BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP015D10 545 bp,

Length=545
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009795884.1|  PREDICTED: microtubule-associated protein 70...    179   8e-50   Nicotiana sylvestris
ref|XP_009613310.1|  PREDICTED: microtubule-associated protein 70...    179   1e-49   Nicotiana tomentosiformis
emb|CDP04519.1|  unnamed protein product                                175   2e-49   Coffea canephora [robusta coffee]
emb|CBI25752.3|  unnamed protein product                                176   1e-48   Vitis vinifera
ref|XP_007026344.1|  Microtubule-associated proteins 70-5 isoform 1     176   3e-48   Theobroma cacao [chocolate]
ref|XP_002267938.1|  PREDICTED: microtubule-associated protein 70-5     176   3e-48   Vitis vinifera
ref|XP_007026345.1|  Microtubule-associated proteins 70-5 isoform 2     171   2e-47   Theobroma cacao [chocolate]
ref|XP_009334569.1|  PREDICTED: microtubule-associated protein 70...    173   3e-47   Pyrus x bretschneideri [bai li]
ref|XP_009333931.1|  PREDICTED: microtubule-associated protein 70...    173   3e-47   Pyrus x bretschneideri [bai li]
ref|XP_006352452.1|  PREDICTED: microtubule-associated protein 70...    172   3e-47   Solanum tuberosum [potatoes]
ref|XP_011095920.1|  PREDICTED: microtubule-associated protein 70...    172   6e-47   Sesamum indicum [beniseed]
ref|XP_011095917.1|  PREDICTED: microtubule-associated protein 70...    171   1e-46   Sesamum indicum [beniseed]
gb|KHG14722.1|  Microtubule-associated 70-5 -like protein               171   1e-46   Gossypium arboreum [tree cotton]
ref|XP_004250289.1|  PREDICTED: microtubule-associated protein 70...    170   2e-46   Solanum lycopersicum
gb|KJB57877.1|  hypothetical protein B456_009G184200                    170   3e-46   Gossypium raimondii
ref|XP_010312762.1|  PREDICTED: microtubule-associated protein 70...    170   3e-46   Solanum lycopersicum
ref|XP_009591783.1|  PREDICTED: microtubule-associated protein 70...    169   6e-46   Nicotiana tomentosiformis
ref|XP_009591784.1|  PREDICTED: microtubule-associated protein 70...    169   6e-46   Nicotiana tomentosiformis
gb|KJB67410.1|  hypothetical protein B456_010G189900                    168   9e-46   Gossypium raimondii
gb|KHG05064.1|  Microtubule-associated protein 70-5                     168   1e-45   Gossypium arboreum [tree cotton]
gb|KJB67409.1|  hypothetical protein B456_010G189900                    167   2e-45   Gossypium raimondii
ref|XP_010057808.1|  PREDICTED: microtubule-associated protein 70...    167   2e-45   Eucalyptus grandis [rose gum]
ref|XP_010057809.1|  PREDICTED: microtubule-associated protein 70...    167   2e-45   Eucalyptus grandis [rose gum]
ref|XP_008367624.1|  PREDICTED: LOW QUALITY PROTEIN: microtubule-...    167   2e-45   
ref|XP_009796359.1|  PREDICTED: microtubule-associated protein 70...    165   1e-44   Nicotiana sylvestris
ref|XP_008370982.1|  PREDICTED: microtubule-associated protein 70-5     164   3e-44   Malus domestica [apple tree]
gb|KDP32904.1|  hypothetical protein JCGZ_13685                         163   6e-44   Jatropha curcas
ref|XP_006467285.1|  PREDICTED: microtubule-associated protein 70...    164   7e-44   Citrus sinensis [Valencia orange]
ref|XP_006449918.1|  hypothetical protein CICLE_v10014697mg             163   8e-44   Citrus clementina
ref|XP_006449917.1|  hypothetical protein CICLE_v10014697mg             163   8e-44   Citrus clementina
ref|XP_006467284.1|  PREDICTED: microtubule-associated protein 70...    163   1e-43   Citrus sinensis [Valencia orange]
gb|EYU27662.1|  hypothetical protein MIMGU_mgv1a021959mg                163   1e-43   Erythranthe guttata [common monkey flower]
ref|XP_011460060.1|  PREDICTED: microtubule-associated protein 70-5     163   1e-43   Fragaria vesca subsp. vesca
ref|XP_006350273.1|  PREDICTED: microtubule-associated protein 70...    156   6e-42   
gb|KGN49039.1|  hypothetical protein Csa_6G511060                       157   1e-41   Cucumis sativus [cucumbers]
ref|XP_002522887.1|  Myosin heavy chain, clone, putative                156   2e-41   
ref|XP_004236657.1|  PREDICTED: microtubule-associated protein 70...    156   2e-41   Solanum lycopersicum
ref|XP_010686630.1|  PREDICTED: microtubule-associated protein 70-5     156   2e-41   Beta vulgaris subsp. vulgaris [Swiss chard]
emb|CAN63131.1|  hypothetical protein VITISV_001458                     155   5e-41   Vitis vinifera
ref|XP_010270219.1|  PREDICTED: microtubule-associated protein 70...    154   9e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010270218.1|  PREDICTED: microtubule-associated protein 70...    154   1e-40   Nelumbo nucifera [Indian lotus]
ref|XP_007212811.1|  hypothetical protein PRUPE_ppa002850mg             154   2e-40   Prunus persica
ref|XP_002307909.1|  hypothetical protein POPTR_0006s01900g             153   2e-40   Populus trichocarpa [western balsam poplar]
ref|XP_002323125.2|  hypothetical protein POPTR_0016s00870g             153   3e-40   Populus trichocarpa [western balsam poplar]
ref|XP_004134988.1|  PREDICTED: microtubule-associated protein 70...    152   4e-40   
ref|XP_011004522.1|  PREDICTED: microtubule-associated protein 70-5     153   4e-40   Populus euphratica
ref|XP_008441104.1|  PREDICTED: microtubule-associated protein 70...    152   4e-40   
ref|XP_008224620.1|  PREDICTED: microtubule-associated protein 70-5     152   6e-40   Prunus mume [ume]
ref|XP_004168631.1|  PREDICTED: microtubule-associated protein 70...    152   6e-40   
ref|XP_009144675.1|  PREDICTED: microtubule-associated protein 70...    149   1e-38   Brassica rapa
gb|KHN40802.1|  Microtubule-associated protein 70-5                     148   1e-38   Glycine soja [wild soybean]
ref|XP_006586778.1|  PREDICTED: microtubule-associated protein 70...    148   2e-38   Glycine max [soybeans]
ref|XP_006597612.1|  PREDICTED: microtubule-associated protein 70-5     148   2e-38   Glycine max [soybeans]
ref|XP_004486342.1|  PREDICTED: microtubule-associated protein 70...    148   2e-38   Cicer arietinum [garbanzo]
ref|XP_010538455.1|  PREDICTED: microtubule-associated protein 70-5     147   3e-38   Tarenaya hassleriana [spider flower]
ref|XP_006584097.1|  PREDICTED: microtubule-associated protein 70...    147   4e-38   Glycine max [soybeans]
ref|XP_006584098.1|  PREDICTED: microtubule-associated protein 70...    147   4e-38   Glycine max [soybeans]
ref|XP_011040173.1|  PREDICTED: microtubule-associated protein 70...    147   5e-38   Populus euphratica
ref|XP_006584096.1|  PREDICTED: microtubule-associated protein 70...    147   5e-38   Glycine max [soybeans]
ref|XP_006856278.1|  hypothetical protein AMTR_s00047p00081310          146   1e-37   Amborella trichopoda
ref|XP_003610594.1|  hypothetical protein MTR_4g133890                  146   1e-37   Medicago truncatula
gb|ACU18231.1|  unknown                                                 143   1e-37   Glycine max [soybeans]
gb|KEH32682.1|  myosin II heavy chain family protein                    145   2e-37   Medicago truncatula
ref|XP_007147624.1|  hypothetical protein PHAVU_006G140300g             145   3e-37   Phaseolus vulgaris [French bean]
ref|NP_193455.2|  microtubule-associated protein 70-5                   144   3e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283554.1|  hypothetical protein CARUB_v10004607mg             144   3e-37   Capsella rubella
gb|KEH36973.1|  myosin II heavy chain family protein                    145   3e-37   Medicago truncatula
ref|XP_006414258.1|  hypothetical protein EUTSA_v10024950mg             144   4e-37   Eutrema salsugineum
ref|XP_004507603.1|  PREDICTED: microtubule-associated protein 70...    144   6e-37   Cicer arietinum [garbanzo]
ref|XP_007154039.1|  hypothetical protein PHAVU_003G086000g             143   1e-36   Phaseolus vulgaris [French bean]
ref|XP_010434704.1|  PREDICTED: microtubule-associated protein 70...    142   2e-36   Camelina sativa [gold-of-pleasure]
emb|CDY35590.1|  BnaC01g21120D                                          142   2e-36   Brassica napus [oilseed rape]
ref|XP_010440039.1|  PREDICTED: microtubule-associated protein 70-5     142   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_006600289.1|  PREDICTED: microtubule-associated protein 70...    141   4e-36   
gb|KHN03540.1|  Microtubule-associated protein 70-5                     142   4e-36   Glycine soja [wild soybean]
gb|KFK32193.1|  hypothetical protein AALP_AA6G209500                    140   1e-35   Arabis alpina [alpine rockcress]
ref|XP_008785643.1|  PREDICTED: microtubule-associated protein 70...    141   1e-35   Phoenix dactylifera
ref|XP_010449651.1|  PREDICTED: microtubule-associated protein 70...    139   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_002868078.1|  atmap70-5                                          139   2e-35   Arabidopsis lyrata subsp. lyrata
ref|XP_010087647.1|  hypothetical protein L484_010598                   139   2e-35   Morus notabilis
emb|CAB10503.1|  myosin II heavy chain like protein                     134   1e-33   Arabidopsis thaliana [mouse-ear cress]
emb|CAB78725.1|  putative protein                                       134   1e-33   Arabidopsis thaliana [mouse-ear cress]
emb|CDX90483.1|  BnaA03g42980D                                          133   3e-33   Brassica napus [oilseed rape]
ref|XP_010939242.1|  PREDICTED: microtubule-associated protein 70...    134   4e-33   Elaeis guineensis
ref|XP_010939241.1|  PREDICTED: microtubule-associated protein 70...    133   8e-33   Elaeis guineensis
ref|XP_009136832.1|  PREDICTED: microtubule-associated protein 70...    132   1e-32   Brassica rapa
emb|CDX81676.1|  BnaC08g39250D                                          131   2e-32   Brassica napus [oilseed rape]
ref|XP_004170227.1|  PREDICTED: microtubule-associated protein 70...    131   3e-32   
ref|XP_004142301.1|  PREDICTED: LOW QUALITY PROTEIN: microtubule-...    131   3e-32   
ref|XP_004170226.1|  PREDICTED: microtubule-associated protein 70...    131   4e-32   
ref|XP_008452405.1|  PREDICTED: microtubule-associated protein 70-1     131   4e-32   Cucumis melo [Oriental melon]
gb|KGN49724.1|  hypothetical protein Csa_5G083860                       130   5e-32   Cucumis sativus [cucumbers]
emb|CDY51769.1|  BnaC05g49520D                                          130   6e-32   Brassica napus [oilseed rape]
ref|XP_010936411.1|  PREDICTED: microtubule-associated protein 70...    130   6e-32   Elaeis guineensis
ref|XP_009390353.1|  PREDICTED: microtubule-associated protein 70...    130   8e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002284904.1|  PREDICTED: microtubule-associated protein 70-2     130   8e-32   Vitis vinifera
ref|XP_002311531.1|  hypothetical protein POPTR_0008s13450g             130   9e-32   Populus trichocarpa [western balsam poplar]
ref|XP_008790325.1|  PREDICTED: microtubule-associated protein 70...    130   9e-32   Phoenix dactylifera
gb|AAO72686.1|  putative myosin heavy chain                             129   9e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011024158.1|  PREDICTED: microtubule-associated protein 70...    130   9e-32   Populus euphratica
ref|XP_003575438.1|  PREDICTED: microtubule-associated protein 70-1     129   1e-31   Brachypodium distachyon [annual false brome]
emb|CDY45293.1|  BnaA06g09630D                                          129   1e-31   Brassica napus [oilseed rape]
ref|XP_009148871.1|  PREDICTED: microtubule-associated protein 70-4     129   1e-31   Brassica rapa
gb|EEC69752.1|  hypothetical protein OsI_39288                          129   1e-31   Oryza sativa Indica Group [Indian rice]
gb|ACO87662.1|  myosin heavy chain                                      129   1e-31   Brachypodium sylvaticum
ref|NP_001067398.1|  Os12g0640900                                       129   1e-31   
emb|CDY42967.1|  BnaA01g17870D                                          128   2e-31   Brassica napus [oilseed rape]
ref|XP_006832841.1|  hypothetical protein AMTR_s00095p00043050          129   2e-31   
tpg|DAA54806.1|  TPA: hypothetical protein ZEAMMB73_048261              127   2e-31   Zea mays [maize]
gb|KJB60886.1|  hypothetical protein B456_009G329800                    128   2e-31   Gossypium raimondii
tpg|DAA54805.1|  TPA: hypothetical protein ZEAMMB73_048261              127   2e-31   Zea mays [maize]
ref|XP_002522178.1|  conserved hypothetical protein                     128   2e-31   
gb|EMT16813.1|  hypothetical protein F775_18335                         128   2e-31   Aegilops tauschii
ref|XP_004963351.1|  PREDICTED: microtubule-associated protein 70...    130   2e-31   
ref|XP_006664255.1|  PREDICTED: microtubule-associated protein 70...    128   3e-31   Oryza brachyantha
ref|XP_008675942.1|  PREDICTED: LOW QUALITY PROTEIN: microtubule-...    127   3e-31   Zea mays [maize]
ref|XP_009109861.1|  PREDICTED: microtubule-associated protein 70...    128   4e-31   Brassica rapa
ref|XP_011027239.1|  PREDICTED: microtubule-associated protein 70...    128   4e-31   Populus euphratica
ref|XP_002307974.2|  hypothetical protein POPTR_0006s03740g             128   4e-31   Populus trichocarpa [western balsam poplar]
gb|KDP38119.1|  hypothetical protein JCGZ_04762                         128   4e-31   Jatropha curcas
gb|KJB60887.1|  hypothetical protein B456_009G329800                    127   4e-31   Gossypium raimondii
ref|XP_009109859.1|  PREDICTED: microtubule-associated protein 70...    128   4e-31   Brassica rapa
ref|XP_010932544.1|  PREDICTED: microtubule-associated protein 70...    128   5e-31   Elaeis guineensis
gb|KJB60884.1|  hypothetical protein B456_009G329800                    128   5e-31   Gossypium raimondii
emb|CDP16283.1|  unnamed protein product                                128   5e-31   Coffea canephora [robusta coffee]
ref|XP_006415832.1|  hypothetical protein EUTSA_v10007068mg             128   5e-31   Eutrema salsugineum
emb|CDY01879.1|  BnaC06g29190D                                          128   5e-31   Brassica napus [oilseed rape]
ref|XP_010932545.1|  PREDICTED: microtubule-associated protein 70...    128   5e-31   Elaeis guineensis
ref|XP_010926101.1|  PREDICTED: microtubule-associated protein 70...    128   5e-31   Elaeis guineensis
ref|XP_010932543.1|  PREDICTED: microtubule-associated protein 70...    128   5e-31   Elaeis guineensis
ref|XP_003532520.1|  PREDICTED: microtubule-associated protein 70...    128   5e-31   Glycine max [soybeans]
emb|CDY09638.1|  BnaC07g34230D                                          127   5e-31   Brassica napus [oilseed rape]
gb|KJB60888.1|  hypothetical protein B456_009G329800                    128   6e-31   Gossypium raimondii
ref|XP_007160432.1|  hypothetical protein PHAVU_002G321500g             128   6e-31   Phaseolus vulgaris [French bean]
ref|XP_002890697.1|  At1g68060/T23K23_9                                 128   7e-31   Arabidopsis lyrata subsp. lyrata
gb|KDO60765.1|  hypothetical protein CISIN_1g007087mg                   127   7e-31   Citrus sinensis [Valencia orange]
gb|KJB50389.1|  hypothetical protein B456_008G168300                    127   7e-31   Gossypium raimondii
ref|XP_010055945.1|  PREDICTED: microtubule-associated protein 70...    127   7e-31   Eucalyptus grandis [rose gum]
gb|KJB50391.1|  hypothetical protein B456_008G168300                    127   7e-31   Gossypium raimondii
ref|XP_010932540.1|  PREDICTED: microtubule-associated protein 70...    127   8e-31   Elaeis guineensis
emb|CDY33736.1|  BnaA09g45420D                                          127   9e-31   Brassica napus [oilseed rape]
gb|KHG19724.1|  Uncharacterized protein F383_26314                      127   9e-31   Gossypium arboreum [tree cotton]
gb|KHN21612.1|  Microtubule-associated protein 70-2                     127   9e-31   Glycine soja [wild soybean]
ref|XP_010695899.1|  PREDICTED: microtubule-associated protein 70...    127   1e-30   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|KJB50390.1|  hypothetical protein B456_008G168300                    127   1e-30   Gossypium raimondii
gb|KHG10997.1|  Microtubule-associated 70-4 -like protein               127   1e-30   Gossypium arboreum [tree cotton]
ref|XP_010916223.1|  PREDICTED: microtubule-associated protein 70...    127   1e-30   Elaeis guineensis
ref|XP_003525226.1|  PREDICTED: microtubule-associated protein 70...    127   1e-30   Glycine max [soybeans]
ref|XP_010916224.1|  PREDICTED: microtubule-associated protein 70...    127   1e-30   Elaeis guineensis
ref|XP_004157994.1|  PREDICTED: microtubule-associated protein 70...    126   1e-30   
ref|XP_006343174.1|  PREDICTED: microtubule-associated protein 70...    127   1e-30   Solanum tuberosum [potatoes]
ref|XP_009149575.1|  PREDICTED: microtubule-associated protein 70...    127   1e-30   Brassica rapa
ref|XP_010916222.1|  PREDICTED: microtubule-associated protein 70...    127   1e-30   Elaeis guineensis
ref|XP_009117870.1|  PREDICTED: microtubule-associated protein 70...    127   1e-30   Brassica rapa
emb|CAJ31079.1|  70 kDa microtubule associated protein Type 2           127   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002525998.1|  Myosin heavy chain, clone, putative                127   1e-30   
ref|XP_008455712.1|  PREDICTED: microtubule-associated protein 70...    127   1e-30   Cucumis melo [Oriental melon]
gb|KJB15337.1|  hypothetical protein B456_002G171800                    125   1e-30   Gossypium raimondii
ref|NP_173873.5|  microtubule-associated protein 70-2                   127   1e-30   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK06943.1|  predicted protein                                      126   1e-30   Hordeum vulgare subsp. vulgare [barley]
ref|XP_004239261.1|  PREDICTED: microtubule-associated protein 70-1     127   1e-30   Solanum lycopersicum
ref|XP_004144334.1|  PREDICTED: microtubule-associated protein 70...    127   1e-30   Cucumis sativus [cucumbers]
ref|XP_006343175.1|  PREDICTED: microtubule-associated protein 70...    127   2e-30   Solanum tuberosum [potatoes]
ref|XP_006391189.1|  hypothetical protein EUTSA_v10018271mg             127   2e-30   Eutrema salsugineum
ref|XP_010499143.1|  PREDICTED: microtubule-associated protein 70...    127   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_006306974.1|  hypothetical protein CARUB_v10008549mg             127   2e-30   Capsella rubella
ref|XP_009105356.1|  PREDICTED: microtubule-associated protein 70-1     127   2e-30   Brassica rapa
ref|XP_006343173.1|  PREDICTED: microtubule-associated protein 70...    127   2e-30   
gb|AAG03117.1|AC004133_11  F5A9.19                                      127   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006469252.1|  PREDICTED: microtubule-associated protein 70...    126   2e-30   Citrus sinensis [Valencia orange]
ref|XP_009768285.1|  PREDICTED: microtubule-associated protein 70...    126   2e-30   Nicotiana sylvestris
ref|XP_009610620.1|  PREDICTED: microtubule-associated protein 70...    126   2e-30   Nicotiana tomentosiformis
gb|AET05426.2|  microtubule-associated protein 70-1                     126   2e-30   Medicago truncatula
gb|KDO60764.1|  hypothetical protein CISIN_1g007087mg                   126   2e-30   Citrus sinensis [Valencia orange]
emb|CDY04200.1|  BnaC06g26150D                                          126   2e-30   Brassica napus [oilseed rape]
ref|XP_003630950.1|  microtubule associated protein Type 2              126   2e-30   
ref|XP_006448158.1|  hypothetical protein CICLE_v10014625mg             126   2e-30   Citrus clementina
ref|XP_008781372.1|  PREDICTED: microtubule-associated protein 70...    126   3e-30   Phoenix dactylifera
emb|CDX84971.1|  BnaC05g20840D                                          126   3e-30   Brassica napus [oilseed rape]
ref|XP_007045277.1|  Microtubule-associated proteins 70-2 isoform 3     125   3e-30   Theobroma cacao [chocolate]
ref|XP_009105067.1|  PREDICTED: microtubule-associated protein 70...    125   3e-30   Brassica rapa
ref|XP_006828475.1|  hypothetical protein AMTR_s00060p00151140          126   3e-30   
emb|CDY07403.1|  BnaA07g24820D                                          125   3e-30   Brassica napus [oilseed rape]
ref|XP_009382991.1|  PREDICTED: microtubule-associated protein 70-1     125   3e-30   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB15336.1|  hypothetical protein B456_002G171800                    125   4e-30   Gossypium raimondii
ref|XP_010271362.1|  PREDICTED: microtubule-associated protein 70...    126   4e-30   Nelumbo nucifera [Indian lotus]
ref|XP_003553384.1|  PREDICTED: microtubule-associated protein 70...    125   4e-30   Glycine max [soybeans]
ref|XP_006355060.1|  PREDICTED: microtubule-associated protein 70...    125   4e-30   Solanum tuberosum [potatoes]
ref|XP_008240691.1|  PREDICTED: microtubule-associated protein 70...    125   4e-30   Prunus mume [ume]
ref|XP_007045279.1|  Microtubule-associated proteins 70-2 isoform 5     124   5e-30   Theobroma cacao [chocolate]
ref|XP_003627322.1|  microtubule associated protein Type 2              125   5e-30   Medicago truncatula
ref|XP_003520494.1|  PREDICTED: microtubule-associated protein 70...    125   5e-30   
gb|EPS64520.1|  hypothetical protein M569_10261                         125   5e-30   Genlisea aurea
ref|XP_008643807.1|  PREDICTED: LOC100285189 isoform X1                 125   5e-30   Zea mays [maize]
ref|XP_006301058.1|  hypothetical protein CARUB_v10021451mg             125   5e-30   Capsella rubella
gb|ACL53445.1|  unknown                                                 125   5e-30   Zea mays [maize]
ref|XP_007045276.1|  Microtubule-associated proteins 70-2 isoform 2     124   6e-30   Theobroma cacao [chocolate]
ref|XP_009599321.1|  PREDICTED: microtubule-associated protein 70...    124   6e-30   Nicotiana tomentosiformis
emb|CDY27573.1|  BnaA09g28340D                                          125   6e-30   Brassica napus [oilseed rape]
ref|XP_009113829.1|  PREDICTED: LOW QUALITY PROTEIN: microtubule-...    125   6e-30   Brassica rapa
ref|XP_007045278.1|  Microtubule-associated proteins 70-1 isoform 4     125   6e-30   Theobroma cacao [chocolate]
gb|KHN15454.1|  Microtubule-associated protein 70-2                     124   7e-30   Glycine soja [wild soybean]
ref|XP_011070564.1|  PREDICTED: microtubule-associated protein 70-2     125   7e-30   Sesamum indicum [beniseed]
ref|NP_001151555.1|  LOC100285189                                       124   7e-30   Zea mays [maize]
ref|XP_007162092.1|  hypothetical protein PHAVU_001G123200g             124   7e-30   Phaseolus vulgaris [French bean]
gb|ABD65109.1|  Myosin II heavy chain-like domain containing protein    124   7e-30   Brassica oleracea
ref|XP_010088195.1|  hypothetical protein L484_005541                   125   7e-30   Morus notabilis
ref|XP_010273713.1|  PREDICTED: microtubule-associated protein 70...    125   7e-30   Nelumbo nucifera [Indian lotus]
gb|KHG17924.1|  Uncharacterized protein F383_01609                      125   8e-30   Gossypium arboreum [tree cotton]
gb|KJB78332.1|  hypothetical protein B456_012G182700                    125   8e-30   Gossypium raimondii
ref|XP_007045275.1|  Microtubule-associated proteins 70-2 isoform 1     125   8e-30   Theobroma cacao [chocolate]
ref|NP_001048050.1|  Os02g0736100                                       124   8e-30   
ref|XP_010460414.1|  PREDICTED: microtubule-associated protein 70-2     125   8e-30   Camelina sativa [gold-of-pleasure]
gb|KFK44516.1|  hypothetical protein AALP_AA1G266900                    125   8e-30   Arabis alpina [alpine rockcress]
ref|XP_008775595.1|  PREDICTED: microtubule-associated protein 70...    125   8e-30   Phoenix dactylifera
ref|XP_002315855.1|  hypothetical protein POPTR_0010s11640g             124   9e-30   Populus trichocarpa [western balsam poplar]
ref|XP_010553646.1|  PREDICTED: microtubule-associated protein 70...    125   9e-30   Tarenaya hassleriana [spider flower]
gb|EEE57764.1|  hypothetical protein OsJ_08300                          124   9e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010319385.1|  PREDICTED: microtubule-associated protein 70-2     124   9e-30   Solanum lycopersicum
ref|XP_006647855.1|  PREDICTED: microtubule-associated protein 70...    124   1e-29   Oryza brachyantha
ref|XP_007028367.1|  Microtubule-associated proteins 70-2 isoform 2     123   1e-29   Theobroma cacao [chocolate]
ref|XP_009380076.1|  PREDICTED: microtubule-associated protein 70...    124   1e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011021765.1|  PREDICTED: microtubule-associated protein 70...    124   1e-29   Populus euphratica
ref|XP_010093577.1|  Microtubule-associated protein 70-2                125   1e-29   Morus notabilis
ref|XP_002887159.1|  atmap70-1                                          124   1e-29   Arabidopsis lyrata subsp. lyrata
ref|XP_007204220.1|  hypothetical protein PRUPE_ppa003030mg             124   1e-29   Prunus persica
ref|NP_176973.1|  microtubule-associated protein 70-1                   124   1e-29   Arabidopsis thaliana [mouse-ear cress]
gb|EYU30134.1|  hypothetical protein MIMGU_mgv1a002946mg                124   1e-29   Erythranthe guttata [common monkey flower]
ref|XP_008341650.1|  PREDICTED: microtubule-associated protein 70...    124   1e-29   Malus domestica [apple tree]
emb|CDY36126.1|  BnaA08g19220D                                          124   1e-29   Brassica napus [oilseed rape]
ref|XP_010551223.1|  PREDICTED: microtubule-associated protein 70-2     124   1e-29   Tarenaya hassleriana [spider flower]
ref|XP_002323245.1|  hypothetical protein POPTR_0016s03570g             124   2e-29   Populus trichocarpa [western balsam poplar]
ref|XP_009776285.1|  PREDICTED: microtubule-associated protein 70...    124   2e-29   Nicotiana sylvestris
gb|AAL11578.1|AF424584_1  At1g14840/F10B6_9                             122   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009101310.1|  PREDICTED: microtubule-associated protein 70...    124   2e-29   Brassica rapa
ref|XP_009411128.1|  PREDICTED: microtubule-associated protein 70-5     123   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS51736.1|  hypothetical protein TRIUR3_31011                       124   2e-29   Triticum urartu
ref|XP_009101312.1|  PREDICTED: microtubule-associated protein 70...    124   2e-29   Brassica rapa
ref|XP_004510505.1|  PREDICTED: microtubule-associated protein 70...    124   2e-29   
ref|XP_006416965.1|  hypothetical protein EUTSA_v10007120mg             124   2e-29   Eutrema salsugineum
ref|XP_007028366.1|  Microtubule-associated proteins 70-2 isoform 1     124   2e-29   Theobroma cacao [chocolate]
ref|XP_003570689.1|  PREDICTED: microtubule-associated protein 70-2     123   2e-29   Brachypodium distachyon [annual false brome]
ref|XP_010477983.1|  PREDICTED: microtubule-associated protein 70-2     124   2e-29   Camelina sativa [gold-of-pleasure]
gb|EMT03977.1|  hypothetical protein F775_09563                         124   2e-29   Aegilops tauschii
ref|XP_010043962.1|  PREDICTED: microtubule-associated protein 70-2     123   3e-29   Eucalyptus grandis [rose gum]
gb|KHN23795.1|  Microtubule-associated protein 70-2                     122   3e-29   Glycine soja [wild soybean]
gb|EMT08820.1|  hypothetical protein F775_15881                         122   3e-29   Aegilops tauschii
gb|KHG20171.1|  Microtubule-associated 70-4 -like protein               123   3e-29   Gossypium arboreum [tree cotton]
ref|XP_007153235.1|  hypothetical protein PHAVU_003G018100g             123   3e-29   Phaseolus vulgaris [French bean]
ref|NP_001170596.1|  hypothetical protein                               123   4e-29   Zea mays [maize]
ref|XP_008221360.1|  PREDICTED: microtubule-associated protein 70...    122   4e-29   
ref|XP_011000423.1|  PREDICTED: microtubule-associated protein 70...    122   4e-29   Populus euphratica
ref|XP_009417688.1|  PREDICTED: microtubule-associated protein 70...    123   4e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007222004.1|  hypothetical protein PRUPE_ppa002899mg             122   5e-29   Prunus persica
ref|XP_006583719.1|  PREDICTED: microtubule-associated protein 70...    122   5e-29   Glycine max [soybeans]
ref|XP_010521011.1|  PREDICTED: microtubule-associated protein 70-2     122   5e-29   Tarenaya hassleriana [spider flower]
ref|XP_008381751.1|  PREDICTED: microtubule-associated protein 70...    122   5e-29   Malus domestica [apple tree]
ref|XP_009348833.1|  PREDICTED: microtubule-associated protein 70...    122   5e-29   Pyrus x bretschneideri [bai li]
ref|XP_010513904.1|  PREDICTED: microtubule-associated protein 70...    122   5e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010227783.1|  PREDICTED: microtubule-associated protein 70-3     122   5e-29   Brachypodium distachyon [annual false brome]
ref|XP_010673027.1|  PREDICTED: microtubule-associated protein 70...    122   5e-29   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010243834.1|  PREDICTED: microtubule-associated protein 70...    122   6e-29   Nelumbo nucifera [Indian lotus]
ref|XP_010513903.1|  PREDICTED: microtubule-associated protein 70...    122   6e-29   Camelina sativa [gold-of-pleasure]
ref|XP_004297434.1|  PREDICTED: microtubule-associated protein 70...    122   6e-29   Fragaria vesca subsp. vesca
ref|XP_009404137.1|  PREDICTED: microtubule-associated protein 70-1     122   6e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010476557.1|  PREDICTED: microtubule-associated protein 70...    122   6e-29   Camelina sativa [gold-of-pleasure]
ref|XP_002892833.1|  atmap70-4                                          122   6e-29   Arabidopsis lyrata subsp. lyrata
ref|NP_563959.1|  microtubule-associated protein 70-4                   122   6e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004498246.1|  PREDICTED: microtubule-associated protein 70...    122   8e-29   Cicer arietinum [garbanzo]
gb|KEH40631.1|  microtubule-associated protein 70-1                     122   8e-29   Medicago truncatula
emb|CDY40783.1|  BnaAnng06460D                                          122   9e-29   Brassica napus [oilseed rape]
ref|XP_004953846.1|  PREDICTED: microtubule-associated protein 70...    121   9e-29   Setaria italica
ref|XP_006303938.1|  hypothetical protein CARUB_v10008632mg             121   1e-28   Capsella rubella
ref|XP_010424947.1|  PREDICTED: microtubule-associated protein 70...    122   1e-28   Camelina sativa [gold-of-pleasure]
gb|EMT03038.1|  hypothetical protein F775_20637                         120   1e-28   Aegilops tauschii
ref|XP_010424948.1|  PREDICTED: microtubule-associated protein 70...    122   1e-28   Camelina sativa [gold-of-pleasure]
emb|CDY03865.1|  BnaC07g10900D                                          122   1e-28   Brassica napus [oilseed rape]
gb|EMS60299.1|  hypothetical protein TRIUR3_07011                       122   1e-28   Triticum urartu
gb|AFK46003.1|  unknown                                                 120   1e-28   Medicago truncatula
ref|XP_008389171.1|  PREDICTED: microtubule-associated protein 70...    122   1e-28   
ref|XP_006574818.1|  PREDICTED: microtubule-associated protein 70...    121   1e-28   
ref|NP_001159233.1|  hypothetical protein                               121   1e-28   
ref|XP_008812973.1|  PREDICTED: microtubule-associated protein 70...    121   1e-28   
ref|XP_006364039.1|  PREDICTED: microtubule-associated protein 70...    121   1e-28   
ref|XP_009777395.1|  PREDICTED: microtubule-associated protein 70...    121   1e-28   
ref|XP_002438163.1|  hypothetical protein SORBIDRAFT_10g009020          121   1e-28   
ref|XP_006655970.1|  PREDICTED: microtubule-associated protein 70...    121   2e-28   
ref|XP_006655969.1|  PREDICTED: microtubule-associated protein 70...    121   2e-28   
ref|XP_010459001.1|  PREDICTED: microtubule-associated protein 70-4     121   2e-28   
ref|XP_001777884.1|  predicted protein                                  120   2e-28   
gb|EEE65458.1|  hypothetical protein OsJ_20834                          121   2e-28   
ref|XP_002271629.1|  PREDICTED: microtubule-associated protein 70-2     120   2e-28   
gb|EYU18624.1|  hypothetical protein MIMGU_mgv1a0077761mg               119   2e-28   
ref|XP_002454321.1|  hypothetical protein SORBIDRAFT_04g028640          120   2e-28   
ref|XP_006395855.1|  hypothetical protein EUTSA_v10003816mg             120   2e-28   
ref|NP_001057297.1|  Os06g0251700                                       120   2e-28   
ref|XP_004503348.1|  PREDICTED: microtubule-associated protein 70...    120   3e-28   
ref|XP_006292757.1|  hypothetical protein CARUB_v10019005mg             120   3e-28   
ref|XP_004503349.1|  PREDICTED: microtubule-associated protein 70...    120   3e-28   
ref|XP_011075430.1|  PREDICTED: microtubule-associated protein 70...    120   3e-28   
ref|XP_010496581.1|  PREDICTED: microtubule-associated protein 70...    120   3e-28   
emb|CDY36256.1|  BnaC07g21100D                                          120   4e-28   
emb|CDY17639.1|  BnaA06g34580D                                          120   4e-28   
ref|XP_010554399.1|  PREDICTED: microtubule-associated protein 70...    119   5e-28   
ref|XP_010554402.1|  PREDICTED: microtubule-associated protein 70...    119   5e-28   
ref|XP_009603020.1|  PREDICTED: microtubule-associated protein 70...    120   5e-28   
ref|XP_004228735.1|  PREDICTED: microtubule-associated protein 70...    120   5e-28   
ref|XP_010554401.1|  PREDICTED: microtubule-associated protein 70...    119   5e-28   
ref|XP_009103049.1|  PREDICTED: microtubule-associated protein 70...    120   5e-28   
ref|XP_010554396.1|  PREDICTED: microtubule-associated protein 70...    119   5e-28   
ref|XP_004965147.1|  PREDICTED: microtubule-associated protein 70...    119   6e-28   
ref|XP_004965146.1|  PREDICTED: microtubule-associated protein 70...    119   6e-28   
ref|NP_178284.1|  microtubule-associated protein 70-3                   119   7e-28   
ref|NP_001189497.1|  microtubule-associated protein 70-3                119   7e-28   
ref|XP_010554397.1|  PREDICTED: microtubule-associated protein 70...    118   8e-28   
ref|XP_010554398.1|  PREDICTED: microtubule-associated protein 70...    118   8e-28   
ref|XP_002875092.1|  atmap70-3                                          119   1e-27   
ref|XP_010554403.1|  PREDICTED: microtubule-associated protein 70...    118   2e-27   
ref|XP_010502169.1|  PREDICTED: microtubule-associated protein 70...    118   3e-27   
ref|XP_010531687.1|  PREDICTED: microtubule-associated protein 70...    117   3e-27   
gb|ABD65132.1|  Myosin II heavy chain-like domain containing protein    116   4e-27   
ref|XP_001771313.1|  predicted protein                                  117   6e-27   
ref|XP_006355767.1|  PREDICTED: microtubule-associated protein 70...    114   4e-26   
ref|XP_001758096.1|  predicted protein                                  114   4e-26   
ref|XP_008775179.1|  PREDICTED: microtubule-associated protein 70...    113   4e-26   
ref|XP_010914823.1|  PREDICTED: microtubule-associated protein 70...    110   1e-24   
ref|XP_009383720.1|  PREDICTED: microtubule-associated protein 70...    108   5e-24   
ref|XP_006448157.1|  hypothetical protein CICLE_v10014625mg             107   1e-23   
ref|XP_010271766.1|  PREDICTED: microtubule-associated protein 70...    105   4e-23   
ref|XP_006649637.1|  PREDICTED: microtubule-associated protein 70...    105   5e-23   
ref|XP_002961395.1|  hypothetical protein SELMODRAFT_77018              105   6e-23   
ref|XP_010271765.1|  PREDICTED: microtubule-associated protein 70...    105   7e-23   
ref|XP_002980874.1|  hypothetical protein SELMODRAFT_113465             105   7e-23   
ref|NP_001151609.1|  ATMAP70-2                                          104   1e-22   
tpg|DAA44092.1|  TPA: ATMAP70-2                                         104   1e-22   
ref|XP_009131080.1|  PREDICTED: microtubule-associated protein 70...  96.3    3e-22   
ref|NP_001049378.1|  Os03g0215700                                       102   6e-22   
gb|EEC74762.1|  hypothetical protein OsI_10528                          102   6e-22   
gb|KFK43754.1|  hypothetical protein AALP_AA1G168500                    102   8e-22   
ref|XP_006840410.1|  hypothetical protein AMTR_s00045p00152960        99.4    9e-21   
gb|EMS61205.1|  hypothetical protein TRIUR3_10457                     99.0    1e-20   
ref|XP_003558494.1|  PREDICTED: microtubule-associated protein 70...  96.7    6e-20   
gb|EMT11914.1|  hypothetical protein F775_14888                       97.1    6e-20   
ref|XP_004985186.1|  PREDICTED: microtubule-associated protein 70...  95.9    1e-19   
gb|KHN08880.1|  Microtubule-associated protein 70-1                   95.5    2e-19   
emb|CDP09571.1|  unnamed protein product                              93.6    2e-19   
dbj|BAK04836.1|  predicted protein                                    94.7    3e-19   
gb|KGN54710.1|  hypothetical protein Csa_4G431900                     91.7    7e-19   
gb|KHN30360.1|  Microtubule-associated protein 70-2                   91.7    5e-18   
gb|KHM98977.1|  Microtubule-associated protein 70-2                   90.5    6e-18   
ref|XP_002468275.1|  hypothetical protein SORBIDRAFT_01g042820        89.0    3e-17   
ref|NP_001184996.1|  microtubule-associated protein 70-4              82.0    1e-14   
emb|CAN80140.1|  hypothetical protein VITISV_038977                   72.4    2e-11   
gb|EPS68244.1|  hypothetical protein M569_06527                       70.9    2e-11   
ref|XP_002890335.1|  hypothetical protein ARALYDRAFT_472169           69.3    2e-10   
ref|XP_010265412.1|  PREDICTED: uncharacterized protein LOC104603...  65.1    2e-09   
ref|XP_010265411.1|  PREDICTED: uncharacterized protein LOC104603...  65.1    2e-09   
ref|XP_010265410.1|  PREDICTED: uncharacterized protein LOC104603...  65.1    2e-09   



>ref|XP_009795884.1| PREDICTED: microtubule-associated protein 70-5-like [Nicotiana 
sylvestris]
Length=529

 Score =   179 bits (454),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 138/159 (87%), Gaps = 4/159 (3%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGAAAN +RDY+RQISE+QEE+RTLERELARVKVSANRVAT+VANEWKDENDKVMP
Sbjct  227  AILAGGAAANRLRDYKRQISELQEEKRTLERELARVKVSANRVATVVANEWKDENDKVMP  286

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR+LQAEMQRLKDKL ISERTAKAEAQLKDKLKLRLKTLE+GLKQ  N +VNP
Sbjct  287  VKQWLEERRLLQAEMQRLKDKLTISERTAKAEAQLKDKLKLRLKTLEEGLKQAFNVSVNP  346

Query  372  KVLSGFSKPEKANHLFGILSS----KKRSASQPRASMVN  476
                G +K +K  H FG+LS+    KKRS SQPR S ++
Sbjct  347  NRNHGSTKIQKTKHFFGVLSNNTGVKKRSTSQPRVSTIS  385



>ref|XP_009613310.1| PREDICTED: microtubule-associated protein 70-5-like [Nicotiana 
tomentosiformis]
Length=529

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 137/159 (86%), Gaps = 4/159 (3%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGAAAN +RDY+RQISE QEE+RTLERELARVKVSANRVAT+VANEWKDENDKVMP
Sbjct  227  AILAGGAAANRLRDYKRQISEFQEEKRTLERELARVKVSANRVATVVANEWKDENDKVMP  286

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR+LQAEMQRLKDKL IS+RTAKAEAQLKDKLKLRLKTLE+GLKQ  N +VNP
Sbjct  287  VKQWLEERRLLQAEMQRLKDKLTISKRTAKAEAQLKDKLKLRLKTLEEGLKQALNVSVNP  346

Query  372  KVLSGFSKPEKANHLFGILSS----KKRSASQPRASMVN  476
                G +K +K  H FG+LSS    KKRS SQPR S ++
Sbjct  347  NRNHGSTKIQKTKHFFGVLSSNTGIKKRSTSQPRVSTIS  385



>emb|CDP04519.1| unnamed protein product [Coffea canephora]
Length=378

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 136/158 (86%), Gaps = 4/158 (3%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILA G AANTIRDYRRQISE+QEE+RTLERELAR+KVSANRVA++VANEWKDENDKVMP
Sbjct  32   AILAAGEAANTIRDYRRQISELQEEKRTLERELARIKVSANRVASVVANEWKDENDKVMP  91

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR+LQAEMQRL+DKLAISE+TAKAEAQLKDKLKLRLKTLE GLK   +  ++P
Sbjct  92   VKQWLEERRLLQAEMQRLRDKLAISEKTAKAEAQLKDKLKLRLKTLEDGLKYASSIPIDP  151

Query  372  KVLSGFSKPEKANHLFGILSS----KKRSASQPRASMV  473
               SG  K EK N+ FGILSS    KKRS SQPRA+ V
Sbjct  152  NTYSGSLKSEKTNNFFGILSSNAGLKKRSKSQPRATTV  189



>emb|CBI25752.3| unnamed protein product [Vitis vinifera]
Length=535

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 135/161 (84%), Gaps = 4/161 (2%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGG AAN IRDYRRQISE+ EE+RTLERELARVKVSANRVAT+VANEWKDENDKVMP
Sbjct  230  AILAGGVAANAIRDYRRQISELNEEKRTLERELARVKVSANRVATVVANEWKDENDKVMP  289

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            +KQWLEERR+LQAE QRL+DKLAISERTAKAEAQLKDKLKLRLKTLE+GLKQ  + + NP
Sbjct  290  IKQWLEERRLLQAETQRLRDKLAISERTAKAEAQLKDKLKLRLKTLEEGLKQVSSFSENP  349

Query  372  KVLSGFSKPEKANHLFGILSS----KKRSASQPRASMVNTT  482
             +     KPEK+NH+ G LS     K+RS SQPR S +  T
Sbjct  350  YLSCRSPKPEKSNHILGFLSGNGGLKRRSTSQPRGSCIGKT  390



>ref|XP_007026344.1| Microtubule-associated proteins 70-5 isoform 1 [Theobroma cacao]
 gb|EOY28966.1| Microtubule-associated proteins 70-5 isoform 1 [Theobroma cacao]
Length=580

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 136/161 (84%), Gaps = 4/161 (2%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGAAAN+IRDY+R+ISE+ EE+RTL+RELARVKVSANRVAT+VANEWKDENDKVMP
Sbjct  229  AILAGGAAANSIRDYQRRISELHEEKRTLDRELARVKVSANRVATVVANEWKDENDKVMP  288

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLE+RR+LQAEMQRLKDKLA+SERTAKAEAQLK+K KLRLK LE GLK   + + NP
Sbjct  289  VKQWLEDRRLLQAEMQRLKDKLAVSERTAKAEAQLKEKFKLRLKILEDGLKHVSSFSGNP  348

Query  372  KVLSGFSKPEKANHLFGILSS----KKRSASQPRASMVNTT  482
                G  KPEK++++ G L+S    +KRS SQPR S ++ T
Sbjct  349  NASCGSPKPEKSSNILGFLTSSGGLRKRSTSQPRGSTISRT  389



>ref|XP_002267938.1| PREDICTED: microtubule-associated protein 70-5 [Vitis vinifera]
Length=584

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 135/161 (84%), Gaps = 4/161 (2%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGG AAN IRDYRRQISE+ EE+RTLERELARVKVSANRVAT+VANEWKDENDKVMP
Sbjct  230  AILAGGVAANAIRDYRRQISELNEEKRTLERELARVKVSANRVATVVANEWKDENDKVMP  289

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            +KQWLEERR+LQAE QRL+DKLAISERTAKAEAQLKDKLKLRLKTLE+GLKQ  + + NP
Sbjct  290  IKQWLEERRLLQAETQRLRDKLAISERTAKAEAQLKDKLKLRLKTLEEGLKQVSSFSENP  349

Query  372  KVLSGFSKPEKANHLFGILSS----KKRSASQPRASMVNTT  482
             +     KPEK+NH+ G LS     K+RS SQPR S +  T
Sbjct  350  YLSCRSPKPEKSNHILGFLSGNGGLKRRSTSQPRGSCIGKT  390



>ref|XP_007026345.1| Microtubule-associated proteins 70-5 isoform 2, partial [Theobroma 
cacao]
 gb|EOY28967.1| Microtubule-associated proteins 70-5 isoform 2, partial [Theobroma 
cacao]
Length=439

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 136/162 (84%), Gaps = 5/162 (3%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGAAAN+IRDY+R+ISE+ EE+RTL+RELARVKVSANRVAT+VANEWKDENDKVMP
Sbjct  87   AILAGGAAANSIRDYQRRISELHEEKRTLDRELARVKVSANRVATVVANEWKDENDKVMP  146

Query  192  VKQWLEERRIL-QAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVN  368
            VKQWLE+RR+L QAEMQRLKDKLA+SERTAKAEAQLK+K KLRLK LE GLK   + + N
Sbjct  147  VKQWLEDRRLLQQAEMQRLKDKLAVSERTAKAEAQLKEKFKLRLKILEDGLKHVSSFSGN  206

Query  369  PKVLSGFSKPEKANHLFGILSS----KKRSASQPRASMVNTT  482
            P    G  KPEK++++ G L+S    +KRS SQPR S ++ T
Sbjct  207  PNASCGSPKPEKSSNILGFLTSSGGLRKRSTSQPRGSTISRT  248



>ref|XP_009334569.1| PREDICTED: microtubule-associated protein 70-5 isoform X2 [Pyrus 
x bretschneideri]
Length=580

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 133/159 (84%), Gaps = 4/159 (3%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN IRDY+RQ  E+ EE+RTLERELAR+KVSANRVAT++ANEWKD+NDKVMP
Sbjct  231  AVLAGGAAANAIRDYQRQAEELHEEKRTLERELARIKVSANRVATVIANEWKDDNDKVMP  290

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR++Q EMQRL+DKLAIS+RTAKAEAQLK+K+KLRLKTLE+GLK   + + NP
Sbjct  291  VKQWLEERRLMQGEMQRLRDKLAISDRTAKAEAQLKEKMKLRLKTLEEGLKHVSSFSCNP  350

Query  372  KVLSGFSKPEKANHLFGILSSK----KRSASQPRASMVN  476
             +  G  KPEK+++  G L+S     KRS SQPR S V+
Sbjct  351  NLFCGSPKPEKSSNFLGFLTSNGGSAKRSTSQPRGSTVS  389



>ref|XP_009333931.1| PREDICTED: microtubule-associated protein 70-5 isoform X1 [Pyrus 
x bretschneideri]
Length=585

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 133/159 (84%), Gaps = 4/159 (3%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN IRDY+RQ  E+ EE+RTLERELAR+KVSANRVAT++ANEWKD+NDKVMP
Sbjct  231  AVLAGGAAANAIRDYQRQAEELHEEKRTLERELARIKVSANRVATVIANEWKDDNDKVMP  290

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR++Q EMQRL+DKLAIS+RTAKAEAQLK+K+KLRLKTLE+GLK   + + NP
Sbjct  291  VKQWLEERRLMQGEMQRLRDKLAISDRTAKAEAQLKEKMKLRLKTLEEGLKHVSSFSCNP  350

Query  372  KVLSGFSKPEKANHLFGILSSK----KRSASQPRASMVN  476
             +  G  KPEK+++  G L+S     KRS SQPR S V+
Sbjct  351  NLFCGSPKPEKSSNFLGFLTSNGGSAKRSTSQPRGSTVS  389



>ref|XP_006352452.1| PREDICTED: microtubule-associated protein 70-5-like [Solanum 
tuberosum]
Length=558

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 139/159 (87%), Gaps = 7/159 (4%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGAAAN IRD +RQISE+QEE+RTLERELAR+K+SANRVAT+VANEWKDENDKVMP
Sbjct  228  AILAGGAAANKIRDCQRQISELQEEKRTLERELARLKISANRVATVVANEWKDENDKVMP  287

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEER++LQAEMQRL++KL ISERTAKAEAQ+KDKLKLRL+TLE+GLKQ  + +V P
Sbjct  288  VKQWLEERKLLQAEMQRLRNKLVISERTAKAEAQIKDKLKLRLRTLEEGLKQVTSVSVIP  347

Query  372  KVLSGFSKPEKANHLFGILSS----KKRSASQPRASMVN  476
               +G  KP+K NHLF +LSS    K+RS SQPRAS +N
Sbjct  348  ---NGSPKPQKTNHLFSLLSSNAGLKRRSTSQPRASTIN  383



>ref|XP_011095920.1| PREDICTED: microtubule-associated protein 70-5 isoform X2 [Sesamum 
indicum]
Length=565

 Score =   172 bits (435),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 136/158 (86%), Gaps = 7/158 (4%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGAAANTIRDYRRQISE+ EE+RTLERELARVKVSANR+AT+VANEWKDE DKVMP
Sbjct  228  AILAGGAAANTIRDYRRQISELNEEKRTLERELARVKVSANRIATVVANEWKDEKDKVMP  287

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR+LQAEMQ+LKDKLAISER AKAEAQ+K+KLKLRLKTLE+GLK   + +VN 
Sbjct  288  VKQWLEERRMLQAEMQKLKDKLAISERAAKAEAQVKEKLKLRLKTLEEGLKHVHSLSVNT  347

Query  372  KVLSGFSKPEKANHLFGILSS----KKRSASQPRASMV  473
               +G  K EK+N+ FGILSS    KKRS SQPR S +
Sbjct  348  ---NGSPKNEKSNNFFGILSSNTRMKKRSTSQPRPSTI  382



>ref|XP_011095917.1| PREDICTED: microtubule-associated protein 70-5 isoform X1 [Sesamum 
indicum]
 ref|XP_011095919.1| PREDICTED: microtubule-associated protein 70-5 isoform X1 [Sesamum 
indicum]
Length=585

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 136/158 (86%), Gaps = 7/158 (4%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGAAANTIRDYRRQISE+ EE+RTLERELARVKVSANR+AT+VANEWKDE DKVMP
Sbjct  228  AILAGGAAANTIRDYRRQISELNEEKRTLERELARVKVSANRIATVVANEWKDEKDKVMP  287

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR+LQAEMQ+LKDKLAISER AKAEAQ+K+KLKLRLKTLE+GLK   + +VN 
Sbjct  288  VKQWLEERRMLQAEMQKLKDKLAISERAAKAEAQVKEKLKLRLKTLEEGLKHVHSLSVNT  347

Query  372  KVLSGFSKPEKANHLFGILSS----KKRSASQPRASMV  473
               +G  K EK+N+ FGILSS    KKRS SQPR S +
Sbjct  348  ---NGSPKNEKSNNFFGILSSNTRMKKRSTSQPRPSTI  382



>gb|KHG14722.1| Microtubule-associated 70-5 -like protein [Gossypium arboreum]
Length=561

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 136/161 (84%), Gaps = 6/161 (4%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGAAAN+IRDY+RQIS++ EE+RTLERELARVKVSANRVAT+VANEWKDENDKVMP
Sbjct  239  AILAGGAAANSIRDYQRQISQLNEEKRTLERELARVKVSANRVATVVANEWKDENDKVMP  298

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLE+RR+LQAEMQRLKDKLA+SERTAKAEAQLK+K KLRLK LE GLK     +VN 
Sbjct  299  VKQWLEDRRLLQAEMQRLKDKLAVSERTAKAEAQLKEKFKLRLKILEDGLKHVSTLSVNA  358

Query  372  KVLSGFSKPEKANHLFGILSS----KKRSASQPRASMVNTT  482
                G  KP+K++++ G+L+     +KRS SQPRAS ++ T
Sbjct  359  SY--GSPKPDKSSNILGLLTGSSGPRKRSTSQPRASTISAT  397



>ref|XP_004250289.1| PREDICTED: microtubule-associated protein 70-5-like isoform X2 
[Solanum lycopersicum]
Length=560

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 137/158 (87%), Gaps = 7/158 (4%)
 Frame = +3

Query  15   ILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMPV  194
            ILAGGAAAN IRD +RQISE+QEE+RTLERELAR+K+SANRVAT+VANEWKDENDKVMPV
Sbjct  230  ILAGGAAANKIRDCQRQISELQEEKRTLERELARLKISANRVATVVANEWKDENDKVMPV  289

Query  195  KQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNPK  374
            KQWLEER++LQAEMQRL++KL  SERTAKAEAQ+KDKLKLRL+TLE+GLKQ+ +  V P 
Sbjct  290  KQWLEERKLLQAEMQRLRNKLVKSERTAKAEAQIKDKLKLRLRTLEEGLKQSTSVFVTP-  348

Query  375  VLSGFSKPEKANHLFGILSS----KKRSASQPRASMVN  476
              +G  KP+K NHLF ILSS    KKRS SQPRAS +N
Sbjct  349  --NGSPKPQKTNHLFSILSSNAGLKKRSTSQPRASTIN  384



>gb|KJB57877.1| hypothetical protein B456_009G184200 [Gossypium raimondii]
Length=567

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 136/161 (84%), Gaps = 4/161 (2%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AIL GGAAAN+IRD RRQIS+++EE+RTLERELARVKV ANRVAT+VANEWKDENDKVMP
Sbjct  234  AILVGGAAANSIRDCRRQISQLREEKRTLERELARVKVLANRVATVVANEWKDENDKVMP  293

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLE+RR+LQAEMQRLKDKL++SERTAKAEAQLKDK KLRLK LE GL    + ++NP
Sbjct  294  VKQWLEDRRLLQAEMQRLKDKLSVSERTAKAEAQLKDKFKLRLKILEDGLNHVSSISINP  353

Query  372  KVLSGFSKPEKANHLFGILSS----KKRSASQPRASMVNTT  482
                G  KPEK++++ G L+S    KKRS SQPRAS ++T+
Sbjct  354  NASYGSPKPEKSSNILGFLTSTSGLKKRSTSQPRASTISTS  394



>ref|XP_010312762.1| PREDICTED: microtubule-associated protein 70-5-like isoform X1 
[Solanum lycopersicum]
Length=570

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 137/159 (86%), Gaps = 7/159 (4%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
             ILAGGAAAN IRD +RQISE+QEE+RTLERELAR+K+SANRVAT+VANEWKDENDKVMP
Sbjct  229  TILAGGAAANKIRDCQRQISELQEEKRTLERELARLKISANRVATVVANEWKDENDKVMP  288

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEER++LQAEMQRL++KL  SERTAKAEAQ+KDKLKLRL+TLE+GLKQ+ +  V P
Sbjct  289  VKQWLEERKLLQAEMQRLRNKLVKSERTAKAEAQIKDKLKLRLRTLEEGLKQSTSVFVTP  348

Query  372  KVLSGFSKPEKANHLFGILSS----KKRSASQPRASMVN  476
               +G  KP+K NHLF ILSS    KKRS SQPRAS +N
Sbjct  349  ---NGSPKPQKTNHLFSILSSNAGLKKRSTSQPRASTIN  384



>ref|XP_009591783.1| PREDICTED: microtubule-associated protein 70-5-like isoform X1 
[Nicotiana tomentosiformis]
Length=567

 Score =   169 bits (428),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 136/161 (84%), Gaps = 7/161 (4%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGAAAN IRD +RQISE+QEE+RTLERELAR+K+SANRVA++VANEWKDENDKVMP
Sbjct  225  AILAGGAAANKIRDCQRQISELQEEKRTLERELARLKISANRVASVVANEWKDENDKVMP  284

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR+LQAEMQRL+DKL ISERTAKAEAQ+KDKLKLRLKTLE GLK T + +  P
Sbjct  285  VKQWLEERRLLQAEMQRLRDKLTISERTAKAEAQIKDKLKLRLKTLEDGLKPTASVSAIP  344

Query  372  KVLSGFSKPEKANHLFGILSS----KKRSASQPRASMVNTT  482
               +G  K  K +HLF ILSS    KKRS SQPRAS +N T
Sbjct  345  ---NGSLKTRKTDHLFSILSSNAGLKKRSTSQPRASTINKT  382



>ref|XP_009591784.1| PREDICTED: microtubule-associated protein 70-5-like isoform X2 
[Nicotiana tomentosiformis]
Length=561

 Score =   169 bits (428),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 136/161 (84%), Gaps = 7/161 (4%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGAAAN IRD +RQISE+QEE+RTLERELAR+K+SANRVA++VANEWKDENDKVMP
Sbjct  225  AILAGGAAANKIRDCQRQISELQEEKRTLERELARLKISANRVASVVANEWKDENDKVMP  284

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR+LQAEMQRL+DKL ISERTAKAEAQ+KDKLKLRLKTLE GLK T + +  P
Sbjct  285  VKQWLEERRLLQAEMQRLRDKLTISERTAKAEAQIKDKLKLRLKTLEDGLKPTASVSAIP  344

Query  372  KVLSGFSKPEKANHLFGILSS----KKRSASQPRASMVNTT  482
               +G  K  K +HLF ILSS    KKRS SQPRAS +N T
Sbjct  345  ---NGSLKTRKTDHLFSILSSNAGLKKRSTSQPRASTINKT  382



>gb|KJB67410.1| hypothetical protein B456_010G189900 [Gossypium raimondii]
Length=524

 Score =   168 bits (425),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 139/161 (86%), Gaps = 6/161 (4%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGAAAN++RDY+RQIS++ EE+RTLERELARVKVSANRVAT+VANEWKDENDKVMP
Sbjct  202  AILAGGAAANSVRDYQRQISQLNEEKRTLERELARVKVSANRVATVVANEWKDENDKVMP  261

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLE+RR+LQAE+QRLKDKLA+SERTAKAEAQLK+KLKLRLK LE GLKQ  + +VN 
Sbjct  262  VKQWLEDRRLLQAEVQRLKDKLAVSERTAKAEAQLKEKLKLRLKILEDGLKQASSLSVNA  321

Query  372  KVLSGFSKPEKANHLFGILSS----KKRSASQPRASMVNTT  482
                G  KP+K++++ G+L+     +KRS SQPRAS ++ T
Sbjct  322  SY--GSPKPDKSSNILGLLTGSSGPRKRSTSQPRASTISAT  360



>gb|KHG05064.1| Microtubule-associated protein 70-5 [Gossypium arboreum]
Length=595

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 136/161 (84%), Gaps = 4/161 (2%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AIL GGAAAN+IRD RRQIS+++EE+RTLERELARVKV ANRVAT+VANEWKDENDKVMP
Sbjct  240  AILVGGAAANSIRDCRRQISQLREEKRTLERELARVKVLANRVATVVANEWKDENDKVMP  299

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLE+RR+LQAEMQRLKDKL++S RTAKAEAQLKDK KLRLK LE GLK   + ++NP
Sbjct  300  VKQWLEDRRLLQAEMQRLKDKLSMSVRTAKAEAQLKDKFKLRLKILEDGLKHISSISINP  359

Query  372  KVLSGFSKPEKANHLFGILSS----KKRSASQPRASMVNTT  482
                G  KPEK++++ G L+S    KKRS SQPRAS ++T+
Sbjct  360  NASYGSPKPEKSSNILGFLTSTGGLKKRSTSQPRASTISTS  400



>gb|KJB67409.1| hypothetical protein B456_010G189900 [Gossypium raimondii]
Length=552

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 139/161 (86%), Gaps = 6/161 (4%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGAAAN++RDY+RQIS++ EE+RTLERELARVKVSANRVAT+VANEWKDENDKVMP
Sbjct  230  AILAGGAAANSVRDYQRQISQLNEEKRTLERELARVKVSANRVATVVANEWKDENDKVMP  289

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLE+RR+LQAE+QRLKDKLA+SERTAKAEAQLK+KLKLRLK LE GLKQ  + +VN 
Sbjct  290  VKQWLEDRRLLQAEVQRLKDKLAVSERTAKAEAQLKEKLKLRLKILEDGLKQASSLSVNA  349

Query  372  KVLSGFSKPEKANHLFGILSS----KKRSASQPRASMVNTT  482
                G  KP+K++++ G+L+     +KRS SQPRAS ++ T
Sbjct  350  SY--GSPKPDKSSNILGLLTGSSGPRKRSTSQPRASTISAT  388



>ref|XP_010057808.1| PREDICTED: microtubule-associated protein 70-5 isoform X1 [Eucalyptus 
grandis]
 gb|KCW75131.1| hypothetical protein EUGRSUZ_E03882 [Eucalyptus grandis]
Length=578

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 136/156 (87%), Gaps = 4/156 (3%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGAAAN+IRDY+RQISEI+EE+RTLERELAR KVSANRVAT+VANEWKD+ND+VMP
Sbjct  227  AILAGGAAANSIRDYQRQISEIKEEKRTLERELARAKVSANRVATVVANEWKDDNDRVMP  286

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            +KQWLEERRILQAEMQRL+DKLA+SER AKAEAQ+K+K KLRLKTLE+GL++  N +VN 
Sbjct  287  IKQWLEERRILQAEMQRLRDKLAVSERAAKAEAQMKEKFKLRLKTLEEGLRRGTNVSVNG  346

Query  372  KVLSGFSKPEKANHLFGILSS----KKRSASQPRAS  467
             +L    K EK++ +F  L+S    KKRS+SQPRA+
Sbjct  347  NLLCASPKTEKSSKIFSFLTSNGGLKKRSSSQPRAT  382



>ref|XP_010057809.1| PREDICTED: microtubule-associated protein 70-5 isoform X2 [Eucalyptus 
grandis]
 gb|KCW75132.1| hypothetical protein EUGRSUZ_E03882 [Eucalyptus grandis]
Length=574

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 136/156 (87%), Gaps = 4/156 (3%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGAAAN+IRDY+RQISEI+EE+RTLERELAR KVSANRVAT+VANEWKD+ND+VMP
Sbjct  227  AILAGGAAANSIRDYQRQISEIKEEKRTLERELARAKVSANRVATVVANEWKDDNDRVMP  286

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            +KQWLEERRILQAEMQRL+DKLA+SER AKAEAQ+K+K KLRLKTLE+GL++  N +VN 
Sbjct  287  IKQWLEERRILQAEMQRLRDKLAVSERAAKAEAQMKEKFKLRLKTLEEGLRRGTNVSVNG  346

Query  372  KVLSGFSKPEKANHLFGILSS----KKRSASQPRAS  467
             +L    K EK++ +F  L+S    KKRS+SQPRA+
Sbjct  347  NLLCASPKTEKSSKIFSFLTSNGGLKKRSSSQPRAT  382



>ref|XP_008367624.1| PREDICTED: LOW QUALITY PROTEIN: microtubule-associated protein 
70-5-like [Malus domestica]
Length=549

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 130/159 (82%), Gaps = 4/159 (3%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAA N IRDY RQ+ E+ EE+RTLERELAR KVSANRVAT++ANEWKD+NDKVMP
Sbjct  204  AVLAGGAAXNAIRDYZRQMEELHEEKRTLERELARXKVSANRVATVIANEWKDDNDKVMP  263

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR++QAEMQRL+DKLAIS+RTAK EAQLK+K+KLRLK LE+GLK   + + NP
Sbjct  264  VKQWLEERRLMQAEMQRLRDKLAISDRTAKTEAQLKEKMKLRLKMLEEGLKHVSSFSCNP  323

Query  372  KVLSGFSKPEKANHLFGILSSK----KRSASQPRASMVN  476
             +  G  KPEK++   G L+S     KRS SQPR S+++
Sbjct  324  NLFCGSPKPEKSSIFLGFLTSNGGSAKRSTSQPRGSIIS  362



>ref|XP_009796359.1| PREDICTED: microtubule-associated protein 70-5-like [Nicotiana 
sylvestris]
Length=547

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 137/161 (85%), Gaps = 7/161 (4%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGAAAN IRD +RQISE+QEE+RTLERELAR+K+SAN+VA++VANEWKDEN KVMP
Sbjct  225  AILAGGAAANKIRDCQRQISELQEEKRTLERELARLKISANKVASVVANEWKDENHKVMP  284

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEER++LQAEMQRL+DKL ISERTAKAEAQ+KDKLKLRLKTLE+ LK T + +V  
Sbjct  285  VKQWLEERKLLQAEMQRLRDKLTISERTAKAEAQIKDKLKLRLKTLEESLKPTASVSV--  342

Query  372  KVLSGFSKPEKANHLFGILSS----KKRSASQPRASMVNTT  482
             V +G  K +K NHLF ILSS    KKRS SQPRAS +N T
Sbjct  343  -VTNGSPKTQKTNHLFSILSSNAGLKKRSTSQPRASTINKT  382



>ref|XP_008370982.1| PREDICTED: microtubule-associated protein 70-5 [Malus domestica]
Length=588

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 128/159 (81%), Gaps = 4/159 (3%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAA N IRDY RQ+ E+ EE+RTLERELAR KVSANRVAT++ANEWKD+NDKVMP
Sbjct  234  AVLAGGAAXNAIRDYZRQMEELHEEKRTLERELARXKVSANRVATVIANEWKDDNDKVMP  293

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR++QAEMQRL+DKLAIS+RTAK EAQLK+K+KLRLK LE+GLK   + +  P
Sbjct  294  VKQWLEERRLMQAEMQRLRDKLAISDRTAKXEAQLKEKMKLRLKXLEEGLKHVSSFSCTP  353

Query  372  KVLSGFSKPEKANHLFGILSSK----KRSASQPRASMVN  476
             +  G  KPEK+++  G L+S      RS SQPR S V+
Sbjct  354  NLFCGSPKPEKSSNFLGFLTSNGGSAXRSTSQPRGSTVS  392



>gb|KDP32904.1| hypothetical protein JCGZ_13685 [Jatropha curcas]
Length=539

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 136/161 (84%), Gaps = 4/161 (2%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGAAANTIRDY+RQISE+ EE+R LERELAR KV+ANRVAT+VANEWKDE+DKVMP
Sbjct  204  AILAGGAAANTIRDYKRQISELNEEKRMLERELARAKVNANRVATVVANEWKDESDKVMP  263

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            V+Q+LEERR+ QAEMQRL+DK+A+ ERTAKAEAQLKDK KLRLKTLE+GLK   + +VN 
Sbjct  264  VQQYLEERRLFQAEMQRLRDKIAVLERTAKAEAQLKDKFKLRLKTLEEGLKHVSSFSVNS  323

Query  372  KVLSGFSKPEKANHLFGILSS----KKRSASQPRASMVNTT  482
              + G  KP K++++ G L+S    +KRS+SQPRAS ++ T
Sbjct  324  DAIPGSPKPAKSSNILGFLTSTGGLRKRSSSQPRASSISRT  364



>ref|XP_006467285.1| PREDICTED: microtubule-associated protein 70-5-like isoform X2 
[Citrus sinensis]
 gb|KDO78529.1| hypothetical protein CISIN_1g007760mg [Citrus sinensis]
Length=589

 Score =   164 bits (414),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 136/160 (85%), Gaps = 5/160 (3%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGG+AAN IRDY+RQI+E+ EE+RTLERELARVKVSANRVAT+VANEWKDENDKVMP
Sbjct  230  AVLAGGSAANAIRDYQRQITELNEEKRTLERELARVKVSANRVATVVANEWKDENDKVMP  289

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            V+QWLEERR+LQAEMQRLKDKLAISERTAKAEAQLK+KLKLRLKTLE+GLK   + + +P
Sbjct  290  VRQWLEERRLLQAEMQRLKDKLAISERTAKAEAQLKEKLKLRLKTLEEGLKHVSSFSGSP  349

Query  372  KVLSGFSKPEK-ANHLFGILSS----KKRSASQPRASMVN  476
                G  K EK +N + G L++    +KRS SQPRAS ++
Sbjct  350  NTFCGSPKTEKSSNIILGFLTANGGLRKRSTSQPRASTIS  389



>ref|XP_006449918.1| hypothetical protein CICLE_v10014697mg [Citrus clementina]
 gb|ESR63158.1| hypothetical protein CICLE_v10014697mg [Citrus clementina]
Length=589

 Score =   163 bits (413),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 136/160 (85%), Gaps = 5/160 (3%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGG+AAN IRDY+RQI+E+ EE+RTLERELARVKVSANRVAT+VANEWKDENDKVMP
Sbjct  230  AVLAGGSAANAIRDYQRQITELNEEKRTLERELARVKVSANRVATVVANEWKDENDKVMP  289

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            V+QWLEERR+LQAEMQRLKDKLAISERTAKAEAQLK+KLKLRLKTLE+GLK   + + +P
Sbjct  290  VRQWLEERRLLQAEMQRLKDKLAISERTAKAEAQLKEKLKLRLKTLEEGLKHVSSFSGSP  349

Query  372  KVLSGFSKPEK-ANHLFGILSS----KKRSASQPRASMVN  476
                G  K EK +N + G L++    +KRS SQPRAS ++
Sbjct  350  NTFCGSPKTEKSSNIILGFLTANGGLRKRSTSQPRASTIS  389



>ref|XP_006449917.1| hypothetical protein CICLE_v10014697mg [Citrus clementina]
 gb|ESR63157.1| hypothetical protein CICLE_v10014697mg [Citrus clementina]
Length=590

 Score =   163 bits (413),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 136/160 (85%), Gaps = 5/160 (3%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGG+AAN IRDY+RQI+E+ EE+RTLERELARVKVSANRVAT+VANEWKDENDKVMP
Sbjct  230  AVLAGGSAANAIRDYQRQITELNEEKRTLERELARVKVSANRVATVVANEWKDENDKVMP  289

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            V+QWLEERR+LQAEMQRLKDKLAISERTAKAEAQLK+KLKLRLKTLE+GLK   + + +P
Sbjct  290  VRQWLEERRLLQAEMQRLKDKLAISERTAKAEAQLKEKLKLRLKTLEEGLKHVSSFSGSP  349

Query  372  KVLSGFSKPEK-ANHLFGILSS----KKRSASQPRASMVN  476
                G  K EK +N + G L++    +KRS SQPRAS ++
Sbjct  350  NTFCGSPKTEKSSNIILGFLTANGGLRKRSTSQPRASTIS  389



>ref|XP_006467284.1| PREDICTED: microtubule-associated protein 70-5-like isoform X1 
[Citrus sinensis]
 gb|KDO78528.1| hypothetical protein CISIN_1g007760mg [Citrus sinensis]
Length=590

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 136/160 (85%), Gaps = 5/160 (3%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGG+AAN IRDY+RQI+E+ EE+RTLERELARVKVSANRVAT+VANEWKDENDKVMP
Sbjct  230  AVLAGGSAANAIRDYQRQITELNEEKRTLERELARVKVSANRVATVVANEWKDENDKVMP  289

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            V+QWLEERR+LQAEMQRLKDKLAISERTAKAEAQLK+KLKLRLKTLE+GLK   + + +P
Sbjct  290  VRQWLEERRLLQAEMQRLKDKLAISERTAKAEAQLKEKLKLRLKTLEEGLKHVSSFSGSP  349

Query  372  KVLSGFSKPEK-ANHLFGILSS----KKRSASQPRASMVN  476
                G  K EK +N + G L++    +KRS SQPRAS ++
Sbjct  350  NTFCGSPKTEKSSNIILGFLTANGGLRKRSTSQPRASTIS  389



>gb|EYU27662.1| hypothetical protein MIMGU_mgv1a021959mg [Erythranthe guttata]
Length=588

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 134/158 (85%), Gaps = 8/158 (5%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGA ANTIRDY+RQISE+ EE+RTLERELAR+KVSANR+AT+VANEWKD+ DKVMP
Sbjct  224  AILAGGATANTIRDYKRQISELNEEKRTLERELARIKVSANRIATVVANEWKDDKDKVMP  283

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNN-NVN  368
            VKQWLEERR+LQAEMQ+LKDKLAISER AKAEAQ+K+KLKLRLKT+E+GLK    +  VN
Sbjct  284  VKQWLEERRVLQAEMQKLKDKLAISERAAKAEAQVKEKLKLRLKTVEEGLKNAPTSFYVN  343

Query  369  PKVLSGFSKPEKANHLFGILSSK----KRSASQPRASM  470
                +G  K EK+++ FGILSS     KRS SQPRASM
Sbjct  344  T---NGSPKNEKSSNFFGILSSNTRMAKRSTSQPRASM  378



>ref|XP_011460060.1| PREDICTED: microtubule-associated protein 70-5 [Fragaria vesca 
subsp. vesca]
Length=582

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 135/161 (84%), Gaps = 4/161 (2%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGAAAN IRDY+RQI E+ +E++TLERELARVKVSANRVAT+VANEWKDENDKVMP
Sbjct  234  AILAGGAAANAIRDYKRQIDELHDEKKTLERELARVKVSANRVATVVANEWKDENDKVMP  293

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLE+RR++QAEMQR+++KLAIS+RTAKAEAQLK+KLKLRLKTLE+GLK   + +VNP
Sbjct  294  VKQWLEDRRLMQAEMQRMREKLAISDRTAKAEAQLKEKLKLRLKTLEEGLKHVSSFSVNP  353

Query  372  KVLSGFSKPEKANHLFGILSSK----KRSASQPRASMVNTT  482
                   K EK+++  G L+S     KRS SQPRAS + ++
Sbjct  354  NSFCRSPKTEKSSNFLGFLTSPGGLGKRSTSQPRASSLRSS  394



>ref|XP_006350273.1| PREDICTED: microtubule-associated protein 70-5-like, partial 
[Solanum tuberosum]
Length=423

 Score =   156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 122/137 (89%), Gaps = 7/137 (5%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGAAANT+RDY+R+ISE+QEE+RTLEREL+RVKVSANRVAT+VANEWKDENDKVMP
Sbjct  168  AILAGGAAANTLRDYKRRISELQEEKRTLERELSRVKVSANRVATVVANEWKDENDKVMP  227

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR+LQAEMQRL+DKL+ISERTAKAEAQLKDKLKLRLKTLE+GLKQ  N N   
Sbjct  228  VKQWLEERRLLQAEMQRLRDKLSISERTAKAEAQLKDKLKLRLKTLEEGLKQAFNPN---  284

Query  372  KVLSGFSKPEKANHLFG  422
                G +KP+K  H  G
Sbjct  285  ----GSTKPQKTKHYLG  297



>gb|KGN49039.1| hypothetical protein Csa_6G511060 [Cucumis sativus]
Length=573

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 131/156 (84%), Gaps = 2/156 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGA AN +RDY+RQI E+ EE+RTLERELAR KVSA+RVAT+VANEWKDENDKVMP
Sbjct  229  AILAGGATANMVRDYKRQIEELHEEKRTLERELARAKVSAHRVATVVANEWKDENDKVMP  288

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEER++LQAE+QR+K+KLAISERTAKAEAQLK+K KLRLKTLE+GLKQ   +++N 
Sbjct  289  VKQWLEERKLLQAELQRVKEKLAISERTAKAEAQLKEKFKLRLKTLEEGLKQIQISSLNS  348

Query  372  KVLSGFSKPEKANHLFGILSS--KKRSASQPRASMV  473
              + G  K E++N++ G L+S  +KRS S  R S +
Sbjct  349  NAICGSPKAERSNNILGFLTSNGRKRSTSLSRPSTI  384



>ref|XP_002522887.1| Myosin heavy chain, clone, putative [Ricinus communis]
 gb|EEF39487.1| Myosin heavy chain, clone, putative [Ricinus communis]
Length=531

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +3

Query  15   ILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMPV  194
            ILAGGAAAN+IRDY+RQISE+ EE+R LERELAR KVSANRVAT+VANEWKDEN++VMPV
Sbjct  235  ILAGGAAANSIRDYKRQISELNEEKRMLERELARAKVSANRVATVVANEWKDENERVMPV  294

Query  195  KQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNPK  374
            KQWLEERRI+QAEMQRLKDKLAISERTAKAEA LKDK K+RLKTLE+GLKQ  +  VN  
Sbjct  295  KQWLEERRIMQAEMQRLKDKLAISERTAKAEALLKDKFKIRLKTLEEGLKQVSSFTVNSN  354

Query  375  VLSGFSKPEKANHLFGILSS  434
               G  KP K +++ G L+S
Sbjct  355  AFCGSPKPAKTSNILGFLTS  374



>ref|XP_004236657.1| PREDICTED: microtubule-associated protein 70-5-like [Solanum 
lycopersicum]
Length=487

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 122/137 (89%), Gaps = 7/137 (5%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGAAANT+RDY+R+ISE+QEE+RTLEREL+RVKVSANRVAT+VANEWKDENDKVMP
Sbjct  227  AILAGGAAANTLRDYKRRISELQEEKRTLERELSRVKVSANRVATVVANEWKDENDKVMP  286

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR+LQAEMQRL+DKL+ISERTAKAEAQLKDKLKLRLKTLE+GLKQ  N N   
Sbjct  287  VKQWLEERRLLQAEMQRLRDKLSISERTAKAEAQLKDKLKLRLKTLEEGLKQAFNPN---  343

Query  372  KVLSGFSKPEKANHLFG  422
                G +KP+K  H  G
Sbjct  344  ----GSTKPQKTKHYLG  356



>ref|XP_010686630.1| PREDICTED: microtubule-associated protein 70-5 [Beta vulgaris 
subsp. vulgaris]
Length=547

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 129/160 (81%), Gaps = 10/160 (6%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGA AN +RD++R+ISE+ EE+R LERELAR +VSANRVAT+VANEWKDENDKVMP
Sbjct  227  AVLAGGATANVVRDFKRKISELYEEKRILERELARARVSANRVATVVANEWKDENDKVMP  286

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR++QAEMQRL+DKLA++ERTAKAEAQLK+K KLRLK +E+GLK   +N   P
Sbjct  287  VKQWLEERRVMQAEMQRLRDKLAVTERTAKAEAQLKEKFKLRLKVVEEGLKHASSNECTP  346

Query  372  KVLSGFSKPEKANHLFGILS----SKKRSASQPRASMVNT  479
            K           + + G ++    +KKRS+SQPRAS++N+
Sbjct  347  KT------SNTTHQILGFVTNNGGAKKRSSSQPRASVINS  380



>emb|CAN63131.1| hypothetical protein VITISV_001458 [Vitis vinifera]
Length=605

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 130/176 (74%), Gaps = 28/176 (16%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGG AAN IRDYRRQISE+ EE+RTLERELARVKVSANRVAT+VANEWKDENDKVMP
Sbjct  258  AILAGGVAANAIRDYRRQISELNEEKRTLERELARVKVSANRVATVVANEWKDENDKVMP  317

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            +KQWLEERR+LQAE QRL+DKLAISERTAKAEAQLKDKLKLRLKTLE+GLKQ        
Sbjct  318  IKQWLEERRLLQAETQRLRDKLAISERTAKAEAQLKDKLKLRLKTLEEGLKQ--------  369

Query  372  KVLSGFSKPEKANHLFGILSS-------------------KKRSASQPRASMVNTT  482
             V S FSKPEK+N      S                    K+RS SQPR S +  T
Sbjct  370  -VSSRFSKPEKSNPYLSCRSPKPENGPITFWRFLSGNGGLKRRSTSQPRGSCIGKT  424



>ref|XP_010270219.1| PREDICTED: microtubule-associated protein 70-5 isoform X2 [Nelumbo 
nucifera]
Length=501

 Score =   154 bits (389),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 129/157 (82%), Gaps = 4/157 (3%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            +ILAGG AAN IRDY+RQISE+ EE+RTLERELAR+KVSANRVA +VANEWKD+NDKVMP
Sbjct  148  SILAGGVAANVIRDYQRQISELNEEKRTLERELARIKVSANRVAAVVANEWKDDNDKVMP  207

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            +KQWLEERR  QAE+QRLKDKL +SERTAKAEA LKD+L++RLKTLE+GLKQ  N ++N 
Sbjct  208  IKQWLEERRFFQAEIQRLKDKLTLSERTAKAEAHLKDRLRMRLKTLEEGLKQVPNLSINL  267

Query  372  KVLSGFSKPEKANHLFGILSS----KKRSASQPRASM  470
                G  K EK N++ G LS+    +++S SQP +S+
Sbjct  268  NAPCGSRKTEKPNYILGFLSNNAGLRRKSTSQPMSSV  304



>ref|XP_010270218.1| PREDICTED: microtubule-associated protein 70-5 isoform X1 [Nelumbo 
nucifera]
Length=580

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 129/157 (82%), Gaps = 4/157 (3%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            +ILAGG AAN IRDY+RQISE+ EE+RTLERELAR+KVSANRVA +VANEWKD+NDKVMP
Sbjct  227  SILAGGVAANVIRDYQRQISELNEEKRTLERELARIKVSANRVAAVVANEWKDDNDKVMP  286

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            +KQWLEERR  QAE+QRLKDKL +SERTAKAEA LKD+L++RLKTLE+GLKQ  N ++N 
Sbjct  287  IKQWLEERRFFQAEIQRLKDKLTLSERTAKAEAHLKDRLRMRLKTLEEGLKQVPNLSINL  346

Query  372  KVLSGFSKPEKANHLFGILSS----KKRSASQPRASM  470
                G  K EK N++ G LS+    +++S SQP +S+
Sbjct  347  NAPCGSRKTEKPNYILGFLSNNAGLRRKSTSQPMSSV  383



>ref|XP_007212811.1| hypothetical protein PRUPE_ppa002850mg [Prunus persica]
 gb|EMJ14010.1| hypothetical protein PRUPE_ppa002850mg [Prunus persica]
Length=628

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 132/158 (84%), Gaps = 7/158 (4%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGAAAN IRDY+RQI E+ EE+R+LERELARVKVSANRVAT++ANEWKDENDKVMP
Sbjct  233  AILAGGAAANAIRDYKRQIEELHEEKRSLERELARVKVSANRVATVIANEWKDENDKVMP  292

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR++QA+MQRL++KLAIS+RTAKAEAQLK+KLKLRLKTLE+GLK    ++ NP
Sbjct  293  VKQWLEERRLMQADMQRLREKLAISDRTAKAEAQLKEKLKLRLKTLEEGLKHV--SSFNP  350

Query  372  KVLSGFSKPEKANHLFGILSSK----KRSASQPRASMV  473
              L    K EK+++  G L S     KRS SQPRAS +
Sbjct  351  H-LCVSPKAEKSSNFLGFLKSNGGLGKRSTSQPRASTI  387



>ref|XP_002307909.1| hypothetical protein POPTR_0006s01900g [Populus trichocarpa]
 gb|EEE91432.1| hypothetical protein POPTR_0006s01900g [Populus trichocarpa]
Length=516

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 126/150 (84%), Gaps = 4/150 (3%)
 Frame = +3

Query  39   NTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMPVKQWLEERR  218
            NTIRDYRRQISE+ EE+R LERELAR +VSANRVAT+VANEWKDENDKVMPVKQWLEERR
Sbjct  243  NTIRDYRRQISELNEEKRILERELARARVSANRVATVVANEWKDENDKVMPVKQWLEERR  302

Query  219  ILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNPKVLSGFSKP  398
            +LQAEMQRLKDKLAISERTA AEAQLK+KLKLRLKTLE+GL+   + +VNP    G  KP
Sbjct  303  MLQAEMQRLKDKLAISERTANAEAQLKEKLKLRLKTLEEGLQHVSSFSVNPNASCGSPKP  362

Query  399  EKANHLFGILSS----KKRSASQPRASMVN  476
             K +++ G L+S    +KRSASQPR S ++
Sbjct  363  GKTSNILGFLTSNGGIRKRSASQPRGSTIS  392



>ref|XP_002323125.2| hypothetical protein POPTR_0016s00870g [Populus trichocarpa]
 gb|EEF04886.2| hypothetical protein POPTR_0016s00870g [Populus trichocarpa]
Length=573

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 123/150 (82%), Gaps = 4/150 (3%)
 Frame = +3

Query  39   NTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMPVKQWLEERR  218
            NTIRDYRRQISE++EE+R LERELAR +VSANRVAT+VANEWKDENDKVMPVKQWLEERR
Sbjct  240  NTIRDYRRQISELKEEKRMLERELARARVSANRVATVVANEWKDENDKVMPVKQWLEERR  299

Query  219  ILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNPKVLSGFSKP  398
            +LQAEMQRLK+KLAISERTA AEAQLK+K+KLRLKTLE+GLK T + + NP    G  KP
Sbjct  300  LLQAEMQRLKEKLAISERTANAEAQLKEKMKLRLKTLEEGLKHTSSFSANPNASCGSPKP  359

Query  399  EKANHLFGILSS----KKRSASQPRASMVN  476
               N + G L S    ++RS SQPR S +N
Sbjct  360  GNTNKILGFLKSNAGMRRRSTSQPRGSSIN  389



>ref|XP_004134988.1| PREDICTED: microtubule-associated protein 70-5-like [Cucumis 
sativus]
Length=515

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGA AN +RDY+RQI E+ EE+RTLERELAR KVSA+RVAT+VANEWKDENDKVMP
Sbjct  229  AILAGGATANMVRDYKRQIEELHEEKRTLERELARAKVSAHRVATVVANEWKDENDKVMP  288

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEER++LQAE+QR+K+KLAISERTAKAEAQLK+K KLRLKTLE+GLKQ   +++N 
Sbjct  289  VKQWLEERKLLQAELQRVKEKLAISERTAKAEAQLKEKFKLRLKTLEEGLKQIQISSLNS  348

Query  372  KVLSGFSKPEKANHLFGILSSKKRSASQ  455
              + G  K E++N++ G L+S  R  S+
Sbjct  349  NAICGSPKAERSNNILGFLTSNGRKRSR  376



>ref|XP_011004522.1| PREDICTED: microtubule-associated protein 70-5 [Populus euphratica]
Length=576

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 127/152 (84%), Gaps = 4/152 (3%)
 Frame = +3

Query  39   NTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMPVKQWLEERR  218
            NTIRDYRRQISE+ EE+R LERELAR +VSANRVAT+VANEWKDENDKVMPVKQWLEERR
Sbjct  243  NTIRDYRRQISELNEEKRILERELARARVSANRVATVVANEWKDENDKVMPVKQWLEERR  302

Query  219  ILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNPKVLSGFSKP  398
            +LQAEMQRLKDKLAISERTA AEAQLK+KLKLRLKTLE+GL+   + +VNP    G  KP
Sbjct  303  LLQAEMQRLKDKLAISERTANAEAQLKEKLKLRLKTLEEGLQHVQSFSVNPNASCGSPKP  362

Query  399  EKANHLFGILSS----KKRSASQPRASMVNTT  482
             K +++ G L+S    +KRSASQPR S ++ +
Sbjct  363  GKTSNILGFLTSNGGIRKRSASQPRGSTISIS  394



>ref|XP_008441104.1| PREDICTED: microtubule-associated protein 70-5-like [Cucumis 
melo]
Length=488

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 130/157 (83%), Gaps = 3/157 (2%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGA AN +RDY+RQI E+ EE+RTLERELAR KVSA+RVAT+VANEWKDENDKVMP
Sbjct  229  AILAGGATANMVRDYKRQIEELHEEKRTLERELARAKVSAHRVATVVANEWKDENDKVMP  288

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdkl-klrlktlEQGLKQTGNNNVN  368
            VKQWLEER++LQAE+QR+K+KLAISERTAKAEAQLK +  KLRLKTLE+GLKQ   + +N
Sbjct  289  VKQWLEERKLLQAELQRMKEKLAISERTAKAEAQLKVEKFKLRLKTLEEGLKQIQISPLN  348

Query  369  PKVLSGFSKPEKANHLFGILSS--KKRSASQPRASMV  473
               + G  K E++N++ G L+S  +KRS S  R S++
Sbjct  349  SNAICGSPKAERSNNILGFLTSNGRKRSTSLSRPSII  385



>ref|XP_008224620.1| PREDICTED: microtubule-associated protein 70-5 [Prunus mume]
Length=579

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 132/158 (84%), Gaps = 7/158 (4%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGAAAN IRDYRRQI E+ EE+R+LERELARVKVSANRVAT++ANEWK+ENDKVMP
Sbjct  233  AILAGGAAANAIRDYRRQIEELHEEKRSLERELARVKVSANRVATVIANEWKEENDKVMP  292

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR++QA+MQRL++KLAIS+RTAKAEAQLK+KLKLRLKTLE+GLK    ++ NP
Sbjct  293  VKQWLEERRLMQADMQRLREKLAISDRTAKAEAQLKEKLKLRLKTLEEGLKHV--SSFNP  350

Query  372  KVLSGFSKPEKANHLFGILSSK----KRSASQPRASMV  473
              L    K EK+++  G L S     KRS SQPRAS +
Sbjct  351  H-LCVSPKAEKSSNFLGFLKSNGGLGKRSTSQPRASTI  387



>ref|XP_004168631.1| PREDICTED: microtubule-associated protein 70-5-like [Cucumis 
sativus]
Length=515

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGA AN +RDY+RQI E+ EE+RTLERELAR KVSA+RVAT+VANEWKDENDKVMP
Sbjct  229  AILAGGATANMVRDYKRQIEELHEEKRTLERELARAKVSAHRVATVVANEWKDENDKVMP  288

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEER++LQAE+QR+K+KLAISERTAKAEAQLK+K KLRLKTLE+GLKQ   +++N 
Sbjct  289  VKQWLEERKLLQAELQRVKEKLAISERTAKAEAQLKEKFKLRLKTLEEGLKQIHISSLNG  348

Query  372  KVLSGFSKPEKANHLFGILSSKKRSASQ  455
              + G  K E++N++ G L+S  R  S+
Sbjct  349  NAICGSPKAERSNNILGFLTSNGRKRSR  376



>ref|XP_009144675.1| PREDICTED: microtubule-associated protein 70-5-like [Brassica 
rapa]
Length=559

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 126/159 (79%), Gaps = 9/159 (6%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGG AAN +RDYRRQIS++ EE+RTLEREL+RVKVSA+RVA  VANEWKDEND+VMP
Sbjct  264  AILAGGTAANAVRDYRRQISQLNEEKRTLERELSRVKVSASRVALAVANEWKDENDRVMP  323

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR+L  EMQ+LKDKLA+SERTAKAE+QLK++LKLRLKT+E GLK      V+P
Sbjct  324  VKQWLEERRLLHGEMQKLKDKLAVSERTAKAESQLKERLKLRLKTIEDGLKSPNMFTVSP  383

Query  372  KVLSGFSKPEKANHLFGILS-----SKKRSASQPRASMV  473
                  +K EK+  + G L+     SKKRS SQPR S+ 
Sbjct  384  TT----TKAEKSGKILGFLTSGVGGSKKRSTSQPRGSLT  418



>gb|KHN40802.1| Microtubule-associated protein 70-5 [Glycine soja]
Length=549

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 130/160 (81%), Gaps = 7/160 (4%)
 Frame = +3

Query  15   ILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMPV  194
            IL+ G  AN IRDY+RQISE+QEE+RTLERELARVKVSANRVAT+VANEWKDENDKVMPV
Sbjct  207  ILSSGVNANAIRDYQRQISELQEEKRTLERELARVKVSANRVATVVANEWKDENDKVMPV  266

Query  195  KQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNPK  374
            KQWLEERRI+QAEMQRLKDKLAISERTAKAE+QLKDKLKLRLKTLE+GLK   N+ V+  
Sbjct  267  KQWLEERRIMQAEMQRLKDKLAISERTAKAESQLKDKLKLRLKTLEEGLKHFSNHPVSSN  326

Query  375  VLSGFSKPEKANHLFGILSS----KKRSASQPRASMVNTT  482
             +S  S+  K   +   L++    + RS SQPR S + ++
Sbjct  327  SVSAKSEKSK---ILSFLTTNSGLRNRSTSQPRGSAIGSS  363



>ref|XP_006586778.1| PREDICTED: microtubule-associated protein 70-5-like [Glycine 
max]
Length=571

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 130/160 (81%), Gaps = 7/160 (4%)
 Frame = +3

Query  15   ILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMPV  194
            IL+ G  AN IRDY+RQISE+QEE+RTLERELARVKVSANRVAT+VANEWKDENDKVMPV
Sbjct  229  ILSSGVNANAIRDYQRQISELQEEKRTLERELARVKVSANRVATVVANEWKDENDKVMPV  288

Query  195  KQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNPK  374
            KQWLEERRI+QAEMQRLKDKLAISERTAKAE+QLKDKLKLRLKTLE+GLK   N+ V+  
Sbjct  289  KQWLEERRIMQAEMQRLKDKLAISERTAKAESQLKDKLKLRLKTLEEGLKHFSNHPVSSN  348

Query  375  VLSGFSKPEKANHLFGILSS----KKRSASQPRASMVNTT  482
             +S  S+  K   +   L++    + RS SQPR S + ++
Sbjct  349  SVSAKSEKSK---ILSFLTTNSGLRNRSTSQPRGSAIGSS  385



>ref|XP_006597612.1| PREDICTED: microtubule-associated protein 70-5 [Glycine max]
 gb|KHN34218.1| Microtubule-associated protein 70-5 [Glycine soja]
Length=571

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 127/155 (82%), Gaps = 5/155 (3%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
             IL+ G  AN +RDY+RQISE+QEE+RTLERELARVKVSANRVAT+VANEWKDENDKVMP
Sbjct  228  VILSSGVNANAVRDYQRQISELQEEKRTLERELARVKVSANRVATVVANEWKDENDKVMP  287

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERRI+QAEMQRLKDKLAISERTAKAE+QLKDKLK+RLKTLE+GLK   NN V+ 
Sbjct  288  VKQWLEERRIMQAEMQRLKDKLAISERTAKAESQLKDKLKMRLKTLEEGLKHFSNNPVSS  347

Query  372  KVLSGFSKPEKANHLFGILSS---KKRSASQPRAS  467
               SG +K EK   L  + ++   + R  SQPR S
Sbjct  348  N--SGSAKSEKYKILSFLTTNGGLRNRCTSQPRGS  380



>ref|XP_004486342.1| PREDICTED: microtubule-associated protein 70-5-like [Cicer arietinum]
Length=570

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 131/158 (83%), Gaps = 6/158 (4%)
 Frame = +3

Query  15   ILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMPV  194
            IL+ GA AN +RDY+RQISE+QEE+RTLERELARVKVSANR+AT+ ANEWKDENDKVMPV
Sbjct  225  ILSSGANANVVRDYKRQISELQEEKRTLERELARVKVSANRIATVAANEWKDENDKVMPV  284

Query  195  KQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNPK  374
            +QWLEERRI+QAEMQRLK+KLAISERTAKAE+QLKDKLKLRLKTLE+GLKQ     ++  
Sbjct  285  RQWLEERRIMQAEMQRLKEKLAISERTAKAESQLKDKLKLRLKTLEEGLKQFS---MSSN  341

Query  375  VLSGFSKPEKANHLFGILSS---KKRSASQPRASMVNT  479
              SG  K +K+N L  + +S   + RS SQPRAS + +
Sbjct  342  AFSGTPKADKSNILSFVTNSDGLRNRSTSQPRASTIGS  379



>ref|XP_010538455.1| PREDICTED: microtubule-associated protein 70-5 [Tarenaya hassleriana]
 ref|XP_010538457.1| PREDICTED: microtubule-associated protein 70-5 [Tarenaya hassleriana]
Length=518

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 122/154 (79%), Gaps = 10/154 (6%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGG+AAN +RDYRR+ISE+ EE+RTLERELARVKVSANRVA  VANEWKDEND+VMP
Sbjct  216  AILAGGSAANAVRDYRRRISELNEEKRTLERELARVKVSANRVALAVANEWKDENDRVMP  275

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VK+WLEERR+L  EMQ+LKDKLAISERTAKAEAQLK+KL+LRLKT+E  LK       NP
Sbjct  276  VKKWLEERRLLHGEMQKLKDKLAISERTAKAEAQLKEKLRLRLKTIEDSLK-------NP  328

Query  372  KVLSGFSKPEKANHLFGILSSKKRSASQPRASMV  473
               S  +K EK   +   LS   RS SQPR SMV
Sbjct  329  NTFSVSTKIEKTGKVLSFLS---RSTSQPRGSMV  359



>ref|XP_006584097.1| PREDICTED: microtubule-associated protein 70-5-like isoform X2 
[Glycine max]
Length=573

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 128/160 (80%), Gaps = 5/160 (3%)
 Frame = +3

Query  15   ILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMPV  194
            ILA GA AN +RDY++QISE+QEE+RTLERELARVKVS NR+A  VANEWKDEN KVMPV
Sbjct  228  ILASGATANAVRDYQQQISELQEEKRTLERELARVKVSTNRIANAVANEWKDENHKVMPV  287

Query  195  KQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNPK  374
            +QWLEERRI+QAE+QRLKDK AISERTAKAE+QLKDKLKLRLKTLE+GLK   NN +   
Sbjct  288  RQWLEERRIMQAEIQRLKDKQAISERTAKAESQLKDKLKLRLKTLEEGLKHFSNNPITSN  347

Query  375  VLSGFSKPEKANHLFGILSS----KKRSASQPRASMVNTT  482
            V     K EK+N + G L++    +KRS SQPRA  V ++
Sbjct  348  VSYASQKAEKSN-ILGFLTTSAGLRKRSTSQPRACTVGSS  386



>ref|XP_006584098.1| PREDICTED: microtubule-associated protein 70-5-like isoform X3 
[Glycine max]
Length=534

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 128/160 (80%), Gaps = 5/160 (3%)
 Frame = +3

Query  15   ILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMPV  194
            ILA GA AN +RDY++QISE+QEE+RTLERELARVKVS NR+A  VANEWKDEN KVMPV
Sbjct  169  ILASGATANAVRDYQQQISELQEEKRTLERELARVKVSTNRIANAVANEWKDENHKVMPV  228

Query  195  KQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNPK  374
            +QWLEERRI+QAE+QRLKDK AISERTAKAE+QLKDKLKLRLKTLE+GLK   NN +   
Sbjct  229  RQWLEERRIMQAEIQRLKDKQAISERTAKAESQLKDKLKLRLKTLEEGLKHFSNNPITSN  288

Query  375  VLSGFSKPEKANHLFGILSS----KKRSASQPRASMVNTT  482
            V     K EK+N + G L++    +KRS SQPRA  V ++
Sbjct  289  VSYASQKAEKSN-ILGFLTTSAGLRKRSTSQPRACTVGSS  327



>ref|XP_011040173.1| PREDICTED: microtubule-associated protein 70-5-like [Populus 
euphratica]
 ref|XP_011040174.1| PREDICTED: microtubule-associated protein 70-5-like [Populus 
euphratica]
Length=573

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 122/150 (81%), Gaps = 4/150 (3%)
 Frame = +3

Query  39   NTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMPVKQWLEERR  218
            NTIRDYRRQISE +EE+R LERELAR +VSANRVAT+VANEWKDENDKVMPVKQWLEERR
Sbjct  240  NTIRDYRRQISEPKEEKRMLERELARARVSANRVATVVANEWKDENDKVMPVKQWLEERR  299

Query  219  ILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNPKVLSGFSKP  398
            +LQAEMQRLK+KLAISERTA AEAQLK+KLKLRLKTLE+GLK T + + NP    G  KP
Sbjct  300  LLQAEMQRLKEKLAISERTANAEAQLKEKLKLRLKTLEEGLKYTSSFSANPNASCGSPKP  359

Query  399  EKANHLFGILSS----KKRSASQPRASMVN  476
               N + G L S    ++RS SQPR S ++
Sbjct  360  GSTNKILGFLKSNAGMRRRSTSQPRGSNIS  389



>ref|XP_006584096.1| PREDICTED: microtubule-associated protein 70-5-like isoform X1 
[Glycine max]
 gb|KHN42272.1| Microtubule-associated protein 70-5 [Glycine soja]
Length=593

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 128/160 (80%), Gaps = 5/160 (3%)
 Frame = +3

Query  15   ILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMPV  194
            ILA GA AN +RDY++QISE+QEE+RTLERELARVKVS NR+A  VANEWKDEN KVMPV
Sbjct  228  ILASGATANAVRDYQQQISELQEEKRTLERELARVKVSTNRIANAVANEWKDENHKVMPV  287

Query  195  KQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNPK  374
            +QWLEERRI+QAE+QRLKDK AISERTAKAE+QLKDKLKLRLKTLE+GLK   NN +   
Sbjct  288  RQWLEERRIMQAEIQRLKDKQAISERTAKAESQLKDKLKLRLKTLEEGLKHFSNNPITSN  347

Query  375  VLSGFSKPEKANHLFGILSS----KKRSASQPRASMVNTT  482
            V     K EK+N + G L++    +KRS SQPRA  V ++
Sbjct  348  VSYASQKAEKSN-ILGFLTTSAGLRKRSTSQPRACTVGSS  386



>ref|XP_006856278.1| hypothetical protein AMTR_s00047p00081310 [Amborella trichopoda]
 gb|ERN17745.1| hypothetical protein AMTR_s00047p00081310 [Amborella trichopoda]
Length=588

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 127/159 (80%), Gaps = 9/159 (6%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            +ILAGGAAAN +RDY+RQI E+ EERRTLERELARVK+ ANRVAT+VANEWKD+NDKVMP
Sbjct  227  SILAGGAAANAVRDYQRQILEMNEERRTLERELARVKILANRVATVVANEWKDDNDKVMP  286

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQ--TGNNNV  365
            VKQWLEER++LQ E+QRL+DKL +SERTAKAE+QLKDK KLRLKTLE+GLKQ  T + N 
Sbjct  287  VKQWLEERKVLQGEIQRLRDKLNVSERTAKAESQLKDKFKLRLKTLEEGLKQVTTSSPNT  346

Query  366  NPKVLSGFSKPEKANHLFGILSS----KKRSASQPRASM  470
                L    KPE    + G LSS    +KRS SQPRAS 
Sbjct  347  EGSHLKQTVKPEP---VLGYLSSNMGPRKRSQSQPRASF  382



>ref|XP_003610594.1| hypothetical protein MTR_4g133890 [Medicago truncatula]
 gb|AES92791.1| myosin II heavy chain family protein [Medicago truncatula]
Length=565

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 124/159 (78%), Gaps = 14/159 (9%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
             ILA GA AN +RDY+RQ SE+QEE+RTLEREL RVKVSANR+A   ANEWKDENDKVMP
Sbjct  227  VILANGATANVVRDYQRQFSELQEEKRTLERELERVKVSANRIANGKANEWKDENDKVMP  286

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERRI+QAEMQRLKDKLAISERTAKAE+Q+K+KLK+RLKTLE+GLK         
Sbjct  287  VKQWLEERRIIQAEMQRLKDKLAISERTAKAESQMKEKLKVRLKTLEEGLKH--------  338

Query  372  KVLSGFSKPEKANHLFGILSS---KKRSASQPRASMVNT  479
               S  SK EK+N +    +S   KKRS SQPRAS + +
Sbjct  339  ---SSISKAEKSNIISSPTASGGPKKRSTSQPRASAIGS  374



>gb|ACU18231.1| unknown [Glycine max]
Length=365

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 120/140 (86%), Gaps = 6/140 (4%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
             IL+ G  AN +RDY+RQISE+QEE+RTLERELARVKVSANRVAT+VANEWKDENDKVMP
Sbjct  228  VILSSGVNANAVRDYQRQISELQEEKRTLERELARVKVSANRVATVVANEWKDENDKVMP  287

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERRI+QAEMQRLKDKLAISERTAKAE+QLKDKLK+RLKTLE+GLK   NN V+ 
Sbjct  288  VKQWLEERRIMQAEMQRLKDKLAISERTAKAESQLKDKLKMRLKTLEEGLKHFSNNPVSS  347

Query  372  KVLSGFSKPEKANHLFGILS  431
               SG +K EK    + ILS
Sbjct  348  N--SGSAKSEK----YKILS  361



>gb|KEH32682.1| myosin II heavy chain family protein [Medicago truncatula]
Length=586

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 124/159 (78%), Gaps = 14/159 (9%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
             ILA GA AN +RDY+RQ SE+QEE+RTLEREL RVKVSANR+A   ANEWKDENDKVMP
Sbjct  235  VILANGATANVVRDYQRQFSELQEEKRTLERELERVKVSANRIANGKANEWKDENDKVMP  294

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERRI+QAEMQRLKDKLAISERTAKAE+Q+K+KLK+RLKTLE+GLK         
Sbjct  295  VKQWLEERRIIQAEMQRLKDKLAISERTAKAESQMKEKLKVRLKTLEEGLKH--------  346

Query  372  KVLSGFSKPEKANHLFGILSS---KKRSASQPRASMVNT  479
               S  SK EK+N +    +S   KKRS SQPRAS + +
Sbjct  347  ---SSISKAEKSNIISSPTASGGPKKRSTSQPRASAIGS  382



>ref|XP_007147624.1| hypothetical protein PHAVU_006G140300g [Phaseolus vulgaris]
 gb|ESW19618.1| hypothetical protein PHAVU_006G140300g [Phaseolus vulgaris]
Length=571

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 130/159 (82%), Gaps = 8/159 (5%)
 Frame = +3

Query  15   ILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMPV  194
            IL+ G  AN +RDY+RQISE+QEE+RTLERELARVKVSANRVAT+VANEWKDENDKVMPV
Sbjct  229  ILSSGVNANAVRDYQRQISELQEEKRTLERELARVKVSANRVATVVANEWKDENDKVMPV  288

Query  195  KQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNPK  374
            KQWLEERRI+QAEMQRLK+KLAISERTAKAE+QLKDKLKLRLKTLE+GLK   N++    
Sbjct  289  KQWLEERRIMQAEMQRLKEKLAISERTAKAESQLKDKLKLRLKTLEEGLKHFSNSSN---  345

Query  375  VLSGFSKPEKANHLFGILSS---KKRSASQPRASMVNTT  482
              SG  K +K+N L  + ++   + RS SQPR S   ++
Sbjct  346  --SGSEKAQKSNILSFLTTNGGLRNRSTSQPRGSTAGSS  382



>ref|NP_193455.2| microtubule-associated protein 70-5 [Arabidopsis thaliana]
 sp|Q8GYX3.1|MP705_ARATH RecName: Full=Microtubule-associated protein 70-5; Short=AtMAP70-5; 
AltName: Full=70 kDa microtubule-associated protein 5 
[Arabidopsis thaliana]
 dbj|BAC42006.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64836.1| At4g17220 [Arabidopsis thaliana]
 emb|CAJ31082.1| 70 kDa microtubule associated protein Type 5 [Arabidopsis thaliana]
 gb|AEE83864.1| microtubule-associated protein 70-5 [Arabidopsis thaliana]
Length=513

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 126/158 (80%), Gaps = 9/158 (6%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGG AAN +RDYRRQIS++ +E+RTLERELARVKVSA+RVA  VANEWKDEND+VMP
Sbjct  215  AILAGGTAANAVRDYRRQISQLNDEKRTLERELARVKVSASRVALAVANEWKDENDRVMP  274

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERRIL  EMQ+LKDKLA+SERTAKAE+QLK++LKLRLKT+E GLK      V+P
Sbjct  275  VKQWLEERRILHGEMQKLKDKLAVSERTAKAESQLKERLKLRLKTIEDGLKGPNTFFVSP  334

Query  372  KVLSGFSKPEKANHLFGILS----SKKRSASQPRASMV  473
                  +K EK+  + G L+    SKKRS+SQ R S+ 
Sbjct  335  T-----TKTEKSGKILGFLTSGGGSKKRSSSQLRGSVT  367



>ref|XP_006283554.1| hypothetical protein CARUB_v10004607mg [Capsella rubella]
 gb|EOA16452.1| hypothetical protein CARUB_v10004607mg [Capsella rubella]
Length=513

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 126/158 (80%), Gaps = 9/158 (6%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGG AAN +RDYRRQIS++ +E+RTLERELARVKVSA+RVA  VANEWKDEND+VMP
Sbjct  215  AILAGGTAANAVRDYRRQISQLNDEKRTLERELARVKVSASRVALAVANEWKDENDRVMP  274

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VK+WLEERR+L  EMQ+LKDKLA+SERTAKAE+QLK++LKLRLKT+E GLK      V+P
Sbjct  275  VKKWLEERRLLHGEMQKLKDKLAVSERTAKAESQLKERLKLRLKTIEDGLKCPNTFLVSP  334

Query  372  KVLSGFSKPEKANHLFGILS----SKKRSASQPRASMV  473
                  +K E++  + G L+    SKKRS SQPR S+ 
Sbjct  335  T-----TKTERSGKILGFLTSGGGSKKRSTSQPRGSIT  367



>gb|KEH36973.1| myosin II heavy chain family protein [Medicago truncatula]
Length=552

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 129/159 (81%), Gaps = 6/159 (4%)
 Frame = +3

Query  15   ILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMPV  194
            IL+ GA AN IRDY+RQISE+QEE+RTLERELARVKVSANR+AT+ ANEWKDE+DKVMPV
Sbjct  223  ILSNGATANLIRDYKRQISELQEEKRTLERELARVKVSANRIATVAANEWKDESDKVMPV  282

Query  195  KQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNPK  374
            +QWLEERRI+QAEMQRLK+KLAISERTAKAE+QLKDKLKLRLKTLE+GLKQ     VN  
Sbjct  283  RQWLEERRIMQAEMQRLKEKLAISERTAKAESQLKDKLKLRLKTLEEGLKQFS---VNSN  339

Query  375  VLSGFSKPEKANHLFGILSS---KKRSASQPRASMVNTT  482
              S   K +K+N L  + ++   + RS SQPR S V  T
Sbjct  340  AFSVSPKADKSNILSFVTNNGGLRNRSTSQPRGSTVGRT  378



>ref|XP_006414258.1| hypothetical protein EUTSA_v10024950mg [Eutrema salsugineum]
 gb|ESQ55711.1| hypothetical protein EUTSA_v10024950mg [Eutrema salsugineum]
Length=512

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 126/158 (80%), Gaps = 8/158 (5%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGG AAN +RDYRRQIS++ EE+RTLERELARVKVSA+RVA  VANEWKDEND+VMP
Sbjct  215  AILAGGTAANAVRDYRRQISQLNEEKRTLERELARVKVSASRVALAVANEWKDENDRVMP  274

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            +KQWL+ERR+L  EMQ+LKDKLAISERTAKAE+QLK++LKLRLKT+E GLK     + +P
Sbjct  275  IKQWLDERRLLHGEMQKLKDKLAISERTAKAESQLKERLKLRLKTIEDGLKGPNKFSDSP  334

Query  372  KVLSGFSKPEKANHLFGILS----SKKRSASQPRASMV  473
                  +K EK+  + G L+    SKKRS SQPR S+ 
Sbjct  335  TT----TKTEKSIKILGFLTNGGGSKKRSTSQPRGSLT  368



>ref|XP_004507603.1| PREDICTED: microtubule-associated protein 70-5-like [Cicer arietinum]
Length=576

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 130/160 (81%), Gaps = 5/160 (3%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVA-NEWKDENDKVM  188
             ILA GAAAN +RDY+RQISE+QE++RTLERELARV+VSANR+A +VA NEWK E+DKVM
Sbjct  227  VILANGAAANVVRDYQRQISELQEQKRTLERELARVRVSANRIANVVAANEWKGESDKVM  286

Query  189  PVKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVN  368
            PVKQWLEERRI+QAEMQRLKDKL +SERTAKAE+QLK+KLK+RLKTLE GLK   + +  
Sbjct  287  PVKQWLEERRIMQAEMQRLKDKLTVSERTAKAESQLKEKLKVRLKTLEAGLKHFSSYSAT  346

Query  369  PKVLSGFSKPEKANHLFGILS---SKKRSASQPRASMVNT  479
              V S   K EK+N + G L+   S+KRS SQPRAS V +
Sbjct  347  SNVFSWSPKEEKSN-IRGFLTSGGSRKRSTSQPRASSVGS  385



>ref|XP_007154039.1| hypothetical protein PHAVU_003G086000g [Phaseolus vulgaris]
 gb|ESW26033.1| hypothetical protein PHAVU_003G086000g [Phaseolus vulgaris]
Length=575

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 129/163 (79%), Gaps = 11/163 (7%)
 Frame = +3

Query  15   ILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMPV  194
            ILA GA AN +RDY+R+ SE+QEE+R LERELARVKVSANR+A +VANEWKDENDKVMPV
Sbjct  228  ILASGATANAVRDYQRRTSELQEEKRKLERELARVKVSANRIANVVANEWKDENDKVMPV  287

Query  195  KQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNPK  374
            +QWLEERRI+QAE+QRLK KLA SERTAKAE+QLKDKLKLRLKTLE+GLK   +    P 
Sbjct  288  RQWLEERRIMQAEIQRLKVKLATSERTAKAESQLKDKLKLRLKTLEEGLKHFSS---YPN  344

Query  375  VL---SGFSKPEKANHLFGILSS----KKRSASQPRASMVNTT  482
            +L       K EK+N + G L++    +KRS SQPRAS V ++
Sbjct  345  ILNVPCASPKAEKSN-ILGFLTTSSDLRKRSTSQPRASRVGSS  386



>ref|XP_010434704.1| PREDICTED: microtubule-associated protein 70-5-like [Camelina 
sativa]
Length=513

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 125/156 (80%), Gaps = 9/156 (6%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGG AAN +RDYRRQIS++ +E+RTLERELARVKVSA+RVA  VANEWKDEND+VMP
Sbjct  215  AILAGGTAANAVRDYRRQISQLNDEKRTLERELARVKVSASRVALAVANEWKDENDRVMP  274

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VK+WLEERR+L  EMQ+LKDKLA+SERTAKAE+QLK++LKLRLKT+E GLK T    V+P
Sbjct  275  VKKWLEERRLLHGEMQKLKDKLAVSERTAKAESQLKERLKLRLKTIEDGLKGTNTFLVSP  334

Query  372  KVLSGFSKPEKANHLFGILS----SKKRSASQPRAS  467
                  +K EK+  + G L+    SKK S SQPR S
Sbjct  335  T-----TKTEKSGKILGFLTSGGGSKKWSNSQPRGS  365



>emb|CDY35590.1| BnaC01g21120D [Brassica napus]
Length=514

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 125/161 (78%), Gaps = 11/161 (7%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqise--iqeerrtlerelarVKVSANRVATIVANEWKDENDKV  185
            AILAGG AAN +RDYRRQIS+    EE+RTLERELARVKVSA+RVA   ANEWKDEND+V
Sbjct  215  AILAGGTAANAVRDYRRQISQLNASEEKRTLERELARVKVSASRVALAFANEWKDENDRV  274

Query  186  MPVKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNV  365
            MPVKQWLEERR+L  EMQ+LKDKLA+SERTAKAE+QLK++LKLRLKT+E GLK     +V
Sbjct  275  MPVKQWLEERRLLHGEMQKLKDKLAVSERTAKAESQLKERLKLRLKTIEDGLKCLNMLSV  334

Query  366  NPKVLSGFSKPEKANHLFGILS-----SKKRSASQPRASMV  473
            +P      +K EK+  + G L+     SKKRS SQPR S+ 
Sbjct  335  SPTT----TKAEKSGKILGFLTSGGGGSKKRSTSQPRGSLT  371



>ref|XP_010440039.1| PREDICTED: microtubule-associated protein 70-5 [Camelina sativa]
Length=513

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 125/156 (80%), Gaps = 9/156 (6%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGG AAN +RDYRRQIS++ +E+RTLERELARVKVSA+RVA  VANEWKDEND+VMP
Sbjct  215  AILAGGTAANAVRDYRRQISQLNDEKRTLERELARVKVSASRVALAVANEWKDENDRVMP  274

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VK+WLEERR+L  EMQ+LKDKLA+SERTAKAE+QLK++LKLRLKT+E GLK T    V+P
Sbjct  275  VKKWLEERRLLHGEMQKLKDKLAVSERTAKAESQLKERLKLRLKTIEDGLKGTNTFLVSP  334

Query  372  KVLSGFSKPEKANHLFGILS----SKKRSASQPRAS  467
                  +K EK+  + G L+    SKK S SQPR S
Sbjct  335  T-----TKTEKSGKILGFLTSGGGSKKWSNSQPRGS  365



>ref|XP_006600289.1| PREDICTED: microtubule-associated protein 70-5-like [Glycine 
max]
Length=571

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 129/159 (81%), Gaps = 3/159 (2%)
 Frame = +3

Query  15   ILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMPV  194
            ILA GA AN +RD +RQISE+QEE+RTLERELARVKVSANR+A +VANEWKDENDKVMPV
Sbjct  228  ILASGATANAVRDCQRQISELQEEKRTLERELARVKVSANRIANVVANEWKDENDKVMPV  287

Query  195  KQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNPK  374
            +QWLEERRI+Q E+Q+LKDKLAISERTA+AE+QLKDKLKLRL+TLE+GLK   +  +   
Sbjct  288  RQWLEERRIMQGEIQQLKDKLAISERTARAESQLKDKLKLRLRTLEEGLKHFSSYPITLN  347

Query  375  VLSGFSKPEKANHLFGILSS---KKRSASQPRASMVNTT  482
            V     K EK+N L  + ++   +KRS SQPRAS V ++
Sbjct  348  VSYASPKAEKSNILAFLTTNGGLRKRSTSQPRASSVGSS  386



>gb|KHN03540.1| Microtubule-associated protein 70-5 [Glycine soja]
Length=582

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 129/159 (81%), Gaps = 3/159 (2%)
 Frame = +3

Query  15   ILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMPV  194
            ILA GA AN +RD +RQISE+QEE+RTLERELARVKVSANR+A +VANEWKDENDKVMPV
Sbjct  228  ILASGATANAVRDCQRQISELQEEKRTLERELARVKVSANRIANVVANEWKDENDKVMPV  287

Query  195  KQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNPK  374
            +QWLEERRI+Q E+Q+LKDKLAISERTA+AE+QLKDKLKLRL+TLE+GLK   +  +   
Sbjct  288  RQWLEERRIMQGEIQQLKDKLAISERTARAESQLKDKLKLRLRTLEEGLKHFSSYPITLN  347

Query  375  VLSGFSKPEKANHLFGILSS---KKRSASQPRASMVNTT  482
            V     K EK+N L  + ++   +KRS SQPRAS V ++
Sbjct  348  VSYASPKAEKSNILAFLTTNGGLRKRSTSQPRASSVGSS  386



>gb|KFK32193.1| hypothetical protein AALP_AA6G209500 [Arabis alpina]
Length=499

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 122/158 (77%), Gaps = 16/158 (10%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGG AAN +RDYRRQIS++ EE+RTLERELARVKVSA+RVA  VANEWKDEND+VMP
Sbjct  215  AILAGGKAANAVRDYRRQISQLNEEKRTLERELARVKVSASRVALAVANEWKDENDRVMP  274

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERRIL  EMQ+LKDKLA+SERTAKAE QLK++LKLRLKT+E G K  G N    
Sbjct  275  VKQWLEERRILHGEMQKLKDKLAVSERTAKAETQLKERLKLRLKTIEDGFK--GQNT---  329

Query  372  KVLSGFSKPEKANHLFGILS-----SKKRSASQPRASM  470
                  +K EK+  + G L+     SKKRS SQPR  +
Sbjct  330  ------TKNEKSGKILGFLTSGGGGSKKRSTSQPRGRI  361



>ref|XP_008785643.1| PREDICTED: microtubule-associated protein 70-4-like [Phoenix 
dactylifera]
Length=646

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 126/158 (80%), Gaps = 15/158 (9%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            +ILAGGAAAN +RDY+R+++E+ EE+RTLERELAR +VSANRVAT+VANEWKD+NDKVMP
Sbjct  227  SILAGGAAANAVRDYQRRVAELNEEKRTLERELARARVSANRVATVVANEWKDDNDKVMP  286

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNV--  365
            VKQWL+ERR LQ E+QRL+DK+A++ERT+KAEAQ+KDKL LRLKTLE+GLKQ  + ++  
Sbjct  287  VKQWLQERRFLQGEIQRLRDKVAVAERTSKAEAQIKDKLNLRLKTLEEGLKQAASLSIKQ  346

Query  366  ---NPKVLSGFSKPEKANHLFGILSSKKRSASQPRASM  470
               + K L G S  E           KKRS SQPRAS+
Sbjct  347  VENSEKKLGGLSNEE----------PKKRSTSQPRASV  374



>ref|XP_010449651.1| PREDICTED: microtubule-associated protein 70-5-like [Camelina 
sativa]
Length=514

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 124/156 (79%), Gaps = 9/156 (6%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGG AAN +RDYRRQIS++ +E+RTLERELARVKVSA+RVA  VANEWKDEND+VMP
Sbjct  215  AILAGGTAANAVRDYRRQISQLNDEKRTLERELARVKVSASRVALAVANEWKDENDRVMP  274

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VK+WLEERR+L  EMQ+LKDKLA+SERTAKAE+QLK++LKLRLKT+E  LK T    V+P
Sbjct  275  VKKWLEERRLLHGEMQKLKDKLAVSERTAKAESQLKERLKLRLKTIEDSLKGTNTFLVSP  334

Query  372  KVLSGFSKPEKANHLFGILS----SKKRSASQPRAS  467
                  +K EK+  + G L+    SKK S SQPR S
Sbjct  335  T-----TKTEKSGKILGFLTSGGGSKKWSNSQPRGS  365



>ref|XP_002868078.1| atmap70-5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44337.1| atmap70-5 [Arabidopsis lyrata subsp. lyrata]
Length=510

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 121/151 (80%), Gaps = 9/151 (6%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGG AAN +RDYRRQIS++ EE+RTLERELARVKVSA+RVA  VANEWKDEND+VMP
Sbjct  215  AILAGGTAANAVRDYRRQISQLNEEKRTLERELARVKVSASRVALAVANEWKDENDRVMP  274

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERRIL  EMQ+LKDKL++SERTAKAE+QLK++LKLRLKT+E GLK      V+P
Sbjct  275  VKQWLEERRILHGEMQKLKDKLSVSERTAKAESQLKERLKLRLKTIEDGLKGPNTCKVSP  334

Query  372  KVLSGFSKPEKANHLFGILS----SKKRSAS  452
                  +K EK+  + G L+    SKKRS S
Sbjct  335  -----TTKTEKSGKILGFLTSGGGSKKRSTS  360



>ref|XP_010087647.1| hypothetical protein L484_010598 [Morus notabilis]
 gb|EXB29540.1| hypothetical protein L484_010598 [Morus notabilis]
Length=548

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 97/123 (79%), Gaps = 4/123 (3%)
 Frame = +3

Query  120  KVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlk  299
            KVSA R+AT+VANEWKDENDKVMPVKQWLEERR++QAEMQRL+DKL +SERTAKAEAQLK
Sbjct  248  KVSATRIATVVANEWKDENDKVMPVKQWLEERRLMQAEMQRLRDKLTVSERTAKAEAQLK  307

Query  300  dklklrlktlEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILSS----KKRSASQPRAS  467
            +K KLRLKTLE GLK   + + N     G  K EK++++ G L+S    +KRS SQPR S
Sbjct  308  EKFKLRLKTLEDGLKDVSSFSNNTSAFCGSPKTEKSSNILGFLTSTGGLRKRSTSQPRGS  367

Query  468  MVN  476
             ++
Sbjct  368  TLS  370



>emb|CAB10503.1| myosin II heavy chain like protein [Arabidopsis thaliana]
Length=550

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 125/164 (76%), Gaps = 15/164 (9%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqise--iqeerrtlerelarVKVSANRVATIVANEWKDENDKV  185
            AILAGG AAN +RDYRRQIS+    +E+RTLERELARVKVSA+RVA  VANEWKDEND+V
Sbjct  215  AILAGGTAANAVRDYRRQISQLNASDEKRTLERELARVKVSASRVALAVANEWKDENDRV  274

Query  186  MPVKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlk----dklklrlktlEQGLKQTG  353
            MPVKQWLEERRIL  EMQ+LKDKLA+SERTAKAE+QLK    ++LKLRLKT+E GLK   
Sbjct  275  MPVKQWLEERRILHGEMQKLKDKLAVSERTAKAESQLKVIAYERLKLRLKTIEDGLKGPN  334

Query  354  NNNVNPKVLSGFSKPEKANHLFGILS----SKKRSASQPRASMV  473
               V+P      +K EK+  + G L+    SKKRS+SQ R S+ 
Sbjct  335  TFFVSPT-----TKTEKSGKILGFLTSGGGSKKRSSSQLRGSVT  373



>emb|CAB78725.1| putative protein [Arabidopsis thaliana]
Length=515

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 125/164 (76%), Gaps = 15/164 (9%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqise--iqeerrtlerelarVKVSANRVATIVANEWKDENDKV  185
            AILAGG AAN +RDYRRQIS+    +E+RTLERELARVKVSA+RVA  VANEWKDEND+V
Sbjct  215  AILAGGTAANAVRDYRRQISQLNASDEKRTLERELARVKVSASRVALAVANEWKDENDRV  274

Query  186  MPVKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlk----dklklrlktlEQGLKQTG  353
            MPVKQWLEERRIL  EMQ+LKDKLA+SERTAKAE+QLK    ++LKLRLKT+E GLK   
Sbjct  275  MPVKQWLEERRILHGEMQKLKDKLAVSERTAKAESQLKVIAYERLKLRLKTIEDGLKGPN  334

Query  354  NNNVNPKVLSGFSKPEKANHLFGILS----SKKRSASQPRASMV  473
               V+P      +K EK+  + G L+    SKKRS+SQ R S+ 
Sbjct  335  TFFVSPT-----TKTEKSGKILGFLTSGGGSKKRSSSQLRGSVT  373



>emb|CDX90483.1| BnaA03g42980D [Brassica napus]
Length=503

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 126/160 (79%), Gaps = 9/160 (6%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGG AAN +RDYRRQIS++  ++RTLERELARVKVSA+RVA  VANEWKDEND+VMP
Sbjct  216  AILAGGTAANAVRDYRRQISQLNAKKRTLERELARVKVSASRVALAVANEWKDENDRVMP  275

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR+L  EMQ+LKDKLA+SERTAKAE+QLK++LKLRLKT+E GLK + N     
Sbjct  276  VKQWLEERRLLHGEMQKLKDKLAVSERTAKAESQLKERLKLRLKTIEDGLKSSQNTFSMS  335

Query  372  KVLSGFSKPEKANHLFGILS------SKKRSASQPRASMV  473
            +     +K EK+  + G L+      SKKRS+SQPR S+ 
Sbjct  336  QT---TTKTEKSGKILGFLTSGGGGGSKKRSSSQPRGSIT  372



>ref|XP_010939242.1| PREDICTED: microtubule-associated protein 70-4-like isoform X2 
[Elaeis guineensis]
 ref|XP_010939243.1| PREDICTED: microtubule-associated protein 70-4-like isoform X2 
[Elaeis guineensis]
Length=596

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 124/156 (79%), Gaps = 11/156 (7%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            +ILAGGAAAN +RDY+RQ++E+ EE+RTLERE+AR  VSANRVAT+VANEWKD+NDKVMP
Sbjct  174  SILAGGAAANAVRDYQRQVAELNEEKRTLEREVARASVSANRVATVVANEWKDDNDKVMP  233

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWL+ER+ L  E+QRL+DK+ ++ERTAKAEAQLKDKL LRL+TLE+GLKQ  + ++  
Sbjct  234  VKQWLQERKFLLGEIQRLRDKVTVAERTAKAEAQLKDKLNLRLRTLEEGLKQAASLSIK-  292

Query  372  KVLSGFSKPEKANHLFGILSS---KKRSASQPRASM  470
                   + EK+    G  S+   K+RS SQPRAS+
Sbjct  293  -------QVEKSEKKIGCSSNEEPKRRSTSQPRASV  321



>ref|XP_010939241.1| PREDICTED: microtubule-associated protein 70-4-like isoform X1 
[Elaeis guineensis]
Length=649

 Score =   133 bits (335),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 124/156 (79%), Gaps = 11/156 (7%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            +ILAGGAAAN +RDY+RQ++E+ EE+RTLERE+AR  VSANRVAT+VANEWKD+NDKVMP
Sbjct  227  SILAGGAAANAVRDYQRQVAELNEEKRTLEREVARASVSANRVATVVANEWKDDNDKVMP  286

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWL+ER+ L  E+QRL+DK+ ++ERTAKAEAQLKDKL LRL+TLE+GLKQ  + ++  
Sbjct  287  VKQWLQERKFLLGEIQRLRDKVTVAERTAKAEAQLKDKLNLRLRTLEEGLKQAASLSIK-  345

Query  372  KVLSGFSKPEKANHLFGILSS---KKRSASQPRASM  470
                   + EK+    G  S+   K+RS SQPRAS+
Sbjct  346  -------QVEKSEKKIGCSSNEEPKRRSTSQPRASV  374



>ref|XP_009136832.1| PREDICTED: microtubule-associated protein 70-5-like [Brassica 
rapa]
Length=495

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 127/160 (79%), Gaps = 9/160 (6%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGG AAN +RDYRRQIS++ EE+RTLERELARVKVSA+RVA  VANEWKD+ND+VMP
Sbjct  208  AILAGGTAANAVRDYRRQISQLNEEKRTLERELARVKVSASRVALAVANEWKDDNDRVMP  267

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR+L  EMQ+LKDKLA+SERTAKAE+QLK++LKLRLKT+E GLK + N     
Sbjct  268  VKQWLEERRLLHGEMQKLKDKLAVSERTAKAESQLKERLKLRLKTIEDGLKSSQNTFSMS  327

Query  372  KVLSGFSKPEKANHLFGILS------SKKRSASQPRASMV  473
            +     +K EK+  + G L+      SKKRS+SQPR S+ 
Sbjct  328  QT---TTKTEKSGKILGFLTSGGGGGSKKRSSSQPRGSIT  364



>emb|CDX81676.1| BnaC08g39250D [Brassica napus]
Length=592

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+ LERELAR KV+ANRVAT+VANEWKD ND+VMP
Sbjct  256  AVLAGGAAANVVRDYQRKFQEMNEERKVLERELARAKVNANRVATVVANEWKDSNDQVMP  315

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            V+QWLEERR LQ EMQ+L+DKLAI++R AK+EAQLK+K  LRL+ LE+ LK+  +N   P
Sbjct  316  VRQWLEERRFLQGEMQQLRDKLAIADRAAKSEAQLKEKFLLRLRVLEESLKRPTSNRGTP  375

Query  372  KVLSGFSKPEKANHLFGILSSKKRSA  449
             V S  + P +   L G  +S K S+
Sbjct  376  VVRSSSNGPSRRQSLGGTETSPKYSS  401



>ref|XP_004170227.1| PREDICTED: microtubule-associated protein 70-1-like isoform 2 
[Cucumis sativus]
Length=610

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 113/140 (81%), Gaps = 2/140 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  260  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVAVVVANEWKDANDKVMP  319

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQT--GNNNV  365
            VKQWLEERR LQ EMQ+L+DKLAI+ERTAK+EAQLK+K +LRL+ LE+ L+ +  GNN  
Sbjct  320  VKQWLEERRFLQGEMQQLRDKLAITERTAKSEAQLKEKYQLRLRVLEESLRGSSGGNNRS  379

Query  366  NPKVLSGFSKPEKANHLFGI  425
             P+  S  + P +   L G+
Sbjct  380  TPEGRSISNGPSRRQSLGGV  399



>ref|XP_004142301.1| PREDICTED: LOW QUALITY PROTEIN: microtubule-associated protein 
70-1-like [Cucumis sativus]
Length=615

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 113/140 (81%), Gaps = 2/140 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  265  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVAVVVANEWKDANDKVMP  324

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQT--GNNNV  365
            VKQWLEERR LQ EMQ+L+DKLAI+ERTAK+EAQLK+K +LRL+ LE+ L+ +  GNN  
Sbjct  325  VKQWLEERRFLQGEMQQLRDKLAITERTAKSEAQLKEKYQLRLRVLEESLRGSSGGNNRS  384

Query  366  NPKVLSGFSKPEKANHLFGI  425
             P+  S  + P +   L G+
Sbjct  385  TPEGRSISNGPSRRQSLGGV  404



>ref|XP_004170226.1| PREDICTED: microtubule-associated protein 70-1-like isoform 1 
[Cucumis sativus]
Length=619

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 113/140 (81%), Gaps = 2/140 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  281  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVAVVVANEWKDANDKVMP  340

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQT--GNNNV  365
            VKQWLEERR LQ EMQ+L+DKLAI+ERTAK+EAQLK+K +LRL+ LE+ L+ +  GNN  
Sbjct  341  VKQWLEERRFLQGEMQQLRDKLAITERTAKSEAQLKEKYQLRLRVLEESLRGSSGGNNRS  400

Query  366  NPKVLSGFSKPEKANHLFGI  425
             P+  S  + P +   L G+
Sbjct  401  TPEGRSISNGPSRRQSLGGV  420



>ref|XP_008452405.1| PREDICTED: microtubule-associated protein 70-1 [Cucumis melo]
Length=633

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 113/140 (81%), Gaps = 2/140 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  283  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVAVVVANEWKDANDKVMP  342

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQT--GNNNV  365
            VKQWLEERR LQ EMQ+L+DKLAI+ERTAK+EAQLK+K +LRL+ LE+ L+ +  GNN  
Sbjct  343  VKQWLEERRFLQGEMQQLRDKLAITERTAKSEAQLKEKYQLRLRVLEESLRGSSGGNNRS  402

Query  366  NPKVLSGFSKPEKANHLFGI  425
             P+  S  + P +   L G+
Sbjct  403  TPEGRSISNGPSRRQSLGGV  422



>gb|KGN49724.1| hypothetical protein Csa_5G083860 [Cucumis sativus]
Length=631

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 113/140 (81%), Gaps = 2/140 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  281  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVAVVVANEWKDANDKVMP  340

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQT--GNNNV  365
            VKQWLEERR LQ EMQ+L+DKLAI+ERTAK+EAQLK+K +LRL+ LE+ L+ +  GNN  
Sbjct  341  VKQWLEERRFLQGEMQQLRDKLAITERTAKSEAQLKEKYQLRLRVLEESLRGSSGGNNRS  400

Query  366  NPKVLSGFSKPEKANHLFGI  425
             P+  S  + P +   L G+
Sbjct  401  TPEGRSISNGPSRRQSLGGV  420



>emb|CDY51769.1| BnaC05g49520D [Brassica napus]
Length=602

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 120/168 (71%), Gaps = 12/168 (7%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+ LERELAR KV+ANRVAT+VANEWKD ND+VMP
Sbjct  258  AVLAGGAAANAVRDYQRKFQEMNEERKILERELARAKVNANRVATVVANEWKDSNDQVMP  317

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            V+QWLEERR +Q EMQ+L+DKLAI++R AK+EAQLK+K  LRL+ LE+ LK+  N    P
Sbjct  318  VRQWLEERRFMQGEMQQLRDKLAIADRAAKSEAQLKEKFLLRLRVLEESLKKPSNRGT-P  376

Query  372  KVLSGFSKPEKANHLFGILSS-----------KKRSASQPRASMVNTT  482
             V S  + P +   L G  +S           K R +SQPR++  + +
Sbjct  377  VVRSSSNGPTRRQSLVGAETSPKYSSSNGSVTKSRPSSQPRSATASAS  424



>ref|XP_010936411.1| PREDICTED: microtubule-associated protein 70-4-like [Elaeis guineensis]
Length=607

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 123/156 (79%), Gaps = 11/156 (7%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            +IL+GGAAAN +RDYRRQ++E+ EE++TLERELAR KVSANRVAT+VANEWK ++DKVMP
Sbjct  227  SILSGGAAANAVRDYRRQVAELNEEKKTLERELARAKVSANRVATVVANEWKGDSDKVMP  286

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERRILQ E+QRL+DK+A++ERTAKAEAQLKDKL LRLKTLE+GLKQ       P
Sbjct  287  VKQWLEERRILQGEIQRLRDKVAVAERTAKAEAQLKDKLNLRLKTLEEGLKQA------P  340

Query  372  KVLSGFSKPEKANHLFGILSS---KKRSASQPRASM  470
             +     + E +   FG  S+   KK S S  RAS+
Sbjct  341  SL--SIKQVENSEKKFGCSSNDEPKKGSTSHARASV  374



>ref|XP_009390353.1| PREDICTED: microtubule-associated protein 70-1-like [Musa acuminata 
subsp. malaccensis]
Length=621

 Score =   130 bits (327),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 127/172 (74%), Gaps = 20/172 (12%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EE +TL+REL+R KV+ANRVA +VANEWKD NDKVMP
Sbjct  278  AVLAGGAAANAVRDYQRKVQEMSEEMKTLDRELSRAKVTANRVAVVVANEWKDANDKVMP  337

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQ--TGNNNV  365
            VKQWLEERR +Q EMQ+L+DKLAISERTA++EAQLK+K  LRLK LE GL+   +G N +
Sbjct  338  VKQWLEERRFMQGEMQQLRDKLAISERTARSEAQLKEKFHLRLKVLEDGLRMSASGTNRI  397

Query  366  NPK---VLSGFSK----------PEKANHLFGILSSKKRSASQPRASMVNTT  482
            N +   V +G S+          P+ AN   G LS  +R + Q R+S+ ++T
Sbjct  398  NVEGKNVSNGPSRRQSLGGADNIPKSAN---GFLS--RRPSFQMRSSISSST  444



>ref|XP_002284904.1| PREDICTED: microtubule-associated protein 70-2 [Vitis vinifera]
 emb|CBI26828.3| unnamed protein product [Vitis vinifera]
Length=637

 Score =   130 bits (327),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 112/139 (81%), Gaps = 2/139 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  287  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVAVVVANEWKDANDKVMP  346

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNN--V  365
            VKQWLEERR LQ EMQ+L+DKLAI+ERTAK+EAQLK+K  LRLK +E+ L+ + N+N   
Sbjct  347  VKQWLEERRFLQGEMQQLRDKLAITERTAKSEAQLKEKYHLRLKVIEESLRGSSNSNNRS  406

Query  366  NPKVLSGFSKPEKANHLFG  422
             P+V S  + P +   L G
Sbjct  407  TPEVRSVSNGPSRRQSLGG  425



>ref|XP_002311531.1| hypothetical protein POPTR_0008s13450g [Populus trichocarpa]
 gb|EEE88898.1| hypothetical protein POPTR_0008s13450g [Populus trichocarpa]
Length=619

 Score =   130 bits (326),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  273  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  332

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNN  362
            VKQWLEERR LQ EMQ+L+DKLAI+ERTAK+EAQLK+K +LRLK LE+ L+ + +NN
Sbjct  333  VKQWLEERRFLQGEMQQLRDKLAITERTAKSEAQLKEKYQLRLKVLEESLRGSSSNN  389



>ref|XP_008790325.1| PREDICTED: microtubule-associated protein 70-4-like [Phoenix 
dactylifera]
Length=611

 Score =   130 bits (326),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 120/155 (77%), Gaps = 11/155 (7%)
 Frame = +3

Query  15   ILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMPV  194
            ILAGGAAAN +RDY+RQ++E+   ++TLERELAR KVSANRVAT+VANEWKD N KVMPV
Sbjct  228  ILAGGAAANAVRDYQRQVAELYVRKKTLERELARAKVSANRVATVVANEWKDGNGKVMPV  287

Query  195  KQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNPK  374
            KQWLEERR LQ EMQRL+DK+A++ERTAKAEAQLKDKL LRLKTLE+GLKQ    +++PK
Sbjct  288  KQWLEERRFLQGEMQRLRDKVAVAERTAKAEAQLKDKLNLRLKTLEEGLKQAP--SLSPK  345

Query  375  VLSGFSKPEKANHLFGILSS---KKRSASQPRASM  470
             +      E +   FG  S+   +KR     RAS+
Sbjct  346  QV------ENSKKKFGCSSNEEPEKRPTFHSRASV  374



>gb|AAO72686.1| putative myosin heavy chain [Oryza sativa Japonica Group]
Length=455

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 118/154 (77%), Gaps = 3/154 (2%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KVSANRVA +VANEWKD NDKVMP
Sbjct  245  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVSANRVAVVVANEWKDGNDKVMP  304

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQ-TGNNNVN  368
            VKQWLEERRILQ EMQ+L+DKLAI+ER A++EAQLKDK +LRLK LE+GL+  T   NV+
Sbjct  305  VKQWLEERRILQGEMQQLRDKLAIAERAARSEAQLKDKFQLRLKVLEEGLRMSTTRTNVS  364

Query  369  PKVLSGFSKPEKANHLFGILSSKKRSASQPRASM  470
                      +  +   G LS  KR + Q R+S+
Sbjct  365  AARRQSIGGADSLSKTNGFLS--KRPSFQMRSSV  396



>ref|XP_011024158.1| PREDICTED: microtubule-associated protein 70-2-like [Populus 
euphratica]
 ref|XP_011024166.1| PREDICTED: microtubule-associated protein 70-2-like [Populus 
euphratica]
Length=619

 Score =   130 bits (326),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  273  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  332

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNN  362
            VKQWLEERR LQ EMQ+L+DKLAI+ERTAK+EAQLK+K +LRLK LE+ L+ + +NN
Sbjct  333  VKQWLEERRFLQGEMQQLRDKLAITERTAKSEAQLKEKYQLRLKVLEESLRGSSSNN  389



>ref|XP_003575438.1| PREDICTED: microtubule-associated protein 70-1 [Brachypodium 
distachyon]
Length=576

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 117/158 (74%), Gaps = 3/158 (2%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EE +TL+RELAR KVSANRVA +VANEWKD NDKVMP
Sbjct  249  AVLAGGAAANAVRDYQRKVQEMNEEMKTLDRELARAKVSANRVAVVVANEWKDGNDKVMP  308

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQ-TGNNNVN  368
            VKQWLEERRILQ EMQ+L+D+LAI+ER A++EAQLKDK +LRLK LE+GL+  T   N +
Sbjct  309  VKQWLEERRILQGEMQQLRDRLAIAERAARSEAQLKDKFQLRLKVLEEGLRMPTSRTNAS  368

Query  369  PKVLSGFSKPEKANHLFGILSSKKRSASQPRASMVNTT  482
                      E  +   G LS  KR + Q R+ +  TT
Sbjct  369  AARRQSIGGAESVSKTNGFLS--KRPSFQMRSPVSTTT  404



>emb|CDY45293.1| BnaA06g09630D [Brassica napus]
Length=601

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 113/147 (77%), Gaps = 1/147 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+ LERELAR KV+ANRVAT+VANEWKD ND+VMP
Sbjct  257  AVLAGGAAANAVRDYQRKFQEMNEERKILERELARAKVNANRVATVVANEWKDSNDQVMP  316

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            V+QWLEERR +Q EMQ+L+DKLAI++R AK+EAQLK+K  LRL+ LE+ LK+  N    P
Sbjct  317  VRQWLEERRFMQGEMQQLRDKLAIADRAAKSEAQLKEKFLLRLRVLEESLKKPSNRGT-P  375

Query  372  KVLSGFSKPEKANHLFGILSSKKRSAS  452
             V S  + P +   L G  +S K S+S
Sbjct  376  GVRSSSNGPTRRQSLVGAETSPKYSSS  402



>ref|XP_009148871.1| PREDICTED: microtubule-associated protein 70-4 [Brassica rapa]
Length=601

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 113/147 (77%), Gaps = 1/147 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+ LERELAR KV+ANRVAT+VANEWKD ND+VMP
Sbjct  257  AVLAGGAAANAVRDYQRKFQEMNEERKILERELARAKVNANRVATVVANEWKDSNDQVMP  316

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            V+QWLEERR +Q EMQ+L+DKLAI++R AK+EAQLK+K  LRL+ LE+ LK+  N    P
Sbjct  317  VRQWLEERRFMQGEMQQLRDKLAIADRAAKSEAQLKEKFLLRLRVLEESLKKPSNRGT-P  375

Query  372  KVLSGFSKPEKANHLFGILSSKKRSAS  452
             V S  + P +   L G  +S K S+S
Sbjct  376  GVRSSSNGPTRRQSLVGAETSPKYSSS  402



>gb|EEC69752.1| hypothetical protein OsI_39288 [Oryza sativa Indica Group]
Length=535

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 118/154 (77%), Gaps = 3/154 (2%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KVSANRVA +VANEWKD NDKVMP
Sbjct  245  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVSANRVAVVVANEWKDGNDKVMP  304

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQ-TGNNNVN  368
            VKQWLEERRILQ EMQ+L+DKLAI+ER A++EAQLKDK +LRLK LE+GL+  T   NV+
Sbjct  305  VKQWLEERRILQGEMQQLRDKLAIAERAARSEAQLKDKFQLRLKVLEEGLRMSTTRTNVS  364

Query  369  PKVLSGFSKPEKANHLFGILSSKKRSASQPRASM  470
                      +  +   G LS  KR + Q R+S+
Sbjct  365  AARRQSIGGADSLSKTNGFLS--KRPSFQMRSSV  396



>gb|ACO87662.1| myosin heavy chain [Brachypodium sylvaticum]
Length=576

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 117/158 (74%), Gaps = 3/158 (2%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EE +TL+RELAR KVSANRVA +VANEWKD NDKVMP
Sbjct  249  AVLAGGAAANAVRDYQRKVLEMNEEMKTLDRELARAKVSANRVAVVVANEWKDGNDKVMP  308

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQ-TGNNNVN  368
            VKQWLEERRILQ EMQ+L+D+LAI+ER A++EAQLKDK +LRLK LE+GL+  T   N +
Sbjct  309  VKQWLEERRILQGEMQQLRDRLAIAERAARSEAQLKDKFQLRLKVLEEGLRMPTSRTNAS  368

Query  369  PKVLSGFSKPEKANHLFGILSSKKRSASQPRASMVNTT  482
                      E  +   G LS  KR + Q R+ +  TT
Sbjct  369  AARRQSIGGAESVSKTNGFLS--KRPSFQMRSPVSTTT  404



>ref|NP_001067398.1| Os12g0640900 [Oryza sativa Japonica Group]
 sp|Q2QLI6.1|MP701_ORYSJ RecName: Full=Microtubule-associated protein 70-1; Short=AtMAP70-1; 
AltName: Full=70 kDa microtubule-associated protein 1 
[Oryza sativa Japonica Group]
 gb|ABA99627.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF30417.1| Os12g0640900 [Oryza sativa Japonica Group]
 dbj|BAG90086.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53684.1| hypothetical protein OsJ_37030 [Oryza sativa Japonica Group]
Length=567

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 118/154 (77%), Gaps = 3/154 (2%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KVSANRVA +VANEWKD NDKVMP
Sbjct  245  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVSANRVAVVVANEWKDGNDKVMP  304

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQ-TGNNNVN  368
            VKQWLEERRILQ EMQ+L+DKLAI+ER A++EAQLKDK +LRLK LE+GL+  T   NV+
Sbjct  305  VKQWLEERRILQGEMQQLRDKLAIAERAARSEAQLKDKFQLRLKVLEEGLRMSTTRTNVS  364

Query  369  PKVLSGFSKPEKANHLFGILSSKKRSASQPRASM  470
                      +  +   G LS  KR + Q R+S+
Sbjct  365  AARRQSIGGADSLSKTNGFLS--KRPSFQMRSSV  396



>emb|CDY42967.1| BnaA01g17870D [Brassica napus]
Length=500

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 116/164 (71%), Gaps = 25/164 (15%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGG AAN             EE+RTLERELARVKVSA+RVA  VANEWKDEND+VMP
Sbjct  215  AILAGGTAANA------------EEKRTLERELARVKVSASRVALAVANEWKDENDRVMP  262

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQl----kdklklrlktlEQGLKQTGNN  359
            VKQWLEERR+L  EMQ+LKDKLA+SERTAKAE+QL    +++LKLRLKT+E GLK     
Sbjct  263  VKQWLEERRLLHGEMQKLKDKLAVSERTAKAESQLNNLIQERLKLRLKTVEDGLKSPNMF  322

Query  360  NVNPKVLSGFSKPEKANHLFGILS-----SKKRSASQPRASMVN  476
             V+P      +K EK+  + G L+     SKKRS SQPR S+ +
Sbjct  323  TVSPTT----TKAEKSGKILGFLTSGGGGSKKRSTSQPRGSITS  362



>ref|XP_006832841.1| hypothetical protein AMTR_s00095p00043050 [Amborella trichopoda]
 gb|ERM98119.1| hypothetical protein AMTR_s00095p00043050 [Amborella trichopoda]
Length=592

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EE++ L+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  252  AVLAGGAAANAVRDYQRKFMEMNEEKKILDRELARTKVTANRVAVVVANEWKDANDKVMP  311

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            V+QWLEERR LQ EMQ+L+DKLAI+ERTAK+EAQLK++  LRLK LE GLK + + ++ P
Sbjct  312  VRQWLEERRFLQGEMQQLRDKLAIAERTAKSEAQLKERYHLRLKVLEDGLKASPSGHIRP  371



>tpg|DAA54806.1| TPA: hypothetical protein ZEAMMB73_048261 [Zea mays]
Length=372

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 122/161 (76%), Gaps = 9/161 (6%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            ++LAGGAAAN +RDY+R++ E+ EE +TL+RELAR KVSANRVA +VANEWKD +DKVMP
Sbjct  57   SVLAGGAAANAVRDYQRKVQEMNEEMKTLDRELARAKVSANRVAVVVANEWKDGDDKVMP  116

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLK-QTGNNNVN  368
            VK+WLEERRILQ EMQ+L+DKLAI+ER A++EAQLK+K +LRLK LE+GL+  T   NV+
Sbjct  117  VKRWLEERRILQGEMQQLRDKLAIAERAARSEAQLKEKFQLRLKVLEEGLRMSTSRTNVS  176

Query  369  P---KVLSGFSKPEKANHLFGILSSKKRSASQPRASMVNTT  482
                + + G     KAN   G LS  KR + Q R+ +  TT
Sbjct  177  GTRRQSIGGADGLSKAN---GFLS--KRPSFQMRSPVSTTT  212



>gb|KJB60886.1| hypothetical protein B456_009G329800 [Gossypium raimondii]
Length=497

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KVSANRVAT+VANEWKD NDKVMP
Sbjct  159  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVSANRVATVVANEWKDANDKVMP  218

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEERR LQ EMQ+L+DKLAI+ERTAK+EAQ
Sbjct  219  VKQWLEERRCLQGEMQQLRDKLAITERTAKSEAQ  252



>tpg|DAA54805.1| TPA: hypothetical protein ZEAMMB73_048261 [Zea mays]
Length=383

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 122/161 (76%), Gaps = 9/161 (6%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            ++LAGGAAAN +RDY+R++ E+ EE +TL+RELAR KVSANRVA +VANEWKD +DKVMP
Sbjct  57   SVLAGGAAANAVRDYQRKVQEMNEEMKTLDRELARAKVSANRVAVVVANEWKDGDDKVMP  116

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLK-QTGNNNVN  368
            VK+WLEERRILQ EMQ+L+DKLAI+ER A++EAQLK+K +LRLK LE+GL+  T   NV+
Sbjct  117  VKRWLEERRILQGEMQQLRDKLAIAERAARSEAQLKEKFQLRLKVLEEGLRMSTSRTNVS  176

Query  369  P---KVLSGFSKPEKANHLFGILSSKKRSASQPRASMVNTT  482
                + + G     KAN   G LS  KR + Q R+ +  TT
Sbjct  177  GTRRQSIGGADGLSKAN---GFLS--KRPSFQMRSPVSTTT  212



>ref|XP_002522178.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40219.1| conserved hypothetical protein [Ricinus communis]
Length=513

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EE++TLERE+AR KVSANRVAT+VANEWKD NDKVMP
Sbjct  278  AVLAGGAAANAVRDYQRKVQEMNEEKKTLEREVARAKVSANRVATVVANEWKDGNDKVMP  337

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNN  362
            VKQWLEERR  Q EMQ+LKDKLA++ERTAKAEAQ+K+K +LR K LE+ L+ +  N+
Sbjct  338  VKQWLEERRFFQGEMQQLKDKLAVAERTAKAEAQMKEKYQLRFKVLEERLRASNGNS  394



>gb|EMT16813.1| hypothetical protein F775_18335 [Aegilops tauschii]
Length=556

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 114/151 (75%), Gaps = 3/151 (2%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EE +TL+RELAR KVSANRVA +VANEWKD NDKVMP
Sbjct  222  AVLAGGAAANAVRDYQRKVQEMNEEMKTLDRELARAKVSANRVAVVVANEWKDGNDKVMP  281

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQ-TGNNNVN  368
            VKQWLEERR+LQ EMQ+L+DKLAI+ER A++EAQLKDK +LRLK LE+GL+  T   N +
Sbjct  282  VKQWLEERRLLQGEMQQLRDKLAIAERAARSEAQLKDKFQLRLKVLEEGLRMSTSRTNAS  341

Query  369  PKVLSGFSKPEKANHLFGILSSKKRSASQPR  461
                      E A+   G LS  KR + Q R
Sbjct  342  AARRQSIGGAESASKTNGFLS--KRPSFQMR  370



>ref|XP_004963351.1| PREDICTED: microtubule-associated protein 70-1-like [Setaria 
italica]
Length=729

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 123/161 (76%), Gaps = 9/161 (6%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EE +TL+RELAR KVSANRVA +VANEWKD NDKVMP
Sbjct  403  AVLAGGAAANAVRDYQRKVQEMNEEMKTLDRELARAKVSANRVAVVVANEWKDGNDKVMP  462

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLK-QTGNNNVN  368
            VKQWL++RRILQ EMQ+L+DKLAI+ER A++EAQLK+K +LRLK LE+GL+  T   NV+
Sbjct  463  VKQWLDQRRILQGEMQQLRDKLAIAERAARSEAQLKEKFQLRLKVLEEGLRMSTSRTNVS  522

Query  369  P---KVLSGFSKPEKANHLFGILSSKKRSASQPRASMVNTT  482
                + + G     KAN   G LS  KR + Q R+S+  TT
Sbjct  523  TTRRQSIGGADGLSKAN---GFLS--KRPSFQMRSSVSTTT  558



>ref|XP_006664255.1| PREDICTED: microtubule-associated protein 70-1-like [Oryza brachyantha]
Length=575

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 118/154 (77%), Gaps = 3/154 (2%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KVSANRVA +VANEWKD NDKVMP
Sbjct  248  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVSANRVAVVVANEWKDGNDKVMP  307

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQ-TGNNNVN  368
            VKQWLEERRILQ EMQ+L+DKL+I+ER A++EAQLKDK +LRLK LE+GL+  T   NVN
Sbjct  308  VKQWLEERRILQGEMQQLRDKLSIAERAARSEAQLKDKFQLRLKVLEEGLRMSTTRTNVN  367

Query  369  PKVLSGFSKPEKANHLFGILSSKKRSASQPRASM  470
                      +  +   G L+  KR + Q R+S+
Sbjct  368  TARRQSIGGADSLSKTNGFLA--KRPSFQMRSSV  399



>ref|XP_008675942.1| PREDICTED: LOW QUALITY PROTEIN: microtubule-associated protein 
70-1-like, partial [Zea mays]
Length=406

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 122/161 (76%), Gaps = 9/161 (6%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            ++LAGGAAAN +RDY+R++ E+ EE +TL+RELAR KVSANRVA +VANEWKD +DKVMP
Sbjct  80   SVLAGGAAANAVRDYQRKVQEMNEEMKTLDRELARAKVSANRVAVVVANEWKDGDDKVMP  139

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLK-QTGNNNVN  368
            VK+WLEERRILQ EMQ+L+DKLAI+ER A++EAQLK+K +LRLK LE+GL+  T   NV+
Sbjct  140  VKRWLEERRILQGEMQQLRDKLAIAERAARSEAQLKEKFQLRLKVLEEGLRMSTSRTNVS  199

Query  369  P---KVLSGFSKPEKANHLFGILSSKKRSASQPRASMVNTT  482
                + + G     KAN   G LS  KR + Q R+ +  TT
Sbjct  200  GTRRQSIGGADGLSKAN---GFLS--KRPSFQMRSPVSTTT  235



>ref|XP_009109861.1| PREDICTED: microtubule-associated protein 70-2 isoform X2 [Brassica 
rapa]
Length=594

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 125/170 (74%), Gaps = 13/170 (8%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY R+  E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  275  AVLAGGAAANAVRDYERKFQEMNEERKTLDRELARAKVTANRVATVVANEWKDGNDKVMP  334

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNV--  365
            VKQWLEERR LQ EMQ+L+DKLAI++R AK+EAQLK+K +LRLK LE+ LK T ++++  
Sbjct  335  VKQWLEERRFLQGEMQQLRDKLAITDRAAKSEAQLKEKFQLRLKVLEETLKGTSSSSIRN  394

Query  366  NPKVLSGFSKPEKANHLFGILS----------SKKRSASQPRASM-VNTT  482
              +  +  S+P +   L G  +          SKK  ASQ R S+ +N+T
Sbjct  395  TSETRTMSSEPSRRQSLGGSENLQKIPANGALSKKAPASQMRHSLSINST  444



>ref|XP_011027239.1| PREDICTED: microtubule-associated protein 70-1-like [Populus 
euphratica]
Length=622

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 110/138 (80%), Gaps = 1/138 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EE++TLERE+AR KVSANRVAT+VANEWKD NDKVMP
Sbjct  277  AVLAGGAAANAVRDYQRKVQEMNEEKKTLEREVARAKVSANRVATVVANEWKDGNDKVMP  336

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQT-GNNNVN  368
            VKQWLEERR  Q EMQ+L+DKLA++ER AKAEAQLKDK +LR K LE+ LK + GN+   
Sbjct  337  VKQWLEERRFFQGEMQQLRDKLAVAERAAKAEAQLKDKYQLRFKVLEERLKASNGNSRAT  396

Query  369  PKVLSGFSKPEKANHLFG  422
            P+  +  + P +   L G
Sbjct  397  PEGRNTSNGPSRRQSLSG  414



>ref|XP_002307974.2| hypothetical protein POPTR_0006s03740g [Populus trichocarpa]
 gb|EEE91497.2| hypothetical protein POPTR_0006s03740g [Populus trichocarpa]
Length=622

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 110/138 (80%), Gaps = 1/138 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EE++TLERE+AR KVSANRVAT+VANEWKD NDKVMP
Sbjct  277  AVLAGGAAANAVRDYQRKVQEMNEEKKTLEREVARAKVSANRVATVVANEWKDGNDKVMP  336

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQT-GNNNVN  368
            VKQWLEERR  Q EMQ+L+DKLA++ER AKAEAQLKDK +LR K LE+ LK + GN+   
Sbjct  337  VKQWLEERRFFQGEMQQLRDKLAVAERAAKAEAQLKDKYQLRFKVLEERLKASNGNSRAT  396

Query  369  PKVLSGFSKPEKANHLFG  422
            P+  +  + P +   L G
Sbjct  397  PEGKNTSNGPSRRQSLGG  414



>gb|KDP38119.1| hypothetical protein JCGZ_04762 [Jatropha curcas]
Length=625

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  276  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  335

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNN  362
            VKQWLEERR LQ EMQ+L+DKLAI+ERTAK+EAQLK+K +LRLK LE+ L+ + ++N
Sbjct  336  VKQWLEERRFLQGEMQQLRDKLAITERTAKSEAQLKEKYQLRLKVLEESLRGSSSSN  392



>gb|KJB60887.1| hypothetical protein B456_009G329800 [Gossypium raimondii]
Length=554

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KVSANRVAT+VANEWKD NDKVMP
Sbjct  281  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVSANRVATVVANEWKDANDKVMP  340

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEERR LQ EMQ+L+DKLAI+ERTAK+EAQ
Sbjct  341  VKQWLEERRCLQGEMQQLRDKLAITERTAKSEAQ  374



>ref|XP_009109859.1| PREDICTED: microtubule-associated protein 70-2 isoform X1 [Brassica 
rapa]
 ref|XP_009109860.1| PREDICTED: microtubule-associated protein 70-2 isoform X1 [Brassica 
rapa]
Length=611

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 125/170 (74%), Gaps = 13/170 (8%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY R+  E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  275  AVLAGGAAANAVRDYERKFQEMNEERKTLDRELARAKVTANRVATVVANEWKDGNDKVMP  334

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNV--  365
            VKQWLEERR LQ EMQ+L+DKLAI++R AK+EAQLK+K +LRLK LE+ LK T ++++  
Sbjct  335  VKQWLEERRFLQGEMQQLRDKLAITDRAAKSEAQLKEKFQLRLKVLEETLKGTSSSSIRN  394

Query  366  NPKVLSGFSKPEKANHLFGILS----------SKKRSASQPRASM-VNTT  482
              +  +  S+P +   L G  +          SKK  ASQ R S+ +N+T
Sbjct  395  TSETRTMSSEPSRRQSLGGSENLQKIPANGALSKKAPASQMRHSLSINST  444



>ref|XP_010932544.1| PREDICTED: microtubule-associated protein 70-2-like isoform X3 
[Elaeis guineensis]
Length=611

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 111/139 (80%), Gaps = 2/139 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGAAAN +RDY+R+  E+ EER+ L+RELAR K++ANRVA +VANEWKD NDKVMP
Sbjct  272  AILAGGAAANAVRDYQRKFQEMNEERKILDRELARAKITANRVAVVVANEWKDANDKVMP  331

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQ--TGNNNV  365
            V+QWLEERR +Q EMQ+L+DKLAI+ERTA++EAQLK+K +LRL+ LE+GL+   +G+N  
Sbjct  332  VRQWLEERRFMQGEMQQLRDKLAIAERTARSEAQLKEKFQLRLRVLEEGLRMSSSGSNRT  391

Query  366  NPKVLSGFSKPEKANHLFG  422
            N +  S  + P +   L G
Sbjct  392  NVEGKSASNGPSRRQSLGG  410



>gb|KJB60884.1| hypothetical protein B456_009G329800 [Gossypium raimondii]
 gb|KJB60885.1| hypothetical protein B456_009G329800 [Gossypium raimondii]
 gb|KJB60889.1| hypothetical protein B456_009G329800 [Gossypium raimondii]
Length=619

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KVSANRVAT+VANEWKD NDKVMP
Sbjct  281  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVSANRVATVVANEWKDANDKVMP  340

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEERR LQ EMQ+L+DKLAI+ERTAK+EAQ
Sbjct  341  VKQWLEERRCLQGEMQQLRDKLAITERTAKSEAQ  374



>emb|CDP16283.1| unnamed protein product [Coffea canephora]
Length=627

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  280  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  339

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEERR LQ EMQ+L+DKLAISERTAK+EAQ
Sbjct  340  VKQWLEERRFLQGEMQQLRDKLAISERTAKSEAQ  373



>ref|XP_006415832.1| hypothetical protein EUTSA_v10007068mg [Eutrema salsugineum]
 gb|ESQ34185.1| hypothetical protein EUTSA_v10007068mg [Eutrema salsugineum]
Length=628

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 124/170 (73%), Gaps = 13/170 (8%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  278  AVLAGGAAANAVRDYQRKFQEMNEERKTLDRELARAKVTANRVATVVANEWKDGNDKVMP  337

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNV--  365
            VKQWLEERR LQ EMQ+L+DKLAI++R AK+EAQLK+K +LRLK LE+ L+ T N++   
Sbjct  338  VKQWLEERRFLQGEMQQLRDKLAITDRAAKSEAQLKEKFQLRLKVLEETLRGTSNSSTRN  397

Query  366  NPKVLSGFSKPEKANHLFGILS----------SKKRSASQPRASM-VNTT  482
              +  S  + P +   L G  S          SKK  ASQ R S+ +N+T
Sbjct  398  TSETRSMSNGPSRRQSLGGADSLQKFPSNGSFSKKAPASQMRHSLSINST  447



>emb|CDY01879.1| BnaC06g29190D [Brassica napus]
Length=624

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 112/139 (81%), Gaps = 2/139 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  273  AVLAGGAAANAVRDYQRKFQEMNEERKTLDRELARAKVTANRVATVVANEWKDGNDKVMP  332

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNV--  365
            VKQWLEERR LQ EMQ+L+DKLAIS+R AK+EAQLK+K +LRLK LE+ L+ T +++V  
Sbjct  333  VKQWLEERRFLQGEMQQLRDKLAISDRAAKSEAQLKEKFQLRLKVLEETLRGTSSSSVRN  392

Query  366  NPKVLSGFSKPEKANHLFG  422
             P+  S  + P +   L G
Sbjct  393  TPEGRSMSNGPSRRQSLCG  411



>ref|XP_010932545.1| PREDICTED: microtubule-associated protein 70-2-like isoform X4 
[Elaeis guineensis]
 ref|XP_010932546.1| PREDICTED: microtubule-associated protein 70-2-like isoform X4 
[Elaeis guineensis]
 ref|XP_010932547.1| PREDICTED: microtubule-associated protein 70-2-like isoform X4 
[Elaeis guineensis]
Length=610

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 111/139 (80%), Gaps = 2/139 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGAAAN +RDY+R+  E+ EER+ L+RELAR K++ANRVA +VANEWKD NDKVMP
Sbjct  272  AILAGGAAANAVRDYQRKFQEMNEERKILDRELARAKITANRVAVVVANEWKDANDKVMP  331

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQ--TGNNNV  365
            V+QWLEERR +Q EMQ+L+DKLAI+ERTA++EAQLK+K +LRL+ LE+GL+   +G+N  
Sbjct  332  VRQWLEERRFMQGEMQQLRDKLAIAERTARSEAQLKEKFQLRLRVLEEGLRMSSSGSNRT  391

Query  366  NPKVLSGFSKPEKANHLFG  422
            N +  S  + P +   L G
Sbjct  392  NVEGKSASNGPSRRQSLGG  410



>ref|XP_010926101.1| PREDICTED: microtubule-associated protein 70-1-like [Elaeis guineensis]
Length=626

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 112/139 (81%), Gaps = 2/139 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EE +TL+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  279  AVLAGGAAANVVRDYQRKVQEMNEEMKTLDRELARAKVTANRVAVVVANEWKDANDKVMP  338

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQT--GNNNV  365
            V+QWLEERR LQ EMQ+L+DKLAI+ERTA++EAQLK+K +LRLK LE+GL+ +  G+N  
Sbjct  339  VRQWLEERRFLQGEMQQLRDKLAIAERTARSEAQLKEKYQLRLKVLEEGLRMSANGSNRT  398

Query  366  NPKVLSGFSKPEKANHLFG  422
            N +  S  + P +   L G
Sbjct  399  NVEGRSVSNGPSRRQSLGG  417



>ref|XP_010932543.1| PREDICTED: microtubule-associated protein 70-2-like isoform X2 
[Elaeis guineensis]
Length=620

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 111/139 (80%), Gaps = 2/139 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGAAAN +RDY+R+  E+ EER+ L+RELAR K++ANRVA +VANEWKD NDKVMP
Sbjct  272  AILAGGAAANAVRDYQRKFQEMNEERKILDRELARAKITANRVAVVVANEWKDANDKVMP  331

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQ--TGNNNV  365
            V+QWLEERR +Q EMQ+L+DKLAI+ERTA++EAQLK+K +LRL+ LE+GL+   +G+N  
Sbjct  332  VRQWLEERRFMQGEMQQLRDKLAIAERTARSEAQLKEKFQLRLRVLEEGLRMSSSGSNRT  391

Query  366  NPKVLSGFSKPEKANHLFG  422
            N +  S  + P +   L G
Sbjct  392  NVEGKSASNGPSRRQSLGG  410



>ref|XP_003532520.1| PREDICTED: microtubule-associated protein 70-2-like [Glycine 
max]
Length=616

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+TL+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  267  AVLAGGAAANAVRDYQRKFQEMNEERKTLDRELARAKVTANRVAVVVANEWKDANDKVMP  326

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNN  359
            VKQWLEERR LQ EMQ+L+DKLAI+ERTAK+EAQLK+K +LRLK L++ L++T N+
Sbjct  327  VKQWLEERRFLQGEMQQLRDKLAITERTAKSEAQLKEKYQLRLKVLQESLRETSNS  382



>emb|CDY09638.1| BnaC07g34230D [Brassica napus]
Length=503

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGG AAN +RDYRRQIS++  ++RTLERELARVKVSA+RVA  VANEWKDEND+VMP
Sbjct  216  AILAGGTAANAVRDYRRQISQLNAKKRTLERELARVKVSASRVALAVANEWKDENDRVMP  275

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGN  356
            VKQWLEERR+L  EMQ+LKDKL +SERTAKAE+QLK++LKLRLKT+E GLK + N
Sbjct  276  VKQWLEERRLLHGEMQKLKDKLGVSERTAKAESQLKERLKLRLKTIEDGLKSSPN  330



>gb|KJB60888.1| hypothetical protein B456_009G329800 [Gossypium raimondii]
Length=615

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KVSANRVAT+VANEWKD NDKVMP
Sbjct  281  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVSANRVATVVANEWKDANDKVMP  340

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEERR LQ EMQ+L+DKLAI+ERTAK+EAQ
Sbjct  341  VKQWLEERRCLQGEMQQLRDKLAITERTAKSEAQ  374



>ref|XP_007160432.1| hypothetical protein PHAVU_002G321500g [Phaseolus vulgaris]
 gb|ESW32426.1| hypothetical protein PHAVU_002G321500g [Phaseolus vulgaris]
Length=616

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  267  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVAVVVANEWKDANDKVMP  326

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNN  359
            VKQWLEERR LQ EMQ+L+DKLAI+ERTAK+EAQLK+K +LRLK L++ L++T N+
Sbjct  327  VKQWLEERRFLQGEMQQLRDKLAITERTAKSEAQLKEKYQLRLKVLQESLRETSNS  382



>ref|XP_002890697.1| At1g68060/T23K23_9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66956.1| At1g68060/T23K23_9 [Arabidopsis lyrata subsp. lyrata]
Length=634

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 125/170 (74%), Gaps = 13/170 (8%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  283  AVLAGGAAANAVRDYQRKFQEMNEERKTLDRELARAKVTANRVATVVANEWKDGNDKVMP  342

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNV--  365
            VKQWLEERR LQ EMQ+L+DKLAI++R AK+EAQLK+K +LRLK LE+ L+ T +++   
Sbjct  343  VKQWLEERRFLQGEMQQLRDKLAITDRAAKSEAQLKEKFQLRLKVLEETLRGTSSSSTRN  402

Query  366  NPKVLSGFSKPEKANHLFGILS----------SKKRSASQPRASM-VNTT  482
             P+  S  + P +   L G  +          SKK  ASQ R S+ +N+T
Sbjct  403  TPEARSMSNGPSRRQSLGGAENLQKFPSNGALSKKAPASQMRHSLSINST  452



>gb|KDO60765.1| hypothetical protein CISIN_1g007087mg [Citrus sinensis]
Length=544

 Score =   127 bits (318),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  204  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  263

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNN  362
            VKQWLEERR LQ EMQ+L+D+LAI+ERTAK+EAQLK+K  LRLK LE+ L+ + N +
Sbjct  264  VKQWLEERRFLQGEMQQLRDRLAITERTAKSEAQLKEKYHLRLKVLEESLRGSSNGS  320



>gb|KJB50389.1| hypothetical protein B456_008G168300 [Gossypium raimondii]
Length=621

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  281  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDSNDKVMP  340

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEERR LQ EMQ+L+DKLAI+ERTAK+EAQ
Sbjct  341  VKQWLEERRFLQGEMQQLRDKLAITERTAKSEAQ  374



>ref|XP_010055945.1| PREDICTED: microtubule-associated protein 70-1-like [Eucalyptus 
grandis]
 gb|KCW90036.1| hypothetical protein EUGRSUZ_A02239 [Eucalyptus grandis]
Length=612

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TLERE+AR KVSANRVAT+VANEWKD NDKVMP
Sbjct  273  AVLAGGAAANAVRDYQRRVQEMNEERKTLEREVARAKVSANRVATVVANEWKDGNDKVMP  332

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNN  359
            VKQWLEERR  Q EMQ+L+DKLA++ERTAKAEAQLK+K +LR K LE+ LK +  N
Sbjct  333  VKQWLEERRFFQGEMQQLRDKLAVAERTAKAEAQLKEKYQLRFKVLEEKLKGSNGN  388



>gb|KJB50391.1| hypothetical protein B456_008G168300 [Gossypium raimondii]
Length=565

 Score =   127 bits (318),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  281  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDSNDKVMP  340

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEERR LQ EMQ+L+DKLAI+ERTAK+EAQ
Sbjct  341  VKQWLEERRFLQGEMQQLRDKLAITERTAKSEAQ  374



>ref|XP_010932540.1| PREDICTED: microtubule-associated protein 70-2-like isoform X1 
[Elaeis guineensis]
 ref|XP_010932541.1| PREDICTED: microtubule-associated protein 70-2-like isoform X1 
[Elaeis guineensis]
Length=644

 Score =   127 bits (320),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 111/139 (80%), Gaps = 2/139 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGGAAAN +RDY+R+  E+ EER+ L+RELAR K++ANRVA +VANEWKD NDKVMP
Sbjct  272  AILAGGAAANAVRDYQRKFQEMNEERKILDRELARAKITANRVAVVVANEWKDANDKVMP  331

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLK--QTGNNNV  365
            V+QWLEERR +Q EMQ+L+DKLAI+ERTA++EAQLK+K +LRL+ LE+GL+   +G+N  
Sbjct  332  VRQWLEERRFMQGEMQQLRDKLAIAERTARSEAQLKEKFQLRLRVLEEGLRMSSSGSNRT  391

Query  366  NPKVLSGFSKPEKANHLFG  422
            N +  S  + P +   L G
Sbjct  392  NVEGKSASNGPSRRQSLGG  410



>emb|CDY33736.1| BnaA09g45420D [Brassica napus]
Length=605

 Score =   127 bits (319),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 115/148 (78%), Gaps = 2/148 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+ LERELAR KV+ANRVAT+VANEWKD ND+VMP
Sbjct  260  AVLAGGAAANAVRDYQRKFQEMNEERKILERELARAKVNANRVATVVANEWKDSNDQVMP  319

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQ-TGNNNV-  365
            V+QWL+ERR LQ EMQ+L+DKL+IS+R AK+EAQLK+K  LRL+ LE+ LK+ T N+N  
Sbjct  320  VRQWLDERRFLQGEMQQLRDKLSISDRAAKSEAQLKEKFLLRLRVLEESLKRPTSNSNRG  379

Query  366  NPKVLSGFSKPEKANHLFGILSSKKRSA  449
             P V S  + P +   L G  +S K S+
Sbjct  380  TPGVRSSSNGPSRRQSLGGTETSPKYSS  407



>gb|KHG19724.1| Uncharacterized protein F383_26314 [Gossypium arboreum]
Length=621

 Score =   127 bits (319),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  281  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDSNDKVMP  340

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEERR LQ EMQ+L+DKLAI+ERTAK+EAQ
Sbjct  341  VKQWLEERRFLQGEMQQLRDKLAITERTAKSEAQ  374



>gb|KHN21612.1| Microtubule-associated protein 70-2 [Glycine soja]
Length=609

 Score =   127 bits (319),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  260  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVAVVVANEWKDANDKVMP  319

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNN  359
            VKQWLEERR LQ EMQ+L+DKLAI+ERTAK+EAQLK+K +LRLK L+  L++T N+
Sbjct  320  VKQWLEERRFLQGEMQQLRDKLAITERTAKSEAQLKEKYQLRLKVLQDSLRETSNS  375



>ref|XP_010695899.1| PREDICTED: microtubule-associated protein 70-2-like [Beta vulgaris 
subsp. vulgaris]
Length=635

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  289  AVLAGGAAANAVRDYQRKMQEMNEERKTLDRELARAKVTANRVATVVANEWKDSNDKVMP  348

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNN  362
            VKQWLEERR LQ EMQ+L+DKLAI+ER AK EAQLK+K +LRLK LE+ L+ T  N+
Sbjct  349  VKQWLEERRCLQGEMQQLRDKLAITERAAKTEAQLKEKFQLRLKVLEENLRGTSTNS  405



>gb|KJB50390.1| hypothetical protein B456_008G168300 [Gossypium raimondii]
Length=621

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  281  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDSNDKVMP  340

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEERR LQ EMQ+L+DKLAI+ERTAK+EAQ
Sbjct  341  VKQWLEERRFLQGEMQQLRDKLAITERTAKSEAQ  374



>gb|KHG10997.1| Microtubule-associated 70-4 -like protein [Gossypium arboreum]
Length=619

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KVSANRVAT+VANEWKD NDKVMP
Sbjct  281  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVSANRVATVVANEWKDANDKVMP  340

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEERR LQ EMQ+L+DKLA++ERTAK+EAQ
Sbjct  341  VKQWLEERRCLQGEMQQLRDKLAVTERTAKSEAQ  374



>ref|XP_010916223.1| PREDICTED: microtubule-associated protein 70-1-like isoform X2 
[Elaeis guineensis]
Length=626

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 111/139 (80%), Gaps = 2/139 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ +E +TL+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  279  AVLAGGAAANAVRDYQRKVQEMNDEMKTLDRELARAKVTANRVAVVVANEWKDANDKVMP  338

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQT--GNNNV  365
            V+QWLEERR +Q EMQ+L+DKLAI+ERTA++EAQLK+K +LRLK LE+GL+ +  G N  
Sbjct  339  VRQWLEERRFMQGEMQQLRDKLAIAERTARSEAQLKEKYQLRLKVLEEGLRMSANGGNRT  398

Query  366  NPKVLSGFSKPEKANHLFG  422
            N +  S  + P +   L G
Sbjct  399  NAEGRSVSNGPSRRQSLGG  417



>ref|XP_003525226.1| PREDICTED: microtubule-associated protein 70-2-like [Glycine 
max]
Length=616

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  267  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVAVVVANEWKDANDKVMP  326

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNN  359
            VKQWLEERR LQ EMQ+L+DKLAI+ERTAK+EAQLK+K +LRLK L+  L++T N+
Sbjct  327  VKQWLEERRFLQGEMQQLRDKLAITERTAKSEAQLKEKYQLRLKVLQDSLRETSNS  382



>ref|XP_010916224.1| PREDICTED: microtubule-associated protein 70-1-like isoform X3 
[Elaeis guineensis]
Length=621

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 111/139 (80%), Gaps = 2/139 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ +E +TL+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  279  AVLAGGAAANAVRDYQRKVQEMNDEMKTLDRELARAKVTANRVAVVVANEWKDANDKVMP  338

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQT--GNNNV  365
            V+QWLEERR +Q EMQ+L+DKLAI+ERTA++EAQLK+K +LRLK LE+GL+ +  G N  
Sbjct  339  VRQWLEERRFMQGEMQQLRDKLAIAERTARSEAQLKEKYQLRLKVLEEGLRMSANGGNRT  398

Query  366  NPKVLSGFSKPEKANHLFG  422
            N +  S  + P +   L G
Sbjct  399  NAEGRSVSNGPSRRQSLGG  417



>ref|XP_004157994.1| PREDICTED: microtubule-associated protein 70-2-like [Cucumis 
sativus]
Length=574

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 106/122 (87%), Gaps = 3/122 (2%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EERRTLERE+AR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  233  AVLAGGAAANAVRDYQRKVQEMSEERRTLEREVARAKVTANRVATVVANEWKDANDKVMP  292

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR  Q EMQ+L++KLA++ERTAKAEAQ+K+K +LR K LE+ L+   ++N NP
Sbjct  293  VKQWLEERRFFQGEMQQLREKLAVAERTAKAEAQMKEKYQLRFKVLEEKLR---SSNGNP  349

Query  372  KV  377
            K+
Sbjct  350  KL  351



>ref|XP_006343174.1| PREDICTED: microtubule-associated protein 70-2-like isoform X2 
[Solanum tuberosum]
Length=622

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  276  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  335

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEA  290
            VKQWLEERRILQ EMQ+L+DKLAI+ERTAK+EA
Sbjct  336  VKQWLEERRILQGEMQQLRDKLAITERTAKSEA  368



>ref|XP_009149575.1| PREDICTED: microtubule-associated protein 70-4-like [Brassica 
rapa]
Length=601

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 115/148 (78%), Gaps = 2/148 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+ LERELAR KV+ANRVAT+VANEWKD ND+VMP
Sbjct  256  AVLAGGAAANAVRDYQRKFQEMNEERKILERELARAKVNANRVATVVANEWKDSNDQVMP  315

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQ-TGNNN-V  365
            V+QWL+ERR LQ EMQ+L+DKL+IS+R AK+EAQLK+K  LRL+ LE+ LK+ T N+N  
Sbjct  316  VRQWLDERRFLQGEMQQLRDKLSISDRAAKSEAQLKEKFLLRLRVLEESLKRPTSNSNRG  375

Query  366  NPKVLSGFSKPEKANHLFGILSSKKRSA  449
             P V S  + P +   L G  +S K S+
Sbjct  376  TPGVRSSSNGPSRRQSLGGTETSPKYSS  403



>ref|XP_010916222.1| PREDICTED: microtubule-associated protein 70-1-like isoform X1 
[Elaeis guineensis]
Length=627

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 111/139 (80%), Gaps = 2/139 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ +E +TL+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  279  AVLAGGAAANAVRDYQRKVQEMNDEMKTLDRELARAKVTANRVAVVVANEWKDANDKVMP  338

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQT--GNNNV  365
            V+QWLEERR +Q EMQ+L+DKLAI+ERTA++EAQLK+K +LRLK LE+GL+ +  G N  
Sbjct  339  VRQWLEERRFMQGEMQQLRDKLAIAERTARSEAQLKEKYQLRLKVLEEGLRMSANGGNRT  398

Query  366  NPKVLSGFSKPEKANHLFG  422
            N +  S  + P +   L G
Sbjct  399  NAEGRSVSNGPSRRQSLGG  417



>ref|XP_009117870.1| PREDICTED: microtubule-associated protein 70-4-like [Brassica 
rapa]
Length=601

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 115/148 (78%), Gaps = 2/148 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+ LERELAR KV+ANRVAT+VANEWKD ND+VMP
Sbjct  256  AVLAGGAAANAVRDYQRKFQEMNEERKILERELARAKVNANRVATVVANEWKDSNDQVMP  315

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQ-TGNNN-V  365
            V+QWL+ERR LQ EMQ+L+DKLAI++R AK+EAQLK+K  LRL+ LE+ LK+ T N+N  
Sbjct  316  VRQWLDERRFLQGEMQQLRDKLAIADRAAKSEAQLKEKFLLRLRVLEESLKRPTSNSNRG  375

Query  366  NPKVLSGFSKPEKANHLFGILSSKKRSA  449
             P V S  + P +   L G  +S K S+
Sbjct  376  TPGVRSSSNGPSRRQSLGGTETSPKYSS  403



>emb|CAJ31079.1| 70 kDa microtubule associated protein Type 2 [Arabidopsis thaliana]
Length=607

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 124/170 (73%), Gaps = 13/170 (8%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  283  AVLAGGAAANAVRDYQRKFQEMNEERKTLDRELARAKVTANRVATVVANEWKDGNDKVMP  342

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNV--  365
            VKQWLEERR LQ EMQ+L+DKLAI++R AK+EAQLK+K +LRLK LE+ L+ T ++    
Sbjct  343  VKQWLEERRFLQGEMQQLRDKLAITDRAAKSEAQLKEKFQLRLKVLEETLRGTSSSATRN  402

Query  366  NPKVLSGFSKPEKANHLFGILS----------SKKRSASQPRASM-VNTT  482
             P+  S  + P +   L G  +          SKK  ASQ R S+ +N+T
Sbjct  403  TPEARSMSNGPSRRQSLGGAENLQKFTSNGALSKKAPASQMRHSLSINST  452



>ref|XP_002525998.1| Myosin heavy chain, clone, putative [Ricinus communis]
 gb|EEF36422.1| Myosin heavy chain, clone, putative [Ricinus communis]
Length=614

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 120/164 (73%), Gaps = 11/164 (7%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  278  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  337

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVN-  368
            VKQWLEERR LQ EMQ+L+DKLAI+ER AK+EAQLK+K  LRLK LE+ L+ + +N  + 
Sbjct  338  VKQWLEERRFLQGEMQQLRDKLAITERAAKSEAQLKEKYHLRLKVLEESLRGSSSNTRSM  397

Query  369  PKVLSGFSKPEKANHLFGI----------LSSKKRSASQPRASM  470
            P+  S  + P +   L G             SK+   SQ R+S+
Sbjct  398  PEGRSTSNGPSRRQSLGGADNFSKFTSNGFLSKRTPTSQLRSSL  441



>ref|XP_008455712.1| PREDICTED: microtubule-associated protein 70-2-like [Cucumis 
melo]
Length=612

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 106/122 (87%), Gaps = 3/122 (2%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EERRTLERE+AR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  271  AVLAGGAAANAVRDYQRKVQEMSEERRTLEREVARAKVTANRVATVVANEWKDANDKVMP  330

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR  Q EMQ+L++KLA++ERTAKAEAQ+K+K +LR K LE+ L+   ++N NP
Sbjct  331  VKQWLEERRFFQGEMQQLREKLAVAERTAKAEAQMKEKYQLRFKVLEEKLR---SSNGNP  387

Query  372  KV  377
            K+
Sbjct  388  KL  389



>gb|KJB15337.1| hypothetical protein B456_002G171800 [Gossypium raimondii]
Length=518

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  178  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  237

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEERR LQ EMQ+L+DKLAI++RTAK+EAQ
Sbjct  238  VKQWLEERRFLQGEMQQLRDKLAITDRTAKSEAQ  271



>ref|NP_173873.5| microtubule-associated protein 70-2 [Arabidopsis thaliana]
 sp|Q8L7S4.1|MP702_ARATH RecName: Full=Microtubule-associated protein 70-2; Short=AtMAP70-2; 
AltName: Full=70 kDa microtubule-associated protein 2 
[Arabidopsis thaliana]
 gb|AAM91095.1| At1g68060/T23K23_9 [Arabidopsis thaliana]
 gb|AAN33201.1| At1g68060/T23K23_9 [Arabidopsis thaliana]
 gb|AEE30561.1| microtubule-associated protein 70-2 [Arabidopsis thaliana]
Length=634

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 124/170 (73%), Gaps = 13/170 (8%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  283  AVLAGGAAANAVRDYQRKFQEMNEERKTLDRELARAKVTANRVATVVANEWKDGNDKVMP  342

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNV--  365
            VKQWLEERR LQ EMQ+L+DKLAI++R AK+EAQLK+K +LRLK LE+ L+ T ++    
Sbjct  343  VKQWLEERRFLQGEMQQLRDKLAITDRAAKSEAQLKEKFQLRLKVLEETLRGTSSSATRN  402

Query  366  NPKVLSGFSKPEKANHLFGILS----------SKKRSASQPRASM-VNTT  482
             P+  S  + P +   L G  +          SKK  ASQ R S+ +N+T
Sbjct  403  TPEARSMSNGPSRRQSLGGAENLQKFTSNGALSKKAPASQMRHSLSINST  452



>dbj|BAK06943.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=576

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 114/151 (75%), Gaps = 3/151 (2%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN ++DY+R++ E+ EE +TL+RELAR KVSANRVA +VANEWKD NDKVMP
Sbjct  251  AVLAGGAAANAVKDYQRKVQEMNEEMKTLDRELARAKVSANRVAVVVANEWKDGNDKVMP  310

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQ-TGNNNVN  368
            VKQWLEERR+LQ EMQ+L+DKLAI+ER A++EAQLKDK +LRLK LE+GL+  T   N +
Sbjct  311  VKQWLEERRLLQGEMQQLRDKLAIAERAARSEAQLKDKFQLRLKVLEEGLRMSTSRTNAS  370

Query  369  PKVLSGFSKPEKANHLFGILSSKKRSASQPR  461
                      E A+   G LS  KR + Q R
Sbjct  371  AARRQSIGGAESASKTNGFLS--KRPSFQMR  399



>ref|XP_004239261.1| PREDICTED: microtubule-associated protein 70-1 [Solanum lycopersicum]
Length=622

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  276  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  335

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEA  290
            VKQWLEERRILQ EMQ+L+DKLAI+ERTAK+EA
Sbjct  336  VKQWLEERRILQGEMQQLRDKLAITERTAKSEA  368



>ref|XP_004144334.1| PREDICTED: microtubule-associated protein 70-2-like [Cucumis 
sativus]
Length=612

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 106/122 (87%), Gaps = 3/122 (2%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EERRTLERE+AR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  271  AVLAGGAAANAVRDYQRKVQEMSEERRTLEREVARAKVTANRVATVVANEWKDANDKVMP  330

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR  Q EMQ+L++KLA++ERTAKAEAQ+K+K +LR K LE+ L+   ++N NP
Sbjct  331  VKQWLEERRFFQGEMQQLREKLAVAERTAKAEAQMKEKYQLRFKVLEEKLR---SSNGNP  387

Query  372  KV  377
            K+
Sbjct  388  KL  389



>ref|XP_006343175.1| PREDICTED: microtubule-associated protein 70-2-like isoform X3 
[Solanum tuberosum]
Length=619

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  276  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  335

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEA  290
            VKQWLEERRILQ EMQ+L+DKLAI+ERTAK+EA
Sbjct  336  VKQWLEERRILQGEMQQLRDKLAITERTAKSEA  368



>ref|XP_006391189.1| hypothetical protein EUTSA_v10018271mg [Eutrema salsugineum]
 gb|ESQ28475.1| hypothetical protein EUTSA_v10018271mg [Eutrema salsugineum]
Length=630

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 112/139 (81%), Gaps = 2/139 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  280  AVLAGGAAANAVRDYQRKFQEMNEERKTLDRELARAKVTANRVATVVANEWKDGNDKVMP  339

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNV--  365
            VKQWLEERR LQ EMQ+L+DKLAIS+R AK+EAQLKD+ +LRLK LE+ L+ T +++V  
Sbjct  340  VKQWLEERRFLQGEMQQLRDKLAISDRAAKSEAQLKDRFQLRLKVLEETLRGTSSSSVRN  399

Query  366  NPKVLSGFSKPEKANHLFG  422
             P+  S  + P +   L G
Sbjct  400  TPEGRSMSNGPSRRQSLGG  418



>ref|XP_010499143.1| PREDICTED: microtubule-associated protein 70-2-like isoform X1 
[Camelina sativa]
 ref|XP_010499145.1| PREDICTED: microtubule-associated protein 70-2-like isoform X2 
[Camelina sativa]
Length=639

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 111/139 (80%), Gaps = 2/139 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  285  AVLAGGAAANAVRDYQRKFQEMNEERKTLDRELARAKVTANRVATVVANEWKDGNDKVMP  344

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNV--  365
            VKQWLEERR LQ EMQ+L+DKLAI++R AK+EAQLK+K +LRL+ LE+ L+ T N++   
Sbjct  345  VKQWLEERRFLQGEMQQLRDKLAITDRAAKSEAQLKEKFQLRLRVLEETLRGTTNSSTRN  404

Query  366  NPKVLSGFSKPEKANHLFG  422
             P+  S  + P +   L G
Sbjct  405  TPEARSMSNGPSRRQSLGG  423



>ref|XP_006306974.1| hypothetical protein CARUB_v10008549mg [Capsella rubella]
 gb|EOA39872.1| hypothetical protein CARUB_v10008549mg [Capsella rubella]
Length=646

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 123/169 (73%), Gaps = 12/169 (7%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  281  AVLAGGAAANAVRDYQRKFQEMNEERKTLDRELARAKVTANRVATVVANEWKDGNDKVMP  340

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVN-  368
            VKQWLEERR LQ EMQ+L+DKLAI++R AK+EAQLK+K +LRLK LE+ L+ T ++  N 
Sbjct  341  VKQWLEERRFLQGEMQQLRDKLAITDRAAKSEAQLKEKFQLRLKVLEETLRGTSSSTRNT  400

Query  369  PKVLSGFSKPEKANHLFGILS----------SKKRSASQPRASM-VNTT  482
            P   S  + P +   L G  +          SKK   SQ R S+ +N+T
Sbjct  401  PDARSMSNGPSRRQSLGGAENLQKFPSNGSLSKKAPTSQMRHSLSINST  449



>ref|XP_009105356.1| PREDICTED: microtubule-associated protein 70-1 [Brassica rapa]
 emb|CDX96050.1| BnaA07g26810D [Brassica napus]
Length=625

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 112/139 (81%), Gaps = 2/139 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  274  AVLAGGAAANAVRDYQRKFQEMNEERKTLDRELARAKVTANRVATVVANEWKDGNDKVMP  333

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNV--  365
            VKQWLEERR LQ EMQ+L+DKLAIS+R AK+EAQLK+K +LRLK LE+ L+ T ++++  
Sbjct  334  VKQWLEERRFLQGEMQQLRDKLAISDRAAKSEAQLKEKFQLRLKVLEETLRGTSSSSIRN  393

Query  366  NPKVLSGFSKPEKANHLFG  422
             P+  S  + P +   L G
Sbjct  394  TPEGRSMSNGPSRRQSLGG  412



>ref|XP_006343173.1| PREDICTED: microtubule-associated protein 70-2-like isoform X1 
[Solanum tuberosum]
Length=651

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  305  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  364

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEA  290
            VKQWLEERRILQ EMQ+L+DKLAI+ERTAK+EA
Sbjct  365  VKQWLEERRILQGEMQQLRDKLAITERTAKSEA  397



>gb|AAG03117.1|AC004133_11 F5A9.19 [Arabidopsis thaliana]
Length=640

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 124/170 (73%), Gaps = 13/170 (8%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  293  AVLAGGAAANAVRDYQRKFQEMNEERKTLDRELARAKVTANRVATVVANEWKDGNDKVMP  352

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNV--  365
            VKQWLEERR LQ EMQ+L+DKLAI++R AK+EAQLK+K +LRLK LE+ L+ T ++    
Sbjct  353  VKQWLEERRFLQGEMQQLRDKLAITDRAAKSEAQLKEKFQLRLKVLEETLRGTSSSATRN  412

Query  366  NPKVLSGFSKPEKANHLFGILS----------SKKRSASQPRASM-VNTT  482
             P+  S  + P +   L G  +          SKK  ASQ R S+ +N+T
Sbjct  413  TPEARSMSNGPSRRQSLGGAENLQKFTSNGALSKKAPASQMRHSLSINST  462



>ref|XP_006469252.1| PREDICTED: microtubule-associated protein 70-2-like [Citrus sinensis]
Length=618

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  278  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  337

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNN  362
            VKQWLEERR LQ EMQ+L+D+LAI+ERTAK+EAQLK+K  LRLK LE+ L+ + N +
Sbjct  338  VKQWLEERRFLQGEMQQLRDRLAITERTAKSEAQLKEKYHLRLKVLEESLRGSSNGS  394



>ref|XP_009768285.1| PREDICTED: microtubule-associated protein 70-2-like [Nicotiana 
sylvestris]
Length=622

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  275  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  334

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEA  290
            VKQWLEERR+LQ EMQ+L+DKLAI+ERTAK+EA
Sbjct  335  VKQWLEERRVLQGEMQQLRDKLAITERTAKSEA  367



>ref|XP_009610620.1| PREDICTED: microtubule-associated protein 70-2-like [Nicotiana 
tomentosiformis]
Length=622

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  275  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  334

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEA  290
            VKQWLEERR+LQ EMQ+L+DKLAI+ERTAK+EA
Sbjct  335  VKQWLEERRVLQGEMQQLRDKLAITERTAKSEA  367



>gb|AET05426.2| microtubule-associated protein 70-1 [Medicago truncatula]
Length=616

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+TL+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  266  AVLAGGAAANAVRDYQRKFQEMNEERKTLDRELARAKVTANRVAVVVANEWKDANDKVMP  325

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNN  359
            VKQWLEERR LQ EMQ+L+DKLAIS+RTAK EAQLK+K +LRLK L++ L++T N+
Sbjct  326  VKQWLEERRFLQGEMQQLRDKLAISDRTAKYEAQLKEKYQLRLKVLQESLRETSNS  381



>gb|KDO60764.1| hypothetical protein CISIN_1g007087mg [Citrus sinensis]
Length=618

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  278  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  337

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNN  362
            VKQWLEERR LQ EMQ+L+D+LAI+ERTAK+EAQLK+K  LRLK LE+ L+ + N +
Sbjct  338  VKQWLEERRFLQGEMQQLRDRLAITERTAKSEAQLKEKYHLRLKVLEESLRGSSNGS  394



>emb|CDY04200.1| BnaC06g26150D [Brassica napus]
Length=617

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+L+GGAAAN +RDY+R+  E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  271  AVLSGGAAANAVRDYQRKFQEMNEERKTLDRELARAKVTANRVATVVANEWKDGNDKVMP  330

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR LQ EMQ+L+DKLAIS+R AK+EAQLKDK +LRLK LE+ L+ T  N    
Sbjct  331  VKQWLEERRFLQGEMQQLRDKLAISDRAAKSEAQLKDKFQLRLKVLEETLRGTSRNTTEG  390

Query  372  KVLS  383
            + +S
Sbjct  391  RSMS  394



>ref|XP_003630950.1| microtubule associated protein Type 2 [Medicago truncatula]
Length=627

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+TL+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  277  AVLAGGAAANAVRDYQRKFQEMNEERKTLDRELARAKVTANRVAVVVANEWKDANDKVMP  336

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNN  359
            VKQWLEERR LQ EMQ+L+DKLAIS+RTAK EAQLK+K +LRLK L++ L++T N+
Sbjct  337  VKQWLEERRFLQGEMQQLRDKLAISDRTAKYEAQLKEKYQLRLKVLQESLRETSNS  392



>ref|XP_006448158.1| hypothetical protein CICLE_v10014625mg [Citrus clementina]
 gb|ESR61398.1| hypothetical protein CICLE_v10014625mg [Citrus clementina]
Length=618

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  278  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  337

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNN  362
            VKQWLEERR LQ EMQ+L+D+LAI+ERTAK+EAQLK+K  LRLK LE+ L+ + N +
Sbjct  338  VKQWLEERRFLQGEMQQLRDRLAITERTAKSEAQLKEKYHLRLKVLEESLRGSSNGS  394



>ref|XP_008781372.1| PREDICTED: microtubule-associated protein 70-1-like [Phoenix 
dactylifera]
Length=625

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 111/139 (80%), Gaps = 2/139 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EE +TL+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  278  AVLAGGAAANAVRDYQRKVQEMNEEMKTLDRELARAKVTANRVAVVVANEWKDANDKVMP  337

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQT--GNNNV  365
            V+QWLEERR +Q EMQ+L+DKLAISER A++EAQLK+K +LR+K LE+GL+ +  G+N  
Sbjct  338  VRQWLEERRFMQGEMQQLRDKLAISERAARSEAQLKEKYQLRIKVLEEGLRMSANGSNRT  397

Query  366  NPKVLSGFSKPEKANHLFG  422
            N +  S  + P +   L G
Sbjct  398  NVEGRSVSNGPSRRQSLGG  416



>emb|CDX84971.1| BnaC05g20840D [Brassica napus]
Length=615

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  275  AVLAGGAAANAVRDYQRKFQEMNEERKTLDRELARAKVTANRVATVVANEWKDGNDKVMP  334

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR LQ EMQ+L+DKLAI++R AK+EAQLK+K +LRLK LE+ L+ T ++   P
Sbjct  335  VKQWLEERRFLQGEMQQLRDKLAITDRAAKSEAQLKEKFQLRLKVLEETLRGTSSSRNTP  394

Query  372  KVLSGFSKPEKANHLFG  422
            +  S  + P       G
Sbjct  395  EARSMSNGPTSRRQSLG  411



>ref|XP_007045277.1| Microtubule-associated proteins 70-2 isoform 3 [Theobroma cacao]
 gb|EOY01109.1| Microtubule-associated proteins 70-2 isoform 3 [Theobroma cacao]
Length=499

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  159  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  218

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEERR LQ EMQ+L+DKLAI+ER AK+EAQ
Sbjct  219  VKQWLEERRFLQGEMQQLRDKLAITERAAKSEAQ  252



>ref|XP_009105067.1| PREDICTED: microtubule-associated protein 70-1-like [Brassica 
rapa]
Length=618

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  271  AVLAGGAAANAVRDYQRKFQEMNEERKTLDRELARAKVTANRVATVVANEWKDGNDKVMP  330

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR LQ EMQ+L+DKLAIS+R AK+EAQLKDK +LRLK LE+ L+ T  N    
Sbjct  331  VKQWLEERRFLQGEMQQLRDKLAISDRAAKSEAQLKDKFQLRLKVLEETLRGTSRNTTEG  390

Query  372  KVLSGFS  392
            + +   S
Sbjct  391  RSMGNGS  397



>ref|XP_006828475.1| hypothetical protein AMTR_s00060p00151140 [Amborella trichopoda]
 gb|ERM95891.1| hypothetical protein AMTR_s00060p00151140 [Amborella trichopoda]
Length=632

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  270  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVAVVVANEWKDANDKVMP  329

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLE+RR +Q EMQ+L+DKLAI+ERTA+ EAQLK+K +LRLK LE  LK +   NV P
Sbjct  330  VKQWLEDRRFMQGEMQQLRDKLAIAERTARYEAQLKEKYQLRLKVLEDSLKASTTGNVRP  389



>emb|CDY07403.1| BnaA07g24820D [Brassica napus]
Length=618

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  271  AVLAGGAAANAVRDYQRKFQEMNEERKTLDRELARAKVTANRVATVVANEWKDGNDKVMP  330

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR LQ EMQ+L+DKLAIS+R AK+EAQLKDK +LRLK LE+ L+ T  N    
Sbjct  331  VKQWLEERRFLQGEMQQLRDKLAISDRAAKSEAQLKDKFQLRLKVLEETLRGTSRNTTEG  390

Query  372  KVLSGFS  392
            + +   S
Sbjct  391  RSMGNGS  397



>ref|XP_009382991.1| PREDICTED: microtubule-associated protein 70-1 [Musa acuminata 
subsp. malaccensis]
Length=617

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 108/139 (78%), Gaps = 2/139 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EE + L+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  274  AVLAGGAAANAVRDYQRKVQEMSEEMKILDRELARAKVTANRVAVVVANEWKDANDKVMP  333

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLK--QTGNNNV  365
            VKQWLEERR +Q EMQ+L+DKLAI+ERTA++EAQLK+K +LRLK LE+GL+   +G N  
Sbjct  334  VKQWLEERRFMQGEMQQLRDKLAIAERTARSEAQLKEKFQLRLKVLEEGLRISASGTNRT  393

Query  366  NPKVLSGFSKPEKANHLFG  422
            +    S  + P     L G
Sbjct  394  SVDGKSTSNSPSGRQSLCG  412



>gb|KJB15336.1| hypothetical protein B456_002G171800 [Gossypium raimondii]
 gb|KJB15338.1| hypothetical protein B456_002G171800 [Gossypium raimondii]
Length=621

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  281  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  340

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEERR LQ EMQ+L+DKLAI++RTAK+EAQ
Sbjct  341  VKQWLEERRFLQGEMQQLRDKLAITDRTAKSEAQ  374



>ref|XP_010271362.1| PREDICTED: microtubule-associated protein 70-2-like [Nelumbo 
nucifera]
Length=673

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  293  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVAVVVANEWKDSNDKVMP  352

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLE+RR LQ EMQ+L+DKLAI+ERTAK+EAQLK+K +LRL+ LE+ L+ + N    P
Sbjct  353  VKQWLEDRRFLQGEMQQLRDKLAIAERTAKSEAQLKEKYQLRLRVLEESLRASSNAGSRP  412



>ref|XP_003553384.1| PREDICTED: microtubule-associated protein 70-2-like [Glycine 
max]
Length=587

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 103/125 (82%), Gaps = 1/125 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ +ER+ LERE+AR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  245  AVLAGGAAANAVRDYQRKVQEMNDERKILEREVARAKVTANRVATVVANEWKDANDKVMP  304

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEER+  Q EMQ+L+DKLAI+ERTAKAEAQ+K+K +LR K LE+ +K T N N   
Sbjct  305  VKQWLEERKFFQGEMQQLRDKLAIAERTAKAEAQMKEKYQLRFKVLEERVK-TSNGNSKF  363

Query  372  KVLSG  386
             V  G
Sbjct  364  TVSDG  368



>ref|XP_006355060.1| PREDICTED: microtubule-associated protein 70-1-like [Solanum 
tuberosum]
Length=617

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 108/138 (78%), Gaps = 1/138 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD +DKVMP
Sbjct  270  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDASDKVMP  329

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNN-NVN  368
            VKQWLEER+ LQ E+Q+L+DKLAISERTAK+EAQLK+K  LRLK LE+ LK T       
Sbjct  330  VKQWLEERKFLQGELQQLRDKLAISERTAKSEAQLKEKYHLRLKVLEETLKSTSTGARTT  389

Query  369  PKVLSGFSKPEKANHLFG  422
            P   S  + P +   L G
Sbjct  390  PDGRSSSNGPSRRRSLGG  407



>ref|XP_008240691.1| PREDICTED: microtubule-associated protein 70-2-like [Prunus mume]
Length=610

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EE++ LERE+AR KVSANRVAT+VANEWKD +DKVMP
Sbjct  268  AVLAGGAAANAVRDYQRKVQEMNEEKKLLEREVARAKVSANRVATVVANEWKDSSDKVMP  327

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEERR  Q EMQ+L+DKLA++ERTAKAEAQ
Sbjct  328  VKQWLEERRFFQGEMQQLRDKLAVAERTAKAEAQ  361



>ref|XP_007045279.1| Microtubule-associated proteins 70-2 isoform 5 [Theobroma cacao]
 gb|EOY01111.1| Microtubule-associated proteins 70-2 isoform 5 [Theobroma cacao]
Length=520

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  178  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  237

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEERR LQ EMQ+L+DKLAI+ER AK+EAQ
Sbjct  238  VKQWLEERRFLQGEMQQLRDKLAITERAAKSEAQ  271



>ref|XP_003627322.1| microtubule associated protein Type 2 [Medicago truncatula]
 gb|AET01798.1| microtubule-associated protein 70-1 [Medicago truncatula]
Length=614

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 103/117 (88%), Gaps = 2/117 (2%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  262  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDSNDKVMP  321

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNN  362
            VKQWLEERR LQ EMQ+L+DKLAI ER AK+EAQLK+K +LRLK LE+ L+  GN+N
Sbjct  322  VKQWLEERRFLQGEMQQLRDKLAIVERAAKSEAQLKEKYQLRLKVLEESLR--GNSN  376



>ref|XP_003520494.1| PREDICTED: microtubule-associated protein 70-2-like [Glycine 
max]
Length=587

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 103/125 (82%), Gaps = 1/125 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+ LERE+AR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  245  AVLAGGAAANAVRDYQRKVQEMNEERKILEREVARAKVTANRVATVVANEWKDANDKVMP  304

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEER+  Q EMQ+L+DKLAI+ERTAKAEAQ+K+K +LR K LE+ +K T N N   
Sbjct  305  VKQWLEERKFFQGEMQQLRDKLAIAERTAKAEAQMKEKYQLRFKVLEERVK-TSNGNSKF  363

Query  372  KVLSG  386
             V  G
Sbjct  364  TVSDG  368



>gb|EPS64520.1| hypothetical protein M569_10261 [Genlisea aurea]
Length=627

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  271  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  330

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEERR LQ EMQ+L+DKL+I+ERTAK+EAQ
Sbjct  331  VKQWLEERRFLQGEMQQLRDKLSIAERTAKSEAQ  364



>ref|XP_008643807.1| PREDICTED: LOC100285189 isoform X1 [Zea mays]
 gb|AFW73305.1| ATMAP70-3 [Zea mays]
Length=590

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +3

Query  15   ILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMPV  194
            +L GGAAAN +RDY+R++ E+ EE++  +RELAR KV+ANRVA +VANEWKD NDKVMPV
Sbjct  251  VLQGGAAANVVRDYQRKVQEMNEEKKIRDRELARAKVTANRVAVVVANEWKDANDKVMPV  310

Query  195  KQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNPK  374
            KQWLEERR LQ EMQ+L+DKLAI+ERTA++EAQLK+K +LRLK LE GL+ T + +  P 
Sbjct  311  KQWLEERRFLQGEMQQLRDKLAIAERTARSEAQLKEKYQLRLKVLEDGLRGTPSGSCRPS  370

Query  375  V  377
            +
Sbjct  371  M  371



>ref|XP_006301058.1| hypothetical protein CARUB_v10021451mg [Capsella rubella]
 gb|EOA33956.1| hypothetical protein CARUB_v10021451mg [Capsella rubella]
Length=614

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 111/139 (80%), Gaps = 2/139 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  269  AVLAGGAAANAVRDYQRKFQEMNEERKTLDRELARAKVTANRVATVVANEWKDGNDKVMP  328

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNV--  365
            VKQWLEERR LQ EMQ+L+DKLAIS+R AK+EAQLKDK +LRLK LE+ L+ T +++   
Sbjct  329  VKQWLEERRFLQGEMQQLRDKLAISDRAAKSEAQLKDKFQLRLKVLEETLRGTSSSSFRS  388

Query  366  NPKVLSGFSKPEKANHLFG  422
             P+  S  + P +   L G
Sbjct  389  TPEGRSMSNGPSRRQSLSG  407



>gb|ACL53445.1| unknown [Zea mays]
 gb|AFW73304.1| hypothetical protein ZEAMMB73_477885 [Zea mays]
Length=592

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +3

Query  15   ILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMPV  194
            +L GGAAAN +RDY+R++ E+ EE++  +RELAR KV+ANRVA +VANEWKD NDKVMPV
Sbjct  253  VLQGGAAANVVRDYQRKVQEMNEEKKIRDRELARAKVTANRVAVVVANEWKDANDKVMPV  312

Query  195  KQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNPK  374
            KQWLEERR LQ EMQ+L+DKLAI+ERTA++EAQLK+K +LRLK LE GL+ T + +  P 
Sbjct  313  KQWLEERRFLQGEMQQLRDKLAIAERTARSEAQLKEKYQLRLKVLEDGLRGTPSGSCRPS  372

Query  375  V  377
            +
Sbjct  373  M  373



>ref|XP_007045276.1| Microtubule-associated proteins 70-2 isoform 2, partial [Theobroma 
cacao]
 gb|EOY01108.1| Microtubule-associated proteins 70-2 isoform 2, partial [Theobroma 
cacao]
Length=547

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  203  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  262

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEERR LQ EMQ+L+DKLAI+ER AK+EAQ
Sbjct  263  VKQWLEERRFLQGEMQQLRDKLAITERAAKSEAQ  296



>ref|XP_009599321.1| PREDICTED: microtubule-associated protein 70-2-like, partial 
[Nicotiana tomentosiformis]
Length=513

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 106/138 (77%), Gaps = 1/138 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  166  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  225

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNN-NVN  368
            VKQWLEER+ LQ EMQ+L+DKLAI+ER AK+EAQLK+K  LRLK LE  L+ T       
Sbjct  226  VKQWLEERKFLQGEMQQLRDKLAITERAAKSEAQLKEKYHLRLKVLEDTLRSTSTGARTT  285

Query  369  PKVLSGFSKPEKANHLFG  422
            P   S  + P +   L G
Sbjct  286  PDGRSSSNGPSRRQSLGG  303



>emb|CDY27573.1| BnaA09g28340D [Brassica napus]
Length=626

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  276  AVLAGGAAANAVRDYQRKFQEMNEERKTLDRELARAKVTANRVATVVANEWKDGNDKVMP  335

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNV  365
            VKQWLEERR LQ EMQ+L+DKLAI++R AK+EAQLK+K +LRLK LE+ L+ T + N 
Sbjct  336  VKQWLEERRFLQGEMQQLRDKLAITDRAAKSEAQLKEKFQLRLKVLEETLRGTSSRNT  393



>ref|XP_009113829.1| PREDICTED: LOW QUALITY PROTEIN: microtubule-associated protein 
70-2-like [Brassica rapa]
Length=626

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  276  AVLAGGAAANAVRDYQRKFQEMNEERKTLDRELARAKVTANRVATVVANEWKDGNDKVMP  335

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNV  365
            VKQWLEERR LQ EMQ+L+DKLAI++R AK+EAQLK+K +LRLK LE+ L+ T + N 
Sbjct  336  VKQWLEERRFLQGEMQQLRDKLAITDRAAKSEAQLKEKFQLRLKVLEETLRGTSSRNT  393



>ref|XP_007045278.1| Microtubule-associated proteins 70-1 isoform 4 [Theobroma cacao]
 gb|EOY01110.1| Microtubule-associated proteins 70-1 isoform 4 [Theobroma cacao]
Length=588

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  259  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  318

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEERR LQ EMQ+L+DKLAI+ER AK+EAQ
Sbjct  319  VKQWLEERRFLQGEMQQLRDKLAITERAAKSEAQ  352



>gb|KHN15454.1| Microtubule-associated protein 70-2 [Glycine soja]
Length=573

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 101/117 (86%), Gaps = 2/117 (2%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  223  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVAVVVANEWKDANDKVMP  282

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNN  362
            VKQWLEERR LQ EMQ+L+DKLAI ER AK EAQLK+K  LRLK LE+GL+  GN+N
Sbjct  283  VKQWLEERRFLQGEMQQLRDKLAIVERAAKYEAQLKEKYHLRLKVLEEGLR--GNSN  337



>ref|XP_011070564.1| PREDICTED: microtubule-associated protein 70-2 [Sesamum indicum]
Length=625

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  278  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  337

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEERR LQ EMQ+L++KLAI+ERTAK+EAQ
Sbjct  338  VKQWLEERRFLQGEMQQLREKLAITERTAKSEAQ  371



>ref|NP_001151555.1| LOC100285189 [Zea mays]
 gb|ACG43303.1| ATMAP70-3 [Zea mays]
Length=590

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +3

Query  15   ILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMPV  194
            +L GGAAAN +RDY+R++ E+ EE++  +RELAR KV+ANRVA +VANEWKD NDKVMPV
Sbjct  251  VLQGGAAANVVRDYQRKVQEMNEEKKIRDRELARAKVTANRVAVVVANEWKDANDKVMPV  310

Query  195  KQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            KQWLEERR LQ EMQ+L+DKLAI+ERTA++EAQLK+K +LRLK LE GL+ T + +  P
Sbjct  311  KQWLEERRFLQGEMQQLRDKLAIAERTARSEAQLKEKYQLRLKVLEDGLRGTPSGSCRP  369



>ref|XP_007162092.1| hypothetical protein PHAVU_001G123200g [Phaseolus vulgaris]
 gb|ESW34086.1| hypothetical protein PHAVU_001G123200g [Phaseolus vulgaris]
Length=586

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 102/125 (82%), Gaps = 1/125 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDYRR++ E+  ER+ LERE+AR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  245  AVLAGGAAANAVRDYRRRVQEMNGERKILEREVARAKVTANRVATVVANEWKDANDKVMP  304

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEER+  Q EMQ+L+DKLAI+ERTAKAEAQ+K+K +LR K LE+ +K T N N   
Sbjct  305  VKQWLEERKFFQGEMQQLRDKLAIAERTAKAEAQMKEKYQLRFKVLEERVK-TSNGNSKF  363

Query  372  KVLSG  386
             V  G
Sbjct  364  TVSDG  368



>gb|ABD65109.1| Myosin II heavy chain-like domain containing protein [Brassica 
oleracea]
Length=508

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 115/170 (68%), Gaps = 32/170 (19%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            AILAGG AAN             EE+RTLERELARVKVSA+RVA   ANEWKDEND+VMP
Sbjct  215  AILAGGTAANA------------EEKRTLERELARVKVSASRVALAFANEWKDENDRVMP  262

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ-----------lkdklklrlktlEQG  338
            VKQWLEERR+L  EMQ+LKDKLA+SERTAKAE+Q           ++++LKLRLKT+E G
Sbjct  263  VKQWLEERRLLHGEMQKLKDKLAVSERTAKAESQLKVDEYIISLVVQERLKLRLKTIEDG  322

Query  339  LKQTGNNNVNPKVLSGFSKPEKANHLFGILS-----SKKRSASQPRASMV  473
            LK     +V+P      +K EK+  + G L+     SKKRS SQPR S+ 
Sbjct  323  LKCLNMLSVSPTT----TKAEKSGKILGFLTSGGGGSKKRSTSQPRGSLT  368



>ref|XP_010088195.1| hypothetical protein L484_005541 [Morus notabilis]
 gb|EXB32335.1| hypothetical protein L484_005541 [Morus notabilis]
Length=637

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  271  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVAVVVANEWKDANDKVMP  330

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNN  362
            VKQWLEERR LQ EMQ+L+DKLAI+ER AK+EAQLKDK  LRLK LE+ L+ T N++
Sbjct  331  VKQWLEERRFLQGEMQQLRDKLAIAERAAKSEAQLKDKFHLRLKVLEESLRGTSNSS  387



>ref|XP_010273713.1| PREDICTED: microtubule-associated protein 70-1-like [Nelumbo 
nucifera]
Length=642

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  290  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVAVVVANEWKDANDKVMP  349

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNN  359
            VKQWLEERR LQ EMQ+L+DKLAI+ERTAK+EAQLK+K  LRLK LE+ L+   N+
Sbjct  350  VKQWLEERRFLQGEMQQLRDKLAITERTAKSEAQLKEKYHLRLKVLEESLRAPSNS  405



>gb|KHG17924.1| Uncharacterized protein F383_01609 [Gossypium arboreum]
Length=621

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  281  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVAMVVANEWKDANDKVMP  340

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEERR LQ EMQ+L+DKLAI+ERTAK+EAQ
Sbjct  341  VKQWLEERRFLQGEMQQLRDKLAITERTAKSEAQ  374



>gb|KJB78332.1| hypothetical protein B456_012G182700 [Gossypium raimondii]
 gb|KJB78333.1| hypothetical protein B456_012G182700 [Gossypium raimondii]
Length=622

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  282  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  341

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEERR LQ EMQ+L+DKLAI+ER AK+EAQ
Sbjct  342  VKQWLEERRFLQGEMQQLRDKLAITERAAKSEAQ  375



>ref|XP_007045275.1| Microtubule-associated proteins 70-2 isoform 1 [Theobroma cacao]
 gb|EOY01107.1| Microtubule-associated proteins 70-2 isoform 1 [Theobroma cacao]
Length=621

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  281  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  340

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEERR LQ EMQ+L+DKLAI+ER AK+EAQ
Sbjct  341  VKQWLEERRFLQGEMQQLRDKLAITERAAKSEAQ  374



>ref|NP_001048050.1| Os02g0736100 [Oryza sativa Japonica Group]
 sp|Q6Z746.1|MP702_ORYSJ RecName: Full=Microtubule-associated protein 70-2; Short=AtMAP70-2; 
AltName: Full=70 kDa microtubule-associated protein 2 
[Oryza sativa Japonica Group]
 dbj|BAD15899.1| putative myosin II heavy chain [Oryza sativa Japonica Group]
 dbj|BAF09964.1| Os02g0736100 [Oryza sativa Japonica Group]
 dbj|BAG95529.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73957.1| hypothetical protein OsI_08848 [Oryza sativa Indica Group]
Length=599

 Score =   124 bits (312),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+ L+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  252  AVLAGGAAANAVRDYQRKVQEMNEERKILDRELARAKVTANRVAVVVANEWKDANDKVMP  311

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR LQ EMQ+L+DKLAI+ERTA++EAQLK+K +LRLK LE GL+   + +  P
Sbjct  312  VKQWLEERRFLQGEMQQLRDKLAIAERTARSEAQLKEKYQLRLKVLEDGLRGPPSGSSRP  371



>ref|XP_010460414.1| PREDICTED: microtubule-associated protein 70-2 [Camelina sativa]
Length=640

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 111/139 (80%), Gaps = 2/139 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  285  AVLAGGAAANAVRDYQRKFQEMNEERKTLDRELARAKVTANRVATVVANEWKDGNDKVMP  344

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNV--  365
            VKQWLEERR LQ EMQ+L+DKLAI++R AK+EAQLK+K +LRL+ LE+ L+ T +++   
Sbjct  345  VKQWLEERRFLQGEMQQLRDKLAITDRAAKSEAQLKEKFQLRLRVLEETLRGTTSSSTRN  404

Query  366  NPKVLSGFSKPEKANHLFG  422
             P+  S  + P +   L G
Sbjct  405  TPEARSMSNGPSRRQSLGG  423



>gb|KFK44516.1| hypothetical protein AALP_AA1G266900 [Arabis alpina]
Length=626

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 124/172 (72%), Gaps = 15/172 (9%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  270  AVLAGGAAANAVRDYQRKFQEMNEERKTLDRELARAKVTANRVATVVANEWKDGNDKVMP  329

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNV--  365
            VKQWLEERR LQ EMQ+L+DKLAI++R AK+EAQLK+K +LRLK LE+ L+ T + +   
Sbjct  330  VKQWLEERRFLQGEMQQLRDKLAITDRAAKSEAQLKEKFQLRLKVLEETLRGTSSISSTR  389

Query  366  -NPKVLSGFSKPEKANHLFGILS-----------SKKRSASQPRASM-VNTT  482
              P+  S  + P +   L G  +           SKK  ASQ R S+ +N+T
Sbjct  390  NTPEARSMSNGPSRRQSLGGAENLQKFPSNGGALSKKAPASQMRHSLSINST  441



>ref|XP_008775595.1| PREDICTED: microtubule-associated protein 70-1-like [Phoenix 
dactylifera]
Length=628

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+L+GGAAAN +RDY+R++ E+ +E +TL+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  281  AVLSGGAAANAVRDYQRKVQEMNDEMKTLDRELARAKVTANRVAVVVANEWKDANDKVMP  340

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGN  356
            V+QWLEERR +Q EMQ+L+DKLAI+ERTA++EAQLK+K +LRLK LE+GL+ + N
Sbjct  341  VRQWLEERRFMQGEMQQLRDKLAIAERTARSEAQLKEKYQLRLKVLEEGLRMSAN  395



>ref|XP_002315855.1| hypothetical protein POPTR_0010s11640g [Populus trichocarpa]
 gb|EEF02026.1| hypothetical protein POPTR_0010s11640g [Populus trichocarpa]
Length=620

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  273  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  332

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNN  362
            VKQWL+ERR LQ EMQ+L+DKLAI+ER AK+EAQLK+K +LRLK LE+ L+ + ++N
Sbjct  333  VKQWLDERRFLQGEMQQLRDKLAITERAAKSEAQLKEKYQLRLKVLEESLRGSSSSN  389



>ref|XP_010553646.1| PREDICTED: microtubule-associated protein 70-3-like [Tarenaya 
hassleriana]
 ref|XP_010553654.1| PREDICTED: microtubule-associated protein 70-3-like [Tarenaya 
hassleriana]
Length=627

 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+ L+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  284  AVLAGGAAANAVRDYQRKVQEMNEERKVLDRELARAKVTANRVATVVANEWKDANDKVMP  343

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEERR LQ EMQ+L+DKLAI+ER AK+EAQ
Sbjct  344  VKQWLEERRFLQGEMQQLRDKLAIAERAAKSEAQ  377



>gb|EEE57764.1| hypothetical protein OsJ_08300 [Oryza sativa Japonica Group]
Length=599

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+ L+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  252  AVLAGGAAANAVRDYQRKVQEMNEERKILDRELARAKVTANRVAVVVANEWKDANDKVMP  311

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR LQ EMQ+L+DKLAI+ERTA++EAQLK+K +LRLK LE GL+   + +  P
Sbjct  312  VKQWLEERRFLQGEMQQLRDKLAIAERTARSEAQLKEKYQLRLKVLEDGLRGPPSGSSRP  371



>ref|XP_010319385.1| PREDICTED: microtubule-associated protein 70-2 [Solanum lycopersicum]
Length=617

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD +DKVMP
Sbjct  270  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDASDKVMP  329

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTG  353
            VKQWLEER+ LQ E+Q+L+DKLAISERTAK+EAQLK+K  LRLK LE+ LK T 
Sbjct  330  VKQWLEERKFLQGELQQLRDKLAISERTAKSEAQLKEKYHLRLKVLEETLKSTS  383



>ref|XP_006647855.1| PREDICTED: microtubule-associated protein 70-2-like [Oryza brachyantha]
Length=598

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 104/120 (87%), Gaps = 2/120 (2%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+ L+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  252  AVLAGGAAANAVRDYQRKVQEMNEERKILDRELARAKVTANRVAVVVANEWKDANDKVMP  311

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLK--QTGNNNV  365
            VKQWLEERR LQ EMQ+L+DKLAI+ERTA++EAQLK+K +LRLK LE GL+   +G+N +
Sbjct  312  VKQWLEERRFLQGEMQQLRDKLAIAERTARSEAQLKEKYQLRLKVLEDGLRGPPSGSNRL  371



>ref|XP_007028367.1| Microtubule-associated proteins 70-2 isoform 2 [Theobroma cacao]
 gb|EOY08869.1| Microtubule-associated proteins 70-2 isoform 2 [Theobroma cacao]
Length=535

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 102/117 (87%), Gaps = 1/117 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +R+Y+R++ E+ EE++TLERE+AR KVSANRVAT+VANEWKD NDKVMP
Sbjct  258  AVLAGGAAANAVREYQRKVQEMNEEKKTLEREVARAKVSANRVATVVANEWKDGNDKVMP  317

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLK-QTGNN  359
            VKQWLEERR LQ EMQ+L+DKLA++ER AKAEA LK+K +LR K LE+ LK  TGN+
Sbjct  318  VKQWLEERRFLQGEMQQLRDKLAVAERAAKAEAHLKEKYQLRFKVLEERLKASTGNS  374



>ref|XP_009380076.1| PREDICTED: microtubule-associated protein 70-1-like [Musa acuminata 
subsp. malaccensis]
Length=621

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 107/127 (84%), Gaps = 1/127 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EE +TL+RELAR KV+ANRVA +VANEWKD +DKVMP
Sbjct  278  AVLAGGAAANAVRDYQRKVQEMSEEMKTLDRELARAKVTANRVAVVVANEWKDASDKVMP  337

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR +Q EMQ+L+DKLAI+ERTA++EAQLK+K ++RLK LE+GL+ +   + N 
Sbjct  338  VKQWLEERRFMQGEMQQLRDKLAITERTARSEAQLKEKFQVRLKVLEEGLRMSAGGS-NR  396

Query  372  KVLSGFS  392
             ++ G S
Sbjct  397  TIVEGKS  403



>ref|XP_011021765.1| PREDICTED: microtubule-associated protein 70-2-like [Populus 
euphratica]
Length=620

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  273  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  332

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEERR LQ EMQ+L+DKLAI+ER AK+EAQ
Sbjct  333  VKQWLEERRFLQGEMQQLRDKLAITERAAKSEAQ  366



>ref|XP_010093577.1| Microtubule-associated protein 70-2 [Morus notabilis]
 gb|EXB54299.1| Microtubule-associated protein 70-2 [Morus notabilis]
Length=903

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TLERE+AR KVSANRVAT+VANEWKD NDKVMP
Sbjct  284  AVLAGGAAANAVRDYQRKVQEMNEERKTLEREVARAKVSANRVATVVANEWKDANDKVMP  343

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQT  350
            VKQWLEER+  Q EMQ+L+DKLAI+ERTAKAEAQLK+K  +R K LE+ LK++
Sbjct  344  VKQWLEERKFFQGEMQQLRDKLAIAERTAKAEAQLKEKYLMRFKVLEERLKRS  396



>ref|XP_002887159.1| atmap70-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63418.1| atmap70-1 [Arabidopsis lyrata subsp. lyrata]
Length=622

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  275  AVLAGGAAANAVRDYQRKFQEMNEERKTLDRELARAKVTANRVATVVANEWKDGNDKVMP  334

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNV  365
            VKQWLEERR LQ EMQ+L+DKLAIS+R AK+EAQLKDK +LRLK LE+ L+ T + ++
Sbjct  335  VKQWLEERRFLQGEMQQLRDKLAISDRAAKSEAQLKDKFQLRLKVLEETLRGTSSISI  392



>ref|XP_007204220.1| hypothetical protein PRUPE_ppa003030mg [Prunus persica]
 gb|EMJ05419.1| hypothetical protein PRUPE_ppa003030mg [Prunus persica]
Length=610

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EE++ LERE+AR KVSANRVAT+VANEWKD +DKVMP
Sbjct  268  AVLAGGAAANAVRDYQRKVQEMNEEKKLLEREVARAKVSANRVATVVANEWKDSSDKVMP  327

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWL+ERR  Q EMQ+L+DKLA++ERTAKAEAQ
Sbjct  328  VKQWLDERRFFQGEMQQLRDKLAVAERTAKAEAQ  361



>ref|NP_176973.1| microtubule-associated protein 70-1 [Arabidopsis thaliana]
 sp|Q9C9X0.1|MP701_ARATH RecName: Full=Microtubule-associated protein 70-1; Short=AtMAP70-1; 
AltName: Full=70 kDa microtubule-associated protein 1 
[Arabidopsis thaliana]
 gb|AAG52019.1|AC012563_29 unknown protein; 30164-32998 [Arabidopsis thaliana]
 gb|AAL67000.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20292.1| unknown protein [Arabidopsis thaliana]
 emb|CAJ31078.1| 70 kDa microtubule associated protein Type 1 [Arabidopsis thaliana]
 gb|AEE34742.1| microtubule-associated protein 70-1 [Arabidopsis thaliana]
Length=622

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  275  AVLAGGAAANAVRDYQRKFQEMNEERKTLDRELARAKVTANRVATVVANEWKDGNDKVMP  334

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNV  365
            VKQWLEERR LQ EMQ+L+DKLAIS+R AK+EAQLKDK +LRL+ LE+ L+ T + ++
Sbjct  335  VKQWLEERRFLQGEMQQLRDKLAISDRAAKSEAQLKDKFQLRLRVLEETLRGTSSISI  392



>gb|EYU30134.1| hypothetical protein MIMGU_mgv1a002946mg [Erythranthe guttata]
Length=623

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  278  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  337

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEERR LQ EMQ+L+DKL I+ERTA++EAQ
Sbjct  338  VKQWLEERRFLQGEMQQLRDKLTITERTARSEAQ  371



>ref|XP_008341650.1| PREDICTED: microtubule-associated protein 70-2-like [Malus domestica]
Length=597

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EE++ LERE+AR KVSANRVAT+VANEWKD +DKVMP
Sbjct  267  AVLAGGAAANAVRDYQRKVQEMNEEKKLLEREVARAKVSANRVATVVANEWKDSSDKVMP  326

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEER+I Q EMQ+L+DKLA+++RTAKAEAQ
Sbjct  327  VKQWLEERKIFQGEMQQLRDKLAVAQRTAKAEAQ  360



>emb|CDY36126.1| BnaA08g19220D [Brassica napus]
Length=617

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGG AAN++RDY+R+  E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  275  AVLAGGTAANSVRDYQRKFQEMNEERKTLDRELARAKVTANRVATVVANEWKDGNDKVMP  334

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNV  365
            VKQWLEERR LQ EMQ+L+DKLAI+ R AK+EAQLK+K +LRLK LE+ LK T ++++
Sbjct  335  VKQWLEERRFLQGEMQQLRDKLAITNRAAKSEAQLKEKFQLRLKVLEETLKGTSSSSI  392



>ref|XP_010551223.1| PREDICTED: microtubule-associated protein 70-2 [Tarenaya hassleriana]
 ref|XP_010551226.1| PREDICTED: microtubule-associated protein 70-2 [Tarenaya hassleriana]
 ref|XP_010551227.1| PREDICTED: microtubule-associated protein 70-2 [Tarenaya hassleriana]
 ref|XP_010551228.1| PREDICTED: microtubule-associated protein 70-2 [Tarenaya hassleriana]
Length=614

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  274  AVLAGGAAANAVRDYQRKFQEMNEERKTLDRELARAKVTANRVATVVANEWKDGNDKVMP  333

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEERR LQ EMQ+L+DKLAI+ER AK+EAQ
Sbjct  334  VKQWLEERRFLQGEMQQLRDKLAIAERAAKSEAQ  367



>ref|XP_002323245.1| hypothetical protein POPTR_0016s03570g [Populus trichocarpa]
 gb|EEF05006.1| hypothetical protein POPTR_0016s03570g [Populus trichocarpa]
Length=604

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+  ER+TLERE+AR KVSANRVAT+VANEWKD NDKVMP
Sbjct  276  AVLAGGAAANAVRDYQRKVQEMNGERKTLEREVARAKVSANRVATVVANEWKDGNDKVMP  335

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEERR  Q EMQ+L+DKLA++ER AKAEAQ
Sbjct  336  VKQWLEERRFFQGEMQQLRDKLAVAERAAKAEAQ  369



>ref|XP_009776285.1| PREDICTED: microtubule-associated protein 70-2-like [Nicotiana 
sylvestris]
Length=629

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 106/138 (77%), Gaps = 1/138 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  282  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMP  341

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNN-NVN  368
            VKQWLEER+ LQ EMQ+L+DKLAI+ER AK+EAQLK+K  LRLK LE  L+ T       
Sbjct  342  VKQWLEERKFLQGEMQQLRDKLAITERAAKSEAQLKEKYHLRLKVLEDTLRSTSTGARTT  401

Query  369  PKVLSGFSKPEKANHLFG  422
            P   S  + P +   L G
Sbjct  402  PDGRSSSNGPSRRQSLGG  419



>gb|AAL11578.1|AF424584_1 At1g14840/F10B6_9 [Arabidopsis thaliana]
 gb|AAN72269.1| At1g14840/F10B6_9 [Arabidopsis thaliana]
Length=396

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+ LERELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  50   AVLAGGAAANAVRDYQRKFQEMNEERKILERELARAKVNANRVATVVANEWKDSNDKVMP  109

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLK  344
            V+QWLEERR LQ EMQ+L+DKLAI++R AK+EAQLK+K  LRL+ LE+ LK
Sbjct  110  VRQWLEERRFLQGEMQQLRDKLAIADRAAKSEAQLKEKFLLRLRVLEESLK  160



>ref|XP_009101310.1| PREDICTED: microtubule-associated protein 70-3 isoform X1 [Brassica 
rapa]
 ref|XP_009101311.1| PREDICTED: microtubule-associated protein 70-3 isoform X1 [Brassica 
rapa]
Length=631

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 109/139 (78%), Gaps = 2/139 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EERR L+RELAR KVSA+RVAT+VANEWKD +DKVMP
Sbjct  278  AVLAGGAAANAVRDYQRKFQEMNEERRVLDRELARAKVSASRVATVVANEWKDGSDKVMP  337

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLK--QTGNNNV  365
            VKQWLEERR LQ EMQ+L+DKLAI++R AK+EAQLK+K +LRLK LE+ L+   +G N  
Sbjct  338  VKQWLEERRFLQGEMQQLRDKLAIADRAAKSEAQLKEKFQLRLKVLEESLRGPPSGGNRT  397

Query  366  NPKVLSGFSKPEKANHLFG  422
             P+  S  + P +   L G
Sbjct  398  TPEGRSISNGPSRRQSLGG  416



>ref|XP_009411128.1| PREDICTED: microtubule-associated protein 70-5 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009411129.1| PREDICTED: microtubule-associated protein 70-5 [Musa acuminata 
subsp. malaccensis]
Length=558

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 117/157 (75%), Gaps = 21/157 (13%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            +ILA    AN IRD +RQISE+ EE+R +ERELARVKVSA+R+AT+ ANEWKD+NDKV+P
Sbjct  227  SILASSVTANAIRDCQRQISELNEEKRMVERELARVKVSASRMATVAANEWKDDNDKVIP  286

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR LQ E+QRL+DKLA++ERTAKAE QLKDKL LRLKT+E+ LK +G      
Sbjct  287  VKQWLEERRFLQGEIQRLRDKLALAERTAKAERQLKDKLSLRLKTVEECLKPSG------  340

Query  372  KVLSGFSKPEKANHL-----FGILSSKKRSASQPRAS  467
                    PEK   L     +G+   KKRSAS+PRAS
Sbjct  341  -------LPEKHGELPGGKKYGV---KKRSASRPRAS  367



>gb|EMS51736.1| hypothetical protein TRIUR3_31011 [Triticum urartu]
Length=610

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+ L+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  251  AVLAGGAAANAVRDYQRKVQEMNEERKVLDRELARTKVTANRVAVVVANEWKDGNDKVMP  310

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR LQ EMQ+L+DKLAI+ERTA++EAQ+K+K + RLK LE GL+   + +  P
Sbjct  311  VKQWLEERRFLQGEMQQLRDKLAIAERTARSEAQVKEKYQWRLKVLEDGLRGPPSGSSRP  370



>ref|XP_009101312.1| PREDICTED: microtubule-associated protein 70-3 isoform X2 [Brassica 
rapa]
Length=630

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 109/139 (78%), Gaps = 2/139 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EERR L+RELAR KVSA+RVAT+VANEWKD +DKVMP
Sbjct  278  AVLAGGAAANAVRDYQRKFQEMNEERRVLDRELARAKVSASRVATVVANEWKDGSDKVMP  337

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLK--QTGNNNV  365
            VKQWLEERR LQ EMQ+L+DKLAI++R AK+EAQLK+K +LRLK LE+ L+   +G N  
Sbjct  338  VKQWLEERRFLQGEMQQLRDKLAIADRAAKSEAQLKEKFQLRLKVLEESLRGPPSGGNRT  397

Query  366  NPKVLSGFSKPEKANHLFG  422
             P+  S  + P +   L G
Sbjct  398  TPEGRSISNGPSRRQSLGG  416



>ref|XP_004510505.1| PREDICTED: microtubule-associated protein 70-2-like [Cicer arietinum]
Length=609

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 122/172 (71%), Gaps = 20/172 (12%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+T++RELAR KVSANRVA +VANEWKD NDKVMP
Sbjct  261  AVLAGGAAANAVRDYQRKVQEMNEERKTIDRELARAKVSANRVAVVVANEWKDSNDKVMP  320

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLK--QTGNNNV  365
            V+QWLE+RR+LQ EMQ+L+DKLAI +R AK+EAQLK+K +LRLK LE  L+    G+N  
Sbjct  321  VRQWLEDRRLLQGEMQQLRDKLAIVDRRAKSEAQLKEKYQLRLKVLEDSLRGNSNGSNRS  380

Query  366  NPKV----------LSG---FSKPEKANHLFGILSSKKRSASQPRASMVNTT  482
             P+           L G   FSKP     L     SK+  + Q R+S+ ++T
Sbjct  381  TPEARSVSNSRRQSLGGVDNFSKPTSNGFL-----SKRSPSFQLRSSLSSST  427



>ref|XP_006416965.1| hypothetical protein EUTSA_v10007120mg [Eutrema salsugineum]
 gb|ESQ35318.1| hypothetical protein EUTSA_v10007120mg [Eutrema salsugineum]
Length=606

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 111/145 (77%), Gaps = 2/145 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+ LERELAR KV+ANRVAT+VANEWKD ND+VMP
Sbjct  259  AVLAGGAAANAVRDYQRKFQEMNEERKILERELARAKVNANRVATVVANEWKDSNDQVMP  318

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQ--TGNNNV  365
            V+QWLEERR LQ EMQ+L+DKLAI++R AK+EAQLK+K  LRL+ LE+ LK+  + +N  
Sbjct  319  VRQWLEERRFLQGEMQQLRDKLAIADRAAKSEAQLKEKFVLRLRVLEESLKRPTSSSNRG  378

Query  366  NPKVLSGFSKPEKANHLFGILSSKK  440
             P   S  + P +   L G  +S K
Sbjct  379  TPGGRSSSNGPARRQSLGGAETSPK  403



>ref|XP_007028366.1| Microtubule-associated proteins 70-2 isoform 1 [Theobroma cacao]
 gb|EOY08868.1| Microtubule-associated proteins 70-2 isoform 1 [Theobroma cacao]
Length=610

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 102/117 (87%), Gaps = 1/117 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +R+Y+R++ E+ EE++TLERE+AR KVSANRVAT+VANEWKD NDKVMP
Sbjct  271  AVLAGGAAANAVREYQRKVQEMNEEKKTLEREVARAKVSANRVATVVANEWKDGNDKVMP  330

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLK-QTGNN  359
            VKQWLEERR LQ EMQ+L+DKLA++ER AKAEA LK+K +LR K LE+ LK  TGN+
Sbjct  331  VKQWLEERRFLQGEMQQLRDKLAVAERAAKAEAHLKEKYQLRFKVLEERLKASTGNS  387



>ref|XP_003570689.1| PREDICTED: microtubule-associated protein 70-2 [Brachypodium 
distachyon]
Length=599

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 110/145 (76%), Gaps = 9/145 (6%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+ L+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  252  AVLAGGAAANAVRDYQRKVQEMNEERKVLDRELARTKVTANRVAVVVANEWKDGNDKVMP  311

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR LQ EMQ+L+DKLAI+ERTA++EAQ+K+K + RLK LE GL+        P
Sbjct  312  VKQWLEERRFLQGEMQQLRDKLAIAERTARSEAQVKEKYQWRLKVLEDGLR-------GP  364

Query  372  KVLSGFSKPEKANHLFGILSSKKRS  446
               SG S+P         +SS++ S
Sbjct  365  P--SGSSRPPTEGKSISNVSSRRLS  387



>ref|XP_010477983.1| PREDICTED: microtubule-associated protein 70-2 [Camelina sativa]
Length=640

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 110/139 (79%), Gaps = 2/139 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R+  E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  286  AVLAGGAAANAVRDYQRKFQEMNEERKTLDRELARAKVTANRVATVVANEWKDGNDKVMP  345

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNV--  365
            VKQWLEERR LQ EMQ+L+DKLAI++R AK+EAQLK+K +LRL+ LE+ L+ T + +   
Sbjct  346  VKQWLEERRFLQGEMQQLRDKLAITDRAAKSEAQLKEKFQLRLRVLEETLRGTSSISTRN  405

Query  366  NPKVLSGFSKPEKANHLFG  422
             P+  S  + P +   L G
Sbjct  406  TPEARSMSNGPSRRQSLGG  424



>gb|EMT03977.1| hypothetical protein F775_09563 [Aegilops tauschii]
Length=804

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+ L+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  270  AVLAGGAAANAVRDYQRKVQEMNEERKVLDRELARTKVTANRVAVVVANEWKDGNDKVMP  329

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR LQ EMQ+L+DKLAI+ERTA++EAQ+K+K + RLK LE GL+   + +  P
Sbjct  330  VKQWLEERRFLQGEMQQLRDKLAIAERTARSEAQVKEKYQWRLKVLEDGLRGPPSGSSRP  389



>ref|XP_010043962.1| PREDICTED: microtubule-associated protein 70-2 [Eucalyptus grandis]
 ref|XP_010043963.1| PREDICTED: microtubule-associated protein 70-2 [Eucalyptus grandis]
 gb|KCW85970.1| hypothetical protein EUGRSUZ_B02673 [Eucalyptus grandis]
 gb|KCW85971.1| hypothetical protein EUGRSUZ_B02673 [Eucalyptus grandis]
Length=629

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 110/138 (80%), Gaps = 1/138 (1%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EERRTL+RELAR KV+ANRVAT+VANEWKD NDKVMP
Sbjct  282  AVLAGGAAANAVRDYQRKVQEMNEERRTLDRELARAKVTANRVATVVANEWKDANDKVMP  341

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLK-QTGNNNVN  368
            VKQWLEERR LQ EMQ+L+DKLAI+ER A++EA LK++ + RLK +E+ L+  +G+NN +
Sbjct  342  VKQWLEERRFLQGEMQQLRDKLAITERAARSEALLKERYQSRLKVIEESLRGSSGSNNRS  401

Query  369  PKVLSGFSKPEKANHLFG  422
                S  + P +   L G
Sbjct  402  ALERSMSNGPSRRQSLGG  419



>gb|KHN23795.1| Microtubule-associated protein 70-2 [Glycine soja]
Length=573

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 101/117 (86%), Gaps = 2/117 (2%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  223  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVAVVVANEWKDANDKVMP  282

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNN  362
            VKQWLEERR LQ EMQ+L+DKLAI ER AK+EAQLK+K  LRLK LE+ L+  GN+N
Sbjct  283  VKQWLEERRFLQGEMQQLRDKLAIVERAAKSEAQLKEKYHLRLKVLEESLR--GNSN  337



>gb|EMT08820.1| hypothetical protein F775_15881 [Aegilops tauschii]
Length=569

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            ++LAGGAAAN +RDY+R++ E+ +ER+TL+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  217  SVLAGGAAANAVRDYQRKVQEMNDERKTLDRELARAKVTANRVAVVVANEWKDSNDKVMP  276

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR +Q EMQ+L+DKLA++ERTA++EAQLK+K +LRLK LE GL+   + +  P
Sbjct  277  VKQWLEERRFMQGEMQQLRDKLAVAERTARSEAQLKEKYQLRLKVLEDGLRGPPSGSSRP  336



>gb|KHG20171.1| Microtubule-associated 70-4 -like protein [Gossypium arboreum]
Length=621

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VAN+WKD NDKVMP
Sbjct  281  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANDWKDANDKVMP  340

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQ  293
            VKQWLEERR LQ EMQ+L+DKLAI+ER AK+EAQ
Sbjct  341  VKQWLEERRFLQGEMQQLRDKLAITERAAKSEAQ  374



>ref|XP_007153235.1| hypothetical protein PHAVU_003G018100g [Phaseolus vulgaris]
 gb|ESW25229.1| hypothetical protein PHAVU_003G018100g [Phaseolus vulgaris]
Length=605

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 101/117 (86%), Gaps = 2/117 (2%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVA +VANEWKD NDKVMP
Sbjct  257  AVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVAVVVANEWKDANDKVMP  316

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNN  362
            VKQWLEERR LQ EMQ+L+DKLAI ER AK+EAQLK+K  LRLK LE+ L+  GN+N
Sbjct  317  VKQWLEERRFLQGEMQQLRDKLAIVERAAKSEAQLKEKYHLRLKVLEESLR--GNSN  371



>ref|NP_001170596.1| hypothetical protein [Zea mays]
 gb|ACR34163.1| unknown [Zea mays]
 gb|AFW76888.1| hypothetical protein ZEAMMB73_452857 [Zea mays]
Length=606

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +3

Query  12   AILAGGAAANTIRDYrrqiseiqeerrtlerelarVKVSANRVATIVANEWKDENDKVMP  191
            A+L GGA AN +RDY+R+  EI EE+RTL+RELAR KV+ANRVA++VANEWKD NDKVMP
Sbjct  249  AVLQGGATANVVRDYQRRFQEINEEKRTLDRELARAKVTANRVASVVANEWKDSNDKVMP  308

Query  192  VKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktlEQGLKQTGNNNVNP  371
            VKQWLEERR  Q EMQ+L+DKLAI+ERTA++EAQLK+K +LRLK LE GL+   + ++ P
Sbjct  309  VKQWLEERRFFQGEMQQLRDKLAITERTARSEAQLKEKYQLRLKVLEDGLRGPPSGSIRP  368



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 579015689490