BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP015D05 548 bp,

Length=525
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP15872.1|  unnamed protein product                                216   5e-63   Coffea canephora [robusta coffee]
ref|XP_011085543.1|  PREDICTED: pentatricopeptide repeat-containi...    198   3e-56   Sesamum indicum [beniseed]
ref|XP_002269506.1|  PREDICTED: pentatricopeptide repeat-containi...    188   1e-52   Vitis vinifera
ref|XP_006344825.1|  PREDICTED: pentatricopeptide repeat-containi...    188   1e-52   Solanum tuberosum [potatoes]
ref|XP_009607494.1|  PREDICTED: pentatricopeptide repeat-containi...    188   1e-52   Nicotiana tomentosiformis
ref|XP_004233935.1|  PREDICTED: pentatricopeptide repeat-containi...    187   3e-52   Solanum lycopersicum
gb|EYU39380.1|  hypothetical protein MIMGU_mgv1a020943mg                187   4e-52   Erythranthe guttata [common monkey flower]
ref|XP_009802251.1|  PREDICTED: pentatricopeptide repeat-containi...    184   3e-51   Nicotiana sylvestris
ref|XP_002533281.1|  pentatricopeptide repeat-containing protein,...    182   2e-50   Ricinus communis
ref|XP_008338176.1|  PREDICTED: pentatricopeptide repeat-containi...    181   4e-50   Malus domestica [apple tree]
ref|XP_008361374.1|  PREDICTED: pentatricopeptide repeat-containi...    181   4e-50   Malus domestica [apple tree]
ref|XP_008361375.1|  PREDICTED: pentatricopeptide repeat-containi...    181   6e-50   Malus domestica [apple tree]
ref|XP_007203181.1|  hypothetical protein PRUPE_ppa025125mg             181   6e-50   Prunus persica
ref|XP_008241610.1|  PREDICTED: pentatricopeptide repeat-containi...    180   1e-49   Prunus mume [ume]
ref|XP_006383263.1|  hypothetical protein POPTR_0005s12980g             177   1e-48   Populus trichocarpa [western balsam poplar]
emb|CBI17585.3|  unnamed protein product                                176   2e-48   Vitis vinifera
ref|XP_011458353.1|  PREDICTED: pentatricopeptide repeat-containi...    175   5e-48   Fragaria vesca subsp. vesca
ref|XP_011458349.1|  PREDICTED: pentatricopeptide repeat-containi...    175   5e-48   Fragaria vesca subsp. vesca
gb|KHN36159.1|  Pentatricopeptide repeat-containing protein             166   7e-48   Glycine soja [wild soybean]
gb|KDP31821.1|  hypothetical protein JCGZ_12282                         174   2e-47   Jatropha curcas
ref|XP_010254978.1|  PREDICTED: pentatricopeptide repeat-containi...    174   2e-47   Nelumbo nucifera [Indian lotus]
ref|XP_011465460.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    173   4e-47   Fragaria vesca subsp. vesca
ref|XP_010099338.1|  hypothetical protein L484_009155                   171   2e-46   Morus notabilis
gb|KJB48471.1|  hypothetical protein B456_008G070500                    169   9e-46   Gossypium raimondii
ref|XP_010680935.1|  PREDICTED: pentatricopeptide repeat-containi...    167   4e-45   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_011009884.1|  PREDICTED: pentatricopeptide repeat-containi...    166   7e-45   Populus euphratica
ref|XP_010999938.1|  PREDICTED: pentatricopeptide repeat-containi...    166   7e-45   Populus euphratica
ref|XP_007047055.1|  Tetratricopeptide repeat (TPR)-like superfam...    166   8e-45   Theobroma cacao [chocolate]
gb|KHN42021.1|  Pentatricopeptide repeat-containing protein             164   3e-44   Glycine soja [wild soybean]
ref|XP_003538834.1|  PREDICTED: pentatricopeptide repeat-containi...    164   4e-44   Glycine max [soybeans]
gb|EPS57610.1|  hypothetical protein M569_17206                         164   4e-44   Genlisea aurea
ref|XP_010029848.1|  PREDICTED: pentatricopeptide repeat-containi...    163   2e-43   Eucalyptus grandis [rose gum]
ref|XP_003611888.1|  Pentatricopeptide repeat-containing protein        162   3e-43   Medicago truncatula
ref|XP_010444766.1|  PREDICTED: pentatricopeptide repeat-containi...    160   1e-42   Camelina sativa [gold-of-pleasure]
gb|KDO79449.1|  hypothetical protein CISIN_1g006615mg                   160   1e-42   Citrus sinensis [Valencia orange]
ref|XP_007156885.1|  hypothetical protein PHAVU_002G025400g             160   1e-42   Phaseolus vulgaris [French bean]
ref|NP_001119513.1|  pentatricopeptide repeat-containing protein        158   8e-42   Arabidopsis thaliana [mouse-ear cress]
emb|CDY54208.1|  BnaCnng26480D                                          157   1e-41   Brassica napus [oilseed rape]
ref|XP_006279534.1|  hypothetical protein CARUB_v10028266mg             157   1e-41   Capsella rubella
ref|XP_006466704.1|  PREDICTED: pentatricopeptide repeat-containi...    157   2e-41   Citrus sinensis [Valencia orange]
ref|XP_006425760.1|  hypothetical protein CICLE_v10027580mg             157   2e-41   Citrus clementina
ref|XP_010484611.1|  PREDICTED: pentatricopeptide repeat-containi...    155   5e-41   Camelina sativa [gold-of-pleasure]
ref|XP_009103500.1|  PREDICTED: pentatricopeptide repeat-containi...    155   6e-41   Brassica rapa
ref|XP_006393857.1|  hypothetical protein EUTSA_v10005592mg             155   7e-41   Eutrema salsugineum
emb|CDY45248.1|  BnaA07g12420D                                          154   2e-40   Brassica napus [oilseed rape]
ref|XP_010558041.1|  PREDICTED: pentatricopeptide repeat-containi...    152   1e-39   Tarenaya hassleriana [spider flower]
gb|KFK28339.1|  hypothetical protein AALP_AA8G503500                    153   2e-39   Arabis alpina [alpine rockcress]
ref|XP_002866749.1|  hypothetical protein ARALYDRAFT_920064             151   2e-39   Arabidopsis lyrata subsp. lyrata
ref|XP_004512000.1|  PREDICTED: pentatricopeptide repeat-containi...    151   3e-39   
ref|XP_010936047.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    151   3e-39   Elaeis guineensis
ref|XP_010465170.1|  PREDICTED: pentatricopeptide repeat-containi...    149   1e-38   Camelina sativa [gold-of-pleasure]
ref|XP_008796384.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    144   1e-36   
ref|XP_009420369.1|  PREDICTED: pentatricopeptide repeat-containi...    130   1e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001172197.1|  Os01g0167750                                       127   8e-31   
gb|EAY72686.1|  hypothetical protein OsI_00553                          127   8e-31   Oryza sativa Indica Group [Indian rice]
gb|EAZ10688.1|  hypothetical protein OsJ_00518                          127   1e-30   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB39907.1|  P0028E10.11                                            127   2e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002455122.1|  hypothetical protein SORBIDRAFT_03g004720          122   7e-29   Sorghum bicolor [broomcorn]
ref|NP_001183205.1|  hypothetical protein                               121   2e-28   Zea mays [maize]
dbj|BAJ89459.1|  predicted protein                                      120   2e-28   Hordeum vulgare subsp. vulgare [barley]
ref|XP_006643794.1|  PREDICTED: pentatricopeptide repeat-containi...    118   7e-28   Oryza brachyantha
ref|XP_009379190.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    113   5e-27   Pyrus x bretschneideri [bai li]
ref|XP_004968314.1|  PREDICTED: pentatricopeptide repeat-containi...    114   6e-26   Setaria italica
ref|XP_006853154.1|  hypothetical protein AMTR_s00038p00179320          101   2e-21   
dbj|BAK04418.1|  predicted protein                                    71.2    3e-11   Hordeum vulgare subsp. vulgare [barley]
ref|XP_004956188.1|  PREDICTED: pentatricopeptide repeat-containi...  68.9    2e-10   Setaria italica
gb|EMS49071.1|  hypothetical protein TRIUR3_09168                     68.6    2e-10   Triticum urartu
gb|EMT24513.1|  hypothetical protein F775_06744                       68.6    2e-10   Aegilops tauschii
ref|NP_001043145.1|  Os01g0505500                                     68.6    3e-10   
gb|EAY74226.1|  hypothetical protein OsI_02107                        68.6    3e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_006390810.1|  hypothetical protein EUTSA_v10018364mg           68.2    3e-10   Eutrema salsugineum
ref|XP_006644208.1|  PREDICTED: pentatricopeptide repeat-containi...  68.2    4e-10   Oryza brachyantha
ref|XP_006405023.1|  hypothetical protein EUTSA_v10000687mg           65.9    7e-10   Eutrema salsugineum
ref|XP_003565781.1|  PREDICTED: pentatricopeptide repeat-containi...  67.0    7e-10   Brachypodium distachyon [annual false brome]
gb|AES95804.2|  PPR containing plant-like protein                     66.2    2e-09   Medicago truncatula
ref|XP_003612846.1|  Pentatricopeptide repeat-containing protein      66.2    2e-09   
gb|EMT02311.1|  hypothetical protein F775_12462                       66.2    2e-09   Aegilops tauschii
gb|AAD43623.1|AC005698_22  T3P18.22                                   64.7    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002436688.1|  hypothetical protein SORBIDRAFT_10g007070        64.7    5e-09   Sorghum bicolor [broomcorn]
emb|CDY03704.1|  BnaA02g15330D                                        64.3    5e-09   Brassica napus [oilseed rape]
emb|CBJ23784.1|  pentatricopeptide (PPR) repeat-containing protein    64.7    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889138.1|  hypothetical protein ARALYDRAFT_476899           63.9    5e-09   Arabidopsis lyrata subsp. lyrata
ref|XP_009127843.1|  PREDICTED: pentatricopeptide repeat-containi...  64.3    5e-09   Brassica rapa
gb|KJB30832.1|  hypothetical protein B456_005G162800                  64.7    6e-09   Gossypium raimondii
ref|NP_176454.1|  pentatricopeptide repeat protein RPF2               64.7    6e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002888819.1|  pentatricopeptide repeat-containing protein      64.3    6e-09   Arabidopsis lyrata subsp. lyrata
gb|AAF19552.1|AC007190_20  F23N19.4                                   64.7    7e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010551610.1|  PREDICTED: pentatricopeptide repeat-containi...  63.9    7e-09   Tarenaya hassleriana [spider flower]
ref|XP_004150483.1|  PREDICTED: pentatricopeptide repeat-containi...  63.9    7e-09   Cucumis sativus [cucumbers]
ref|XP_004161997.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  63.9    8e-09   
ref|XP_006382734.1|  hypothetical protein POPTR_0005s04890g           63.9    8e-09   Populus trichocarpa [western balsam poplar]
ref|XP_011032509.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    9e-09   Populus euphratica
ref|XP_006382722.1|  helicase domain-containing family protein        63.5    1e-08   Populus trichocarpa [western balsam poplar]
ref|XP_009414726.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002281336.1|  PREDICTED: putative pentatricopeptide repeat...  63.9    1e-08   Vitis vinifera
ref|XP_010096768.1|  hypothetical protein L484_025886                 63.5    1e-08   Morus notabilis
gb|KDO64719.1|  hypothetical protein CISIN_1g037620mg                 62.4    1e-08   Citrus sinensis [Valencia orange]
ref|XP_009414725.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001764969.1|  predicted protein                                63.2    1e-08   Physcomitrella patens
ref|XP_006448295.1|  hypothetical protein CICLE_v10014876mg           63.2    1e-08   Citrus clementina
gb|EMT00568.1|  hypothetical protein F775_12441                       62.4    1e-08   Aegilops tauschii
ref|XP_008467144.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    2e-08   Cucumis melo [Oriental melon]
ref|XP_006468828.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    2e-08   Citrus sinensis [Valencia orange]
gb|AFK45860.1|  unknown                                               60.5    2e-08   Medicago truncatula
emb|CDY09511.1|  BnaC02g20530D                                        62.8    2e-08   Brassica napus [oilseed rape]
emb|CAN80799.1|  hypothetical protein VITISV_019809                   63.2    2e-08   Vitis vinifera
ref|NP_177262.1|  pentatricopeptide repeat-containing protein         62.8    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010551608.1|  PREDICTED: pentatricopeptide repeat-containi...  62.8    2e-08   Tarenaya hassleriana [spider flower]
gb|EPS61555.1|  hypothetical protein M569_13242                       62.0    2e-08   Genlisea aurea
ref|NP_001147833.1|  GTP binding protein                              62.8    2e-08   Zea mays [maize]
emb|CBJ23782.1|  pentatricopeptide (PPR) repeat-containing protein    62.8    2e-08   Arabidopsis thaliana [mouse-ear cress]
gb|ACP39954.1|  pentatricopeptide repeat protein                      62.4    2e-08   Gossypium hirsutum [American cotton]
ref|XP_010933048.1|  PREDICTED: protein Rf1, mitochondrial-like       62.8    3e-08   Elaeis guineensis
ref|XP_002962188.1|  hypothetical protein SELMODRAFT_60915            62.4    3e-08   Selaginella moellendorffii
ref|XP_007143028.1|  hypothetical protein PHAVU_007G037500g           62.4    3e-08   Phaseolus vulgaris [French bean]
ref|XP_006382719.1|  pentatricopeptide repeat-containing family p...  62.4    3e-08   Populus trichocarpa [western balsam poplar]
gb|KFK41530.1|  hypothetical protein AALP_AA2G141500                  62.4    3e-08   Arabis alpina [alpine rockcress]
ref|XP_006382761.1|  hypothetical protein POPTR_0005s05170g           62.0    3e-08   Populus trichocarpa [western balsam poplar]
ref|NP_176529.1|  pentatricopeptide repeat-containing protein         62.4    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006661947.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    3e-08   Oryza brachyantha
ref|XP_010935557.1|  PREDICTED: protein Rf1, mitochondrial-like       62.4    3e-08   Elaeis guineensis
ref|XP_011032524.1|  PREDICTED: putative pentatricopeptide repeat...  62.0    4e-08   Populus euphratica
ref|XP_010427923.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    4e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006301573.1|  hypothetical protein CARUB_v10022011mg           61.6    4e-08   Capsella rubella
ref|XP_002965100.1|  hypothetical protein SELMODRAFT_83796            62.0    4e-08   Selaginella moellendorffii
ref|XP_010471113.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    4e-08   Camelina sativa [gold-of-pleasure]
ref|XP_009622072.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    4e-08   Nicotiana tomentosiformis
ref|XP_011032541.1|  PREDICTED: putative pentatricopeptide repeat...  62.0    4e-08   Populus euphratica
ref|XP_010415802.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    4e-08   Camelina sativa [gold-of-pleasure]
emb|CED92696.1|  PPR protein                                          61.6    5e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CCD31439.1|  RNA processing factor 3                              61.6    5e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009768960.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    5e-08   Nicotiana sylvestris
gb|EMT29441.1|  hypothetical protein F775_20076                       61.6    5e-08   Aegilops tauschii
ref|XP_006387304.1|  hypothetical protein POPTR_1306s00200g           61.6    5e-08   Populus trichocarpa [western balsam poplar]
gb|EEC66968.1|  hypothetical protein OsI_33625                        62.0    5e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_011032562.1|  PREDICTED: putative pentatricopeptide repeat...  60.1    5e-08   Populus euphratica
emb|CED92695.1|  PPR protein                                          61.6    6e-08   Arabidopsis thaliana [mouse-ear cress]
gb|EMS49689.1|  Protein Rf1, mitochondrial                            61.6    6e-08   Triticum urartu
gb|ABB47632.1|  pentatricopeptide, putative, expressed                61.6    6e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EEE50977.1|  hypothetical protein OsJ_31558                        61.6    6e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EMT01673.1|  hypothetical protein F775_23319                       61.2    7e-08   Aegilops tauschii
ref|XP_010681691.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    7e-08   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|EYU46490.1|  hypothetical protein MIMGU_mgv11b018784mg             60.8    8e-08   Erythranthe guttata [common monkey flower]
ref|XP_006382709.1|  hypothetical protein POPTR_0005s04650g           60.8    8e-08   Populus trichocarpa [western balsam poplar]
ref|XP_009356158.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    9e-08   Pyrus x bretschneideri [bai li]
emb|CBI16176.3|  unnamed protein product                              60.8    9e-08   Vitis vinifera
ref|XP_008389228.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    9e-08   Malus domestica [apple tree]
ref|XP_009626803.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    1e-07   Nicotiana tomentosiformis
ref|NP_176501.1|  transacting siRNA generating locus                  60.8    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006838717.1|  hypothetical protein AMTR_s00002p00251730        60.8    1e-07   Amborella trichopoda
ref|XP_006389306.1|  hypothetical protein POPTR_0030s00260g           60.5    1e-07   Populus trichocarpa [western balsam poplar]
emb|CBI24780.3|  unnamed protein product                              60.8    1e-07   Vitis vinifera
ref|XP_010650766.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    1e-07   Vitis vinifera
gb|KDP38032.1|  hypothetical protein JCGZ_04675                       60.5    1e-07   Jatropha curcas
ref|XP_002319601.2|  hypothetical protein POPTR_0013s03290g           60.5    1e-07   Populus trichocarpa [western balsam poplar]
ref|XP_010933049.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    1e-07   Elaeis guineensis
ref|XP_011032465.1|  PREDICTED: putative pentatricopeptide repeat...  60.5    1e-07   Populus euphratica
ref|XP_011031386.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    1e-07   Populus euphratica
gb|KJB26426.1|  hypothetical protein B456_004G240600                  60.1    1e-07   Gossypium raimondii
gb|EMT30302.1|  hypothetical protein F775_16218                       60.5    1e-07   Aegilops tauschii
ref|XP_003535704.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    1e-07   Glycine max [soybeans]
gb|AES62791.2|  PPR containing plant-like protein                     60.1    1e-07   Medicago truncatula
ref|XP_002974875.1|  hypothetical protein SELMODRAFT_150113           59.7    1e-07   Selaginella moellendorffii
ref|XP_003592540.1|  Pentatricopeptide repeat-containing protein      60.1    1e-07   
ref|NP_177858.2|  pentatricopeptide repeat-containing protein         59.7    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176481.2|  pentatricopeptide repeat protein RPF3               60.1    2e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AAG29197.1|AC078898_7  hypothetical protein                        59.7    2e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AAF75803.1|AC011000_6  Contains weak similarity to leaf protei...  60.1    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004172591.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    2e-07   
ref|XP_002963786.1|  hypothetical protein SELMODRAFT_79843            59.7    2e-07   Selaginella moellendorffii
ref|XP_006494534.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    2e-07   
emb|CDX81633.1|  BnaC08g39680D                                        60.1    2e-07   Brassica napus [oilseed rape]
ref|XP_002964278.1|  hypothetical protein SELMODRAFT_80975            58.9    2e-07   Selaginella moellendorffii
emb|CDP04586.1|  unnamed protein product                              59.7    2e-07   Coffea canephora [robusta coffee]
ref|XP_002315895.2|  hypothetical protein POPTR_0010s12490g           59.3    2e-07   Populus trichocarpa [western balsam poplar]
ref|XP_010935675.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    2e-07   Elaeis guineensis
ref|XP_002465109.1|  hypothetical protein SORBIDRAFT_01g032160        59.7    3e-07   Sorghum bicolor [broomcorn]
ref|XP_010935652.1|  PREDICTED: protein Rf1, mitochondrial-like       59.7    3e-07   Elaeis guineensis
ref|XP_006487354.1|  PREDICTED: putative pentatricopeptide repeat...  59.3    3e-07   Citrus sinensis [Valencia orange]
ref|XP_011038680.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    3e-07   Populus euphratica
ref|XP_010430362.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_002989531.1|  hypothetical protein SELMODRAFT_130008           58.9    3e-07   Selaginella moellendorffii
gb|ACU25590.1|  pentatricopeptide repeat-containing protein           58.9    3e-07   Priva cordifolia
ref|XP_010937068.1|  PREDICTED: protein Rf1, mitochondrial-like       59.3    3e-07   Elaeis guineensis
emb|CDY34870.1|  BnaA09g47960D                                        58.2    4e-07   Brassica napus [oilseed rape]
ref|XP_005649725.1|  TPR-like protein                                 59.3    4e-07   Coccomyxa subellipsoidea C-169
ref|XP_008466623.1|  PREDICTED: LOW QUALITY PROTEIN: putative pen...  59.3    4e-07   Cucumis melo [Oriental melon]
ref|XP_010458689.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    4e-07   Camelina sativa [gold-of-pleasure]
ref|XP_008243338.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    4e-07   
ref|XP_009604239.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    4e-07   Nicotiana tomentosiformis
ref|XP_003558596.2|  PREDICTED: pentatricopeptide repeat-containi...  58.9    4e-07   
ref|XP_006382765.1|  hypothetical protein POPTR_0005s05210g           58.9    4e-07   Populus trichocarpa [western balsam poplar]
emb|CDX82419.1|  BnaA03g34020D                                        58.9    4e-07   Brassica napus [oilseed rape]
ref|XP_009135469.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    4e-07   Brassica rapa
ref|XP_006487353.1|  PREDICTED: putative pentatricopeptide repeat...  58.9    4e-07   Citrus sinensis [Valencia orange]
ref|XP_009138046.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    4e-07   Brassica rapa
emb|CDY13456.1|  BnaA03g51740D                                        58.9    4e-07   Brassica napus [oilseed rape]
ref|XP_002531063.1|  pentatricopeptide repeat-containing protein,...  58.5    4e-07   Ricinus communis
ref|XP_008781836.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    4e-07   Phoenix dactylifera
gb|KFK22834.1|  hypothetical protein AALP_AAs49566U000200             58.5    4e-07   Arabis alpina [alpine rockcress]
gb|KDO38524.1|  hypothetical protein CISIN_1g011362mg                 58.5    5e-07   Citrus sinensis [Valencia orange]
gb|KHN42388.1|  Pentatricopeptide repeat-containing protein, mito...  58.2    5e-07   Glycine soja [wild soybean]
ref|XP_004976824.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    5e-07   Setaria italica
ref|XP_008222885.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    5e-07   
ref|XP_006300966.1|  hypothetical protein CARUB_v10021355mg           58.5    5e-07   Capsella rubella
ref|XP_008781835.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    5e-07   Phoenix dactylifera
ref|XP_008358091.1|  PREDICTED: putative pentatricopeptide repeat...  56.2    5e-07   
ref|XP_009417258.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    5e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006382763.1|  hypothetical protein POPTR_0005s05190g           58.5    5e-07   Populus trichocarpa [western balsam poplar]
gb|KCW64612.1|  hypothetical protein EUGRSUZ_G02199                   58.2    5e-07   Eucalyptus grandis [rose gum]
ref|XP_010066642.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    6e-07   Eucalyptus grandis [rose gum]
ref|XP_008802945.1|  PREDICTED: protein Rf1, mitochondrial-like       58.5    6e-07   Phoenix dactylifera
ref|XP_004137973.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    6e-07   Cucumis sativus [cucumbers]
ref|XP_006285538.1|  hypothetical protein CARUB_v10006979mg           58.5    6e-07   Capsella rubella
ref|XP_004514198.1|  PREDICTED: pentatricopeptide repeat-containi...  55.5    6e-07   
emb|CDX72330.1|  BnaC07g43520D                                        58.5    6e-07   Brassica napus [oilseed rape]
ref|XP_006364273.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    6e-07   Solanum tuberosum [potatoes]
ref|XP_010548153.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    6e-07   Tarenaya hassleriana [spider flower]
ref|XP_010673763.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    6e-07   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_011031385.1|  PREDICTED: putative pentatricopeptide repeat...  58.2    7e-07   Populus euphratica
ref|XP_004172473.1|  PREDICTED: putative pentatricopeptide repeat...  57.8    7e-07   
ref|XP_006303621.1|  hypothetical protein CARUB_v10011428mg           58.2    7e-07   Capsella rubella
ref|XP_009628783.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    7e-07   Nicotiana tomentosiformis
ref|XP_006487359.1|  PREDICTED: putative pentatricopeptide repeat...  58.2    7e-07   Citrus sinensis [Valencia orange]
ref|XP_006487360.1|  PREDICTED: putative pentatricopeptide repeat...  58.2    7e-07   
ref|XP_002283327.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    8e-07   Vitis vinifera
ref|XP_006423451.1|  hypothetical protein CICLE_v10030082mg           57.8    8e-07   Citrus clementina
ref|XP_010243796.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    8e-07   Nelumbo nucifera [Indian lotus]
ref|XP_011034889.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    8e-07   Populus euphratica
gb|EYU30048.1|  hypothetical protein MIMGU_mgv1a021243mg              57.4    8e-07   Erythranthe guttata [common monkey flower]
ref|XP_006605955.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    8e-07   Glycine max [soybeans]
ref|XP_011092997.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    8e-07   Sesamum indicum [beniseed]
ref|XP_008662715.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    8e-07   Zea mays [maize]
ref|XP_010933042.1|  PREDICTED: protein Rf1, mitochondrial-like       58.2    8e-07   Elaeis guineensis
gb|ACU25557.1|  pentatricopeptide repeat-containing protein           57.4    8e-07   Verbena perennis
gb|AES76395.2|  pentatricopeptide (PPR) repeat protein                57.8    9e-07   Medicago truncatula
gb|AIU48581.1|  tetratricopeptide repeat-like superfamily protein     57.8    9e-07   Zea mays [maize]
ref|NP_001061174.1|  Os08g0191900                                     57.8    9e-07   
ref|XP_011070642.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    9e-07   Sesamum indicum [beniseed]
ref|XP_003620177.1|  Pentatricopeptide repeat-containing protein      57.8    9e-07   
ref|XP_001776359.1|  predicted protein                                57.4    9e-07   Physcomitrella patens
gb|EAZ05871.1|  hypothetical protein OsI_28108                        57.8    9e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_010935645.1|  PREDICTED: protein Rf1, mitochondrial-like       57.8    9e-07   Elaeis guineensis
ref|XP_006382762.1|  hypothetical protein POPTR_0005s05180g           57.4    9e-07   Populus trichocarpa [western balsam poplar]
ref|NP_194913.1|  proton gradient regulation 3                        57.8    9e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010447486.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    9e-07   Camelina sativa [gold-of-pleasure]
gb|AFV61022.1|  pentatricopeptide repeat-containing protein 11        57.4    1e-06   Coelocarpum swinglei
ref|XP_009625048.1|  PREDICTED: putative pentatricopeptide repeat...  57.8    1e-06   Nicotiana tomentosiformis
ref|XP_006837809.1|  hypothetical protein AMTR_s00104p00122950        57.8    1e-06   
ref|XP_010458712.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    1e-06   Camelina sativa [gold-of-pleasure]
emb|CDP00705.1|  unnamed protein product                              57.8    1e-06   Coffea canephora [robusta coffee]
gb|KCW48641.1|  hypothetical protein EUGRSUZ_K02299                   57.4    1e-06   Eucalyptus grandis [rose gum]
ref|XP_008781092.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    1e-06   Phoenix dactylifera
gb|KDO37236.1|  hypothetical protein CISIN_1g044047mg                 56.6    1e-06   Citrus sinensis [Valencia orange]
ref|XP_004298459.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    1e-06   Fragaria vesca subsp. vesca
ref|XP_008802326.1|  PREDICTED: protein Rf1, mitochondrial-like       57.8    1e-06   Phoenix dactylifera
gb|ACU25571.1|  pentatricopeptide repeat-containing protein           57.4    1e-06   Glandularia araucana
gb|ACU25581.1|  pentatricopeptide repeat-containing protein           57.4    1e-06   Mulguraea aspera
ref|XP_002526170.1|  pentatricopeptide repeat-containing protein,...  57.4    1e-06   Ricinus communis
gb|KHN39477.1|  Putative pentatricopeptide repeat-containing protein  57.0    1e-06   Glycine soja [wild soybean]
emb|CDY16002.1|  BnaC08g41210D                                        57.0    1e-06   Brassica napus [oilseed rape]
ref|XP_010037002.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    1e-06   Eucalyptus grandis [rose gum]
gb|ACU25592.1|  pentatricopeptide repeat-containing protein           57.0    1e-06   Tamonea boxiana
gb|ACU25563.1|  pentatricopeptide repeat-containing protein           57.0    1e-06   Verbena hastata [American blue vervain]
ref|XP_006296960.1|  hypothetical protein CARUB_v10012952mg           57.8    1e-06   Capsella rubella
gb|ACU25579.1|  pentatricopeptide repeat-containing protein           57.0    1e-06   Mulguraea asparagoides
ref|XP_009118082.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    1e-06   Brassica rapa
ref|XP_006651067.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  57.4    1e-06   
ref|XP_006487312.1|  PREDICTED: putative pentatricopeptide repeat...  57.0    1e-06   
gb|AIU48565.1|  tetratricopeptide repeat-like superfamily protein     57.0    1e-06   Panicum virgatum
ref|XP_008442691.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  57.4    1e-06   Cucumis melo [Oriental melon]
ref|XP_004983977.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    1e-06   
ref|XP_007158272.1|  hypothetical protein PHAVU_002G138600g           57.4    1e-06   Phaseolus vulgaris [French bean]
gb|EMS64684.1|  Protein Rf1, mitochondrial                            57.4    1e-06   Triticum urartu
ref|XP_010935563.1|  PREDICTED: protein Rf1, mitochondrial-like       57.4    1e-06   Elaeis guineensis
dbj|BAB09426.1|  unnamed protein product                              57.0    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002525999.1|  pentatricopeptide repeat-containing protein,...  57.4    1e-06   
ref|XP_010943853.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    1e-06   Elaeis guineensis
ref|XP_002301924.1|  hypothetical protein POPTR_0002s01200g           57.4    1e-06   Populus trichocarpa [western balsam poplar]
gb|KJB79647.1|  hypothetical protein B456_013G060600                  57.0    1e-06   
ref|XP_006306401.1|  hypothetical protein CARUB_v10012310mg           57.4    1e-06   
ref|XP_007018012.1|  Pentatricopeptide repeat superfamily protein...  57.4    1e-06   
ref|XP_008220663.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    1e-06   
ref|XP_010923753.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    1e-06   
gb|AHB18408.1|  pentatricopeptide repeat-containing protein           57.4    1e-06   
ref|NP_199684.2|  pentatricopeptide repeat-containing protein         57.0    1e-06   
gb|AFV61016.1|  pentatricopeptide repeat-containing protein 11        56.6    1e-06   
ref|XP_006282792.1|  hypothetical protein CARUB_v10006400mg           57.4    1e-06   
ref|XP_010935655.1|  PREDICTED: protein Rf1, mitochondrial-like       57.4    1e-06   
ref|XP_010088193.1|  hypothetical protein L484_005539                 57.0    1e-06   
ref|XP_009118081.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    1e-06   
ref|XP_011462083.1|  PREDICTED: pentatricopeptide repeat-containi...  55.1    1e-06   
ref|XP_010063125.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  57.4    1e-06   
ref|XP_010923744.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    1e-06   
ref|XP_006303680.1|  hypothetical protein CARUB_v10011758mg           57.0    1e-06   
gb|KHG16388.1|  hypothetical protein F383_21662                       57.0    2e-06   
gb|EMS68498.1|  Protein Rf1, mitochondrial                            57.0    2e-06   
gb|ACU27922.1|  At1g03560-like protein                                55.1    2e-06   
ref|XP_006302023.1|  hypothetical protein CARUB_v10020005mg           57.0    2e-06   
ref|XP_008802345.1|  PREDICTED: protein Rf1, mitochondrial-like       57.0    2e-06   
ref|XP_008790623.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    2e-06   
ref|XP_006494529.1|  PREDICTED: putative pentatricopeptide repeat...  57.0    2e-06   
gb|ACU25556.1|  pentatricopeptide repeat-containing protein           56.6    2e-06   
ref|XP_008783963.1|  PREDICTED: pentatricopeptide repeat-containi...  55.5    2e-06   
ref|XP_011003821.1|  PREDICTED: putative pentatricopeptide repeat...  56.6    2e-06   
gb|ACU25580.1|  pentatricopeptide repeat-containing protein           56.6    2e-06   
gb|ACU27923.1|  At1g03560-like protein                                54.7    2e-06   
ref|XP_009594249.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    2e-06   
gb|ACU25578.1|  pentatricopeptide repeat-containing protein           56.6    2e-06   
gb|AIU48572.1|  tetratricopeptide repeat-like superfamily protein     56.6    2e-06   
gb|EYU19802.1|  hypothetical protein MIMGU_mgv11b0020781mg            56.6    2e-06   
gb|AFV61013.1|  pentatricopeptide repeat-containing protein 11        56.6    2e-06   
ref|XP_002443991.1|  hypothetical protein SORBIDRAFT_07g005470        56.6    2e-06   
ref|XP_006382720.1|  hypothetical protein POPTR_0005s04760g           57.0    2e-06   
ref|XP_002280443.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    2e-06   
ref|XP_001691064.1|  predicted mitochondrial protein                  56.6    2e-06   
ref|XP_007018011.1|  Pentatricopeptide repeat (PPR-like) superfam...  56.6    2e-06   
ref|XP_009788330.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    2e-06   
gb|KEH36300.1|  PPR containing plant-like protein                     56.6    2e-06   
ref|XP_004972659.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    2e-06   
gb|AHX42047.1|  pentatricopeptide repeat-containing protein 11        55.8    2e-06   
ref|XP_008801766.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    2e-06   
ref|XP_006494532.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    2e-06   
ref|XP_007018010.1|  Pentatricopeptide repeat (PPR-like) superfam...  56.6    2e-06   
gb|AIU48570.1|  tetratricopeptide repeat-like superfamily protein     56.6    2e-06   
ref|XP_006659201.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    2e-06   
ref|XP_002964758.1|  hypothetical protein SELMODRAFT_82857            56.6    2e-06   
ref|XP_011032523.1|  PREDICTED: putative pentatricopeptide repeat...  56.6    2e-06   
ref|XP_008779524.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  56.6    2e-06   
ref|XP_010462662.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    2e-06   
ref|XP_010530461.1|  PREDICTED: putative pentatricopeptide repeat...  56.6    2e-06   
gb|ACU25668.1|  pentatricopeptide repeat-containing protein           56.2    2e-06   
gb|ACU25559.1|  pentatricopeptide repeat-containing protein           56.2    2e-06   
ref|XP_008809556.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    2e-06   
ref|XP_002309564.2|  hypothetical protein POPTR_0006s25910g           56.6    2e-06   
ref|XP_004293246.2|  PREDICTED: pentatricopeptide repeat-containi...  56.6    2e-06   
ref|XP_006847029.1|  hypothetical protein AMTR_s00017p00176770        56.6    2e-06   
ref|XP_006391807.1|  hypothetical protein EUTSA_v10023351mg           56.6    2e-06   
ref|XP_011032518.1|  PREDICTED: putative pentatricopeptide repeat...  56.6    2e-06   
gb|ACU25558.1|  pentatricopeptide repeat-containing protein           56.2    2e-06   
gb|KJB84450.1|  hypothetical protein B456_N026600                     56.6    2e-06   
ref|XP_010430336.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    2e-06   
gb|ACU25576.1|  pentatricopeptide repeat-containing protein           56.2    2e-06   
gb|ACU25562.1|  pentatricopeptide repeat-containing protein           56.2    2e-06   
gb|EMS59339.1|  Protein Rf1, mitochondrial                            56.6    2e-06   
ref|XP_010922022.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    3e-06   
ref|XP_010432808.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    3e-06   
ref|XP_004298524.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    3e-06   
ref|XP_010914611.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    3e-06   
ref|XP_007226699.1|  hypothetical protein PRUPE_ppa020452mg           56.6    3e-06   
ref|XP_007159689.1|  hypothetical protein PHAVU_002G258900g           56.2    3e-06   
ref|XP_006382641.1|  hypothetical protein POPTR_0005s04060g           56.2    3e-06   
ref|XP_011005933.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    3e-06   
gb|KJB79646.1|  hypothetical protein B456_013G060600                  56.2    3e-06   
ref|XP_011005931.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    3e-06   
ref|XP_002267947.3|  PREDICTED: pentatricopeptide repeat-containi...  56.6    3e-06   
emb|CDX75201.1|  BnaA01g05010D                                        56.2    3e-06   
ref|XP_001772751.1|  predicted protein                                56.2    3e-06   
ref|XP_006494533.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    3e-06   
gb|AFV61019.1|  pentatricopeptide repeat-containing protein 11        55.8    3e-06   
gb|KDP29434.1|  hypothetical protein JCGZ_18355                       55.8    3e-06   
emb|CBI28459.3|  unnamed protein product                              56.2    3e-06   
emb|CDP04644.1|  unnamed protein product                              55.8    3e-06   
ref|XP_011460945.1|  PREDICTED: putative pentatricopeptide repeat...  56.2    3e-06   
emb|CDP18152.1|  unnamed protein product                              56.2    3e-06   
ref|XP_004238857.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    3e-06   
ref|XP_006494531.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    3e-06   
ref|XP_010445955.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    3e-06   
ref|XP_009784742.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    3e-06   
ref|XP_006447324.1|  hypothetical protein CICLE_v10014552mg           56.2    3e-06   
gb|EMT33585.1|  hypothetical protein F775_11798                       55.8    3e-06   
ref|XP_004514199.1|  PREDICTED: pentatricopeptide repeat-containi...  55.1    3e-06   
ref|XP_008363495.1|  PREDICTED: putative pentatricopeptide repeat...  55.8    3e-06   
ref|XP_010687146.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    3e-06   
gb|KJB57946.1|  hypothetical protein B456_009G186600                  55.8    3e-06   
ref|XP_002458297.1|  hypothetical protein SORBIDRAFT_03g030795        53.5    3e-06   
emb|CDP13067.1|  unnamed protein product                              55.8    4e-06   
ref|XP_006371715.1|  hypothetical protein POPTR_0018s00690g           55.8    4e-06   
ref|XP_009144209.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    4e-06   
ref|XP_010482140.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    4e-06   
ref|XP_010919368.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    4e-06   
emb|CDY10802.1|  BnaA05g11340D                                        55.8    4e-06   
ref|XP_010540629.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    4e-06   
ref|XP_004147817.1|  PREDICTED: putative pentatricopeptide repeat...  55.8    4e-06   
ref|XP_004245400.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    4e-06   
ref|XP_010539933.1|  PREDICTED: putative pentatricopeptide repeat...  55.8    4e-06   
ref|XP_009615415.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    4e-06   
ref|XP_009777862.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    4e-06   
ref|XP_011019656.1|  PREDICTED: putative pentatricopeptide repeat...  55.5    4e-06   
gb|ACU25659.1|  pentatricopeptide repeat-containing protein           55.5    4e-06   
ref|XP_002267263.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    4e-06   
emb|CAN75494.1|  hypothetical protein VITISV_030525                   55.8    4e-06   
gb|KHG05456.1|  hypothetical protein F383_30320                       54.7    4e-06   
ref|XP_010539935.1|  PREDICTED: putative pentatricopeptide repeat...  55.8    4e-06   
ref|XP_004166285.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    4e-06   
ref|XP_008377633.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  55.8    4e-06   
ref|XP_004135985.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    4e-06   
ref|XP_011041249.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    4e-06   
gb|AEK82965.1|  pentatricopeptide repeat superfamily protein          54.3    4e-06   
ref|XP_010540625.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    4e-06   
ref|XP_008451469.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    4e-06   
gb|EPS58287.1|  hypothetical protein M569_16528                       55.5    4e-06   
ref|XP_010533434.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    4e-06   
ref|XP_006344217.1|  PREDICTED: pentatricopeptide repeat-containi...  55.5    4e-06   
gb|EPS72780.1|  hypothetical protein M569_01977                       55.8    4e-06   
ref|XP_006296607.1|  hypothetical protein CARUB_v10013192mg           55.5    4e-06   
ref|XP_002438158.1|  hypothetical protein SORBIDRAFT_10g008940        55.5    4e-06   
ref|XP_002306972.1|  hypothetical protein POPTR_0005s27160g           55.8    4e-06   
gb|KHN29017.1|  Pentatricopeptide repeat-containing protein, mito...  55.1    4e-06   
ref|XP_008660079.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    4e-06   
ref|XP_003531325.2|  PREDICTED: pentatricopeptide repeat-containi...  55.5    5e-06   
ref|XP_006423385.1|  hypothetical protein CICLE_v10028132mg           55.5    5e-06   
ref|XP_007224618.1|  hypothetical protein PRUPE_ppa026847mg           55.5    5e-06   
gb|KDO85077.1|  hypothetical protein CISIN_1g0057292mg                55.5    5e-06   
ref|XP_002436360.1|  hypothetical protein SORBIDRAFT_10g001070        55.8    5e-06   
ref|XP_007031103.1|  Tetratricopeptide repeat-like superfamily pr...  55.5    5e-06   
ref|XP_009775676.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    5e-06   
ref|XP_008229438.1|  PREDICTED: putative pentatricopeptide repeat...  55.5    5e-06   
ref|XP_010418269.1|  PREDICTED: pentatricopeptide repeat-containi...  55.5    5e-06   
ref|XP_011003802.1|  PREDICTED: putative pentatricopeptide repeat...  55.5    5e-06   
ref|XP_004500883.1|  PREDICTED: pentatricopeptide repeat-containi...  55.5    5e-06   
ref|XP_011462084.1|  PREDICTED: uncharacterized protein LOC101301280  55.8    5e-06   
gb|ACU25575.1|  pentatricopeptide repeat-containing protein           55.1    5e-06   
ref|XP_008790190.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  55.8    5e-06   
gb|ACU25577.1|  pentatricopeptide repeat-containing protein           55.1    5e-06   
gb|AHX42008.1|  pentatricopeptide repeat-containing protein 11        54.7    5e-06   
ref|XP_004500882.1|  PREDICTED: pentatricopeptide repeat-containi...  55.5    5e-06   
ref|XP_004299489.2|  PREDICTED: pentatricopeptide repeat-containi...  55.5    5e-06   
gb|ACU25584.1|  pentatricopeptide repeat-containing protein           55.1    5e-06   
gb|ACU25573.1|  pentatricopeptide repeat-containing protein           55.1    5e-06   
gb|AEK82946.1|  pentatricopeptide repeat superfamily protein          53.9    5e-06   
ref|XP_008813367.1|  PREDICTED: pentatricopeptide repeat-containi...  55.5    5e-06   
ref|XP_007139919.1|  hypothetical protein PHAVU_008G069700g           55.5    5e-06   
gb|AAM52340.1|  fertility restorer-like protein                       55.5    5e-06   
gb|AIU48583.1|  tetratricopeptide repeat-like superfamily protein     55.1    5e-06   
ref|XP_010315134.1|  PREDICTED: pentatricopeptide repeat-containi...  55.5    5e-06   
gb|AIU48558.1|  tetratricopeptide repeat-like superfamily protein     55.1    5e-06   
gb|KJB71862.1|  hypothetical protein B456_011G145000                  55.5    5e-06   
ref|XP_010418294.1|  PREDICTED: pentatricopeptide repeat-containi...  55.5    5e-06   
ref|XP_008221377.1|  PREDICTED: putative pentatricopeptide repeat...  55.5    5e-06   
gb|AIU48562.1|  tetratricopeptide repeat-like superfamily protein     55.1    5e-06   
ref|XP_002460204.1|  hypothetical protein SORBIDRAFT_02g024500        55.5    5e-06   
dbj|BAF01006.1|  hypothetical protein                                 55.5    5e-06   
ref|XP_006357891.1|  PREDICTED: pentatricopeptide repeat-containi...  55.5    5e-06   
gb|AGZ20103.1|  pentatricopeptide repeat-containing protein           55.5    5e-06   
gb|KDP35001.1|  hypothetical protein JCGZ_09289                       55.5    5e-06   
ref|XP_003573383.1|  PREDICTED: pentatricopeptide repeat-containi...  55.5    6e-06   
ref|XP_009767989.1|  PREDICTED: putative pentatricopeptide repeat...  55.5    6e-06   
gb|KFK29785.1|  hypothetical protein AALP_AA7G179200                  55.5    6e-06   
ref|XP_002515418.1|  pentatricopeptide repeat-containing protein,...  55.5    6e-06   
ref|XP_010043749.1|  PREDICTED: pentatricopeptide repeat-containi...  55.5    6e-06   
ref|XP_011081976.1|  PREDICTED: pentatricopeptide repeat-containi...  55.5    6e-06   
ref|XP_010043774.1|  PREDICTED: pentatricopeptide repeat-containi...  55.5    6e-06   
ref|XP_008347337.1|  PREDICTED: pentatricopeptide repeat-containi...  55.1    6e-06   
ref|XP_006592041.1|  PREDICTED: putative pentatricopeptide repeat...  55.5    6e-06   
ref|XP_011026595.1|  PREDICTED: putative pentatricopeptide repeat...  55.1    6e-06   
gb|AIU48538.1|  tetratricopeptide repeat-like superfamily protein     55.1    6e-06   
ref|XP_002886448.1|  hypothetical protein ARALYDRAFT_475066           54.7    6e-06   
ref|XP_009130054.1|  PREDICTED: pentatricopeptide repeat-containi...  55.5    6e-06   
ref|XP_002315827.2|  pentatricopeptide repeat-containing family p...  55.1    6e-06   
ref|XP_008802946.1|  PREDICTED: protein Rf1, mitochondrial-like       55.5    6e-06   
ref|XP_006850541.1|  hypothetical protein AMTR_s00159p00058480        55.5    6e-06   
ref|XP_001785401.1|  predicted protein                                54.7    6e-06   
gb|KHN05463.1|  Putative pentatricopeptide repeat-containing protein  55.5    6e-06   
ref|XP_004485837.1|  PREDICTED: pentatricopeptide repeat-containi...  55.1    6e-06   
ref|XP_008778587.1|  PREDICTED: pentatricopeptide repeat-containi...  55.1    6e-06   
ref|XP_008358085.1|  PREDICTED: putative pentatricopeptide repeat...  55.1    6e-06   
ref|XP_003603286.1|  Pentatricopeptide repeat-containing protein      55.5    6e-06   
gb|ACU25567.1|  pentatricopeptide repeat-containing protein           55.1    6e-06   
ref|XP_006423448.1|  hypothetical protein CICLE_v10028481mg           55.1    6e-06   
ref|XP_004231193.1|  PREDICTED: pentatricopeptide repeat-containi...  55.5    6e-06   
gb|EMS48214.1|  Protein Rf1, mitochondrial                            55.1    6e-06   
ref|XP_006303167.1|  hypothetical protein CARUB_v10008555mg           55.1    6e-06   
ref|NP_171855.1|  pentatricopeptide repeat-containing protein         55.1    6e-06   
ref|XP_008377072.1|  PREDICTED: pentatricopeptide repeat-containi...  55.1    6e-06   
gb|AFV61054.1|  pentatricopeptide repeat-containing protein 11        55.1    6e-06   
gb|KGN57153.1|  hypothetical protein Csa_3G165700                     55.1    6e-06   
ref|XP_004134500.1|  PREDICTED: LOW QUALITY PROTEIN: putative pen...  55.1    6e-06   
gb|AIU48549.1|  tetratricopeptide repeat-like superfamily protein     55.1    6e-06   
gb|AFV61023.1|  pentatricopeptide repeat-containing protein 11        55.1    6e-06   
ref|XP_010474583.1|  PREDICTED: pentatricopeptide repeat-containi...  54.7    6e-06   
ref|XP_008778583.1|  PREDICTED: pentatricopeptide repeat-containi...  55.1    6e-06   
ref|XP_004162218.1|  PREDICTED: putative pentatricopeptide repeat...  55.1    6e-06   
gb|ACU25566.1|  pentatricopeptide repeat-containing protein           54.7    6e-06   
gb|AAM97065.1|  putative membrane-associated salt-inducible protein   55.1    7e-06   
ref|XP_006494524.1|  PREDICTED: protein Rf1, mitochondrial-like       55.1    7e-06   
ref|XP_006280306.1|  hypothetical protein CARUB_v10026229mg           55.1    7e-06   
ref|XP_002985064.1|  hypothetical protein SELMODRAFT_424099           55.5    7e-06   
gb|KJB38291.1|  hypothetical protein B456_006G247100                  55.1    7e-06   
ref|XP_010462657.1|  PREDICTED: pentatricopeptide repeat-containi...  55.1    7e-06   
gb|ACN56994.1|  At1g03560-like protein                                53.1    7e-06   
ref|XP_009377129.1|  PREDICTED: putative pentatricopeptide repeat...  52.4    7e-06   
ref|XP_004955810.1|  PREDICTED: pentatricopeptide repeat-containi...  55.1    7e-06   
ref|XP_003546411.1|  PREDICTED: pentatricopeptide repeat-containi...  55.1    7e-06   
ref|XP_010921506.1|  PREDICTED: pentatricopeptide repeat-containi...  55.1    7e-06   
ref|NP_176447.1|  pentatricopeptide repeat-adenylate cyclase          55.1    7e-06   
ref|XP_010934122.1|  PREDICTED: pentatricopeptide repeat-containi...  55.1    7e-06   
gb|KCW88409.1|  hypothetical protein EUGRSUZ_A00796                   55.1    7e-06   
ref|XP_002521980.1|  pentatricopeptide repeat-containing protein,...  55.1    7e-06   
ref|XP_002863920.1|  pentatricopeptide repeat-containing protein      54.7    7e-06   



>emb|CDP15872.1| unnamed protein product [Coffea canephora]
Length=655

 Score =   216 bits (551),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 136/174 (78%), Gaps = 5/174 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF RMI++GALPN RTYTVII+HL+ SG  DSA +VF++LPQMRIKR+LKQYS++V A  
Sbjct  195  VFRRMIDEGALPNCRTYTVIIEHLLGSGHLDSAFQVFQMLPQMRIKRSLKQYSVLVAALC  254

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
             NDQ+D VK L DEMR DGILPGRAMQ SLQR+QEAGY E   EL+REMLPD RIK++A 
Sbjct  255  QNDQIDLVKTLLDEMRIDGILPGRAMQNSLQRLQEAGYVEETKELLREMLPDERIKTVAY  314

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
            ++D       +D+ + E+E+++ V   A D++QLKPWLDPAAL SALQ W PEE
Sbjct  315  ALDG-----SEDDMEDEDEDANHVDGRAVDQMQLKPWLDPAALASALQQWRPEE  363



>ref|XP_011085543.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631 
[Sesamum indicum]
Length=675

 Score =   198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 130/174 (75%), Gaps = 3/174 (2%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF RMI +GA+PN RTYTVII HL+K GK DSA E+F++LP MRI+RTLKQYS++V AF 
Sbjct  197  VFCRMIEEGAIPNCRTYTVIIQHLLKFGKLDSAVELFQMLPLMRIRRTLKQYSMLVEAFT  256

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
              D+L+ VK L  EM+ DGILPGRAM  SLQRM+EAG+ +  +ELIREM+PD RIKSI  
Sbjct  257  GADRLEVVKTLLSEMQTDGILPGRAMLLSLQRMKEAGFADETEELIREMMPDERIKSIGY  316

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
            S+ + ED+ + +++D    +     E   D +QLKPWLDPAAL S L+HWEPEE
Sbjct  317  SIVSPEDDVDVEDEDEGAGSH---LEGNKDDVQLKPWLDPAALASTLKHWEPEE  367



>ref|XP_002269506.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631 
[Vitis vinifera]
 ref|XP_010649204.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631 
[Vitis vinifera]
 ref|XP_010649205.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631 
[Vitis vinifera]
Length=660

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 128/175 (73%), Gaps = 10/175 (6%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F ++I++GA+PNSRTYTV+++HL  SGK DSA +VF +LP MRI+RTL+QYSI+V  F 
Sbjct  193  IFHKIISEGAIPNSRTYTVVLEHLANSGKLDSAIKVFNILPLMRIRRTLRQYSILVEEFT  252

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
            S ++ D VK L DEM+ DGILPGRAMQ SLQRMQEAG+    DE +R MLPD RIK++  
Sbjct  253  SINRFDVVKALLDEMQIDGILPGRAMQLSLQRMQEAGFVHETDEFLRGMLPDERIKNVGF  312

Query  362  SMDAnedededdnddgeeenSDCVSEDAG-DRLQLKPWLDPAALTSALQHWEPEE  523
             +D+          D +++ ++  S+DAG D +QLKPWLDP AL +AL +W+P E
Sbjct  313  CVDS---------SDDDDDENNHSSDDAGVDGVQLKPWLDPRALANALNNWDPNE  358



>ref|XP_006344825.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631-like 
[Solanum tuberosum]
Length=653

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 133/174 (76%), Gaps = 5/174 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF RMI +GALPN RTYT+II+HLV+S K DSA E+F +LP +RIKRTLKQYS++V AF 
Sbjct  195  VFRRMIEEGALPNCRTYTIIIEHLVRSRKLDSAIELFHMLPHVRIKRTLKQYSVLVEAFT  254

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
              +QLD VK L D+MR+DGILP RAM WSLQ+MQ AGY    +EL+R+ML DGRIK I  
Sbjct  255  IANQLDVVKVLLDQMRSDGILPVRAMLWSLQQMQSAGYDAETNELLRDMLSDGRIKMIGY  314

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
            SMD++ED+ +D++++ +  N++ V     D+  LKPWLDPA+L +ALQ+W  EE
Sbjct  315  SMDSSEDDSDDEDEEIDGNNTNAV-----DQPHLKPWLDPASLANALQNWGAEE  363



>ref|XP_009607494.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631 
[Nicotiana tomentosiformis]
Length=655

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 134/174 (77%), Gaps = 3/174 (2%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF RMI +GALPN RTYT++I+HLV+S K D A E+F +LP +R+KRTLKQYS++V AF 
Sbjct  195  VFHRMIEEGALPNCRTYTILIEHLVRSRKLDLAIELFHMLPHVRMKRTLKQYSVLVEAFS  254

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
              +QLD VK L D+M++DGILPGRAM WSLQ+MQ+AGY    +EL+ +MLPDGRIK I  
Sbjct  255  IANQLDVVKILLDQMKSDGILPGRAMLWSLQQMQDAGYDAETNELLWDMLPDGRIKKIGY  314

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
            SMD+    ++D++D+ E++ SDC   +A D+  LKPWLDPA+L +ALQ+W  EE
Sbjct  315  SMDS---SEDDNDDEDEDKESDCNHTNAVDQPHLKPWLDPASLANALQNWGAEE  365



>ref|XP_004233935.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631 
[Solanum lycopersicum]
Length=653

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 132/174 (76%), Gaps = 5/174 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F RMI +GALPN RTYT++I+HLVK+   DSA E+F +LP +RIKRTLKQYS++V AF 
Sbjct  195  LFRRMIEEGALPNCRTYTIMIEHLVKTRNLDSAIELFHMLPHVRIKRTLKQYSVLVEAFT  254

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
              +QLD VK L D+MR+DGILP RAM WSLQ+MQ AGY    +EL+R+MLPDGRIK I  
Sbjct  255  IANQLDVVKVLLDQMRSDGILPVRAMLWSLQQMQSAGYDAETNELLRDMLPDGRIKMIGY  314

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
            S D++ED+ +D++++ +  N++ V     D+  LKPWLDPA+L +ALQ+W  EE
Sbjct  315  SKDSSEDDSDDEDEEIDGNNTNAV-----DQPHLKPWLDPASLANALQNWGAEE  363



>gb|EYU39380.1| hypothetical protein MIMGU_mgv1a020943mg [Erythranthe guttata]
Length=657

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 125/174 (72%), Gaps = 7/174 (4%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF RMI++GALPN RTYTVII HL+K  K D A  +F++LP MRI+RTLKQYS++V AF 
Sbjct  197  VFCRMIDEGALPNCRTYTVIIQHLIKFEKLDPAMRIFQMLPLMRIRRTLKQYSLLVEAFT  256

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
             +  LD VK L +EMRADG+LPGRAM  SLQ M+EAGY + VDELI+E++PD RIKSI  
Sbjct  257  GSGNLDVVKTLLNEMRADGVLPGRAMITSLQHMKEAGYADEVDELIKEIIPDDRIKSIG-  315

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
                       + D+ ++   D  ++D  D ++LKPWLDPAAL SALQ+WE EE
Sbjct  316  ------YYSVVNPDEDDDVIDDDENDDVKDEVRLKPWLDPAALASALQYWEQEE  363



>ref|XP_009802251.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631 
[Nicotiana sylvestris]
Length=655

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 134/174 (77%), Gaps = 3/174 (2%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF RMI +GALPN RTYT++I+HLV+S K DSA E+F +LP +R+KRTLKQYS++V AF 
Sbjct  195  VFHRMIEEGALPNCRTYTILIEHLVRSRKLDSAIELFHMLPHVRMKRTLKQYSVLVEAFS  254

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
              +QLD VK L D+M++DGILPG+AM WSLQ+M +AGY    +EL+R+MLPD RIK I  
Sbjct  255  IANQLDVVKILLDQMKSDGILPGQAMLWSLQQMLDAGYDAETNELLRDMLPDRRIKKIGY  314

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
            SMD+    ++D++D+ E++ SDC   +A D+  LKPWLDPA+L +AL++W  EE
Sbjct  315  SMDS---SEDDNDDEDEDKESDCNHTNAVDQPHLKPWLDPASLANALRNWGAEE  365



>ref|XP_002533281.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF29113.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=652

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 121/173 (70%), Gaps = 5/173 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F RMI++GA+PNSRTYTV+I+HLVK GK DSA EVF VLP MRIKRTLKQYS++V  F+
Sbjct  194  IFYRMIDEGAIPNSRTYTVMIEHLVKLGKLDSAIEVFSVLPLMRIKRTLKQYSVLVDGFV  253

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
              ++ D VK L +EM+ DG  PGRAM  +LQRMQEAG+ E   E ++EM PD RIKSI  
Sbjct  254  GVERFDEVKKLVNEMKVDGKFPGRAMHSALQRMQEAGFVEETKEFVKEMFPDERIKSIGS  313

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPE  520
              D ++D+++D  +    +     SE     ++LKPWLDP AL +AL  W PE
Sbjct  314  CSDGSDDDEDDYENVNNGDVHTDTSE-----VRLKPWLDPKALANALSQWSPE  361



>ref|XP_008338176.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631 
[Malus domestica]
Length=657

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 127/174 (73%), Gaps = 1/174 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF  MI +GA+PNSRTYTV+I+HLV SGK+ SA EVF VLP MR+KRTL Q+S++V A +
Sbjct  195  VFSMMIEEGAIPNSRTYTVMIEHLVSSGKWKSAMEVFNVLPLMRVKRTLNQFSVLVDACV  254

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
              +Q D V++L +EMR DGILPGRAM+ SLQR+QEAG+    DE +REMLP+G IKSI  
Sbjct  255  GVEQFDEVENLLNEMRVDGILPGRAMRLSLQRIQEAGFVHETDEFLREMLPNGGIKSIKX  314

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
             +  + D D+DD++D  E+  D    D  + +QLKPWLDP +L +ALQ W  +E
Sbjct  315  CV-DSGDGDDDDDEDSGEDAGDVGGVDDVNGVQLKPWLDPRSLANALQKWNSDE  367



>ref|XP_008361374.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631-like 
isoform X1 [Malus domestica]
Length=657

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 127/174 (73%), Gaps = 1/174 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF  MI +GA+PNSRTYTV+I+HLV SGK+ SA EVF VLP MR+KRTL Q+S++V A +
Sbjct  195  VFSMMIXEGAIPNSRTYTVMIEHLVSSGKWKSAMEVFNVLPLMRVKRTLNQFSVLVDACV  254

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
              +Q D V++L +EMR DGILPGRAM+ SLQR+QEAG+    DE +REMLP+G IKSI  
Sbjct  255  GVEQFDEVENLLNEMRVDGILPGRAMRLSLQRIQEAGFVHETDEFLREMLPNGGIKSIKX  314

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
             +  + D D+DD++D  E+  D    D  + +QLKPWLDP +L +ALQ W  +E
Sbjct  315  CV-DSGDGDDDDDEDSGEDAGDVGGVDDVNGVQLKPWLDPRSLANALQKWNSDE  367



>ref|XP_008361375.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631-like 
isoform X2 [Malus domestica]
Length=638

 Score =   181 bits (458),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 127/174 (73%), Gaps = 1/174 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF  MI +GA+PNSRTYTV+I+HLV SGK+ SA EVF VLP MR+KRTL Q+S++V A +
Sbjct  195  VFSMMIXEGAIPNSRTYTVMIEHLVSSGKWKSAMEVFNVLPLMRVKRTLNQFSVLVDACV  254

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
              +Q D V++L +EMR DGILPGRAM+ SLQR+QEAG+    DE +REMLP+G IKSI  
Sbjct  255  GVEQFDEVENLLNEMRVDGILPGRAMRLSLQRIQEAGFVHETDEFLREMLPNGGIKSIKX  314

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
             +  + D D+DD++D  E+  D    D  + +QLKPWLDP +L +ALQ W  +E
Sbjct  315  CV-DSGDGDDDDDEDSGEDAGDVGGVDDVNGVQLKPWLDPRSLANALQKWNSDE  367



>ref|XP_007203181.1| hypothetical protein PRUPE_ppa025125mg [Prunus persica]
 gb|EMJ04380.1| hypothetical protein PRUPE_ppa025125mg [Prunus persica]
Length=680

 Score =   181 bits (459),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 127/174 (73%), Gaps = 5/174 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF  MI +GA+PNSRTYTV+I+HLV SGK  SA EVF VLP MR+KRTL QYS++V A +
Sbjct  222  VFHMMIEEGAIPNSRTYTVMIEHLVSSGKLQSAMEVFNVLPLMRVKRTLNQYSVLVEACV  281

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
               Q D VK L +EMR DGILPGRAM+ SL+++QEAG+ +  DE +REMLP+  IK+I+ 
Sbjct  282  GVKQFDEVKILLNEMRVDGILPGRAMRLSLEQIQEAGFVQETDEFLREMLPNEDIKNISY  341

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
             +D+++++++ D D  +    D V+E     +QLKPWLDP AL +ALQ W P+E
Sbjct  342  CVDSSDEDEDHDEDATDVGGGDDVNE-----VQLKPWLDPRALANALQKWSPDE  390



>ref|XP_008241610.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631 
[Prunus mume]
Length=663

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 125/174 (72%), Gaps = 5/174 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF  MI +GA+PNSRTYTV+I+HLV SGK  SA EVF VLP MR+KRTL QYS++V A +
Sbjct  205  VFHMMIEEGAIPNSRTYTVMIEHLVSSGKLQSAIEVFNVLPLMRVKRTLNQYSVLVEACV  264

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
               Q D VK L +EMR DGILPGRAM+ SL+++QEAG+ +  DE +REMLP+  IK+I+ 
Sbjct  265  GVKQFDEVKILLNEMRVDGILPGRAMRLSLEQIQEAGFVQETDEFLREMLPNEDIKNISY  324

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
             +D+ +++++ D D  +    D V E     +QLKPWLDP AL +ALQ W P+E
Sbjct  325  CVDSRDEDEDHDEDATDVGGGDDVIE-----VQLKPWLDPRALANALQKWSPDE  373



>ref|XP_006383263.1| hypothetical protein POPTR_0005s12980g [Populus trichocarpa]
 gb|ERP61060.1| hypothetical protein POPTR_0005s12980g [Populus trichocarpa]
Length=659

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 126/176 (72%), Gaps = 4/176 (2%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF RMI++GA+PNSRTYTV+I+HLV SGK D A E+F VLP MRIKRTLKQY ++V  F+
Sbjct  193  VFYRMIHEGAIPNSRTYTVMIEHLVNSGKLDPAIEIFSVLPLMRIKRTLKQYLVLVEGFV  252

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
              ++ D V+ L DEMRADG  PGRAM+ +LQ +QEAG+ E  +E ++EM PD RIKSI+ 
Sbjct  253  GLERFDGVRTLLDEMRADGKFPGRAMRKALQCLQEAGFVEETEEFLKEMFPDERIKSISN  312

Query  362  SMDAn---edededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPE  520
            S D +   + +++ D D+ E+EN  C   D  + ++LKPWLDP AL  AL  W P+
Sbjct  313  SGDISFDKDGDEDGDEDEDEDENHGCAFADIQE-VRLKPWLDPRALAKALNKWSPD  367



>emb|CBI17585.3| unnamed protein product [Vitis vinifera]
Length=636

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 111/174 (64%), Gaps = 32/174 (18%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F ++I++GA+PNSRTYTV+++HL  SGK DSA +VF +LP MRI+RTL+QYSI+V  F 
Sbjct  193  IFHKIISEGAIPNSRTYTVVLEHLANSGKLDSAIKVFNILPLMRIRRTLRQYSILVEEFT  252

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
            S ++ D VK L DEM+ DGILPGRAMQ SLQRMQEAG+    DE +R MLPD RIK++  
Sbjct  253  SINRFDVVKALLDEMQIDGILPGRAMQLSLQRMQEAGFVHETDEFLRGMLPDERIKNVG-  311

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
                                             LKPWLDP AL +AL +W+P E
Sbjct  312  -------------------------------FCLKPWLDPRALANALNNWDPNE  334



>ref|XP_011458353.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=635

 Score =   175 bits (444),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 126/180 (70%), Gaps = 6/180 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF RM+ +GALPN RTYTV+I H+VK GK ++A EVF+VLP MR+KR+L+QY ++V A +
Sbjct  184  VFYRMVAEGALPNCRTYTVMIKHMVKCGKLEAAMEVFKVLPFMRVKRSLRQYQVLVEACV  243

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
               Q + VK L +EMR DG+LPGRAM  SL+RMQEAG+ E  DE +REMLP+  IKSI  
Sbjct  244  GEKQFEGVKALLEEMRVDGMLPGRAMHLSLKRMQEAGFIEESDEFLREMLPNEGIKSIGY  303

Query  362  SMDAnedededdnddgeeenSDCVSE------DAGDRLQLKPWLDPAALTSALQHWEPEE  523
              D  +D+D+DD+++ +EE      +        G  +QLKPWLDP +LT+ALQ W P E
Sbjct  304  CDDCGDDDDDDDDEERDEEEDADDDDDRAGKGKEGIGVQLKPWLDPRSLTNALQSWSPNE  363



>ref|XP_011458349.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631-like 
isoform X1 [Fragaria vesca subsp. vesca]
 ref|XP_011458350.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631-like 
isoform X1 [Fragaria vesca subsp. vesca]
 ref|XP_011458351.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631-like 
isoform X1 [Fragaria vesca subsp. vesca]
 ref|XP_011458352.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=653

 Score =   175 bits (444),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 126/180 (70%), Gaps = 6/180 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF RM+ +GALPN RTYTV+I H+VK GK ++A EVF+VLP MR+KR+L+QY ++V A +
Sbjct  184  VFYRMVAEGALPNCRTYTVMIKHMVKCGKLEAAMEVFKVLPFMRVKRSLRQYQVLVEACV  243

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
               Q + VK L +EMR DG+LPGRAM  SL+RMQEAG+ E  DE +REMLP+  IKSI  
Sbjct  244  GEKQFEGVKALLEEMRVDGMLPGRAMHLSLKRMQEAGFIEESDEFLREMLPNEGIKSIGY  303

Query  362  SMDAnedededdnddgeeenSDCVSE------DAGDRLQLKPWLDPAALTSALQHWEPEE  523
              D  +D+D+DD+++ +EE      +        G  +QLKPWLDP +LT+ALQ W P E
Sbjct  304  CDDCGDDDDDDDDEERDEEEDADDDDDRAGKGKEGIGVQLKPWLDPRSLTNALQSWSPNE  363



>gb|KHN36159.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=194

 Score =   166 bits (419),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 123/175 (70%), Gaps = 1/175 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF RMI++G+LPN R+YTVII+HLVKS K   A E F +LP MRIKRTLKQYS+++  F+
Sbjct  10   VFHRMIDEGSLPNCRSYTVIIEHLVKSRKLSEALEAFNLLPSMRIKRTLKQYSVLLEGFV  69

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
             + Q D V+ L +EM  DGILP R M   LQ+M+E G  E  + L+R +LPD R++S++ 
Sbjct  70   GSKQFDEVRILVEEMLVDGILPSRGMGLLLQQMKEEGVLEGKERLLRGILPDARVRSVSY  129

Query  362  SMDAnedededdnddge-eenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
            S+D  +++++++  +G+ E  SD    D  D + LKPW+DP AL SAL++W P+E
Sbjct  130  SIDNGDEDEDENEKEGKDENISDACQCDHVDGIHLKPWMDPRALASALRNWSPDE  184



>gb|KDP31821.1| hypothetical protein JCGZ_12282 [Jatropha curcas]
Length=650

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 120/173 (69%), Gaps = 7/173 (4%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF +MI++GA+PNSRTYTV+I+HL+ SGK +SA E+F +LP MRIKRTLKQYS++V  F+
Sbjct  193  VFYKMIDEGAIPNSRTYTVMIEHLINSGKLNSAIEIFSLLPLMRIKRTLKQYSVLVEGFV  252

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
               + D VK L +EMR DG  PG  M+ +LQ MQEAG+    ++ +REM PD RIK+I  
Sbjct  253  GAKRFDEVKTLLNEMRIDGKFPGHTMRLALQHMQEAGFVHETEDFLREMFPDERIKNIGS  312

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPE  520
              D+++++D  D + G+      V  D  D ++LKPWLDP AL +AL  W PE
Sbjct  313  YTDSSDEDDNKDVNHGD------VHTDT-DEIKLKPWLDPKALANALSQWSPE  358



>ref|XP_010254978.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631 
[Nelumbo nucifera]
 ref|XP_010254979.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631 
[Nelumbo nucifera]
Length=658

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 122/174 (70%), Gaps = 7/174 (4%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F RMI++GA PNSRTYTV+I+HL  SGK DSA EVF+ LP MR+KRT +QYS++  +FI
Sbjct  201  MFSRMISEGANPNSRTYTVMIEHLANSGKLDSAEEVFKRLPSMRVKRTSRQYSVLAQSFI  260

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
               + D VK+L  EMR DGILPGR MQ SL+ MQ+AGY E  +E IRE+ PD RI  +  
Sbjct  261  LVKRFDEVKELLKEMRMDGILPGRTMQLSLKCMQDAGYLEETEEFIRELSPDERIGRVGF  320

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
             MD ++++++ D+DD   E         GD +QLKPWLDP+AL SAL  W+P E
Sbjct  321  YMDDSDNDEDGDDDDNSGEAD-------GDGIQLKPWLDPSALASALSDWKPGE  367



>ref|XP_011465460.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At5g66631 [Fragaria vesca subsp. vesca]
Length=641

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 122/174 (70%), Gaps = 4/174 (2%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF RM+ +GALPN RTYTV+I+H+VK GK ++A EVF+VLP MR+KR+L+QY ++V A +
Sbjct  184  VFYRMVEEGALPNCRTYTVMIEHMVKCGKLEAAMEVFKVLPFMRVKRSLRQYQVLVEACV  243

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
               Q + VK L +EMR DGIL GRAM  SL+RM+EAG+ E  DE +REMLP+  I SI  
Sbjct  244  GAKQFEGVKALLEEMRVDGILLGRAMLLSLERMREAGFVEESDEFLREMLPNEAISSIGY  303

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
              D ++D+D++++ D +           G  +QLKPWLDP +LT+ALQ W P E
Sbjct  304  CDDCSDDDDDEEDVDDDRAGKG----KEGSGVQLKPWLDPRSLTNALQSWSPNE  353



>ref|XP_010099338.1| hypothetical protein L484_009155 [Morus notabilis]
 gb|EXB77859.1| hypothetical protein L484_009155 [Morus notabilis]
Length=653

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 122/177 (69%), Gaps = 10/177 (6%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F RMI++GA+PN RTYT++I+HLV SGK +SA EVF +LP MRIKRTL QYS++V  F 
Sbjct  194  IFYRMIDEGAIPNCRTYTIMIEHLVNSGKLNSAMEVFGILPLMRIKRTLNQYSLLVEGFT  253

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIA-  358
               Q D V+ L +EM+ DGILPGRAM+ SL+RM+E G+ +   E + EMLPD RIK++  
Sbjct  254  GVKQFDKVQTLLEEMKVDGILPGRAMRLSLERMKEVGFVQETQEFLEEMLPDERIKTVEY  313

Query  359  CSMDAnedededdnddgeeenSDCVSEDAGD--RLQLKPWLDPAALTSALQHWEPEE  523
            C  D  +D+ +D+ DDG       V    GD   ++LK WLDP AL +ALQ W PEE
Sbjct  314  CGDDNYDDDYDDNYDDG-------VQASGGDGVGVRLKRWLDPRALATALQKWSPEE  363



>gb|KJB48471.1| hypothetical protein B456_008G070500 [Gossypium raimondii]
Length=660

 Score =   169 bits (428),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 118/172 (69%), Gaps = 8/172 (5%)
 Frame = +2

Query  5    FDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFIS  184
            F  MI+ G +PNSRTYT++I+HLV+ GK  +A EVF VLP MRIKRTLKQ+ I+V  F+ 
Sbjct  207  FRGMIDQGVIPNSRTYTIVIEHLVRLGKLGAAMEVFTVLPSMRIKRTLKQFLILVEGFVG  266

Query  185  NDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIACS  364
             ++ D VK L  EMR DG LPGRAM+  L+RM+EAG+    DE + EMLPDGRIKS+   
Sbjct  267  GERFDVVKSLLKEMREDGKLPGRAMRIYLERMKEAGFAGETDEFLVEMLPDGRIKSVGSC  326

Query  365  MDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPE  520
             D+++++++ D+D  E  +   V        +LKPWLDP AL +AL+ W PE
Sbjct  327  EDSSDEDEDGDDDVNEGVDVHTV--------KLKPWLDPKALANALKQWSPE  370



>ref|XP_010680935.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631 
[Beta vulgaris subsp. vulgaris]
Length=645

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 119/175 (68%), Gaps = 9/175 (5%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F  M+ +G  PNSRTYT++I HLV SGK D A E+F +LP+MR+KRTL+QYS++V AF+
Sbjct  194  IFRSMMQEGVFPNSRTYTLVIQHLVNSGKLDKAKEIFYILPRMRVKRTLRQYSLLVEAFL  253

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIA-  358
            +  Q +AVK L  +M+ +GILP R+M  SLQRM E G  +  D+ ++EM+PD RIK+I  
Sbjct  254  NIQQYEAVKTLLGDMKMEGILPPRSMLLSLQRMTETGVLDESDDFVKEMVPDSRIKNIEF  313

Query  359  CSMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
            C+           +DD +++  DC  E     +QLKPWLDP+AL SAL+HW  ++
Sbjct  314  CADFI--------DDDNKDDGDDCSGEAVVHSVQLKPWLDPSALASALRHWREDD  360



>ref|XP_011009884.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631-like 
[Populus euphratica]
Length=659

 Score =   166 bits (421),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 120/175 (69%), Gaps = 2/175 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF RMI++GA+PNSRTYTV+I+HLV SGK D A E+F VLP MRIKRTLKQY ++V  F+
Sbjct  193  VFYRMIHEGAIPNSRTYTVMIEHLVNSGKLDPAIEIFSVLPLMRIKRTLKQYLVLVEGFV  252

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
              ++ D V+ L DEMRADG  PGRAM+ +L  ++ AG+ E  ++ ++EM PD RIKSI+ 
Sbjct  253  GLERFDGVRTLLDEMRADGKFPGRAMRKALHCLRGAGFVEETEDFLKEMFPDERIKSIST  312

Query  362  SMDAnedededdnddgeeenSDCVSEDAGD--RLQLKPWLDPAALTSALQHWEPE  520
              D +  ED D+++D E +  +       D   ++LKPWLDP AL  AL  W P+
Sbjct  313  CRDISFGEDADEDEDEETDEDENHGGAFADIQEVRLKPWLDPRALAKALNKWSPD  367



>ref|XP_010999938.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631-like 
[Populus euphratica]
Length=659

 Score =   166 bits (421),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 120/175 (69%), Gaps = 2/175 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF RMI++GA+PNSRTYTV+I+HLV SGK D A E+F VLP MRIKRTLKQY ++V  F+
Sbjct  193  VFYRMIHEGAIPNSRTYTVMIEHLVNSGKLDPAIEIFSVLPLMRIKRTLKQYLVLVEGFV  252

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
              ++ D V+ L DEMRADG  PGRAM+ +L  ++ AG+ E  ++ ++EM PD RIKSI+ 
Sbjct  253  GLERFDGVRTLLDEMRADGKFPGRAMRKALHCLRGAGFVEETEDFLKEMFPDERIKSIST  312

Query  362  SMDAnedededdnddgeeenSDCVSEDAGD--RLQLKPWLDPAALTSALQHWEPE  520
              D +  ED D+++D E +  +       D   ++LKPWLDP AL  AL  W P+
Sbjct  313  CRDISFGEDADEDEDEETDEDENHGGAFADIQEVRLKPWLDPRALAKALNKWSPD  367



>ref|XP_007047055.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
[Theobroma cacao]
 gb|EOX91212.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
[Theobroma cacao]
Length=649

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 122/173 (71%), Gaps = 10/173 (6%)
 Frame = +2

Query  5    FDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFIS  184
            F  MI++G +PNSRTYT++I+HLV+  K D+A EVF VLP +RIKRTLKQYS+++  F+ 
Sbjct  196  FRGMIDEGVIPNSRTYTILIEHLVRLEKLDAAMEVFSVLPLIRIKRTLKQYSVLIEGFVG  255

Query  185  NDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSI-AC  361
             +Q D VK L  EM+ DG LPGRAM+  L+RM+EAG  +  DE + EMLPDGRIKSI +C
Sbjct  256  GEQFDVVKRLLKEMKEDGKLPGRAMRVYLERMKEAGCVDETDEFLVEMLPDGRIKSIGSC  315

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPE  520
               ++EDE+EDD+ +   +           +++LKPWLDP AL +AL+ W PE
Sbjct  316  EDSSDEDENEDDDMNEGVDV---------HKVELKPWLDPKALANALKEWVPE  359



>gb|KHN42021.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=642

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 126/174 (72%), Gaps = 1/174 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF RMI++G+LPN R+YTVII+HLVKS K   A EVF +LP MRIKRTL+QYS+++  F+
Sbjct  184  VFRRMIDEGSLPNCRSYTVIIEHLVKSRKLSEALEVFNLLPSMRIKRTLRQYSVLLEGFV  243

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
             + Q D V+ L +EM+ DGILP R M   LQ+M+E G  E  ++L+R +LPD  I+S++ 
Sbjct  244  GSKQFDEVRILVEEMQVDGILPSRGMGLLLQQMKEEGILEGKEQLLRGILPDETIRSVSY  303

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
            S+D+  DEDE++N+D +E  SD    +  D + LKPW+DP AL SAL++W P+E
Sbjct  304  SIDS-GDEDENENEDQDENISDAGQCNHVDGIHLKPWMDPRALVSALRNWSPDE  356



>ref|XP_003538834.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631-like 
[Glycine max]
Length=658

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 126/174 (72%), Gaps = 1/174 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF RMI++G+LPN R+YTVII+HLVKS K   A EVF +LP MRIKRTL+QYS+++  F+
Sbjct  200  VFRRMIDEGSLPNCRSYTVIIEHLVKSRKLSEALEVFNLLPSMRIKRTLRQYSVLLEGFV  259

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
             + Q D V+ L +EM+ DGILP R M   LQ+M+E G  E  ++L+R +LPD  I+S++ 
Sbjct  260  GSKQFDEVRILVEEMQVDGILPSRGMGLLLQQMKEEGILEGKEQLLRGILPDETIRSVSY  319

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
            S+D+  DEDE++N+D +E  SD    +  D + LKPW+DP AL SAL++W P+E
Sbjct  320  SIDS-GDEDENENEDQDENISDAGQCNHVDGIHLKPWMDPRALVSALRNWSPDE  372



>gb|EPS57610.1| hypothetical protein M569_17206, partial [Genlisea aurea]
Length=598

 Score =   164 bits (415),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 117/174 (67%), Gaps = 19/174 (11%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F ++  +GAL N RTYT+++ HL+K GK DSA E+F++LP M +KRTL+QYS++V AF 
Sbjct  191  MFAQITQEGALHNCRTYTIVVQHLIKLGKLDSAMELFQILPHMMVKRTLRQYSLLVEAFT  250

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
              ++ D VK L  EM+ DGILPGR+M  SLQRM+EAG+     ELI ++LPD RIK I  
Sbjct  251  DANRFDVVKALLHEMQLDGILPGRSMLSSLQRMKEAGFDSESKELINDLLPDSRIKQIGY  310

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
            S DA                    S+D  D ++LKPWLDPAAL+SAL++WEP+E
Sbjct  311  STDA-------------------SSDDDDDDVKLKPWLDPAALSSALRNWEPDE  345



>ref|XP_010029848.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631 
[Eucalyptus grandis]
 gb|KCW56819.1| hypothetical protein EUGRSUZ_I02485 [Eucalyptus grandis]
Length=664

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 119/175 (68%), Gaps = 3/175 (2%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F RMI +GA PNSRTYT II+HLV SGK DSA EVF VLP MRIKRT KQ+SI+V   +
Sbjct  195  IFHRMIVEGANPNSRTYTNIIEHLVNSGKLDSALEVFNVLPLMRIKRTSKQFSILVEGLV  254

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
            S  + D VK L   M A+G+LP RA+  SLQ M+EAG     DE++ EMLP+ RIKSI  
Sbjct  255  SVRRFDEVKILLSNMHAEGMLPVRALLCSLQHMKEAGCIHENDEILSEMLPNERIKSIEY  314

Query  362  SMDAnedededdnddgeeenSDC-VSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
             +D   D+++ + +D  E++  C V+E  G  + LKPWLDP AL +ALQ W P E
Sbjct  315  FVDDTGDDNDHEAEDEVEDDVACDVNEVNG--VNLKPWLDPRALANALQSWSPSE  367


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/118 (25%), Positives = 55/118 (47%), Gaps = 7/118 (6%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            V D MI +G  P+ +T++ ++DH  K G   +  ++F ++ Q  I+     + +++  + 
Sbjct  509  VLDEMILNGICPDIQTFSGLMDHFAKHGDIKNVQKIFGMVRQSGIEPDAYMFKVLILGYC  568

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQ-------WSLQRMQEAGYGESVDELIREMLP  334
              D+      +F++MR   +LP  A +       W   R +EA   E   E   + LP
Sbjct  569  KCDRAALAWRVFEDMRNSNLLPDYATKELLVKSLWKEGRRREAAIVEESCEETNDSLP  626



>ref|XP_003611888.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES94846.1| PPR containing plant-like protein [Medicago truncatula]
Length=659

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 122/174 (70%), Gaps = 3/174 (2%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F +M++DG++PN R+Y++II+HLVK  KF  A EVF +LP MRIKRTLKQYS+++   +
Sbjct  199  IFCKMVDDGSVPNCRSYSIIIEHLVKCRKFLEAIEVFNLLPLMRIKRTLKQYSVLIEGLV  258

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
             +   D V  L +EM+ DGILP R +   LQ++++ G+ + VDEL   + PD RIKS++ 
Sbjct  259  GSKMFDEVGVLVNEMQVDGILPSRTVSLLLQQVKDEGFLKDVDELFEGICPDERIKSVSF  318

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
            S+D++++++ +   + E E S C   D  D ++LKPWLDP +L SALQ+W P+E
Sbjct  319  SIDSSDEDENEYKGENENEVSQC---DHVDGIRLKPWLDPRSLASALQNWSPDE  369



>ref|XP_010444766.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631 
[Camelina sativa]
Length=666

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 116/172 (67%), Gaps = 10/172 (6%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
             FD+MIN+G LPNSRT+T++I+HL+K G  D+A +VF+ LP MRI RTLK YS++V AF+
Sbjct  202  TFDQMINEGGLPNSRTFTIMIEHLLKLGNLDAAMDVFKTLPLMRITRTLKHYSVLVEAFV  261

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
               +   VK L  EM+ADG  P R M   L+RM+EAG+ +  DE +REMLPD RIK I+ 
Sbjct  262  DAQRFGEVKTLLAEMKADGKFPSRRMLEPLKRMREAGFEQETDEFLREMLPDERIKYISM  321

Query  362  -SMDAnedededdnddgeeenSDCVSEDAGD-RLQLKPWLDPAALTSALQHW  511
             SMD+          D E++  D  ++D  + R++LKPWLDP AL ++L+ W
Sbjct  322  YSMDS--------PSDSEDDEGDQHNDDVNETRVKLKPWLDPKALANSLKKW  365



>gb|KDO79449.1| hypothetical protein CISIN_1g006615mg [Citrus sinensis]
Length=638

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 113/176 (64%), Gaps = 15/176 (9%)
 Frame = +2

Query  5    FDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFIS  184
            F ++I++GA+PNSRTYTV+I+HLV  GK DSA EVF  LP MRIKRT KQY I+V  F+ 
Sbjct  195  FRQVIDEGAIPNSRTYTVMIEHLVNLGKLDSALEVFSALPLMRIKRTSKQYLILVEGFVG  254

Query  185  NDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIACS  364
             ++ D  K L +EMR DG  PGRAM+ +L+RMQE G+ +  +E +REMLPD RIK++   
Sbjct  255  VERFDEAKSLLNEMRDDGKFPGRAMRVALERMQEMGFIQGANEFLREMLPDKRIKNV---  311

Query  365  MDAnedededdnddgeeenSDCVSEDAGDRL----QLKPWLDPAALTSALQHWEPE  520
                        D  +++  +    ++G R+    QLKPWLDP AL + L  W PE
Sbjct  312  --------RYYEDGSDDDEDENDDNNSGVRIAYGVQLKPWLDPKALANTLDEWSPE  359



>ref|XP_007156885.1| hypothetical protein PHAVU_002G025400g [Phaseolus vulgaris]
 gb|ESW28879.1| hypothetical protein PHAVU_002G025400g [Phaseolus vulgaris]
Length=660

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 126/175 (72%), Gaps = 1/175 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF RMI++G+LPN R+ T+II+HLVKS K   A EVF +LP MR+KRTLKQYS+++  F+
Sbjct  200  VFQRMIDEGSLPNCRSCTIIIEHLVKSRKLSEALEVFNLLPLMRVKRTLKQYSVLLEGFV  259

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
             + + D V+ L  EM+ DGILP R +   LQ+M+E G  E  ++L+R +LPD RI+ ++ 
Sbjct  260  GSKRFDEVRILVHEMQVDGILPSRGVSLLLQQMKEEGILEDKEQLLRGILPDERIRRVSY  319

Query  362  SMDAnedededdnddgeeenSDCVSE-DAGDRLQLKPWLDPAALTSALQHWEPEE  523
            S+D+ ++ ++++ ++GE EN +  S+ D  D + LKPWLDP AL SAL++W P+E
Sbjct  320  SIDSGDEAEDENENEGENENINDASQCDLVDGVHLKPWLDPRALVSALRNWSPDE  374



>ref|NP_001119513.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|B3H4P1.1|PP450_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g66631 
[Arabidopsis thaliana]
 gb|AED98242.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=661

 Score =   158 bits (399),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 112/180 (62%), Gaps = 27/180 (15%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
             FD++IN+G +PNSRT+T++I+HLVK G  D+A ++F  LP MRI RTLK YS++V AF+
Sbjct  199  TFDQIINEGGIPNSRTFTIMIEHLVKLGNLDAAMKIFETLPLMRITRTLKHYSVLVEAFV  258

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
               + D VK L  EM++DG  P R M   L+RM+EAG+    +E +REMLPD RIK I+ 
Sbjct  259  DAQRFDEVKTLIAEMKSDGKFPSRRMLEPLKRMREAGFEHETEEFLREMLPDERIKDISM  318

Query  362  -SMDAnedededdnddgeeenSDCVSEDAGD---------RLQLKPWLDPAALTSALQHW  511
             SMD                 SD  SED GD         +++LKPWLDP AL ++L+ W
Sbjct  319  YSMD---------------NPSD--SEDEGDEYKDDVNEAQVKLKPWLDPKALATSLKKW  361



>emb|CDY54208.1| BnaCnng26480D [Brassica napus]
Length=655

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 108/170 (64%), Gaps = 10/170 (6%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
             FD+MIN+G +PNSRT+T++I+HLVKSG  D+A EVF  LP MRI RTLK YS++V AF+
Sbjct  196  TFDQMINNGGIPNSRTFTIMIEHLVKSGNLDAAMEVFETLPSMRITRTLKHYSVLVEAFV  255

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
               + D VK L  EM+ADG  P R M   L+RM+EAG+ +   E +REMLPD RIK ++ 
Sbjct  256  DAQRFDRVKTLLAEMKADGKFPSRRMLEPLKRMREAGFEQETGEFLREMLPDERIKDVS-  314

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHW  511
                          +  +   +  S+    +++LKPWLDP AL ++L+ W
Sbjct  315  ---------MYSMCNPSDSEEEDESDHDDAQVKLKPWLDPKALANSLKKW  355



>ref|XP_006279534.1| hypothetical protein CARUB_v10028266mg [Capsella rubella]
 gb|EOA12432.1| hypothetical protein CARUB_v10028266mg [Capsella rubella]
Length=656

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 111/180 (62%), Gaps = 27/180 (15%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
             FD+MIN+G LPNSRT+T++I+HLVK G  D+A +VF  LP MRI RTLK YS++V AF+
Sbjct  199  TFDQMINEGGLPNSRTFTIMIEHLVKLGNLDAALKVFETLPLMRITRTLKHYSVLVEAFV  258

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
               +   VK L   M+ADG  P R M   L+ M+EAG+ +  +E +REMLPD RIK I+ 
Sbjct  259  DAQRFGVVKTLLAAMKADGKFPSRRMLEPLKCMKEAGFEQETEEFLREMLPDERIKDISL  318

Query  362  -SMDAnedededdnddgeeenSDCVSEDAGD---------RLQLKPWLDPAALTSALQHW  511
             SMD+                SD  SED GD         R++LKPWLDP AL ++L+ W
Sbjct  319  YSMDS---------------PSD--SEDEGDEQNDDVNEARVKLKPWLDPKALANSLKKW  361



>ref|XP_006466704.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631-like 
[Citrus sinensis]
Length=650

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 112/176 (64%), Gaps = 15/176 (9%)
 Frame = +2

Query  5    FDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFIS  184
            F ++I++GA+PNSRTYTV+I+HLV  GK DSA EVF  LP MRIKRT KQY I+V  F+ 
Sbjct  195  FRQVIDEGAIPNSRTYTVMIEHLVNLGKLDSALEVFSALPLMRIKRTSKQYLILVEGFVG  254

Query  185  NDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIACS  364
             ++ D  K L +EMR DG  PGR M+ +L+RMQE G+ E  +E +REMLPD RIK++   
Sbjct  255  VERFDEAKSLLNEMRDDGKFPGRDMRVALERMQEMGFIEGTNEFLREMLPDKRIKNV---  311

Query  365  MDAnedededdnddgeeenSDCVSEDAGDRL----QLKPWLDPAALTSALQHWEPE  520
                        D  +++  +    ++G R+    +LKPWLDP AL + L  W PE
Sbjct  312  --------RYYEDGSDDDEDENDDNNSGVRIAHGVRLKPWLDPKALANTLDEWSPE  359



>ref|XP_006425760.1| hypothetical protein CICLE_v10027580mg, partial [Citrus clementina]
 gb|ESR39000.1| hypothetical protein CICLE_v10027580mg, partial [Citrus clementina]
Length=635

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 112/177 (63%), Gaps = 15/177 (8%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
             F ++I++GA+PNSRTYTV+I+HLV  GK DSA EVF  LP MRIKRT KQY I+V  F+
Sbjct  179  TFRQVIDEGAIPNSRTYTVMIEHLVNLGKLDSALEVFSALPLMRIKRTSKQYLILVEGFV  238

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
              ++ D  K L +EMR DG  PGR M+ +L+RMQE G+ E  +E +REMLPD RIK++  
Sbjct  239  GVERFDEAKSLLNEMRDDGKFPGRDMRVALERMQEMGFIEGTNEFLREMLPDKRIKNV--  296

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRL----QLKPWLDPAALTSALQHWEPE  520
                         D  +++  +    ++G R+    +LKPWLDP AL + L  W PE
Sbjct  297  ---------RYYEDGSDDDEDENDDNNSGVRIAHGVRLKPWLDPKALANTLDEWSPE  344



>ref|XP_010484611.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631-like 
[Camelina sativa]
Length=659

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 109/180 (61%), Gaps = 29/180 (16%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
             FD+MIN+G LPNSRT+T++I+HL+K G  D+A  VF+ LP MRI RTLK YS++  A +
Sbjct  198  TFDQMINEGGLPNSRTFTIMIEHLLKLGNLDAAMNVFKTLPLMRITRTLKHYSVLFEACV  257

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
               +   VK L  EM+ADG  P R +   L+RM+EAG+ +  DE +REMLPD RIK I+ 
Sbjct  258  HALRFGEVKTLLAEMKADGKFPSRRLLEPLKRMREAGFEQETDEFLREMLPDERIKDISM  317

Query  362  -SMDAnedededdnddgeeenSDCVSEDAGD---------RLQLKPWLDPAALTSALQHW  511
             SMD+                    SED GD         R++LKPWLDP AL ++L+ W
Sbjct  318  YSMDSP-------------------SEDEGDEHNDDVNETRVKLKPWLDPKALANSLKKW  358



>ref|XP_009103500.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631 
[Brassica rapa]
Length=661

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 111/170 (65%), Gaps = 7/170 (4%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
             FD MIN+G +PNSRT+T++I+HLVKSG  D+A EVF  LP MRI RTLK YS++V AF+
Sbjct  199  TFDHMINNGGIPNSRTFTIMIEHLVKSGNLDAAMEVFETLPSMRITRTLKHYSVLVEAFV  258

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
               +   VK L  EM++DG  P R M   L+RM+EAG+ E   E +REMLPD R+K ++ 
Sbjct  259  DAQRFGQVKTLLAEMKSDGKFPSRRMFEPLKRMREAGFEEETGEFLREMLPDERVKDVSM  318

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHW  511
                N  + E++ ++ E E  D        +++LKPWLDP AL ++L+ W
Sbjct  319  YSMCNPSDSEEEKEEEEPERDDA-------QVKLKPWLDPKALANSLKKW  361



>ref|XP_006393857.1| hypothetical protein EUTSA_v10005592mg [Eutrema salsugineum]
 gb|ESQ31143.1| hypothetical protein EUTSA_v10005592mg [Eutrema salsugineum]
Length=661

 Score =   155 bits (392),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 112/170 (66%), Gaps = 3/170 (2%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
             FD MIN G +PNSRT+T++I+HLVK G  D+A ++F  LP MRI RTLK YS+++ AF+
Sbjct  196  TFDHMINHGGIPNSRTFTIMIEHLVKLGNLDAAMKIFETLPLMRITRTLKHYSVLIEAFV  255

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
               +   VK L  EM+ADG  P R M   L+RM++AG+ +   EL+REMLPD RIK I+ 
Sbjct  256  DAQRYGEVKILLAEMKADGKFPSRRMLEPLKRMRDAGFEQESQELLREMLPDERIKDIST  315

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHW  511
            S   +   D ++  + +E + D  SE    +++LKPWLDP AL S+L+ W
Sbjct  316  SYSMDNPSDTEEEKEDDEHSYDDASE---GQVKLKPWLDPKALASSLKSW  362



>emb|CDY45248.1| BnaA07g12420D [Brassica napus]
Length=657

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 114/170 (67%), Gaps = 11/170 (6%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
             FD MIN+G +PNSRT+T++I+HLVKSG  D+A EVF  LP MRI RTLK YS++V AF+
Sbjct  199  TFDHMINNGGIPNSRTFTIMIEHLVKSGNLDAAMEVFETLPSMRITRTLKHYSVLVEAFV  258

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
               +   VK L  EM+ADG  P R +   L+RM+EAG+ E   E +REMLPD R+K +  
Sbjct  259  DAQRFVQVKTLLAEMKADGKFPSRRLFEPLKRMREAGFEEETGEFLREMLPDERVKDV--  316

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHW  511
            SM + +D +E + ++ E +++         +++LKPWLDP AL ++L+ W
Sbjct  317  SMYSMDDPNESEEEEPERDDA---------QVKLKPWLDPKALANSLKKW  357



>ref|XP_010558041.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631 
[Tarenaya hassleriana]
 ref|XP_010558049.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631 
[Tarenaya hassleriana]
 ref|XP_010558058.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631 
[Tarenaya hassleriana]
 ref|XP_010558066.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631 
[Tarenaya hassleriana]
 ref|XP_010558074.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631 
[Tarenaya hassleriana]
Length=654

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 111/185 (60%), Gaps = 31/185 (17%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
             F+RMIN+G +PNSRT+TV+I+HLV  G  D A ++F++LP MRI RTLK YS+++ A +
Sbjct  196  TFERMINEGGIPNSRTFTVMIEHLVNLGNLDGAVDIFKILPSMRITRTLKHYSVLIEAIV  255

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSI-A  358
              ++   VK L  EM+ADG  PGR M   L+RM++ G+ + V+E + EM PD RIK I  
Sbjct  256  GEERFGEVKTLLSEMKADGKFPGRRMLGPLKRMKDMGFEQEVEEFLGEMSPDERIKDIYG  315

Query  359  CSMDAnedededdnddgeeenSDCVSEDAGDR------------LQLKPWLDPAALTSAL  502
             SM++                SD   ++ GDR            ++LKPWLDP AL  AL
Sbjct  316  YSMES---------------PSD---DEEGDRNDGDDSDGEEVAVKLKPWLDPKALAGAL  357

Query  503  QHWEP  517
            ++W P
Sbjct  358  KNWNP  362



>gb|KFK28339.1| hypothetical protein AALP_AA8G503500 [Arabis alpina]
Length=1000

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 110/180 (61%), Gaps = 27/180 (15%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
             FD M+N+G +PNSRT+T++I+HLV  G  D+A +VF  LP MRI RTLK YS++VGAF+
Sbjct  541  TFDLMVNEGGIPNSRTFTIMIEHLVSLGNLDAAMKVFETLPLMRITRTLKHYSVLVGAFV  600

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
               +   VK L  EM+ADG  P R M   L+RM+EAG+ +  +E + EMLPD RIK I+ 
Sbjct  601  DAQRFGEVKVLLAEMKADGKFPSRRMLEPLKRMREAGFEQETEEFLSEMLPDERIKDISM  660

Query  362  -SMDAnedededdnddgeeenSDCVSEDAGD---------RLQLKPWLDPAALTSALQHW  511
             SMD                 SD  SE+ GD         +++LKPWLDP AL ++L+ W
Sbjct  661  YSMD---------------NPSD--SEEEGDEHNDDVNEGQVKLKPWLDPKALANSLKKW  703



>ref|XP_002866749.1| hypothetical protein ARALYDRAFT_920064 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43008.1| hypothetical protein ARALYDRAFT_920064 [Arabidopsis lyrata subsp. 
lyrata]
Length=661

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 110/180 (61%), Gaps = 27/180 (15%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
             FD++ N G +PNSRT+T++I+HLVK G  D+A +VF  LP MRI RTLK YS++V AF+
Sbjct  199  TFDQITNQGGIPNSRTFTIMIEHLVKLGNLDAAMKVFETLPLMRITRTLKHYSVLVEAFV  258

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
            +  +   VK L  EM+ADG  P R M   L+ M+EAG+ +  +E +REMLPD RIK I+ 
Sbjct  259  NAQRFGEVKTLLAEMKADGKFPSRRMLEPLKLMREAGFEQETEEFLREMLPDERIKDISI  318

Query  362  -SMDAnedededdnddgeeenSDCVSEDAGD---------RLQLKPWLDPAALTSALQHW  511
             SMD                 SD  SE+ GD         +++LKPWLDP AL ++L+ W
Sbjct  319  YSMD---------------NPSD--SEEEGDEHNDNVNEGQVKLKPWLDPKALATSLKKW  361



>ref|XP_004512000.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631-like 
[Cicer arietinum]
Length=654

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 115/175 (66%), Gaps = 12/175 (7%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF +M+++G+LPN R++++II+HLVK  KF  A EVF  LP MRIKRTLKQY +++   +
Sbjct  201  VFHKMVDEGSLPNCRSFSIIIEHLVKCRKFWEAIEVFNSLPLMRIKRTLKQYFVLIEGLV  260

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
             +   D +  L +EM+ DGILP R +   LQR+++ G+ + +DEL  ++ PD RIK++  
Sbjct  261  GSKLFDEIGVLVNEMQVDGILPSRTLSLLLQRVKDEGFLKDIDELFSDICPDKRIKNVRY  320

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDR-LQLKPWLDPAALTSALQHWEPEE  523
            S+D+            +E+ ++ V ED  +  + LKPWLDP +L SALQ+W P+E
Sbjct  321  SIDS-----------NDEDGNENVDEDEDENGIHLKPWLDPRSLASALQNWSPDE  364



>ref|XP_010936047.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At5g66631 [Elaeis guineensis]
Length=680

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 118/174 (68%), Gaps = 2/174 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
             F++MI +GA PNSRTYT+IIDHL++SG  D A EVF +LP MRI+RT KQY+++  A  
Sbjct  218  TFNQMIQEGANPNSRTYTIIIDHLIRSGNLDHAIEVFHLLPSMRIRRTSKQYNVLAEALS  277

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
            S+ +   ++ L   M +DGILPGR+M+ ++ RM+EAG+    +E ++ + PD RI  IA 
Sbjct  278  SSGRFVDLEKLIKAMNSDGILPGRSMREAISRMREAGHTTGTEEFVKILFPDARI-GIAV  336

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
              + +E+E +++ D  E+ + +    D  D+++LKPWLDP AL  AL+ W+P E
Sbjct  337  EEEESEEETDEEPDKEEDSDDN-PKNDGSDQVKLKPWLDPIALAKALEDWDPAE  389



>ref|XP_010465170.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631-like 
[Camelina sativa]
Length=666

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 115/171 (67%), Gaps = 9/171 (5%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
             FD+MIN+G L NSRT+T++I+HL+K G  D A  VF+ LP MRI RTLK YS++V AF+
Sbjct  203  TFDQMINEGGLSNSRTFTIMIEHLLKLGNLDEAMNVFKTLPLMRITRTLKHYSVLVEAFV  262

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
               +   VK L  E++ADG  P R M   L+RM+EAG+ +  +E +REMLPD RIK I+ 
Sbjct  263  DAQRFGEVKTLLCELKADGKFPSRRMLEPLKRMREAGFEQETEEFLREMLPDERIKDISM  322

Query  362  -SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHW  511
             S+D+  D +++  ++ ++     VSE    +++LKPWLDP AL ++L+ W
Sbjct  323  YSVDSPSDSEDEGEEENDD-----VSE---AQVKLKPWLDPKALANSLKKW  365



>ref|XP_008796384.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At5g66631 [Phoenix dactylifera]
Length=668

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 112/174 (64%), Gaps = 7/174 (4%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
             FD+MI +GA PNSRTYT+IIDHL++SG  + A EVF +LP MRI+RT KQY+++  A  
Sbjct  215  TFDQMIQEGANPNSRTYTIIIDHLIRSGNLEQAIEVFHLLPSMRIRRTSKQYNVLADALS  274

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
            S+ +   ++ L   M  DGILPGR+M+ ++ RM+EAG+    +E ++ + PD RI     
Sbjct  275  SSGRFVDLEKLIKAMNYDGILPGRSMREAISRMREAGHTTGTEEFVKILSPDDRI-----  329

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
                  +E+E++ ++ EE   D    D   +++LKPWLDP AL  AL+ W+P E
Sbjct  330  --GFAVEEEENEEEEEEEAPDDNQKNDGSGQIKLKPWLDPIALARALEDWDPTE  381



>ref|XP_009420369.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631 
[Musa acuminata subsp. malaccensis]
Length=666

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 107/174 (61%), Gaps = 7/174 (4%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
             F +MI +GA PNSRTYTVII HLV+SG  D+ATE+F +LP MR   T KQY ++  A+ 
Sbjct  212  TFSQMIQEGANPNSRTYTVIIRHLVRSGHLDAATEIFHLLPSMRTPHTSKQYEVLAEAYS  271

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
            S    D +  L  EM +DGILPG AM+ ++ +M+ AG+    +E ++E+ P+ RI  I  
Sbjct  272  SAGLFDELGRLVKEMNSDGILPGPAMRAAMAKMRAAGHIVGTEEFVQELFPNDRIADIVS  331

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
                 E  +E+D+        D   +  GDR++LKPWL+P AL  AL+ W+P E
Sbjct  332  DSGDEEGCEEEDSR-------DKDDDIEGDRIRLKPWLEPTALARALEDWDPNE  378



>ref|NP_001172197.1| Os01g0167750 [Oryza sativa Japonica Group]
 dbj|BAD68304.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD68308.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAH90927.1| Os01g0167750 [Oryza sativa Japonica Group]
Length=628

 Score =   127 bits (319),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 108/174 (62%), Gaps = 2/174 (1%)
 Frame = +2

Query  5    FDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFIS  184
            F  M+ +GALPN+RTYTV+I+HL  +G  D A EVFR+LP +R +RT +QY+++  A  S
Sbjct  158  FRAMVREGALPNARTYTVVIEHLASAGFVDQAVEVFRLLPSLRARRTTRQYNVLAEALAS  217

Query  185  NDQLDAVKDLFDEMRA-DGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
              + D ++ L  EM A DG++PG  M+ ++  M+EAG+ E  ++ + E+ P+ RI     
Sbjct  218  AGKFDQLRWLVREMVAVDGVMPGPQMRAAIAAMREAGHAEGTEDFVEELSPNERIGYAVD  277

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
             +D   D D+++ +  +++  D   +  G R  LKPWLDP  L  AL+ WEP E
Sbjct  278  DVDGEGDSDDEEEEGDDDDGVDGRDKGRG-RATLKPWLDPRELARALEGWEPRE  330


 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/120 (23%), Positives = 57/120 (48%), Gaps = 10/120 (8%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            + + M++ G LP+ +T++ +++HL  +G+      +  ++ Q  ++     YS+++  + 
Sbjct  473  LLEEMMSRGVLPDLQTFSGLMEHLAGAGELKGVHRLLGLVRQCELQPDGYMYSVLIKVYC  532

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQ-------WSLQRMQEAGYGESVDELIREMLPDG  340
              ++      LFDEMR  G+ P    +       W   +++EA     V+E   E   DG
Sbjct  533  KKERAALALKLFDEMRGAGVAPDAPTKALLVKSLWREGKLREAA---QVEERCEEAAGDG  589



>gb|EAY72686.1| hypothetical protein OsI_00553 [Oryza sativa Indica Group]
Length=628

 Score =   127 bits (319),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 108/174 (62%), Gaps = 2/174 (1%)
 Frame = +2

Query  5    FDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFIS  184
            F  M+ +GALPN+RTYTV+I+HL  +G  D A EVFR+LP +R +RT +QY+++  A  S
Sbjct  158  FRAMVREGALPNARTYTVVIEHLASAGFVDQAVEVFRLLPSLRARRTTRQYNVLAEALAS  217

Query  185  NDQLDAVKDLFDEMRA-DGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
              + D ++ L  EM A DG++PG  M+ ++  M+EAG+ E  ++ + E+ P+ RI     
Sbjct  218  AGKFDQLRWLVREMVAVDGVMPGPQMRAAIAAMREAGHAEGTEDFVEELSPNERIGYAVD  277

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
             +D   D D+++ +  +++  D   +  G R  LKPWLDP  L  AL+ WEP E
Sbjct  278  DVDGEGDSDDEEEEGDDDDGVDGRDKGRG-RATLKPWLDPRELARALEGWEPRE  330


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 58/120 (48%), Gaps = 10/120 (8%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            + + M++ G LP+ +T++ +++HL  +G+      +  ++ Q  ++     YS+++ A+ 
Sbjct  473  LLEEMMSRGVLPDLQTFSGLMEHLAGAGELKGVHRLLGLVRQCELQPDGYMYSVLIKAYC  532

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQ-------WSLQRMQEAGYGESVDELIREMLPDG  340
              ++      LFDEMR  G+ P    +       W   +++EA     V+E   E   DG
Sbjct  533  KKERAALALKLFDEMRGAGVAPDAPTKALLVKSLWREGKLREAA---QVEERCEEAAGDG  589



>gb|EAZ10688.1| hypothetical protein OsJ_00518 [Oryza sativa Japonica Group]
Length=644

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 108/174 (62%), Gaps = 2/174 (1%)
 Frame = +2

Query  5    FDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFIS  184
            F  M+ +GALPN+RTYTV+I+HL  +G  D A EVFR+LP +R +RT +QY+++  A  S
Sbjct  158  FRAMVREGALPNARTYTVVIEHLASAGFVDQAVEVFRLLPSLRARRTTRQYNVLAEALAS  217

Query  185  NDQLDAVKDLFDEMRA-DGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
              + D ++ L  EM A DG++PG  M+ ++  M+EAG+ E  ++ + E+ P+ RI     
Sbjct  218  AGKFDQLRWLVREMVAVDGVMPGPQMRAAIAAMREAGHAEGTEDFVEELSPNERIGYAVD  277

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
             +D   D D+++ +  +++  D   +  G R  LKPWLDP  L  AL+ WEP E
Sbjct  278  DVDGEGDSDDEEEEGDDDDGVDGRDKGRG-RATLKPWLDPRELARALEGWEPRE  330



>dbj|BAB39907.1| P0028E10.11 [Oryza sativa Japonica Group]
Length=736

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 108/174 (62%), Gaps = 2/174 (1%)
 Frame = +2

Query  5    FDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFIS  184
            F  M+ +GALPN+RTYTV+I+HL  +G  D A EVFR+LP +R +RT +QY+++  A  S
Sbjct  158  FRAMVREGALPNARTYTVVIEHLASAGFVDQAVEVFRLLPSLRARRTTRQYNVLAEALAS  217

Query  185  NDQLDAVKDLFDEMRA-DGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
              + D ++ L  EM A DG++PG  M+ ++  M+EAG+ E  ++ + E+ P+ RI     
Sbjct  218  AGKFDQLRWLVREMVAVDGVMPGPQMRAAIAAMREAGHAEGTEDFVEELSPNERIGYAVD  277

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
             +D   D D+++ +  +++  D   +  G R  LKPWLDP  L  AL+ WEP E
Sbjct  278  DVDGEGDSDDEEEEGDDDDGVDGRDKGRG-RATLKPWLDPRELARALEGWEPRE  330



>ref|XP_002455122.1| hypothetical protein SORBIDRAFT_03g004720 [Sorghum bicolor]
 gb|EES00242.1| hypothetical protein SORBIDRAFT_03g004720 [Sorghum bicolor]
Length=652

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 106/174 (61%), Gaps = 7/174 (4%)
 Frame = +2

Query  5    FDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFIS  184
            F RM+ +GALPN+RTYTV+I HL  +G  D A EVFR+LP +R++RT +QY+++  A  S
Sbjct  188  FRRMVREGALPNARTYTVVIAHLASAGFVDQALEVFRILPSLRVRRTTRQYNVLAEALAS  247

Query  185  NDQLDAVKDLFDEMRA-DGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
              + D ++ L  EM A DG++PG  M+ ++  M+E G+ +  ++ + E+ P+ R   I  
Sbjct  248  TGRFDQLRWLVREMAAVDGVMPGPQMRAAIAAMREDGHIDGTEDFVEELSPNAR---IGY  304

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
            ++D  E E + + +D + E  D      G++  LKPWLDP  L  AL  W+  E
Sbjct  305  AVDDVEGEGDSEEEDEQGEEKD---RSNGEKQTLKPWLDPRELARALDGWDSRE  355



>ref|NP_001183205.1| hypothetical protein [Zea mays]
 ref|XP_008673324.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008673325.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008673326.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008673327.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACR36053.1| unknown [Zea mays]
 tpg|DAA53304.1| TPA: hypothetical protein ZEAMMB73_741646 [Zea mays]
Length=629

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 106/174 (61%), Gaps = 3/174 (2%)
 Frame = +2

Query  5    FDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFIS  184
            F RM+ +GALPN+RTYTV+I HL  +G  D A EVFR+LP +R++RT +QY+++  A  S
Sbjct  162  FRRMVREGALPNARTYTVVIAHLASAGFVDQALEVFRILPSLRVRRTTRQYNVLAEALAS  221

Query  185  NDQLDAVKDLFDEMRA-DGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
              + D ++ L  EM A DG++PG  M+ ++  ++EAG+ +   + + E+ P+ RI     
Sbjct  222  GGRFDQLRWLVREMAAVDGVMPGPQMRAAIAALREAGHVDGTKDFVEELSPNARIGYAVD  281

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
             ++   D +E+D+DD +E          G++  LKPWLDP  L  AL  W+  E
Sbjct  282  DVEGEGDGEEEDDDDEDEGEVK--DRGNGEKQTLKPWLDPRELARALDGWDSRE  333


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/119 (24%), Positives = 57/119 (48%), Gaps = 7/119 (6%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            + + M+  G LP+ +T++ +++HL  +G       +  ++ Q  ++     YS++V A+ 
Sbjct  476  LLEEMMARGVLPDLQTFSGLMEHLAGAGDLKGVHRLLGLVRQCELQPDGYMYSVLVRAYC  535

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQ-------WSLQRMQEAGYGESVDELIREMLPD  337
              ++      +FDEMRA G+ P    +       W   +++EA   E     + + LPD
Sbjct  536  KRERAALALRVFDEMRAAGVTPDAPTKALLVKSLWREGKLREAALVEERCNDVVDGLPD  594



>dbj|BAJ89459.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=624

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 105/174 (60%), Gaps = 9/174 (5%)
 Frame = +2

Query  5    FDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFIS  184
            F  M+ +GALPN+RTYTV++ HL  +G  D A EVFR+LP +RI+RT +QY+++  A   
Sbjct  154  FGAMVREGALPNARTYTVVVSHLAGAGFVDQALEVFRLLPSLRIRRTTRQYNVLAEALAE  213

Query  185  NDQLDAVKDLFDEMRA-DGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
              + D ++ L  EM A DG++PG   + ++  M+EAG+ E  ++ + E+ PD RI     
Sbjct  214  AGRFDQLRWLVREMAAVDGVMPGPQTRAAIAAMREAGHTEGTEDFVEELSPDARIPYAVG  273

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHWEPEE  523
              DA+ + D ++ +DG ++         G    L+PWLDP  L  AL+ W+P+E
Sbjct  274  --DADGEGDSEEEEDGGKDTPR------GKETPLRPWLDPRELARALEGWDPKE  319


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/113 (25%), Positives = 54/113 (48%), Gaps = 10/113 (9%)
 Frame = +2

Query  14   MINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISNDQ  193
            M   G LP+ +T++ +I+HL  +G       +F ++ Q  ++     Y++++ A+   ++
Sbjct  467  MATRGVLPDLQTFSGLIEHLAGAGDLKGVHRLFGMVRQCELRPDGHMYAVLIRAYCKRER  526

Query  194  LDAVKDLFDEMRADGILPGRAMQ-------WSLQRMQEAGYGESVDELIREML  331
                  LFDEMR  G+ P    +       W   +++EA     V+E   EM+
Sbjct  527  AALALKLFDEMRGAGVAPDAPTKALLVKSLWREGKLREAAL---VEERCEEMI  576



>ref|XP_006643794.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631-like, 
partial [Oryza brachyantha]
Length=521

 Score =   118 bits (295),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 108/177 (61%), Gaps = 10/177 (6%)
 Frame = +2

Query  5    FDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFIS  184
            F  M+ +GALPN+RTYTV+I HL  +G  D A EVFR+LP +R +RT +QY+++  A  +
Sbjct  56   FRSMVREGALPNARTYTVVIAHLASAGFVDQALEVFRLLPSLRARRTTRQYNVLAEALAA  115

Query  185  NDQLDAVKDLFDEMRA-DGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
              + + ++ L  EM A DG++PG  M+ ++  M+E G+ E  ++ + E+ P+ RI     
Sbjct  116  AGKFEQLRWLVREMVAGDGVMPGPQMRAAIAAMREEGHTEGTEDFLEELSPNERIGY---  172

Query  362  SMDAnedededdnddgeeenSDCVSEDAG-DRLQ--LKPWLDPAALTSALQHWEPEE  523
               A +D + + + + EE++ D  + D G  R Q  LKPWLDP  L  AL+ WEP E
Sbjct  173  ---AVDDVEGEGDSEEEEDDEDAANRDKGRGRAQATLKPWLDPRELARALEGWEPRE  226



>ref|XP_009379190.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At5g66631 [Pyrus x bretschneideri]
Length=255

 Score =   113 bits (282),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 75/111 (68%), Gaps = 3/111 (3%)
 Frame = +2

Query  5    FDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFIS  184
            F  MI +G  P     TV+I+HL+ SG   SA EVF VLP MR+ RTL Q+S++V A + 
Sbjct  72   FGMMIEEGGSPEVGLKTVMIEHLLSSG---SAMEVFNVLPLMRVNRTLNQFSVLVEACVD  128

Query  185  NDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPD  337
             +Q D VK+L +E+R DGILP  AM+ SL+R+Q+AG+     E +REMLP+
Sbjct  129  VEQFDEVKNLLNEIRVDGILPAHAMRLSLERIQKAGFVHETXEFLREMLPN  179



>ref|XP_004968314.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631-like 
[Setaria italica]
Length=631

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 109/179 (61%), Gaps = 12/179 (7%)
 Frame = +2

Query  5    FDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFIS  184
            F  M+ +GALPN+RTYTV+I HL  +G  D A EVFR+LP +R++RT +QY+++  A  +
Sbjct  162  FRGMVREGALPNARTYTVVIAHLASAGFVDQALEVFRILPSLRVRRTTRQYNVLAEALAA  221

Query  185  NDQLDAVKDLFDEMRA-DGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIAC  361
             ++ D ++ L  EM A DG++PG  M+ ++  M+E G+ +  ++ + E+ P+ RI     
Sbjct  222  AERFDELRWLVREMAAVDGVMPGPQMRAAIAAMREGGHIDGTEDFVAELSPNARIGY---  278

Query  362  SMDAnedededdnddgeeenSDCVSEDAGDR-----LQLKPWLDPAALTSALQHWEPEE  523
               A +D + + + + E++++  V+ D  DR       LKPWLDP  L  AL  W+P E
Sbjct  279  ---AVDDVEGEGDSEEEDDDNVGVNHDDRDRGSSANQTLKPWLDPRELARALDGWDPRE  334


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/119 (24%), Positives = 57/119 (48%), Gaps = 7/119 (6%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            + + M+  G LP+ +T++ +++HL  +G       +  ++ Q  ++     YS++V A+ 
Sbjct  477  LLEEMMARGVLPDLQTFSGLMEHLAGAGDLKGVHRLLGLVRQCELRPDGYMYSVLVRAYC  536

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQ-------WSLQRMQEAGYGESVDELIREMLPD  337
              ++      +FDEMRA G+ P    +       W   +++EA   E   E +   LP+
Sbjct  537  KRERAALALRVFDEMRAAGVAPDAPTKALLVKSLWREGKLREAALVEERCEDVTGGLPE  595



>ref|XP_006853154.1| hypothetical protein AMTR_s00038p00179320 [Amborella trichopoda]
 gb|ERN14621.1| hypothetical protein AMTR_s00038p00179320 [Amborella trichopoda]
Length=709

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 105/184 (57%), Gaps = 13/184 (7%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F  M+N G LPNSRTYTVII H+V  GK     EVF+ LP MR+KRT  QY++++ AF 
Sbjct  229  LFLYMLNKGNLPNSRTYTVIIRHMVDMGKAKEGFEVFKRLPGMRVKRTRLQYTLLIQAFS  288

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLP-DGRIKSIA  358
                 D V  L  +M+ DG+LP R+   S+Q +++ G  +  +E++++    D RI SI 
Sbjct  289  QLGDSDMVLVLVRDMQKDGVLPMRS---SVQALRKVGLKKEAEEMVKDFFTLDSRIGSIQ  345

Query  359  CS---------MDAnedededdnddgeeenSDCVSEDAGDRLQLKPWLDPAALTSALQHW  511
             S             + +D+ D D+ ++++ D   +   + + LKPW+DP A+ S L+ W
Sbjct  346  GSSLCTSFFDDDQEGDVDDDGDGDNDDDDDDDNGLDGNDELVSLKPWVDPYAIASCLRDW  405

Query  512  EPEE  523
            +  E
Sbjct  406  DHAE  409



>dbj|BAK04418.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=565

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 69/124 (56%), Gaps = 12/124 (10%)
 Frame = +2

Query  8    DRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISN  187
            D M   G  PNSRTY +I+ HL+KS K + A  VF+ + +   +  L  Y++MVG F SN
Sbjct  413  DEMRKSGIGPNSRTYDIILHHLIKSQKIEEAYNVFQGMSKDGCEPQLNTYTMMVGMFCSN  472

Query  188  DQLDAVKDLFDEMRADGILPGRAMQWSL-------QRMQEAG--YGESVDELIREMLPDG  340
            +++D    ++++M+  G+LP   M  +L        R++EA   + E +D  IR   P G
Sbjct  473  ERVDVALKVWNQMKEKGVLPCMHMFSALINGLCFENRLEEACAYFQEMLDRGIR---PPG  529

Query  341  RIKS  352
            ++ S
Sbjct  530  QLFS  533



>ref|XP_004956188.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial-like [Setaria italica]
Length=557

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 67/115 (58%), Gaps = 12/115 (10%)
 Frame = +2

Query  35   PNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISNDQLDAVKDL  214
            PNSRTY +I+ HL+KS KF+ A +VF+ +     +  L  Y++MVG F SN+++D    +
Sbjct  414  PNSRTYDIILHHLIKSQKFEEAYDVFQKMGMDGCEPQLNTYTMMVGMFCSNERVDMALKV  473

Query  215  FDEMRADGILPGRAMQWSL-------QRMQEAG--YGESVDELIREMLPDGRIKS  352
            + +M+  G+LP   M  +L        R++EA   + E +D+ IR   P G++ S
Sbjct  474  WKQMKEKGVLPCMHMFSALINGLCFENRLEEACAYFQEMLDKGIR---PPGQLFS  525



>gb|EMS49071.1| hypothetical protein TRIUR3_09168 [Triticum urartu]
Length=534

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 69/124 (56%), Gaps = 12/124 (10%)
 Frame = +2

Query  8    DRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISN  187
            D M   G  PNSRTY +I+ HL+KS K + A  VF+ + +   +  L  Y++MV  F SN
Sbjct  382  DEMRKSGIGPNSRTYDIILHHLIKSQKIEEAYNVFQGMGKDGCEPQLNTYTMMVSMFCSN  441

Query  188  DQLDAVKDLFDEMRADGILPGRAMQWSL-------QRMQEAG--YGESVDELIREMLPDG  340
            +++D    ++++M+  G+LP   M  +L        R++EA   + E +D+ IR   P G
Sbjct  442  ERVDVALKVWNQMKEKGVLPCMHMFSALINGLCFENRLEEACVYFQEMLDKGIR---PPG  498

Query  341  RIKS  352
            ++ S
Sbjct  499  QLFS  502



>gb|EMT24513.1| hypothetical protein F775_06744 [Aegilops tauschii]
Length=539

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 69/124 (56%), Gaps = 12/124 (10%)
 Frame = +2

Query  8    DRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISN  187
            D M   G  PNSRTY +I+ HL+KS K + A  VF+ + +   +  L  Y++MV  F SN
Sbjct  387  DEMRKSGIGPNSRTYDIILHHLIKSQKIEEAYNVFQGMGKDGCEPQLNTYTMMVSMFCSN  446

Query  188  DQLDAVKDLFDEMRADGILPGRAMQWSL-------QRMQEAG--YGESVDELIREMLPDG  340
            +++D    ++++M+  G+LP   M  +L        R++EA   + E +D+ IR   P G
Sbjct  447  ERVDVALKVWNQMKEKGVLPCMHMFSALINGLCFENRLEEACVYFQEMLDKGIR---PPG  503

Query  341  RIKS  352
            ++ S
Sbjct  504  QLFS  507



>ref|NP_001043145.1| Os01g0505500 [Oryza sativa Japonica Group]
 dbj|BAD73118.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza 
sativa Japonica Group]
 dbj|BAF05059.1| Os01g0505500 [Oryza sativa Japonica Group]
 gb|EAZ12059.1| hypothetical protein OsJ_01942 [Oryza sativa Japonica Group]
Length=540

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 70/124 (56%), Gaps = 12/124 (10%)
 Frame = +2

Query  8    DRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISN  187
            D M   G  PN+RTY +I++HL+KS K + A  +F+ + +   +  L  Y++MVG F SN
Sbjct  388  DEMRKSGIGPNTRTYDIILNHLIKSEKIEEAYNLFQRMERDGCEPELNTYTMMVGMFCSN  447

Query  188  DQLDAVKDLFDEMRADGILPGRAMQWSL-------QRMQEAG--YGESVDELIREMLPDG  340
            +++D    ++ +M+  G+LP   M  +L        R++EA   + E +D+ IR   P G
Sbjct  448  ERVDMALKVWKQMKEKGVLPCMHMFSALINGLCFENRLEEACVYFQEMLDKGIR---PPG  504

Query  341  RIKS  352
            ++ S
Sbjct  505  QLFS  508



>gb|EAY74226.1| hypothetical protein OsI_02107 [Oryza sativa Indica Group]
Length=540

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 70/124 (56%), Gaps = 12/124 (10%)
 Frame = +2

Query  8    DRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISN  187
            D M   G  PN+RTY +I++HL+KS K + A  +F+ + +   +  L  Y++MVG F SN
Sbjct  388  DEMRKSGIGPNTRTYDIILNHLIKSEKIEEAYNLFQRMERDGCEPELNTYTMMVGMFCSN  447

Query  188  DQLDAVKDLFDEMRADGILPGRAMQWSL-------QRMQEAG--YGESVDELIREMLPDG  340
            +++D    ++ +M+  G+LP   M  +L        R++EA   + E +D+ IR   P G
Sbjct  448  ERVDMALKVWKQMKEKGVLPCMHMFSALINGLCFDNRLEEACVYFQEMLDKGIR---PPG  504

Query  341  RIKS  352
            ++ S
Sbjct  505  QLFS  508



>ref|XP_006390810.1| hypothetical protein EUTSA_v10018364mg [Eutrema salsugineum]
 gb|ESQ28096.1| hypothetical protein EUTSA_v10018364mg [Eutrema salsugineum]
Length=548

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 54/90 (60%), Gaps = 3/90 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            V ++M + G  PN+RTY +I+ HL++  +   A EV++   QM  + T+  Y IMV  F 
Sbjct  397  VVEQMRSKGVGPNARTYDIILHHLIRMQRTKEAYEVYQ---QMSCEPTVSTYEIMVRMFC  453

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL  271
            + ++LD    ++DEMR  G+LPG  M  SL
Sbjct  454  NKERLDMAIKIWDEMRGKGVLPGMHMFSSL  483



>ref|XP_006644208.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial-like [Oryza brachyantha]
Length=539

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 70/124 (56%), Gaps = 12/124 (10%)
 Frame = +2

Query  8    DRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISN  187
            D M   G  PN+RTY +I++HL+KS K + A ++F+ +     +  L  Y++MVG F SN
Sbjct  387  DEMRKSGIGPNARTYDIILNHLIKSEKIEEAYKLFQGMETDGCEPQLNTYTMMVGMFCSN  446

Query  188  DQLDAVKDLFDEMRADGILPGRAMQWSL-------QRMQEAG--YGESVDELIREMLPDG  340
            +++D    ++ +M+  G+LP   M  +L        R++EA   + E +D+ IR   P G
Sbjct  447  ERVDMALKVWKQMKEKGVLPCMHMFSALINGLCFENRLEEACVYFQEMLDKGIR---PPG  503

Query  341  RIKS  352
            ++ S
Sbjct  504  QLFS  507



>ref|XP_006405023.1| hypothetical protein EUTSA_v10000687mg [Eutrema salsugineum]
 gb|ESQ46476.1| hypothetical protein EUTSA_v10000687mg [Eutrema salsugineum]
Length=307

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 60/114 (53%), Gaps = 4/114 (4%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            V + M + G  PN+RTY +I+ HL++  +   A EV++   +M  + T+  Y IMV  F 
Sbjct  156  VVEEMRSKGVGPNARTYDIILHHLIRMQRTKEAYEVYQ---KMSCEPTVSTYEIMVRMFC  212

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDG  340
            + ++LD    ++DEMR  G+LPG  M  SL   M      +   E   EML  G
Sbjct  213  NKERLDMAIKIWDEMRGKGVLPGMHMFSSLITAMCHENKLDEACEYFNEMLDVG  266



>ref|XP_003565781.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial-like [Brachypodium distachyon]
Length=547

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 68/124 (55%), Gaps = 12/124 (10%)
 Frame = +2

Query  8    DRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISN  187
            D M   G  PN+RTY +I+ +L+KS K + A  VF+ +     +  L  Y++MVG F SN
Sbjct  395  DEMRKTGIGPNARTYDIILQYLIKSQKIEEAYNVFQRMGMEGCEPQLNTYTMMVGMFCSN  454

Query  188  DQLDAVKDLFDEMRADGILPGRAMQWSL-------QRMQEAG--YGESVDELIREMLPDG  340
            +++D    ++ +M+  G+LP   M  SL        R++EA   + E +D+ IR   P G
Sbjct  455  ERVDMALKVWKQMKEKGVLPCMHMFSSLINGLCFENRLEEACVYFQEMLDKGIR---PPG  511

Query  341  RIKS  352
            ++ S
Sbjct  512  QLFS  515



>gb|AES95804.2| PPR containing plant-like protein [Medicago truncatula]
Length=722

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF  M N G LP+  +Y+++ID   + G+ D A+EVF+ +    I   +  YSI++  F 
Sbjct  273  VFKEMKNSGILPDVYSYSILIDGFCRKGRVDQASEVFKEMRNSGILPNIYSYSILIDGFC  332

Query  182  SNDQLDAVKDLFDEMRADGILP  247
               ++D   ++F+EM+  GILP
Sbjct  333  KEGRVDKALEVFEEMKNSGILP  354


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/82 (33%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF  M N G LPN  +Y+++ID   K G+ D A EVF  +    I   +  YSI++  F 
Sbjct  308  VFKEMRNSGILPNIYSYSILIDGFCKEGRVDKALEVFEEMKNSGILPDVYSYSILIDGFC  367

Query  182  SNDQLDAVKDLFDEMRADGILP  247
                +D+    ++EM ++   P
Sbjct  368  RKGDMDSAIKFWEEMTSNNFSP  389


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 23/70 (33%), Positives = 37/70 (53%), Gaps = 0/70 (0%)
 Frame = +2

Query  38   NSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISNDQLDAVKDLF  217
            N+  +  +I  L + G  D A+EVF+ +    I   +  YSI++  F    ++D   ++F
Sbjct  250  NNHCFNAVIYGLCQGGILDEASEVFKEMKNSGILPDVYSYSILIDGFCRKGRVDQASEVF  309

Query  218  DEMRADGILP  247
             EMR  GILP
Sbjct  310  KEMRNSGILP  319


 Score = 48.9 bits (115),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 22/79 (28%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +FD M  +G  PN  TYT  I+  +K  K + A +++  + +  +      Y++++ AF 
Sbjct  588  LFDEMSREGCSPNVVTYTCFINEYLKLNKNNQAHKLYEKMKERGVYPDQILYTMLIAAFC  647

Query  182  SNDQLDAVKDLFDEMRADG  238
            +  +++  + LFDEM+ +G
Sbjct  648  NTGEMNRAEALFDEMKQEG  666



>ref|XP_003612846.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
Length=892

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF  M N G LP+  +Y+++ID   + G+ D A+EVF+ +    I   +  YSI++  F 
Sbjct  302  VFKEMKNSGILPDVYSYSILIDGFCRKGRVDQASEVFKEMRNSGILPNIYSYSILIDGFC  361

Query  182  SNDQLDAVKDLFDEMRADGILP  247
               ++D   ++F+EM+  GILP
Sbjct  362  KEGRVDKALEVFEEMKNSGILP  383


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/82 (33%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF  M N G LPN  +Y+++ID   K G+ D A EVF  +    I   +  YSI++  F 
Sbjct  337  VFKEMRNSGILPNIYSYSILIDGFCKEGRVDKALEVFEEMKNSGILPDVYSYSILIDGFC  396

Query  182  SNDQLDAVKDLFDEMRADGILP  247
                +D+    ++EM ++   P
Sbjct  397  RKGDMDSAIKFWEEMTSNNFSP  418


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 23/70 (33%), Positives = 37/70 (53%), Gaps = 0/70 (0%)
 Frame = +2

Query  38   NSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISNDQLDAVKDLF  217
            N+  +  +I  L + G  D A+EVF+ +    I   +  YSI++  F    ++D   ++F
Sbjct  279  NNHCFNAVIYGLCQGGILDEASEVFKEMKNSGILPDVYSYSILIDGFCRKGRVDQASEVF  338

Query  218  DEMRADGILP  247
             EMR  GILP
Sbjct  339  KEMRNSGILP  348


 Score = 48.9 bits (115),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 22/79 (28%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +FD M  +G  PN  TYT  I+  +K  K + A +++  + +  +      Y++++ AF 
Sbjct  617  LFDEMSREGCSPNVVTYTCFINEYLKLNKNNQAHKLYEKMKERGVYPDQILYTMLIAAFC  676

Query  182  SNDQLDAVKDLFDEMRADG  238
            +  +++  + LFDEM+ +G
Sbjct  677  NTGEMNRAEALFDEMKQEG  695



>gb|EMT02311.1| hypothetical protein F775_12462 [Aegilops tauschii]
Length=715

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 66/115 (57%), Gaps = 3/115 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            + D M++ G  P+  TY+++ID   K+G+ D A  VFR +   ++K  +  ++IM+GA +
Sbjct  527  LLDNMVSIGMDPDVITYSILIDGYCKNGRIDDALVVFREMLAGKVKPCIITFNIMIGALL  586

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL--QRMQEAGYGESVDELIREMLPDG  340
               + +  KDLFD + A G++P   + +SL  Q++ E G  +  D+L   M  +G
Sbjct  587  KGGRKEEAKDLFDGIWAKGLVP-TVVTYSLMIQKLIEEGSLQESDDLFLSMEKNG  640


 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 63/118 (53%), Gaps = 4/118 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F  M++ G  P++  +  I+DHL K+G+   A ++F ++  M +K  +  YS ++G ++
Sbjct  457  LFSEMLDRGIYPDTVFFNTIMDHLCKNGRVMEAQDLFDLMVHMGVKPDVCTYSTLIGGYL  516

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELI--REMLPDGRIK  349
               ++D V  L D M + G+ P   + +S+        G   D L+  REML  G++K
Sbjct  517  FVGKMDEVSKLLDNMVSIGMDPD-VITYSILIDGYCKNGRIDDALVVFREMLA-GKVK  572



>gb|AAD43623.1|AC005698_22 T3P18.22 [Arabidopsis thaliana]
Length=425

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 59/121 (49%), Gaps = 1/121 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F  M++DG  PN  TY  ++D L K+GK + A  VF  L + +++ T+  Y+IM+    
Sbjct  248  IFKEMVSDGVPPNIMTYNTLLDGLCKNGKLEKAMVVFEYLQRSKMEPTIYTYNIMIEGMC  307

Query  182  SNDQLDAVKDLFDEMRADGILPG-RAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIA  358
               +++   DLF  +   G+ P   A    +      G  E  D L +EM  DG + +  
Sbjct  308  KAGKVEDGWDLFCNLSLKGVKPDVVAYNTMISGFCRKGSKEEADALFKEMKEDGTLPNSG  367

Query  359  C  361
            C
Sbjct  368  C  368



>ref|XP_002436688.1| hypothetical protein SORBIDRAFT_10g007070 [Sorghum bicolor]
 gb|EER88055.1| hypothetical protein SORBIDRAFT_10g007070 [Sorghum bicolor]
Length=551

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 65/115 (57%), Gaps = 12/115 (10%)
 Frame = +2

Query  35   PNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISNDQLDAVKDL  214
            PNSRTY VI+ +L+KS KF+ A  VF+ +     +  L  Y++MVG F SN ++D   ++
Sbjct  408  PNSRTYDVILHYLIKSQKFEEAYNVFQRMGMDGCEPQLNTYTMMVGMFCSNGRVDMALNV  467

Query  215  FDEMRADGILPGRAMQWSL-------QRMQEAG--YGESVDELIREMLPDGRIKS  352
            + +M   G+LP   M  +L        R++EA   + E +D+ IR   P G++ S
Sbjct  468  WKQMGERGVLPCMHMFSALINGLCFENRLEEACVYFQEMLDKGIR---PPGQLFS  519



>emb|CDY03704.1| BnaA02g15330D [Brassica napus]
Length=506

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 3/90 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            V + M   G  PN+RTY +I+ HL++  +   A EV++   +M  + T+  Y IMV  F 
Sbjct  355  VVEEMRTKGIGPNARTYDIILHHLIRMQRTKEAYEVYQ---KMSCEPTVSTYEIMVRMFC  411

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL  271
            + ++LD    ++DEM+  G+LPG  M  SL
Sbjct  412  NKERLDMAIKIWDEMKGKGVLPGMHMFSSL  441



>emb|CBJ23784.1| pentatricopeptide (PPR) repeat-containing protein [Arabidopsis 
thaliana]
Length=630

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 59/121 (49%), Gaps = 1/121 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F  M++DG  PN  TY  ++D L K+GK + A  VF  L + +++ T+  Y+IM+    
Sbjct  453  IFKEMVSDGVPPNIMTYNTLLDGLCKNGKLEKAMVVFEYLQRSKMEPTIYTYNIMIEGMC  512

Query  182  SNDQLDAVKDLFDEMRADGILPG-RAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIA  358
               +++   DLF  +   G+ P   A    +      G  E  D L +EM  DG + +  
Sbjct  513  KAGKVEDGWDLFCNLSLKGVKPDVVAYNTMISGFCRKGSKEEADALFKEMKEDGTLPNSG  572

Query  359  C  361
            C
Sbjct  573  C  573



>ref|XP_002889138.1| hypothetical protein ARALYDRAFT_476899 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65397.1| hypothetical protein ARALYDRAFT_476899 [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +2

Query  14   MINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISNDQ  193
             I D   PN RTYTV+ID L  SGK   A  +F+ + +  IK  +  Y++++ +F S D 
Sbjct  191  FIYDNCCPNVRTYTVLIDALCGSGKKSEALNLFKQMSESGIKPDVYMYTVLIQSFCSGDT  250

Query  194  LDAVKDLFDEMRADGILPG  250
            LD    L D M  +G++P 
Sbjct  251  LDEASGLLDHMFENGLMPN  269



>ref|XP_009127843.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial [Brassica rapa]
Length=506

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 3/90 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            V + M   G  PN+RTY +I+ HL++  +   A EV++   +M  + T+  Y IMV  F 
Sbjct  355  VVEEMRTKGIGPNARTYDIILHHLIRMQRTKEAYEVYQ---KMSCEPTVSTYEIMVRMFC  411

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL  271
            + ++LD    ++DEM+  G+LPG  M  SL
Sbjct  412  NKERLDMAIKIWDEMKGKGVLPGMHMFSSL  441



>gb|KJB30832.1| hypothetical protein B456_005G162800 [Gossypium raimondii]
Length=590

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 33/87 (38%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVF-RVLPQMRIKRTLKQYSIMVGAF  178
            V D M    A PNSRTY +I+ HL+K+ + + A   F ++L +   + T+  Y I+V  F
Sbjct  431  VIDEMRKHSAGPNSRTYDIILHHLIKARRTNEAYFRFQKMLNEPGCEPTVSTYEIIVRMF  490

Query  179  ISNDQLDAVKDLFDEMRADGILPGRAM  259
             + D++D  K ++D+M+A G+LPG  M
Sbjct  491  CNEDRVDLAKQVWDQMKAKGVLPGMHM  517



>ref|NP_176454.1| pentatricopeptide repeat protein RPF2 [Arabidopsis thaliana]
 sp|Q9SXD1.2|PPR91_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g62670, 
mitochondrial; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE33992.1| pentatricopeptide repeat protein RPF2 [Arabidopsis thaliana]
Length=630

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 59/121 (49%), Gaps = 1/121 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F  M++DG  PN  TY  ++D L K+GK + A  VF  L + +++ T+  Y+IM+    
Sbjct  453  IFKEMVSDGVPPNIMTYNTLLDGLCKNGKLEKAMVVFEYLQRSKMEPTIYTYNIMIEGMC  512

Query  182  SNDQLDAVKDLFDEMRADGILPG-RAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIA  358
               +++   DLF  +   G+ P   A    +      G  E  D L +EM  DG + +  
Sbjct  513  KAGKVEDGWDLFCNLSLKGVKPDVVAYNTMISGFCRKGSKEEADALFKEMKEDGTLPNSG  572

Query  359  C  361
            C
Sbjct  573  C  573



>ref|XP_002888819.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH65078.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=512

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 52/88 (59%), Gaps = 3/88 (3%)
 Frame = +2

Query  8    DRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISN  187
            D M + G  PN+RTY +I+ HL++  +   A EV++   +M  + T+  Y IMV  F + 
Sbjct  363  DEMRSKGIGPNARTYDIILHHLIRMQRTKEAYEVYQ---KMSCEPTVSTYEIMVRMFCNK  419

Query  188  DQLDAVKDLFDEMRADGILPGRAMQWSL  271
            ++LD    ++DEM+  G+LPG  M  SL
Sbjct  420  ERLDMAIKIWDEMKGKGVLPGMHMFSSL  447



>gb|AAF19552.1|AC007190_20 F23N19.4 [Arabidopsis thaliana]
Length=1244

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 59/121 (49%), Gaps = 1/121 (1%)
 Frame = +2

Query  2     VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
             +F  M++DG  PN  TY  ++D L K+GK + A  VF  L + +++ T+  Y+IM+    
Sbjct  1067  IFKEMVSDGVPPNIMTYNTLLDGLCKNGKLEKAMVVFEYLQRSKMEPTIYTYNIMIEGMC  1126

Query  182   SNDQLDAVKDLFDEMRADGILPG-RAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIA  358
                +++   DLF  +   G+ P   A    +      G  E  D L +EM  DG + +  
Sbjct  1127  KAGKVEDGWDLFCNLSLKGVKPDVVAYNTMISGFCRKGSKEEADALFKEMKEDGTLPNSG  1186

Query  359   C  361
             C
Sbjct  1187  C  1187


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 40/77 (52%), Gaps = 0/77 (0%)
 Frame = +2

Query  14   MINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISNDQ  193
            MI     PN  TY+ ++D  VK+GK   A E+F  + +M I   +  YS ++     +D+
Sbjct  354  MIKKKITPNVITYSALLDAFVKNGKVLEAKELFEEMVRMSIDPDIVTYSSLINGLCLHDR  413

Query  194  LDAVKDLFDEMRADGIL  244
            +D    +FD M + G L
Sbjct  414  IDEANQMFDLMVSKGCL  430



>ref|XP_010551610.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial isoform X2 [Tarenaya hassleriana]
Length=472

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 47/87 (54%), Gaps = 3/87 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            V   M  +G  PNSRTY +I+ HL++        E + V  +M  +  +  Y IMV  F 
Sbjct  359  VVKEMRAEGIGPNSRTYDIILHHLIR---MRCTKEAYNVFKRMNCEPAVSTYEIMVRMFC  415

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQ  262
             N+++D    ++DEM+  G+LPG++  
Sbjct  416  KNERVDMAMKIWDEMKGKGVLPGKSFH  442



>ref|XP_004150483.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial-like [Cucumis sativus]
 gb|KGN51506.1| hypothetical protein Csa_5G571490 [Cucumis sativus]
Length=542

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query  8    DRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVF-RVLPQMRIKRTLKQYSIMVGAFIS  184
            D M   G  PNSRTY +I+ HL+K  K   A  VF R+  +   + TL  Y IM+  F +
Sbjct  389  DEMRKSGVGPNSRTYDIILHHLIKGRKSKEAYSVFQRMSREPGCEPTLSTYDIMIRMFCN  448

Query  185  NDQLDAVKDLFDEMRADGILPG  250
             +++D    ++DEM+A G+LPG
Sbjct  449  EERVDMAIQIWDEMKAKGVLPG  470



>ref|XP_004161997.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At1g71060, mitochondrial-like [Cucumis sativus]
Length=542

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query  8    DRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVF-RVLPQMRIKRTLKQYSIMVGAFIS  184
            D M   G  PNSRTY +I+ HL+K  K   A  VF R+  +   + TL  Y IM+  F +
Sbjct  389  DEMRKSGVGPNSRTYDIILHHLIKGRKSKEAYSVFQRMSREPGCEPTLSTYDIMIRMFCN  448

Query  185  NDQLDAVKDLFDEMRADGILPG  250
             +++D    ++DEM+A G+LPG
Sbjct  449  EERVDMAIQIWDEMKAKGVLPG  470



>ref|XP_006382734.1| hypothetical protein POPTR_0005s04890g [Populus trichocarpa]
 gb|ERP60531.1| hypothetical protein POPTR_0005s04890g [Populus trichocarpa]
Length=447

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 72/126 (57%), Gaps = 4/126 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMV-GAF  178
            +F +M + G LPN RTY++++D L K G  + A ++   + + +++  +  Y+I++ G F
Sbjct  264  LFKKMCSSGMLPNLRTYSILLDGLCKHGHLEEALKLLTSMQERKLEPDIVLYNILIQGMF  323

Query  179  ISNDQLDAVKDLFDEMRADGILPG-RAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSI  355
            I+  +L+  K+LF ++ A+GI P  R     ++ + + G  +   +L R+M  DG +   
Sbjct  324  IAG-KLEVAKELFSKLFANGIRPSVRTYNIMIKGLLKEGLSDEAYKLFRKMEDDGFLPD-  381

Query  356  ACSMDA  373
            +CS + 
Sbjct  382  SCSYNV  387



>ref|XP_011032509.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, 
mitochondrial-like [Populus euphratica]
Length=501

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 72/126 (57%), Gaps = 4/126 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMV-GAF  178
            +F +M + G LPN RTY++++D L K G  + A ++ + + + +++  +  Y+I++ G F
Sbjct  318  LFKKMCSSGMLPNLRTYSILLDGLCKHGHLEEALKLLKSMQERKLEPDIVLYNILIQGMF  377

Query  179  ISNDQLDAVKDLFDEMRADGILPG-RAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSI  355
            I+  +L+  K+LF  + A+GI P  R     ++ + + G  +   +L R+M  DG +   
Sbjct  378  IAG-KLEVAKELFSMLFANGIRPSVRTYNIMIKGLLKEGLSDEAYKLFRKMEDDGFLPD-  435

Query  356  ACSMDA  373
            +CS + 
Sbjct  436  SCSYNV  441



>ref|XP_006382722.1| helicase domain-containing family protein [Populus trichocarpa]
 gb|ERP60519.1| helicase domain-containing family protein [Populus trichocarpa]
Length=588

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 38/125 (30%), Positives = 71/125 (57%), Gaps = 4/125 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMV-GAF  178
            +F  M + G LP+  TY+ ++D L K G  D A ++ + + + +I+  +  Y+I++ G F
Sbjct  405  LFKEMCSSGLLPDLMTYSTLLDGLCKHGHLDEALKLLKSMQESKIEPDIVLYNILIEGMF  464

Query  179  ISNDQLDAVKDLFDEMRADGILPG-RAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSI  355
            I+  +L+  K+LF ++ ADGI P  R     ++ + + G  +   EL R+M  DG + + 
Sbjct  465  IAG-KLEVAKELFSKLFADGIQPTIRTYTIMIKGLLKEGLSDEAYELFRKMEDDGFLPN-  522

Query  356  ACSMD  370
            +CS +
Sbjct  523  SCSYN  527


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 29/114 (25%), Positives = 50/114 (44%), Gaps = 1/114 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF+ M   GA PN+ TY  ++D    + + D A +V  ++        +  Y+I++  + 
Sbjct  300  VFEAMTKKGAEPNAYTYNALMDGYCLNNQMDEAQKVLDIMVDKGCAPVVHSYNILINGYC  359

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDG  340
               +LD  K L  EM    + P      +L Q + + G  +    L +EM   G
Sbjct  360  KRRRLDEAKSLLVEMSEKELTPDTVTYSTLMQGLCQVGRPQEALNLFKEMCSSG  413



>ref|XP_009414726.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial isoform X2 [Musa acuminata subsp. malaccensis]
Length=486

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 65/117 (56%), Gaps = 6/117 (5%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQ-MRIKRTLKQYSIMVGAF  178
            V D M + G  PN+RT  +I+ HL+K+GK + A E+FR + + +  +  L  Y++MV  F
Sbjct  331  VVDEMKSCGIGPNARTCDIILHHLIKAGKTEEAYEIFRRMGRDIGCEPQLNTYTMMVSMF  390

Query  179  ISNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIR---EMLPDG  340
             S +++D    ++++M A GILP   M  +L  +    Y   +D+  R   EML  G
Sbjct  391  CSVERIDMAMKVWNQMNAKGILPCMHMFSAL--INGLCYENRLDDACRYFQEMLDKG  445



>ref|XP_002281336.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g59900 [Vitis vinifera]
Length=900

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 48/90 (53%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F+ M + G  PN  TY+++ID   K GK D A      + ++ IK T+  YS ++    
Sbjct  377  LFNNMGHKGLFPNDVTYSILIDSFCKRGKLDVALHFLGKMTEVGIKATVYPYSSLISGHC  436

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL  271
               +L A K LFDEM A+G+ P   +  SL
Sbjct  437  KLGKLRAAKSLFDEMIANGLKPNVVIYTSL  466



>ref|XP_010096768.1| hypothetical protein L484_025886 [Morus notabilis]
 gb|EXB65620.1| hypothetical protein L484_025886 [Morus notabilis]
Length=551

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 53/91 (58%), Gaps = 1/91 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVF-RVLPQMRIKRTLKQYSIMVGAF  178
            V D M   G  PNSRTY +I+ HL+K  + + A  VF R+  +   + T+  Y IMV  F
Sbjct  396  VVDEMRECGVGPNSRTYDIILHHLIKDKRTEEAFSVFQRMSREPGCEPTVSTYEIMVRMF  455

Query  179  ISNDQLDAVKDLFDEMRADGILPGRAMQWSL  271
             + ++LD    ++D+M+A G+LPG  M  +L
Sbjct  456  CNVERLDMAIQIWDQMKAKGVLPGMHMFSTL  486



>gb|KDO64719.1| hypothetical protein CISIN_1g037620mg [Citrus sinensis]
Length=330

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 53/91 (58%), Gaps = 1/91 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQM-RIKRTLKQYSIMVGAF  178
            + D M   G  PN+RTY +++ HL+K+G+ + A  VF+ + +    + T+  Y I+V  F
Sbjct  172  MMDEMRKCGIGPNTRTYDIVLHHLIKAGRTEEAYSVFKRMSRKPGTEPTVSTYEIVVRMF  231

Query  179  ISNDQLDAVKDLFDEMRADGILPGRAMQWSL  271
              N Q+D    ++DEM+A G+LP   M  +L
Sbjct  232  CYNAQVDMAMRIWDEMKARGVLPVMHMYSTL  262



>ref|XP_009414725.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial isoform X1 [Musa acuminata subsp. malaccensis]
Length=560

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 65/117 (56%), Gaps = 6/117 (5%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQ-MRIKRTLKQYSIMVGAF  178
            V D M + G  PN+RT  +I+ HL+K+GK + A E+FR + + +  +  L  Y++MV  F
Sbjct  405  VVDEMKSCGIGPNARTCDIILHHLIKAGKTEEAYEIFRRMGRDIGCEPQLNTYTMMVSMF  464

Query  179  ISNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIR---EMLPDG  340
             S +++D    ++++M A GILP   M  +L  +    Y   +D+  R   EML  G
Sbjct  465  CSVERIDMAMKVWNQMNAKGILPCMHMFSAL--INGLCYENRLDDACRYFQEMLDKG  519



>ref|XP_001764969.1| predicted protein [Physcomitrella patens]
 gb|EDQ70185.1| predicted protein [Physcomitrella patens]
Length=497

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 55/106 (52%), Gaps = 1/106 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            ++  M+     P   TYT I+  L +SG+  +A  +F  LP   +  ++  Y+I++ A +
Sbjct  358  MYAEMVKAKCKPTVDTYTAILHSLARSGRVKAAITLFEKLPSFGVPPSIATYTILLKACL  417

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQR-MQEAGYGESVDEL  316
              D+L+ V  L+  MR DG+ P RA+   + R +  AG  +  D L
Sbjct  418  KADELETVLKLYAGMRRDGLTPSRAIHRMVTRGLHAAGMHDEADAL  463



>ref|XP_006448295.1| hypothetical protein CICLE_v10014876mg [Citrus clementina]
 gb|ESR61535.1| hypothetical protein CICLE_v10014876mg [Citrus clementina]
Length=531

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 53/91 (58%), Gaps = 1/91 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQM-RIKRTLKQYSIMVGAF  178
            + D M   G  PNSRTY +++ HL+K+G+ + A  VF+ + +    + T+  Y I+V  F
Sbjct  379  MMDEMRKCGIGPNSRTYDIVLHHLIKAGRTEEAYSVFKRMSRKPGTEPTVSTYEIVVRMF  438

Query  179  ISNDQLDAVKDLFDEMRADGILPGRAMQWSL  271
              N Q+D    ++DEM+A G+LP   M  +L
Sbjct  439  CYNAQVDMAMRIWDEMKARGVLPVMHMYSTL  469



>gb|EMT00568.1| hypothetical protein F775_12441 [Aegilops tauschii]
Length=354

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 65/115 (57%), Gaps = 3/115 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            + D M++ G  P+  TY ++ID   K+GK D A  VFR + + + K ++  ++IM+GA +
Sbjct  158  LLDNMVSIGMEPDVITYNILIDGYSKNGKIDDALVVFRGMLERKDKPSVITFNIMIGALL  217

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL--QRMQEAGYGESVDELIREMLPDG  340
                 +  KDLFD + A G++P   + +SL  Q++ E G  +  D+L   M  +G
Sbjct  218  KCRGKEEAKDLFDGIWAKGLVP-DVVTYSLMIQKLIEEGSLQESDDLFLSMEKNG  271



>ref|XP_008467144.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial [Cucumis melo]
 ref|XP_008467145.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial [Cucumis melo]
Length=542

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = +2

Query  11   RMIND----GALPNSRTYTVIIDHLVKSGKFDSATEVF-RVLPQMRIKRTLKQYSIMVGA  175
            RM++D    G  PNSRTY +I+ HL+K  K   A  VF R+  +   + TL  Y IM+  
Sbjct  386  RMVDDMRKSGIGPNSRTYDIILHHLIKGRKSKEAYSVFQRMSREPGCEPTLSTYEIMIRM  445

Query  176  FISNDQLDAVKDLFDEMRADGILPG  250
            F + +++D    ++DEM+A G+LPG
Sbjct  446  FCNEERVDMAIQIWDEMKAKGVLPG  470



>ref|XP_006468828.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial-like [Citrus sinensis]
Length=537

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 53/91 (58%), Gaps = 1/91 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQM-RIKRTLKQYSIMVGAF  178
            + D M   G  PNSRTY +++ HL+K+G+ + A  VF+ + +    + T+  Y I+V  F
Sbjct  379  MMDEMRKCGIGPNSRTYDIVLHHLIKAGRTEEAYSVFKRMSRKPGTEPTVSTYEIVVRMF  438

Query  179  ISNDQLDAVKDLFDEMRADGILPGRAMQWSL  271
              N Q+D    ++DEM+A G+LP   M  +L
Sbjct  439  CYNAQVDMAMRIWDEMKARGVLPVMHMYSTL  469



>gb|AFK45860.1| unknown [Medicago truncatula]
Length=197

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 50/83 (60%), Gaps = 1/83 (1%)
 Frame = +2

Query  26   GALPNSRTYTVIIDHLVKSGKFDSATEVF-RVLPQMRIKRTLKQYSIMVGAFISNDQLDA  202
            G  PN+RTY +I+ HL+K G+   A  VF R+  +   + ++  Y+IMV  F + +QLD 
Sbjct  50   GIGPNARTYDIILVHLIKGGRTKEAYSVFQRMSSETGCEPSVSTYAIMVRMFCNENQLDM  109

Query  203  VKDLFDEMRADGILPGRAMQWSL  271
               +++EM+  GILPG  M  +L
Sbjct  110  AMVVWNEMKDKGILPGIHMFSTL  132



>emb|CDY09511.1| BnaC02g20530D [Brassica napus]
Length=513

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 3/90 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            V + M   G  PN+RTY +I+ HL++  +   A EV++   +M  + T+  Y IMV  F 
Sbjct  362  VVEEMRLKGIGPNARTYDIILHHLIRMQRTKEAYEVYQ---KMSCEPTVSTYEIMVRMFC  418

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL  271
            + ++LD    ++DEM+  G+LPG  M  SL
Sbjct  419  NKERLDMAIKIWDEMKGKGVLPGMHMFSSL  448



>emb|CAN80799.1| hypothetical protein VITISV_019809 [Vitis vinifera]
Length=1099

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 58/114 (51%), Gaps = 1/114 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            + +RM+ND  LPNS TY V+I+ L K  K   A+ +   +  M +K T+  Y+I++G  +
Sbjct  531  LLERMLNDACLPNSYTYNVLIEGLCKEKKMKEASSLVAKMLTMGVKPTVVTYTILIGEML  590

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWS-LQRMQEAGYGESVDELIREMLPDG  340
             +   D    +F+ M + G  P      + L      G  E VD++I +M  +G
Sbjct  591  KDGAFDHALKVFNHMVSLGYQPDVCTYTAFLHAYFSQGMLEEVDDVIAKMNEEG  644



>ref|NP_177262.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9C9A2.1|PP112_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51696.1|AC016972_15 hypothetical protein; 31939-30407 [Arabidopsis thaliana]
 gb|AEE35157.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=510

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 50/88 (57%), Gaps = 3/88 (3%)
 Frame = +2

Query  8    DRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISN  187
            D M   G  PN+RTY +I+ HL++  +   A EV++    M  + T+  Y IMV  F + 
Sbjct  361  DEMRLKGVGPNARTYDIILHHLIRMQRSKEAYEVYQT---MSCEPTVSTYEIMVRMFCNK  417

Query  188  DQLDAVKDLFDEMRADGILPGRAMQWSL  271
            ++LD    ++DEM+  G+LPG  M  SL
Sbjct  418  ERLDMAIKIWDEMKGKGVLPGMHMFSSL  445



>ref|XP_010551608.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial isoform X1 [Tarenaya hassleriana]
 ref|XP_010551609.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial isoform X1 [Tarenaya hassleriana]
Length=512

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 48/90 (53%), Gaps = 3/90 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            V   M  +G  PNSRTY +I+ HL++        E + V  +M  +  +  Y IMV  F 
Sbjct  359  VVKEMRAEGIGPNSRTYDIILHHLIR---MRCTKEAYNVFKRMNCEPAVSTYEIMVRMFC  415

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL  271
             N+++D    ++DEM+  G+LPG  M  +L
Sbjct  416  KNERVDMAMKIWDEMKGKGVLPGMHMFSTL  445



>gb|EPS61555.1| hypothetical protein M569_13242, partial [Genlisea aurea]
Length=360

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 53/99 (54%), Gaps = 1/99 (1%)
 Frame = +2

Query  14   MINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISNDQ  193
            M   G  PN  TY  ++D L K+G+ D A  +   + +    +T   Y+ M+  F SN +
Sbjct  256  MAARGTTPNEHTYNALLDGLCKNGRLDEAEALHGEMAEKGFGKTTVAYNTMIAGFCSNAK  315

Query  194  LDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVD  310
            L+  + LF+EMRA+ + PG  + +S+     A +G +V+
Sbjct  316  LEEARGLFEEMRAEAV-PGDRVTYSVLIRWFAFHGRAVE  353



>ref|NP_001147833.1| GTP binding protein [Zea mays]
 gb|ACG28835.1| GTP binding protein [Zea mays]
 gb|AFW85360.1| GTP binding protein [Zea mays]
Length=547

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 64/115 (56%), Gaps = 12/115 (10%)
 Frame = +2

Query  35   PNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISNDQLDAVKDL  214
            PNSRTY VI+ +L+KS KF+ A  +F+ +     +  L  Y++MVG F SN ++D    +
Sbjct  404  PNSRTYDVILHYLIKSQKFEEAYNIFQRMGIDGCEPQLNTYTMMVGMFCSNGRVDMALKV  463

Query  215  FDEMRADGILPGRAMQWSL-------QRMQEAG--YGESVDELIREMLPDGRIKS  352
            + +M   G+LP   M  +L        R++EA   + E +D+ IR   P G++ S
Sbjct  464  WKQMGEKGVLPCMHMFSALINGLCFENRLEEACVYFQEMLDKGIR---PPGQLFS  515



>emb|CBJ23782.1| pentatricopeptide (PPR) repeat-containing protein [Arabidopsis 
thaliana]
Length=630

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 60/121 (50%), Gaps = 1/121 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F +M++DG  P+  TY++++D L K GK + A  VF  L + +++  +  Y+IM+    
Sbjct  453  IFKKMVSDGVPPDIITYSILLDGLCKYGKLEKALVVFEYLQKSKMEPNIYTYNIMIEGMC  512

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDGRIKSIA  358
               +++   DLF  +   G+ P   +  ++       G  E  D L REM  DG +    
Sbjct  513  KAGKVEDGWDLFCSLSLKGVKPNVIIYTTMISGFCRKGLKEEADALFREMKEDGTLPDSG  572

Query  359  C  361
            C
Sbjct  573  C  573



>gb|ACP39954.1| pentatricopeptide repeat protein [Gossypium hirsutum]
 gb|ACP39955.1| pentatricopeptide repeat protein [Gossypium hirsutum]
Length=547

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/87 (37%), Positives = 52/87 (60%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLP-QMRIKRTLKQYSIMVGAF  178
            V D M    A PNSRTY +I+ HL+K+ + + A   F+ +  +   + T+  Y I+V  F
Sbjct  388  VIDEMRKHSAGPNSRTYDIILHHLIKARRTNEAYFRFQKMSNEPGCEPTVSTYEIIVRMF  447

Query  179  ISNDQLDAVKDLFDEMRADGILPGRAM  259
             + D++D  K ++D+M+A G+LPG  M
Sbjct  448  CNEDRVDLAKQVWDQMKAKGVLPGMHM  474



>ref|XP_010933048.1| PREDICTED: protein Rf1, mitochondrial-like [Elaeis guineensis]
Length=757

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF+ M+  G  PNS TY+V+I+  VK+ K D A E+F  + Q  +K  +  YSI++    
Sbjct  340  VFNSMLVKGPAPNSHTYSVLINGFVKNQKMDEAMELFNKMQQEGVKPDIITYSIILDGLC  399

Query  182  SNDQLDAVKDLFDEMRADGILP  247
               +++ V+ L DEM   GI P
Sbjct  400  HLGKMEDVRGLLDEMMTQGIRP  421



>ref|XP_002962188.1| hypothetical protein SELMODRAFT_60915, partial [Selaginella moellendorffii]
 gb|EFJ37448.1| hypothetical protein SELMODRAFT_60915, partial [Selaginella moellendorffii]
Length=535

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 59/116 (51%), Gaps = 13/116 (11%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF+ M+  G  P+  TY +IID+  K G   +AT V R++ +  +K     Y++++  F+
Sbjct  303  VFETMVEKGCKPDMHTYGIIIDNFCKEGSMAAATHVLRLMDKAAVKPNRYIYTMIMDGFV  362

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQ-------WSLQRMQEAGYGESVDELIREM  328
             + +L+   +L+  +  DGILP              L++M EA       EL+REM
Sbjct  363  KSSRLEEALELYQRILKDGILPSTVTYNTVINALCKLKKMDEA------LELLREM  412


 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 59/116 (51%), Gaps = 3/116 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMR--IKRTLKQYSIMVGA  175
            ++ R++ DG LP++ TY  +I+ L K  K D A E+ R + + +  ++ ++  YS+++  
Sbjct  373  LYQRILKDGILPSTVTYNTVINALCKLKKMDEALELLREMQRRKEELEPSIVTYSMIIHG  432

Query  176  FISNDQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDG  340
                   +   DL  EM  +G++P      SL Q +  AG      EL+ EML  G
Sbjct  433  LGKVGMEERAFDLLAEMIDNGVIPDCFTYTSLIQTLAGAGKVSRAMELLEEMLKAG  488


 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 52/103 (50%), Gaps = 1/103 (1%)
 Frame = +2

Query  35   PNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISNDQLDAVKDL  214
            P+S TYT I+D L K+G +D+  E +  +   + + TL  Y+++V       +++   D+
Sbjct  104  PDSVTYTAIVDGLFKAGNYDAGLEYYEKMVASKCEPTLLTYTVLVDGLCKAHKVERACDV  163

Query  215  FDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDG  340
            F+EM   G  P      SL   + +AG  +   +L+  M+  G
Sbjct  164  FEEMIRKGHKPDIIAYSSLIDGLSKAGRVDEARKLVDLMIARG  206



>ref|XP_007143028.1| hypothetical protein PHAVU_007G037500g [Phaseolus vulgaris]
 gb|ESW15022.1| hypothetical protein PHAVU_007G037500g [Phaseolus vulgaris]
Length=523

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 71/140 (51%), Gaps = 24/140 (17%)
 Frame = +2

Query  11   RMIND----GALPNSRTYTVIIDHLVKSGKFDSATEVFRVLP-QMRIKRTLKQYSIMVGA  175
            RM+ +    G  PNSRT+ +I+ HL+K G+ + A  VFR +  +   + ++  Y IMV  
Sbjct  367  RMVGEMKKCGIGPNSRTFDIILHHLIKVGRIEEACTVFRRMNGEFGCEPSVSTYEIMVRM  426

Query  176  FISNDQLDAVKDLFDEMRADGILPGRAMQWSL-------QRMQEAG--YGESVDELIR--  322
            F +  +LD    ++DEM+  GILPG  M  +L        ++ EA   + E +D  IR  
Sbjct  427  FCNEVRLDMAMAVWDEMKEKGILPGVHMFSTLICSLCHENKLNEACKYFQEMLDVGIRPP  486

Query  323  --------EMLPDGRIKSIA  358
                    E L D R++ +A
Sbjct  487  AKMFSTLKEALVDARMEHVA  506



>ref|XP_006382719.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|ERP60516.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=688

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 30/109 (28%), Positives = 60/109 (55%), Gaps = 1/109 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F +M + G LP   TY+++++ L K G  D A ++F+ + + +++  +  Y+I++    
Sbjct  570  LFKKMCSSGMLPTLMTYSILLNGLCKHGHLDEALKLFKSMKEKKLEPDIILYTILIEGMF  629

Query  182  SNDQLDAVKDLFDEMRADGIL-PGRAMQWSLQRMQEAGYGESVDELIRE  325
               +L+  K LF ++ ADGI  PGR     ++ + + G  +   EL R+
Sbjct  630  IGGKLEVAKGLFSKLSADGIQPPGRTYNVMIKGLLKEGLSDEAYELFRK  678



>gb|KFK41530.1| hypothetical protein AALP_AA2G141500 [Arabis alpina]
Length=515

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 3/90 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            V + M   G  PN+RTY +I+ HL++  +   A EV++   +M  + T+  Y IMV  F 
Sbjct  364  VVEEMRLKGVGPNARTYDIILHHLIRMQRTKEAYEVYQ---KMSCEPTVSTYEIMVRMFC  420

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL  271
            + ++LD    ++DEM+  G+LPG  M  SL
Sbjct  421  NIERLDMAIKIWDEMKGKGVLPGMHMFSSL  450



>ref|XP_006382761.1| hypothetical protein POPTR_0005s05170g [Populus trichocarpa]
 gb|ERP60558.1| hypothetical protein POPTR_0005s05170g [Populus trichocarpa]
Length=530

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 35/125 (28%), Positives = 70/125 (56%), Gaps = 4/125 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMV-GAF  178
            +F  M + G LPN  TY++++D   K G  D A ++ + + + +++  +  Y+I++ G F
Sbjct  347  IFKEMCSYGLLPNLVTYSILLDGFCKHGHLDEALKLLKSMKEKKLEPNIVHYTILIEGMF  406

Query  179  ISNDQLDAVKDLFDEMRADGILPG-RAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSI  355
            I+  +L+  K+LF ++  DGI P  R     ++ + + G  +   +L R+M  DG + + 
Sbjct  407  IAG-KLEVAKELFSKLFGDGIRPTIRTYTVMIKGLLKEGLSDEAYDLFRKMEDDGFLPN-  464

Query  356  ACSMD  370
            +CS +
Sbjct  465  SCSYN  469


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 50/110 (45%), Gaps = 6/110 (5%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F ++  DG  P  RTYTV+I  L+K G  D A ++FR +           Y++M+  F+
Sbjct  417  LFSKLFGDGIRPTIRTYTVMIKGLLKEGLSDEAYDLFRKMEDDGFLPNSCSYNVMIQGFL  476

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREML  331
             N        L DEM       G+    +L   Q     ES DE+I + +
Sbjct  477  QNQDSSTAIRLIDEM------VGKRFSVNLSTFQMLLDLESQDEIISQFM  520


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 55/119 (46%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF+ MI  G  PN  TY  ++D      + + A EVF ++ +      ++ Y+I++  F 
Sbjct  242  VFETMIEKGVEPNIYTYNALMDGYCLQRQMNEAKEVFEIMARQGCAPDVRSYNILINGFC  301

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDGRIKSI  355
             + ++D  K L  EM    + P      +L Q + + G  +    + +EM   G + ++
Sbjct  302  KSRRMDEAKSLLAEMYHKALNPDTVTYSTLMQGLCQFGRPKDALNIFKEMCSYGLLPNL  360



>ref|NP_176529.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9SH26.1|PP102_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g63400 
[Arabidopsis thaliana]
 gb|AAF19704.1|AC008047_11 F2K11.22 [Arabidopsis thaliana]
 gb|AEE34095.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=577

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 58/114 (51%), Gaps = 1/114 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF +M++DG  PN  TY  ++D L K+GK + A  VF  L + +++ T+  Y+IM+    
Sbjct  457  VFKQMVSDGVHPNIMTYNTLLDGLCKNGKLEKAMVVFEYLQRSKMEPTIYTYNIMIEGMC  516

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDG  340
               +++   DLF  +   G+ P   +  ++       G  E  D L R+M  DG
Sbjct  517  KAGKVEDGWDLFCSLSLKGVKPDVIIYNTMISGFCRKGLKEEADALFRKMREDG  570



>ref|XP_006661947.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, 
chloroplastic-like [Oryza brachyantha]
Length=1091

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 60/114 (53%), Gaps = 1/114 (1%)
 Frame = +2

Query  2     VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
             +F  M++ G  P+ ++YT+IID L K+G+ +     FR L +  ++  L  Y++++    
Sbjct  928   LFQNMVDQGINPDIKSYTIIIDTLCKAGQLNDGLTYFRQLSEFGLEPDLITYNLLIDGLG  987

Query  182   SNDQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDG  340
              + +L+    LF+EM+  GI P      SL   + +AG G    ++  E+L  G
Sbjct  988   KSKRLEEADALFNEMQKKGIAPNLYTYNSLILHLGKAGKGAEAGKMYEELLAKG  1041



>ref|XP_010935557.1| PREDICTED: protein Rf1, mitochondrial-like [Elaeis guineensis]
Length=800

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 65/136 (48%), Gaps = 20/136 (15%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VFD M+  G  PN  TY+ +I+  VK+ K D A E+F+ + Q  +K  +  YS ++    
Sbjct  363  VFDSMLGKGLSPNCYTYSALINGFVKNQKMDEAMELFKKMQQQGLKPNIITYSTLLDGLC  422

Query  182  SNDQLDAVKDLFDEMRADGILP------------GRAMQWS-----LQRMQEAGYGESV-  307
               +++ V  L DEM A GI P            GR  +W      L +M E G   ++ 
Sbjct  423  HLGRVEDVGSLLDEMVAQGIHPDIITYNSIIRWFGRLGKWKKAFQFLNKMIEQGIHPNIV  482

Query  308  --DELIREMLPDGRIK  349
              + LI  +  +G+++
Sbjct  483  TLNALINFICKEGKVQ  498



>ref|XP_011032524.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Populus euphratica]
 ref|XP_011032525.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Populus euphratica]
 ref|XP_011032526.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Populus euphratica]
 ref|XP_011032527.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Populus euphratica]
Length=570

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 37/125 (30%), Positives = 71/125 (57%), Gaps = 4/125 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMV-GAF  178
            +F  M + G LP+  TY+ ++D L K G+ + A ++ + + + +I   +  Y+I++ G F
Sbjct  429  LFKEMCSSGLLPDLVTYSTLLDGLCKHGRLEEALKLLKSMQESKIDPDIVLYNILIEGMF  488

Query  179  ISNDQLDAVKDLFDEMRADGILPG-RAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSI  355
            I+  +L+  K+LF ++ ADGI P  R     ++ + + G  +   EL R+M  DG + + 
Sbjct  489  IAG-KLEVAKELFSKLFADGIQPTIRTYTIMIKGLLKEGLSDEAYELFRKMEDDGFLPN-  546

Query  356  ACSMD  370
            +CS +
Sbjct  547  SCSYN  551



>ref|XP_010427923.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial-like [Camelina sativa]
Length=509

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 3/82 (4%)
 Frame = +2

Query  26   GALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISNDQLDAV  205
            G  PN+RTY +I+ HL +  +   A EV++   +M  + T+  Y IMV  F + ++LD  
Sbjct  366  GIGPNARTYDIILHHLTRKQRTKEAYEVYK---KMSCEPTVSTYEIMVRMFCNEERLDMA  422

Query  206  KDLFDEMRADGILPGRAMQWSL  271
              ++DEM+  G+LPG  M  SL
Sbjct  423  VKIWDEMKGKGVLPGMHMFSSL  444



>ref|XP_006301573.1| hypothetical protein CARUB_v10022011mg [Capsella rubella]
 gb|EOA34471.1| hypothetical protein CARUB_v10022011mg [Capsella rubella]
Length=512

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 3/82 (4%)
 Frame = +2

Query  26   GALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISNDQLDAV  205
            G  PN+RTY +I+ HL +  +   A EV++   +M  + T+  Y IMV  F + ++LD  
Sbjct  369  GVGPNARTYDIILHHLTRKQRTKEAYEVYK---KMSCEPTVGTYEIMVRMFCNEERLDMA  425

Query  206  KDLFDEMRADGILPGRAMQWSL  271
              ++DEM+  G+LPG  M  SL
Sbjct  426  IKIWDEMKGKGVLPGMHMFSSL  447



>ref|XP_002965100.1| hypothetical protein SELMODRAFT_83796 [Selaginella moellendorffii]
 gb|EFJ33938.1| hypothetical protein SELMODRAFT_83796 [Selaginella moellendorffii]
Length=603

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 59/116 (51%), Gaps = 13/116 (11%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF+ M+  G  P+  TY +IID+  K G   +AT V R++ +  +K     Y++++  F+
Sbjct  360  VFETMVEKGCKPDMHTYGIIIDNFCKEGSMAAATHVLRLMDKAAVKPNRYIYTMIMDGFV  419

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQ-------WSLQRMQEAGYGESVDELIREM  328
             + +L+   +L+  +  DGILP              L++M EA       EL+REM
Sbjct  420  KSSRLEEALELYQRILKDGILPSTVTYNTVINALCKLKKMDEA------LELLREM  469


 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 59/116 (51%), Gaps = 3/116 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMR--IKRTLKQYSIMVGA  175
            ++ R++ DG LP++ TY  +I+ L K  K D A E+ R + + +  ++ ++  YS+++  
Sbjct  430  LYQRILKDGILPSTVTYNTVINALCKLKKMDEALELLREMQRRKEELEPSIVTYSMIIHG  489

Query  176  FISNDQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDG  340
                   +   DL  EM  +G++P      SL Q +  AG      EL+ EML  G
Sbjct  490  LGKVGMEERAFDLLAEMIDNGVIPDCFTYTSLIQTLAGAGKVSRAMELLEEMLKAG  545



>ref|XP_010471113.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial [Camelina sativa]
Length=507

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 3/82 (4%)
 Frame = +2

Query  26   GALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISNDQLDAV  205
            G  PN+RTY +I+ HL +  +   A EV++   +M  + T+  Y IMV  F + ++LD  
Sbjct  364  GIGPNARTYDIILHHLTRKQRTKEAYEVYK---KMSCEPTVSTYEIMVRMFCNEERLDMA  420

Query  206  KDLFDEMRADGILPGRAMQWSL  271
              ++DEM+  G+LPG  M  SL
Sbjct  421  IKIWDEMKGKGVLPGMHMFSSL  442



>ref|XP_009622072.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial [Nicotiana tomentosiformis]
Length=520

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +2

Query  35   PNSRTYTVIIDHLVKSGKFDSATEVFRVLPQ-MRIKRTLKQYSIMVGAFISNDQLDAVKD  211
            PNSRTY +I+ HL+K+ + + A  VF+ +    R + T+  Y IMV  F + D+ D    
Sbjct  376  PNSRTYDIILHHLIKAKRTNEAYSVFQKMSNDPRCEPTVSTYEIMVRMFCNEDRTDMALR  435

Query  212  LFDEMRADGILPGRAM  259
            ++D+M+A G+LPG  M
Sbjct  436  VWDQMKARGVLPGMHM  451



>ref|XP_011032541.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Populus euphratica]
Length=615

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 38/128 (30%), Positives = 70/128 (55%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMV-GAF  178
            +F  M + G LP+   Y++++D   K G  D A ++ + + + RIK  +  Y+I++ G F
Sbjct  432  LFKEMCSSGLLPDLMAYSILLDGFCKHGHLDEALKLLKEMHERRIKPNIILYTILIRGMF  491

Query  179  ISNDQLDAVKDLFDEMRADGILPGRAMQWS----LQRMQEAGYGESVDELIREMLPDGRI  346
            I+  +L+  K+LF ++ ADGI P     W+    ++ + + G  +   EL R+M  DG +
Sbjct  492  IAG-KLEIAKELFSKLSADGIRPD---IWTYNVMIKGLLKEGLSDEAYELFRKMEDDGFL  547

Query  347  KSIACSMD  370
               +CS +
Sbjct  548  PD-SCSYN  554



>ref|XP_010415802.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial-like [Camelina sativa]
Length=507

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 3/82 (4%)
 Frame = +2

Query  26   GALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISNDQLDAV  205
            G  PN+RTY +I+ HL +  +   A EV++   +M  + T+  Y IMV  F + ++LD  
Sbjct  364  GIGPNARTYDIILHHLTRKQRTKEAYEVYK---KMSCEPTVSTYEIMVRMFCNEERLDMA  420

Query  206  KDLFDEMRADGILPGRAMQWSL  271
              ++DEM+  G+LPG  M  SL
Sbjct  421  IKIWDEMKGKGVLPGMHMFSSL  442



>emb|CED92696.1| PPR protein [Arabidopsis thaliana]
Length=629

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 60/121 (50%), Gaps = 1/121 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F +M++DG  P+  TY++++D L K GK + A  VF  L + +++  +  Y+IM+    
Sbjct  452  IFKKMVSDGVPPDIITYSILLDGLCKYGKLEKALVVFEYLQKSKMEPDIYTYNIMIEGMC  511

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDGRIKSIA  358
               +++   DLF  +   G+ P   +  ++       G  E  D L REM  DG +    
Sbjct  512  KAGKVEDGWDLFCSLSLKGVKPNVIIYTTMISGFCRKGLKEEADALFREMKEDGTLPDSG  571

Query  359  C  361
            C
Sbjct  572  C  572



>emb|CCD31439.1| RNA processing factor 3 [Arabidopsis thaliana]
 emb|CED92694.1| PPR protein [Arabidopsis thaliana]
Length=629

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 60/121 (50%), Gaps = 1/121 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F +M++DG  P+  TY++++D L K GK + A  VF  L + +++  +  Y+IM+    
Sbjct  452  IFKKMVSDGVPPDIITYSILLDGLCKYGKLEKALVVFEYLQKSKMEPDIYTYNIMIEGMC  511

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDGRIKSIA  358
               +++   DLF  +   G+ P   +  ++       G  E  D L REM  DG +    
Sbjct  512  KAGKVEDGWDLFCSLSLKGVKPNVIIYTTMISGFCRKGLKEEADALFREMKEDGTLPDSG  571

Query  359  C  361
            C
Sbjct  572  C  572



>ref|XP_009768960.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, 
mitochondrial-like [Nicotiana sylvestris]
Length=755

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 48/90 (53%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +FDRM   G +PN  T   ++D + K G+ +S  E+F  +    +K     Y+I++ +F 
Sbjct  428  LFDRMKKGGVVPNVITLNTLLDGMCKHGRVNSGIELFAEMQGKGVKGNAITYTILITSFC  487

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL  271
            S + +D    LF+EM  +G  P   + +SL
Sbjct  488  SVNNIDKAMKLFNEMSENGCFPDAKVYYSL  517



>gb|EMT29441.1| hypothetical protein F775_20076 [Aegilops tauschii]
Length=612

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 64/115 (56%), Gaps = 3/115 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            + D M++ G  P+  TYT++ID   K+G+ D A  V R +    +K  +   +IM+GA +
Sbjct  424  LLDNMVSIGLKPDVITYTILIDGYSKNGRIDDALVVSREMLAGNVKPCVITLNIMIGALL  483

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL--QRMQEAGYGESVDELIREMLPDG  340
               + +  KDLFD++ A G++P   + +SL  Q++ E G  +  D+L   M  +G
Sbjct  484  KGGRKEEAKDLFDDIWAKGLVP-TVVTYSLMIQKLIEEGSLQESDDLFLSMEKNG  537



>ref|XP_006387304.1| hypothetical protein POPTR_1306s00200g, partial [Populus trichocarpa]
 gb|ERP46218.1| hypothetical protein POPTR_1306s00200g, partial [Populus trichocarpa]
Length=525

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 36/125 (29%), Positives = 70/125 (56%), Gaps = 4/125 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMV-GAF  178
            +F  M + G LPN  TY++++D   K G  D A ++ + + + +++  +  Y+I++ G F
Sbjct  347  LFKEMCSYGLLPNLVTYSILLDGFCKHGHLDEALKLLKSMQEKKLEPNIVLYTILIEGMF  406

Query  179  ISNDQLDAVKDLFDEMRADGILPG-RAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSI  355
            I+  +L+  K+LF ++ ADGI P  R     ++ + + G  +   +L R+M  DG +   
Sbjct  407  IAG-KLEVAKELFSKLFADGIRPTIRTYTVMIKGLLKEGLSDEAYDLFRKMEDDGFLPD-  464

Query  356  ACSMD  370
            +CS +
Sbjct  465  SCSYN  469


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 49/100 (49%), Gaps = 5/100 (5%)
 Frame = +2

Query  35   PNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISNDQLDAVKDL  214
            PN   YT++I+ +  +GK + A E+F  L    I+ T++ Y++M+   +     D   DL
Sbjct  393  PNIVLYTILIEGMFIAGKLEVAKELFSKLFADGIRPTIRTYTVMIKGLLKEGLSDEAYDL  452

Query  215  FDEMRADGILPGRA-----MQWSLQRMQEAGYGESVDELI  319
            F +M  DG LP        +Q  LQ    +     +DE++
Sbjct  453  FRKMEDDGFLPDSCSYNVIIQGFLQNQDSSTAIRLIDEMV  492



>gb|EEC66968.1| hypothetical protein OsI_33625 [Oryza sativa Indica Group]
Length=1351

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 61/114 (54%), Gaps = 1/114 (1%)
 Frame = +2

Query  2     VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
             +F  M++ G  P+ ++YT+IID L K+G+ +     FR L +M ++  L  Y++++    
Sbjct  996   LFQDMVDQGINPDIKSYTIIIDTLCKAGQLNDGLTYFRQLLEMGLEPDLITYNLLIDGLG  1055

Query  182   SNDQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDG  340
              + +L+    LF+EM+  GI+P      SL   + +AG      ++  E+L  G
Sbjct  1056  KSKRLEEAVSLFNEMQKKGIVPNLYTYNSLILHLGKAGKAAEAGKMYEELLTKG  1109



>ref|XP_011032562.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Populus euphratica]
Length=270

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 65/115 (57%), Gaps = 3/115 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMV-GAF  178
            +F+ M + G LP+  TY++++D L K+G  D A ++     + +++  +  Y+I++ G F
Sbjct  90   LFNVMCSHGLLPDLITYSILLDGLFKNGHLDEALKLLWSTQEKKLEPNIVLYTILIEGMF  149

Query  179  ISNDQLDAVKDLFDEMRADGILPG-RAMQWSLQRMQEAGYGESVDELIREMLPDG  340
            IS +  +  K+LF ++ ADGI P  R     ++ + + G  +   EL R+M  DG
Sbjct  150  ISGEH-EVAKELFFKLSADGIRPAVRTYDVMIKGLPKEGLSDEAYELFRKMEDDG  203



>emb|CED92695.1| PPR protein [Arabidopsis thaliana]
Length=629

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 58/116 (50%), Gaps = 1/116 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF +M++DG  PN  TY++++D L K GK + A  VF  L + +++  +  Y+IM+    
Sbjct  452  VFKQMVSDGVPPNIITYSILLDGLCKYGKLEKALVVFEYLQKSKMEPDIYTYNIMIEGMC  511

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDGRI  346
               +++   DLF  +   G+ P      ++       G  E  D L REM  DG +
Sbjct  512  KAGKVEDGWDLFCSLSLKGVKPNVITYTTMISGFCRKGLKEEADALFREMKEDGTL  567



>gb|EMS49689.1| Protein Rf1, mitochondrial [Triticum urartu]
Length=713

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 65/115 (57%), Gaps = 3/115 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            + D M++ G  P+  TY ++ID   K+G+ D A  VFR +   + K ++  ++IM+GA +
Sbjct  527  LLDNMVSIGMEPDVITYNILIDGYSKNGRIDDALVVFREMLDTKGKPSVISFNIMIGALL  586

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL--QRMQEAGYGESVDELIREMLPDG  340
               +    KDLFD + A+G++P   + +SL  Q++ E G  +  D+L   M  +G
Sbjct  587  KCGRKAEAKDLFDGIWANGLVP-DIVTYSLMIQKLIEEGSLQESDDLFVSMEKNG  640


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F  M  +G  P+  TYT+ +D+L KSG+   A ++F  +  +  K T+  YSI++  + 
Sbjct  282  IFQEMSRNGVQPDIVTYTIQMDYLCKSGRCTEARKIFDSMISLGQKPTVTTYSILLHGYA  341

Query  182  SNDQLDAVKDLFDEMRADGILP  247
                   +  L D M  +GI+P
Sbjct  342  MEKSFHDMLCLIDLMVGNGIVP  363



>gb|ABB47632.1| pentatricopeptide, putative, expressed [Oryza sativa Japonica 
Group]
Length=1080

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 61/114 (54%), Gaps = 1/114 (1%)
 Frame = +2

Query  2     VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
             +F  M++ G  P+ ++YT+IID L K+G+ +     FR L +M ++  L  Y++++    
Sbjct  917   LFQDMVDQGINPDIKSYTIIIDTLCKAGQLNDGLTYFRQLLEMGLEPDLITYNLLIDGLG  976

Query  182   SNDQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDG  340
              + +L+    LF+EM+  GI+P      SL   + +AG      ++  E+L  G
Sbjct  977   KSKRLEEAVSLFNEMQKKGIVPNLYTYNSLILHLGKAGKAAEAGKMYEELLTKG  1030



>gb|EEE50977.1| hypothetical protein OsJ_31558 [Oryza sativa Japonica Group]
Length=1263

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 61/114 (54%), Gaps = 1/114 (1%)
 Frame = +2

Query  2     VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
             +F  M++ G  P+ ++YT+IID L K+G+ +     FR L +M ++  L  Y++++    
Sbjct  1042  LFQDMVDQGINPDIKSYTIIIDTLCKAGQLNDGLTYFRQLLEMGLEPDLITYNLLIDGLG  1101

Query  182   SNDQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDG  340
              + +L+    LF+EM+  GI+P      SL   + +AG      ++  E+L  G
Sbjct  1102  KSKRLEEAVSLFNEMQKKGIVPNLYTYNSLILHLGKAGKAAEAGKMYEELLTKG  1155



>gb|EMT01673.1| hypothetical protein F775_23319 [Aegilops tauschii]
Length=809

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 71/126 (56%), Gaps = 4/126 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            + D M++ G  P+  TY ++ID   K+GK D A  VFR + + + K ++  ++IM+GA +
Sbjct  650  LLDNMVSIGMEPDVITYNILIDGYSKNGKIDDALVVFRGMLERKDKPSVFTFNIMIGALL  709

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQ--RMQEAGYGESVDELIREMLPDGRIKSI  355
               + +  KDLFD + A G++P   + +SL   ++ E G  +  D+L   M  +G   + 
Sbjct  710  KCRRKEEAKDLFDGIWAKGLVP-DVVTYSLMILKLIEEGSLQESDDLFLSMEKNG-YPAN  767

Query  356  ACSMDA  373
            +C ++A
Sbjct  768  SCMLNA  773



>ref|XP_010681691.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial [Beta vulgaris subsp. vulgaris]
Length=542

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 57/115 (50%), Gaps = 2/115 (2%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVF-RVLPQMRIKRTLKQYSIMVGAF  178
            + D M      PNSRTY +I+ HL+K+GK++ A  VF R+            Y+I++  F
Sbjct  388  ILDEMKKCKVGPNSRTYDIILHHLIKAGKYEEAYSVFMRMNNDQGCDPIESTYTIIIRMF  447

Query  179  ISNDQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDG  340
                +LD    ++++M+  GILPG  M  +L    + A   E   +   EML  G
Sbjct  448  CGKGELDMAVKVWNQMKGKGILPGMHMFATLINSFRHANKLEDACKFFEEMLDFG  502



>gb|EYU46490.1| hypothetical protein MIMGU_mgv11b018784mg [Erythranthe guttata]
Length=612

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 57/124 (46%), Gaps = 6/124 (5%)
 Frame = +2

Query  5    FDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFIS  184
            F  +   G  PNS T   ++D L K+GK D A+E+F    +M +  +   YSIM+  F  
Sbjct  459  FQTLEKSGYKPNSLTCNCLLDGLCKAGKLDLASELFGRFSEMELAPSAYTYSIMINGFCK  518

Query  185  NDQLDAVKDLFDEMRADGILPGRAMQWSLQR-MQEAGYGESVDELI-----REMLPDGRI  346
              QL+   +LF EM   G  P  A   +L R   +    + V EL+     R  +PD   
Sbjct  519  GGQLEKANNLFLEMEKKGCAPDVATFNTLMRGFCDNNDADKVVELLHLMAERSFVPDSYT  578

Query  347  KSIA  358
             +I 
Sbjct  579  AAIV  582



>ref|XP_006382709.1| hypothetical protein POPTR_0005s04650g [Populus trichocarpa]
 gb|ERP60506.1| hypothetical protein POPTR_0005s04650g [Populus trichocarpa]
Length=531

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 37/128 (29%), Positives = 69/128 (54%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMV-GAF  178
            +F  M + G LP+   Y++++D   K G  D A ++ + + + RIK  +  Y+I++ G F
Sbjct  347  LFKEMCSSGLLPDLMAYSILLDGFCKHGHLDEALKLLKEMHERRIKPNIILYTILIRGMF  406

Query  179  ISNDQLDAVKDLFDEMRADGILPGRAMQWS----LQRMQEAGYGESVDELIREMLPDGRI  346
            I+  +L+  K+LF ++ ADGI P     W+    ++ + + G  +   E  R+M  DG +
Sbjct  407  IAG-KLEVAKELFSKLSADGIRPD---IWTYNVMIKGLLKEGLSDEAYEFFRKMEDDGFL  462

Query  347  KSIACSMD  370
               +CS +
Sbjct  463  PD-SCSYN  469



>ref|XP_009356158.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial-like [Pyrus x bretschneideri]
Length=523

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 64/117 (55%), Gaps = 6/117 (5%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLP-QMRIKRTLKQYSIMVGAF  178
            V D M   G  PN+RTY +I+ HLVK+ + + A  +F+ +  +   + T+  Y IMV  F
Sbjct  366  VVDEMRKCGIGPNARTYDIILHHLVKARRTEQAYSIFQQMSREPGCEPTVSTYEIMVRMF  425

Query  179  ISNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVD---ELIREMLPDG  340
             + +++D    ++D+M+  G+LPG  M  +L  +    +G  +D   +  +EML  G
Sbjct  426  CNEERVDMAMQVWDQMKTRGVLPGMHMFSTL--INSLCHGNKLDDACKYFQEMLDAG  480



>emb|CBI16176.3| unnamed protein product [Vitis vinifera]
Length=819

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 32/90 (36%), Positives = 48/90 (53%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F+ M + G  PN  TY+++ID   K GK D A      + ++ IK T+  YS ++    
Sbjct  377  LFNNMGHKGLFPNDVTYSILIDSFCKRGKLDVALHFLGKMTEVGIKATVYPYSSLISGHC  436

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL  271
               +L A K LFDEM A+G+ P   +  SL
Sbjct  437  KLGKLRAAKSLFDEMIANGLKPNVVIYTSL  466



>ref|XP_008389228.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial-like [Malus domestica]
Length=523

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 64/117 (55%), Gaps = 6/117 (5%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQ-MRIKRTLKQYSIMVGAF  178
            V D M   G  PN+RTY +I+ HLVK+ + + A  +F+ + +    + T+  Y IMV  F
Sbjct  366  VVDEMRKCGIGPNARTYDIILHHLVKARRTEQAYSIFQQMSRDPGCEPTVSTYEIMVRMF  425

Query  179  ISNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVD---ELIREMLPDG  340
             + +++D    ++D+M+  G+LPG  M  +L  +    +G  +D   +  +EML  G
Sbjct  426  CNEERMDMALQVWDQMKTRGVLPGMHMFATL--INSLCHGNKLDDACKYFQEMLDAG  480



>ref|XP_009626803.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, 
mitochondrial-like [Nicotiana tomentosiformis]
Length=758

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 49/90 (54%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +FD+M   G +PN  T   ++D + K G+ +S  E+F  +    +K     Y+I++ +F 
Sbjct  431  LFDQMKKGGVVPNVITLNTLLDGMCKHGRVNSGIELFAEMQGKGVKGNAITYTILITSFC  490

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL  271
            S + +D   +LF+EM  +G  P   + +SL
Sbjct  491  SVNNIDKAMNLFNEMSENGCFPDAKVYYSL  520



>ref|NP_176501.1| transacting siRNA generating locus [Arabidopsis thaliana]
 sp|Q9CAN0.1|PPR99_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g63130, 
mitochondrial; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51613.1|AC010795_17 unknown protein; 64081-65973 [Arabidopsis thaliana]
 gb|AAM91590.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15444.1| unknown protein [Arabidopsis thaliana]
 gb|AEE34059.1| transacting siRNA generating locus [Arabidopsis thaliana]
Length=630

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 59/114 (52%), Gaps = 1/114 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF +M++DG LP+  TY++++D L  +GK ++A  VF  L + +++  +  Y+IM+    
Sbjct  453  VFKQMVSDGVLPDIMTYSILLDGLCNNGKVETALVVFEYLQRSKMEPDIYTYNIMIEGMC  512

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQR-MQEAGYGESVDELIREMLPDG  340
               +++   DLF  +   G+ P      ++       G  E  D L REM  +G
Sbjct  513  KAGKVEDGWDLFCSLSLKGVKPNVVTYTTMMSGFCRKGLKEEADALFREMKEEG  566


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F+ MI+    PN  TY  +I    K+ + D   E+FR + Q  +      Y+ ++  F 
Sbjct  383  MFELMISKDCFPNVVTYNTLIKGFCKAKRVDEGMELFREMSQRGLVGNTVTYTTLIHGFF  442

Query  182  SNDQLDAVKDLFDEMRADGILP  247
               + D  + +F +M +DG+LP
Sbjct  443  QARECDNAQIVFKQMVSDGVLP  464



>ref|XP_006838717.1| hypothetical protein AMTR_s00002p00251730 [Amborella trichopoda]
 gb|ERN01286.1| hypothetical protein AMTR_s00002p00251730 [Amborella trichopoda]
Length=904

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 59/114 (52%), Gaps = 1/114 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            + D+MI  G  PNS TY  +ID L K GK D A+     + ++ IK T+  Y+I++    
Sbjct  534  LLDKMIEHGCFPNSYTYNSVIDGLCKEGKMDEASLCLERMVELGIKPTVVTYTILIDQLC  593

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQ-EAGYGESVDELIREMLPDG  340
              ++++    +F++M + G  P      S+     + G  E V++L+ +M  +G
Sbjct  594  KEEKIEQAIQVFEQMVSSGCTPDACAYTSIIFAYFKEGNLEEVEKLMLKMDTEG  647



>ref|XP_006389306.1| hypothetical protein POPTR_0030s00260g, partial [Populus trichocarpa]
 gb|ERP48220.1| hypothetical protein POPTR_0030s00260g, partial [Populus trichocarpa]
Length=455

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 59/114 (52%), Gaps = 1/114 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F  M + G LPN  TY++++D L K G  D A +V + + + RI+  +  Y+I++    
Sbjct  277  LFKEMCSYGLLPNLITYSIVLDGLCKHGLLDEAFKVLKAMQERRIEPDIFIYTILIRGMC  336

Query  182  SNDQLDAVKDLFDEMRADGILPG-RAMQWSLQRMQEAGYGESVDELIREMLPDG  340
            +  +L+A ++LF  +   GI P     +  +  + + G      EL R+M  DG
Sbjct  337  NFGKLEAARELFSNLFVKGIQPDVVTYKVMISGLLKEGLSNEACELFRKMAVDG  390



>emb|CBI24780.3| unnamed protein product [Vitis vinifera]
Length=890

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 35/114 (31%), Positives = 58/114 (51%), Gaps = 1/114 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            + +RM+ND  LPNS TY V+I+ L K  K   A+ +   +  M +K T+  Y+I++G  +
Sbjct  531  LLERMLNDACLPNSYTYNVLIEGLCKEKKMKEASSLVAKMLTMGVKPTVVTYTILIGEML  590

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWS-LQRMQEAGYGESVDELIREMLPDG  340
             +   D    +F+ M + G  P      + L      G  E VD++I +M  +G
Sbjct  591  KDGAFDHALKVFNHMVSLGYQPDVCTYTAFLHAYFSQGMLEEVDDVIAKMNEEG  644



>ref|XP_010650766.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 
[Vitis vinifera]
 ref|XP_010650767.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 
[Vitis vinifera]
 ref|XP_010650768.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 
[Vitis vinifera]
 ref|XP_010650769.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 
[Vitis vinifera]
 ref|XP_010650770.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 
[Vitis vinifera]
Length=913

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 35/114 (31%), Positives = 58/114 (51%), Gaps = 1/114 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            + +RM+ND  LPNS TY V+I+ L K  K   A+ +   +  M +K T+  Y+I++G  +
Sbjct  543  LLERMLNDACLPNSYTYNVLIEGLCKEKKMKEASSLVAKMLTMGVKPTVVTYTILIGEML  602

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWS-LQRMQEAGYGESVDELIREMLPDG  340
             +   D    +F+ M + G  P      + L      G  E VD++I +M  +G
Sbjct  603  KDGAFDHALKVFNHMVSLGYQPDVCTYTAFLHAYFSQGMLEEVDDVIAKMNEEG  656



>gb|KDP38032.1| hypothetical protein JCGZ_04675 [Jatropha curcas]
Length=489

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 52/87 (60%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVF-RVLPQMRIKRTLKQYSIMVGAF  178
            + D M   G  PN+RTY +I+ HL+K+ + + A  VF ++  +   + T+  Y I+V  F
Sbjct  334  IVDEMRRYGIGPNARTYDIILHHLIKAQRTEEALSVFEKMSSEQGCEPTVSTYEIIVRMF  393

Query  179  ISNDQLDAVKDLFDEMRADGILPGRAM  259
             + +++D    ++D+M+A GILPG  M
Sbjct  394  CNAERVDKAIQIWDQMKAKGILPGMHM  420



>ref|XP_002319601.2| hypothetical protein POPTR_0013s03290g [Populus trichocarpa]
 gb|EEE95524.2| hypothetical protein POPTR_0013s03290g [Populus trichocarpa]
Length=497

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 66/126 (52%), Gaps = 4/126 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +   M + G LPN  TY++++D L K G  D A E+ + + + +I+  +  Y+I++    
Sbjct  314  LLKEMCSYGLLPNLITYSIVLDGLCKHGHLDEAFELLKAMQESKIEPNIFIYTILIEGMC  373

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWS--LQRMQEAGYGESVDELIREMLPDGRIKSI  355
            +  +L+A ++LF  +   GI P   + ++  +  + + G      EL REM  +G + + 
Sbjct  374  TFGKLEAARELFSNLFVKGIQP-TVVTYTVMISGLLKGGLSNEACELFREMAVNGCLPN-  431

Query  356  ACSMDA  373
            +C+ + 
Sbjct  432  SCTYNV  437


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/119 (23%), Positives = 54/119 (45%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF+ M   G  P+  TY  ++D      + D A ++F ++ +      ++ Y+I++    
Sbjct  209  VFETMTEKGLEPDVYTYNALVDGYCSRSQMDEAQKLFNIMDRKGCAPNVRSYNILINGHC  268

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQR-MQEAGYGESVDELIREMLPDGRIKSI  355
             + ++D  K L  EM    + P      +L R   + G  +   EL++EM   G + ++
Sbjct  269  KSGRIDEAKGLLAEMSHKSLTPDIFTYSTLMRGFCQVGRPQEAQELLKEMCSYGLLPNL  327



>ref|XP_010933049.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Elaeis guineensis]
Length=756

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/82 (37%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF+ M+  G  PNS TY+V+I+  VK+ K D A E+F  + +  +K  +  YSI++    
Sbjct  340  VFNSMLVKGPAPNSHTYSVLINGFVKNQKMDEAMELFNKMQKGGVKPDIITYSIILDGLC  399

Query  182  SNDQLDAVKDLFDEMRADGILP  247
               +++ V+ L DEM   GI P
Sbjct  400  HLGKMEDVRGLLDEMMTQGIRP  421



>ref|XP_011032465.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Populus euphratica]
Length=584

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 36/125 (29%), Positives = 70/125 (56%), Gaps = 4/125 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMV-GAF  178
            +F  M + G LPN  TY++++D   K G  D A ++ + + + +++  +  Y+I++ G F
Sbjct  406  LFKEMCSYGLLPNLVTYSILLDGFCKHGYLDEALKLLQSMQEKKLEPNIVLYTILIEGMF  465

Query  179  ISNDQLDAVKDLFDEMRADGILPG-RAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSI  355
            I+  +L+  K+LF ++ ADGI P  R     ++ + + G  +   +L R+M  DG +   
Sbjct  466  IAG-KLEVAKELFSKLFADGIRPTIRTYTVMIKGLLKEGLSDEAYDLFRKMEDDGFLPD-  523

Query  356  ACSMD  370
            +CS +
Sbjct  524  SCSYN  528



>ref|XP_011031386.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62930, 
chloroplastic-like isoform X2 [Populus euphratica]
Length=403

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 54/114 (47%), Gaps = 1/114 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F  M  +G LPN RTY+++ID   K G    A  +FR +    +K  L  Y+I+V A  
Sbjct  242  LFRNMRTNGNLPNLRTYSILIDGFCKQGYLGKAFRLFRAMQSTHLKPNLVMYTILVHAMC  301

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQ-RMQEAGYGESVDELIREMLPDG  340
             +  L   + LF E+   G+ P   +  ++   + + G  +   E  R M  DG
Sbjct  302  KSGNLKDARKLFSELFVQGLQPNVQIYTTIIFGLCKEGLLDEALEAFRNMEEDG  355



>gb|KJB26426.1| hypothetical protein B456_004G240600, partial [Gossypium raimondii]
Length=509

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 62/124 (50%), Gaps = 2/124 (2%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            + D MI  G  P+  TY  IID L    + D A  VF+++ +      ++ Y+IM+  + 
Sbjct  232  IVDTMIKQGIEPDVVTYNSIIDGLGLEKQMDKAKRVFQLMIEKGCASNIRSYNIMINGYC  291

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDGRIKS-I  355
               +LD   +LFDE+  +G +P      +L Q M + G   +  +L+R +L  G +   +
Sbjct  292  KAKRLDEAMELFDEITQNGQIPDTVTYNTLMQGMCQLGRVATACKLLRTLLASGPVPDLV  351

Query  356  ACSM  367
             CS+
Sbjct  352  TCSI  355


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/108 (26%), Positives = 53/108 (49%), Gaps = 11/108 (10%)
 Frame = +2

Query  14   MINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISNDQ  193
            ++  G +P+  T ++++D L KSGK + A ++ R + + R++  +  YSI++        
Sbjct  341  LLASGPVPDLVTCSILLDGLCKSGKLEEALKLCRAMQKSRLEVDIISYSILIDGLCKAGN  400

Query  194  LDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPD  337
            ++A K+LF E+   G+ P               Y   ++   RE LPD
Sbjct  401  VEAGKELFHELSVSGLKP-----------NVYTYSILINGFCREGLPD  437



>gb|EMT30302.1| hypothetical protein F775_16218 [Aegilops tauschii]
Length=798

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 65/115 (57%), Gaps = 3/115 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            + D M++ G  P+  TY ++ID   K+GK + A   FR + + ++K ++  ++IM+G  +
Sbjct  610  LLDNMVSIGMEPDVITYNILIDGYSKNGKINDALVFFREMLEGKVKPSVIIFNIMIGVLL  669

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL--QRMQEAGYGESVDELIREMLPDG  340
               + +  KDLFD + A G++P   + +SL  Q++ E G  +  D+L   M  +G
Sbjct  670  KCGRKEEAKDLFDGIWAKGLVP-DVVTYSLMIQKLIEEGSLQESDDLFLSMEKNG  723


 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 64/118 (54%), Gaps = 4/118 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F  M++ G  PN+  +  I+D L K+G+   A ++F ++  M +K  +  Y+ + G ++
Sbjct  540  LFSEMLDRGICPNTLFFNTIMDRLCKNGRVMEAQDLFDLMVHMGVKPDVCTYNKLTGGYL  599

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELI--REMLPDGRIK  349
               ++D V  L D M + G+ P   + +++     +  G+  D L+  REML +G++K
Sbjct  600  FIGKMDEVSKLLDNMVSIGMEP-DVITYNILIDGYSKNGKINDALVFFREML-EGKVK  655



>ref|XP_003535704.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial-like [Glycine max]
Length=507

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 53/93 (57%), Gaps = 6/93 (6%)
 Frame = +2

Query  11   RMIND----GALPNSRTYTVIIDHLVKSGKFDSATEVFRVLP--QMRIKRTLKQYSIMVG  172
            RM+ +    G  PNSRT+ +++ HL+K  + + A+ VFR +   +   + ++  Y IMV 
Sbjct  350  RMVGEMKKCGIGPNSRTFDIVLHHLIKGRRIEEASSVFRRMNGGEFGCEPSVSTYEIMVR  409

Query  173  AFISNDQLDAVKDLFDEMRADGILPGRAMQWSL  271
             F + + LD    ++DEM+  GILPG  M  +L
Sbjct  410  MFCNEELLDMAVAVWDEMKGKGILPGMHMFSTL  442



>gb|AES62791.2| PPR containing plant-like protein [Medicago truncatula]
Length=509

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 50/83 (60%), Gaps = 1/83 (1%)
 Frame = +2

Query  26   GALPNSRTYTVIIDHLVKSGKFDSATEVF-RVLPQMRIKRTLKQYSIMVGAFISNDQLDA  202
            G  PN+RTY +I+ HL+K G+   A  VF R+  +   + ++  Y+IMV  F + +QLD 
Sbjct  362  GIGPNARTYDIILVHLIKGGRTKEAYSVFQRMSSETGCEPSVSTYAIMVRMFCNENQLDM  421

Query  203  VKDLFDEMRADGILPGRAMQWSL  271
               +++EM+  GILPG  M  +L
Sbjct  422  AMVVWNEMKDKGILPGIHMFSTL  444



>ref|XP_002974875.1| hypothetical protein SELMODRAFT_150113 [Selaginella moellendorffii]
 gb|EFJ24395.1| hypothetical protein SELMODRAFT_150113 [Selaginella moellendorffii]
Length=382

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 57/119 (48%), Gaps = 13/119 (11%)
 Frame = +2

Query  11   RMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISND  190
            RM++ G +P+  TYTV+ID L K G+ D A E+FR L   +    +  YS ++G +    
Sbjct  247  RMVSQGCIPDVVTYTVVIDKLCKVGRVDDAHEIFRELVANKCSPNVVTYSALIGGYCRAS  306

Query  191  QLDAVKDLFDEMRA-DGILPGRAMQWSLQRM--QEAGYGESVDELIREM-----LPDGR  343
            ++D    +  EM     ++    M W L  +   E  YG     + REM     +PD R
Sbjct  307  RVDEGGKVMREMACRPNVVTYNTMIWGLSMVDRNEEAYG-----MFREMSECGFVPDAR  360


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 52/118 (44%), Gaps = 1/118 (1%)
 Frame = +2

Query  5    FDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFIS  184
            F +M  +G +P   ++  II  L ++ +   A EVF  +        L  YS+++     
Sbjct  140  FTQMTEEGYVPTLVSFNAIITGLCRARRLADALEVFNEMIDRDFHPNLVTYSVVIDGLCK  199

Query  185  NDQLDAVKDLFDEMRADGILPGRAMQWSLQ-RMQEAGYGESVDELIREMLPDGRIKSI  355
            +DQLD  + L D M ++G  P       L      AG  +S   L+R M+  G I  +
Sbjct  200  SDQLDEAQQLLDRMVSEGCRPDLVAYTPLVLGFSAAGRLDSALGLLRRMVSQGCIPDV  257



>ref|XP_003592540.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
Length=507

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 50/83 (60%), Gaps = 1/83 (1%)
 Frame = +2

Query  26   GALPNSRTYTVIIDHLVKSGKFDSATEVF-RVLPQMRIKRTLKQYSIMVGAFISNDQLDA  202
            G  PN+RTY +I+ HL+K G+   A  VF R+  +   + ++  Y+IMV  F + +QLD 
Sbjct  360  GIGPNARTYDIILVHLIKGGRTKEAYSVFQRMSSETGCEPSVSTYAIMVRMFCNENQLDM  419

Query  203  VKDLFDEMRADGILPGRAMQWSL  271
               +++EM+  GILPG  M  +L
Sbjct  420  AMVVWNEMKDKGILPGIHMFSTL  442



>ref|NP_177858.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 gb|AEE35966.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=402

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +2

Query  11   RMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISND  190
            +M +D   PN RTYTV+ID L  SG+   A  +F+ + +  IK     Y++++ +F S D
Sbjct  250  KMKDDNCCPNVRTYTVLIDALCGSGQKSEAMNLFKQMSESGIKPDDCMYTVLIQSFCSGD  309

Query  191  QLDAVKDLFDEMRADGILPG  250
             LD    L + M  +G++P 
Sbjct  310  TLDEASGLLEHMLENGLMPN  329



>ref|NP_176481.2| pentatricopeptide repeat protein RPF3 [Arabidopsis thaliana]
 sp|Q9LQ14.2|PPR96_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g62930, 
chloroplastic; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE34023.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=629

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 59/116 (51%), Gaps = 1/116 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F +M++DG  P+  TY++++D L K GK + A  VF  L + +++  +  Y+IM+    
Sbjct  452  IFKKMVSDGVPPDIITYSILLDGLCKYGKLEKALVVFEYLQKSKMEPDIYTYNIMIEGMC  511

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDGRI  346
               +++   DLF  +   G+ P   +  ++       G  E  D L REM  DG +
Sbjct  512  KAGKVEDGWDLFCSLSLKGVKPNVIIYTTMISGFCRKGLKEEADALFREMKEDGTL  567



>gb|AAG29197.1|AC078898_7 hypothetical protein [Arabidopsis thaliana]
Length=441

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +2

Query  11   RMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISND  190
            +M +D   PN RTYTV+ID L  SG+   A  +F+ + +  IK     Y++++ +F S D
Sbjct  250  KMKDDNCCPNVRTYTVLIDALCGSGQKSEAMNLFKQMSESGIKPDDCMYTVLIQSFCSGD  309

Query  191  QLDAVKDLFDEMRADGILPG  250
             LD    L + M  +G++P 
Sbjct  310  TLDEASGLLEHMLENGLMPN  329



>gb|AAF75803.1|AC011000_6 Contains weak similarity to leaf protein from Ipomea nil gb|D85101 
and contains a RepB PF|01051 protein and multiple PPR 
PF|01535 repeats [Arabidopsis thaliana]
Length=613

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 59/116 (51%), Gaps = 1/116 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F +M++DG  P+  TY++++D L K GK + A  VF  L + +++  +  Y+IM+    
Sbjct  436  IFKKMVSDGVPPDIITYSILLDGLCKYGKLEKALVVFEYLQKSKMEPDIYTYNIMIEGMC  495

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDGRI  346
               +++   DLF  +   G+ P   +  ++       G  E  D L REM  DG +
Sbjct  496  KAGKVEDGWDLFCSLSLKGVKPNVIIYTTMISGFCRKGLKEEADALFREMKEDGTL  551



>ref|XP_004172591.1| PREDICTED: pentatricopeptide repeat-containing protein At2g32630-like, 
partial [Cucumis sativus]
Length=602

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/90 (31%), Positives = 49/90 (54%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            + + M   G +P++ TYT +ID    SG  D A E+F  +PQ+ + R +  Y++++    
Sbjct  490  LINEMQERGLMPDTYTYTSLIDGERASGNVDRALELFNEMPQLGLNRNVVTYTVIISGLS  549

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL  271
             + + D    L+DEM  +GI+P   +  SL
Sbjct  550  KDGRADEAFKLYDEMNKEGIVPDDGIYSSL  579



>ref|XP_002963786.1| hypothetical protein SELMODRAFT_79843 [Selaginella moellendorffii]
 gb|EFJ35657.1| hypothetical protein SELMODRAFT_79843 [Selaginella moellendorffii]
Length=432

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 57/119 (48%), Gaps = 13/119 (11%)
 Frame = +2

Query  11   RMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISND  190
            RM++ G +P+  TYTV+ID L K G+ D A E+FR L   +    +  YS ++G +    
Sbjct  297  RMVSQGCIPDVVTYTVVIDKLCKVGRVDDAHEIFRELVANKCSPNVVTYSALIGGYCRAS  356

Query  191  QLDAVKDLFDEMRAD-GILPGRAMQWSLQRM--QEAGYGESVDELIREM-----LPDGR  343
            ++D    +  EM     ++    M W L  +   E  YG     + REM     +PD R
Sbjct  357  RVDEGGKVMREMACRPNVVTYNTMIWGLSMVDRNEEAYG-----MFREMSECGFVPDAR  410


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 52/118 (44%), Gaps = 1/118 (1%)
 Frame = +2

Query  5    FDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFIS  184
            F +M  +G +P   ++  II  L ++ +   A EVF  +        L  YS+++     
Sbjct  190  FTQMTEEGYVPTLVSFNAIITGLCRARRLADALEVFNEMIDRDFHPNLVTYSVVIDGLCK  249

Query  185  NDQLDAVKDLFDEMRADGILPGRAMQWSLQ-RMQEAGYGESVDELIREMLPDGRIKSI  355
            +DQLD  + L D M ++G  P       L      AG  +S   L+R M+  G I  +
Sbjct  250  SDQLDEAQQLLDRMVSEGCRPDLVAYTPLVLGFSAAGRLDSALGLLRRMVSQGCIPDV  307



>ref|XP_006494534.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62930, 
chloroplastic-like isoform X2 [Citrus sinensis]
Length=437

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 57/112 (51%), Gaps = 12/112 (11%)
 Frame = +2

Query  50   YTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISNDQLDAVKDLFDEMR  229
            Y+ +ID L K GK ++A E+F+ LP++ +   +  Y+IM+  F ++ Q+D   DLF +M 
Sbjct  308  YSCLIDGLCKIGKLETAWELFQSLPRVGLMPNVVTYNIMIHGFCNDGQMDKAHDLFLDME  367

Query  230  ADGILPG----RAMQWSLQRMQEAGYGESVDELI-----REMLPDGRIKSIA  358
            A G+ P       +     R  E      V EL+     R ++PDG   SI 
Sbjct  368  AKGVAPNCVTFNTLMLGCIRNNET---SKVVELLHRMDERNVIPDGSTLSIV  416



>emb|CDX81633.1| BnaC08g39680D [Brassica napus]
Length=909

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 62/135 (46%), Gaps = 24/135 (18%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F  M+++G  PN  TY ++++     GK D A ++F  LP   +K  +K Y++M+G   
Sbjct  772  LFQEMVSEGVHPNIMTYGILLE-----GKVDDAWDLFCSLPSKGVKPDVKTYTVMIGGLC  826

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQR-----------------MQEAGYG--ES  304
                L     LF +M  DGI P      +L R                 M+  G+    S
Sbjct  827  KKGSLSEADALFRKMEEDGITPISGTYNTLIRAHLREGDLATSAKLIEEMKSCGFSADAS  886

Query  305  VDELIREMLPDGRIK  349
              +++ +ML DGR+K
Sbjct  887  TIKIVMDMLSDGRMK  901



>ref|XP_002964278.1| hypothetical protein SELMODRAFT_80975 [Selaginella moellendorffii]
 gb|EFJ34611.1| hypothetical protein SELMODRAFT_80975 [Selaginella moellendorffii]
Length=331

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VFD+M+    +PN  TYT +ID L KSGK  +A EV   + +  +   +  YS ++  F 
Sbjct  136  VFDKMVRSNCVPNVVTYTTLIDGLSKSGKVQAAAEVLDGMVKKGVTPNVATYSCLIDGFC  195

Query  182  SNDQLDAVKDLFDEMRADGILP  247
               ++D    L ++M   GI P
Sbjct  196  KVRRVDEAHKLLEQMVTQGIAP  217


 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 55/113 (49%), Gaps = 7/113 (6%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            + ++M+  G  P   TY ++++ L ++ K + A ++FR + Q R   T+  Y+ ++ A  
Sbjct  206  LLEQMVTQGIAPTVVTYNILLNSLCRADKLEDAFKLFRGMAQRRCHPTVVTYNTLLRALC  265

Query  182  SNDQLDAVKDLFDEMRADGILPGR----AMQWSLQRMQEAGYGESVDELIREM  328
             + QLD    L+ EM A G  P       + W L R   AG      EL+ +M
Sbjct  266  HHKQLDGAHRLYAEMIAKGCPPDAITYDTLAWGLTR---AGKVHEAQELMEKM  315


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F++M+     PN  TY  +I+ L K+ + ++A E+F+ +       T   Y+ ++  F 
Sbjct  66   LFEKMVKQRINPNVVTYNTLINGLCKAWRIETAYELFKEMAGKGYVPTEVSYNTLIDGFC  125

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDGRIKSIA  358
                L A KD+FD+M     +P      +L   + ++G  ++  E++  M+  G   ++A
Sbjct  126  KKKDLVAAKDVFDKMVRSNCVPNVVTYTTLIDGLSKSGKVQAAAEVLDGMVKKGVTPNVA  185



>emb|CDP04586.1| unnamed protein product [Coffea canephora]
Length=517

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 51/91 (56%), Gaps = 1/91 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLP-QMRIKRTLKQYSIMVGAF  178
            + D M   G  PNSRTY +I+ HL+KS +   A  VF+ +  +   + T+  Y IMV  F
Sbjct  362  IVDEMRICGVGPNSRTYDIILHHLIKSHRTQEAYAVFQKMNDEPGCEPTISTYEIMVRMF  421

Query  179  ISNDQLDAVKDLFDEMRADGILPGRAMQWSL  271
             + ++ D    ++++M+A G LPG  M  SL
Sbjct  422  CNEERTDMALRVWNQMKAKGFLPGMHMFSSL  452



>ref|XP_002315895.2| hypothetical protein POPTR_0010s12490g [Populus trichocarpa]
 gb|EEF02066.2| hypothetical protein POPTR_0010s12490g [Populus trichocarpa]
Length=488

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 51/88 (58%), Gaps = 0/88 (0%)
 Frame = +2

Query  8    DRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISN  187
            D M   G  P++RTY +I+ HL+++GK   A  VF+ +     + ++  Y I+V  F + 
Sbjct  336  DEMRKGGVGPSARTYDIILHHLIRAGKTKIAYSVFQKMSCEGCEPSVSTYEIIVRMFCNE  395

Query  188  DQLDAVKDLFDEMRADGILPGRAMQWSL  271
            D++D    ++D+M+A GILP   M  +L
Sbjct  396  DRVDMAIKVWDQMKAKGILPVMHMFSTL  423



>ref|XP_010935675.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12775, 
mitochondrial-like [Elaeis guineensis]
Length=456

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 47/90 (52%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            V D M+  G  PN  TY+V+I+  VK+ K D A E+F  + Q  +K  +  Y+ ++    
Sbjct  272  VLDSMLGKGLAPNCHTYSVLINGFVKNQKMDEAVELFNQMQQQGVKPHVVTYNTVLDGLC  331

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL  271
               +++ V+   DEM A GI P   M  S+
Sbjct  332  HLGRVEDVRSFLDEMVAQGIHPNVIMYNSI  361



>ref|XP_002465109.1| hypothetical protein SORBIDRAFT_01g032160 [Sorghum bicolor]
 gb|EER92107.1| hypothetical protein SORBIDRAFT_01g032160 [Sorghum bicolor]
Length=1153

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 62/114 (54%), Gaps = 1/114 (1%)
 Frame = +2

Query  2     VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
             +F++M+  G  P+ ++YTV+ID L  +G+ +     FR L ++ ++  L  Y++++    
Sbjct  935   IFEKMVEQGINPDIKSYTVLIDTLCTAGRLNDGLSYFRQLLELGLEPDLIIYNLLIDGLG  994

Query  182   SNDQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDG  340
              +++++    LF+EM+  GI+P      SL   + +AG      ++  E+L  G
Sbjct  995   KSERIEEAVCLFNEMKKKGIVPNLYTYNSLILHLGKAGKASEAAQMYEELLIKG  1048



>ref|XP_010935652.1| PREDICTED: protein Rf1, mitochondrial-like [Elaeis guineensis]
Length=796

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 65/136 (48%), Gaps = 20/136 (15%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VFD M + G  PN  TY+ +I+  +K+ K D A E+F  + Q  +K  +  YSI++    
Sbjct  366  VFDSMSDKGLAPNCHTYSTLINGFIKNQKMDEAVELFNQMQQQGVKPDVVTYSILLDGLC  425

Query  182  SNDQLDAVKDLFDEMRADGILP------------GRAMQW-----SLQRMQEAGYGESV-  307
               ++  V+ L DEM + GI P            GR  +W     SL  M E G   ++ 
Sbjct  426  HLGRVQDVRCLLDEMASHGIHPDVVTYSSMICGFGRLGKWNEAFQSLNEMIERGIRPNIV  485

Query  308  --DELIREMLPDGRIK  349
              + LI  +  +G+++
Sbjct  486  ALNLLIDFICKEGKVQ  501


 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 65/125 (52%), Gaps = 5/125 (4%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQY-SIMVGAF  178
            V+D M++ G  PN  TY ++ID   K  + D A  +F  +P+  ++ T   Y +I+ G +
Sbjct  541  VYDLMVSKGHKPNVVTYNILIDGYCKRRRIDKALSLFNAMPRNGVQHTTVVYNTILAGMY  600

Query  179  ISNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIA  358
             +    DA K LFD+M A G+ P      ++  + E    + +DE ++ +  D    +++
Sbjct  601  RAGRVADAEK-LFDKMLAAGVWPNLRTYNTI--LYELCKNQCIDEAMK-LFQDTLSSTVS  656

Query  359  CSMDA  373
             ++D+
Sbjct  657  LNIDS  661



>ref|XP_006487354.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial-like isoform X2 [Citrus sinensis]
Length=487

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 57/114 (50%), Gaps = 1/114 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            + D MI  G  P++ TY  ++D    +G+ + A E+F  +  M  K T+  YSI++  + 
Sbjct  191  LLDLMIQHGVRPDAFTYNTLLDGFCLTGRVNHAKELFVSMESMGCKHTVFSYSILINGYC  250

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDG  340
             N +++    L+ EM + GI P   +  +L   + E    E   +L+ EM  DG
Sbjct  251  KNKEIEGALTLYSEMLSKGIKPDVVIHNTLFVGLFEIHQVERAFKLLDEMQRDG  304


 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 59/119 (50%), Gaps = 12/119 (10%)
 Frame = +2

Query  44   RTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISNDQLDAVKDLFDE  223
            R Y  +ID L KSG+ + A E+FR LP   +   +  YSIM+G   ++ Q+D  +DLF +
Sbjct  345  RAYNSLIDGLCKSGRLEIALELFRSLPCGVLVPNVVTYSIMIGGLCNDGQMDKARDLFLD  404

Query  224  MRADGILPGRA----MQWSLQRMQEAGYGESVDELIREM-----LPDGRIKSIACSMDA  373
            M  + ++P       +     R+ E      V EL+ +M     +PD  I SI   + A
Sbjct  405  MEENAVVPNVITFDMLIRGFIRINEP---SKVIELLHKMKEINVMPDASIVSIVVDLLA  460



>ref|XP_011038680.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial [Populus euphratica]
 ref|XP_011038681.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial [Populus euphratica]
Length=541

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 51/88 (58%), Gaps = 0/88 (0%)
 Frame = +2

Query  8    DRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISN  187
            D M   G  P++RTY +I+ HL+++GK   A  VF+ +     + ++  Y I+V  F + 
Sbjct  389  DEMRKGGVGPSARTYDIILHHLIRAGKTKIAYSVFQKMSCEGCEPSVSTYEIIVRMFCNE  448

Query  188  DQLDAVKDLFDEMRADGILPGRAMQWSL  271
            D++D    ++D+M+A GILP   M  +L
Sbjct  449  DRVDMAIKVWDQMKAKGILPVMHMFSTL  476



>ref|XP_010430362.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, 
mitochondrial-like [Camelina sativa]
Length=153

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/82 (27%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F  M++ G  PN+ TY+ +I    + G F+ A ++F+ +    +      YS ++  F 
Sbjct  32   IFQEMVSSGVCPNTITYSTLIHGFCQEGDFNGALDIFQDMVSSGVCPNTITYSTLIHGFC  91

Query  182  SNDQLDAVKDLFDEMRADGILP  247
                L+  +D+F EM + G+ P
Sbjct  92   QVGYLNGARDIFQEMVSSGVCP  113



>ref|XP_002989531.1| hypothetical protein SELMODRAFT_130008 [Selaginella moellendorffii]
 gb|EFJ09407.1| hypothetical protein SELMODRAFT_130008 [Selaginella moellendorffii]
Length=436

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VFD+M+    +PN  TYT +ID L KSGK  +A EV   + +  +   +  YS ++  F 
Sbjct  241  VFDKMVRSNCVPNVVTYTTLIDGLSKSGKVQAAAEVLDGMVKKGVTPNVATYSCLIDGFC  300

Query  182  SNDQLDAVKDLFDEMRADGILP  247
               ++D    L ++M   GI P
Sbjct  301  KVRRVDEAHKLLEQMVTQGIAP  322


 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 55/113 (49%), Gaps = 7/113 (6%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            + ++M+  G  P   TY ++++ L ++ K + A ++FR + Q R   T+  Y+ ++ A  
Sbjct  311  LLEQMVTQGIAPTVVTYNILLNSLCRADKLEDAFKLFRGMAQRRCHPTVVTYNTLLRALC  370

Query  182  SNDQLDAVKDLFDEMRADGILPGR----AMQWSLQRMQEAGYGESVDELIREM  328
             + QLD    L+ EM A G  P       + W L R   AG      EL+ +M
Sbjct  371  HHKQLDGAHRLYAEMIAKGCPPDAITYDTLAWGLTR---AGKVHEAQELMEKM  420


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 62/128 (48%), Gaps = 4/128 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F++M+     PN  TY  +I+ L K+ + ++A E+F+ +       T   Y+ ++  F 
Sbjct  171  LFEKMVKQRINPNVVTYNTLINGLCKAWRIETAYELFKEMAGKGYVPTEVSYNTLIDGFC  230

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDG---RIK  349
                L A KD+FD+M     +P      +L   + ++G  ++  E++  M+  G    + 
Sbjct  231  KKKDLVAAKDVFDKMVRSNCVPNVVTYTTLIDGLSKSGKVQAAAEVLDGMVKKGVTPNVA  290

Query  350  SIACSMDA  373
            + +C +D 
Sbjct  291  TYSCLIDG  298



>gb|ACU25590.1| pentatricopeptide repeat-containing protein [Priva cordifolia]
Length=418

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 46/90 (51%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +FD M+  G +PN  T+T +ID   K+GK D A E+++ +    +   L  Y+ ++  F 
Sbjct  228  LFDEMLEKGLVPNGVTFTTLIDGHCKNGKLDLAMEIYKQILSQGLSPDLITYNTLIYGFC  287

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL  271
                L   +DL DEM   G+ P +    +L
Sbjct  288  KKGDLKQTRDLIDEMSMKGLKPDKITYTTL  317



>ref|XP_010937068.1| PREDICTED: protein Rf1, mitochondrial-like [Elaeis guineensis]
Length=765

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VFD M   G  PN  TY+ +I+  VK+ K D A E+F+ + Q  +K  +  YS ++    
Sbjct  335  VFDSMSGKGLCPNCHTYSALINGFVKNQKIDGAVELFKKMQQQGLKPNVVTYSTLLDGLC  394

Query  182  SNDQLDAVKDLFDEMRADGILP  247
               +++ V  L +EM A GI P
Sbjct  395  HLGRMEDVGSLLNEMVAQGIQP  416


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            V+D M++ G  PN+ TY ++ID   K  + D A  +F  +P   ++ T   Y+I++    
Sbjct  510  VYDSMVSKGHKPNAVTYNILIDGYCKRCRIDKALSLFNAMPDHGVQHTTIVYNIILVGMY  569

Query  182  SNDQLDAVKDLFDEMRADGILP  247
               ++   +  FD+M A  + P
Sbjct  570  RLGRITDAEKFFDKMLAARVCP  591



>emb|CDY34870.1| BnaA09g47960D [Brassica napus]
Length=287

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 58/114 (51%), Gaps = 1/114 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            + DRM+++G  P+  TY  +++ + KSG   SA ++ R +   +IK     Y+I++ +  
Sbjct  126  LIDRMVDNGCQPDGATYGPVLNRMCKSGNTASALDLLRKMEDRKIKLDAVTYNIIIDSLC  185

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQR-MQEAGYGESVDELIREMLPDG  340
             +  LD    LF+EM   GI P      SL R    AG  +    L+R+M+  G
Sbjct  186  KDGSLDDALSLFNEMETKGIKPNVFTYNSLIRGFCSAGRWDDGAPLLRDMITRG  239



>ref|XP_005649725.1| TPR-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25181.1| TPR-like protein [Coccomyxa subellipsoidea C-169]
Length=905

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 55/114 (48%), Gaps = 1/114 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            V+ RM+++G  PN+ TY  +I    K+G+ D   EVF+ +     +R++  YS ++ A  
Sbjct  337  VYKRMLDEGYSPNATTYNALISAYGKAGQLDKVMEVFQEMVHKGCERSVITYSSLISACE  396

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDG  340
               Q +   +LF+EM  +G +P      SL     +    E   E+  +M   G
Sbjct  397  KAGQWELALELFNEMAGEGCIPNTVTYNSLITACAQGAQWEKASEVFEQMQKGG  450



>ref|XP_008466623.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing 
protein At1g19290 [Cucumis melo]
Length=912

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 37/118 (31%), Positives = 62/118 (53%), Gaps = 3/118 (3%)
 Frame = +2

Query  8    DRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISN  187
            D MIN G +PN   Y  +I+ L KSG  D A  +F  L Q  +  T+  Y+I++  +   
Sbjct  775  DDMINAGLVPNIVVYNALINGLCKSGNLDRAKRLFHKLAQKGLSPTVVTYNILIDGYCKG  834

Query  188  DQ-LDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDGRIKSI  355
             + +DA+K L ++MR +G+ P      +L   + + G  +   EL+ EM+  G+  S+
Sbjct  835  GRTIDALK-LKNKMREEGLSPSSITYSTLIHGLDKEGKSKQSVELLNEMMKAGKESSV  891



>ref|XP_010458689.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Camelina sativa]
Length=575

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            + DRMI +G  PN  TY  +++ + KSGK   A E+ R + + +IK  +  YSI++    
Sbjct  201  LIDRMIENGCQPNEVTYGPVLNVMCKSGKTALAMELLRKMEERKIKLNVVHYSIIIDGLC  260

Query  182  SNDQLDAVKDLFDEMRADG  238
             ++ LD   +LF+EM   G
Sbjct  261  KDENLDDALNLFNEMEVKG  279



>ref|XP_008243338.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial [Prunus mume]
Length=559

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 52/91 (57%), Gaps = 1/91 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLP-QMRIKRTLKQYSIMVGAF  178
            V + M   G  PN RTY +I+ HLVK+ + + A  VF+ +  +   + T+  Y I+V  F
Sbjct  402  VVEEMRKCGIGPNPRTYDIILHHLVKARRTEQAYSVFQQISREPGCEPTVSTYEILVRMF  461

Query  179  ISNDQLDAVKDLFDEMRADGILPGRAMQWSL  271
             + DQ+D    ++D+M+  G+LPG  M  +L
Sbjct  462  CNEDQVDMALRVWDQMKTKGVLPGMHMFSTL  492



>ref|XP_009604239.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, 
mitochondrial-like [Nicotiana tomentosiformis]
 ref|XP_009604240.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, 
mitochondrial-like [Nicotiana tomentosiformis]
 ref|XP_009604241.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, 
mitochondrial-like [Nicotiana tomentosiformis]
Length=864

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/114 (25%), Positives = 61/114 (54%), Gaps = 1/114 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            V+D+M+++G +P+  +Y  +I    ++G  D A ++F  LP+ ++K  +  YSI++  + 
Sbjct  477  VWDKMVDNGVVPSIASYNNMILGNCRNGNMDKALDLFSQLPERQLKANVVTYSILIDGYF  536

Query  182  SNDQLDAVKDLFDEMRADGILPG-RAMQWSLQRMQEAGYGESVDELIREMLPDG  340
                 D  +++FD+M   GI P        +  + +AG      +L+++++  G
Sbjct  537  RKGDTDKARNMFDQMVTSGIAPTDYTFNTLISGLSKAGKMSEAKDLLKKIVAGG  590


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 57/119 (48%), Gaps = 0/119 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +FD++   G  PN  TY V+I+   K+G  + A E++R +    IK  +   + ++  F+
Sbjct  373  LFDKLAEYGLTPNKVTYAVLIEGCCKNGNIEKAVEIYRQMKLAGIKPNVYVENSLIKGFL  432

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIA  358
            S + LD   ++FDE    G     A    +    + G  +    +  +M+ +G + SIA
Sbjct  433  SVNLLDEALNVFDEAINSGTANVFAYNSIIAWFCKKGRMDDAQNVWDKMVDNGVVPSIA  491



>ref|XP_003558596.2| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like 
[Brachypodium distachyon]
 ref|XP_010229041.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like 
[Brachypodium distachyon]
 ref|XP_010229042.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like 
[Brachypodium distachyon]
 ref|XP_003561950.2| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like 
[Brachypodium distachyon]
Length=781

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 56/116 (48%), Gaps = 1/116 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            + +RM   G  PN +TY V+I  L K   F  A E+ +V+ + +I   +  YS ++    
Sbjct  418  MLERMKRSGCRPNVQTYNVLIHGLTKQNNFSGAEELCKVMLEEKISPDVVTYSTVINGLC  477

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDGRI  346
            +N  +    ++F++M   G LP      SL Q + + G  E  +E+  E+   G I
Sbjct  478  NNGAIPLALEMFNKMVKHGCLPNLHTYSSLIQALGQEGRVEEAEEMFSELKKQGLI  533



>ref|XP_006382765.1| hypothetical protein POPTR_0005s05210g [Populus trichocarpa]
 gb|ERP60562.1| hypothetical protein POPTR_0005s05210g [Populus trichocarpa]
Length=525

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 35/125 (28%), Positives = 67/125 (54%), Gaps = 4/125 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMV-GAF  178
            +F  M + G  PN  TY +++D   K G  D A ++ + + +  ++  +  Y+I++ G F
Sbjct  347  LFKEMCSYGPPPNLVTYVILLDGFCKHGHLDEALKLLKSMQEKNLEPNIVHYTILIEGMF  406

Query  179  ISNDQLDAVKDLFDEMRADGILPG-RAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSI  355
            I+  +L+  K+LF ++  DGI P  R     ++ + +AG  +   +L R+M  DG +   
Sbjct  407  IAG-KLEVAKELFSKLFGDGIRPTIRTYTVMIKGLLKAGLSDEAYDLFRKMEDDGFLPD-  464

Query  356  ACSMD  370
            +CS +
Sbjct  465  SCSYN  469


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 49/100 (49%), Gaps = 5/100 (5%)
 Frame = +2

Query  35   PNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISNDQLDAVKDL  214
            PN   YT++I+ +  +GK + A E+F  L    I+ T++ Y++M+   +     D   DL
Sbjct  393  PNIVHYTILIEGMFIAGKLEVAKELFSKLFGDGIRPTIRTYTVMIKGLLKAGLSDEAYDL  452

Query  215  FDEMRADGILPGRA-----MQWSLQRMQEAGYGESVDELI  319
            F +M  DG LP        +Q  LQ    +     +DE++
Sbjct  453  FRKMEDDGFLPDSCSYNVIIQGFLQNQDSSTAIRLIDEMV  492



>emb|CDX82419.1| BnaA03g34020D [Brassica napus]
Length=640

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 36/115 (31%), Positives = 60/115 (52%), Gaps = 2/115 (2%)
 Frame = +2

Query  2    VFDRMINDG-ALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAF  178
            V+  M N+G   P++ TY+ +I    K G+ DSA  +F  + +  ++ T K Y+ ++G +
Sbjct  219  VYSEMCNEGDCFPDTVTYSAVISSYDKLGRNDSAIRLFDEMRENNLEPTEKIYTTLLGVY  278

Query  179  ISNDQLDAVKDLFDEMRADGILPGRAMQWSLQR-MQEAGYGESVDELIREMLPDG  340
                 +D   DLF+EMR +G LP       L + + +AG  E    L + M+ DG
Sbjct  279  FKVGGVDKALDLFEEMRREGCLPSVYTYTELVKGLGKAGRVEEAYGLYKNMVRDG  333



>ref|XP_009135469.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010 
[Brassica rapa]
Length=640

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 36/115 (31%), Positives = 60/115 (52%), Gaps = 2/115 (2%)
 Frame = +2

Query  2    VFDRMINDG-ALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAF  178
            V+  M N+G   P++ TY+ +I    K G+ DSA  +F  + +  ++ T K Y+ ++G +
Sbjct  219  VYSEMCNEGDCFPDTVTYSAVISSYDKLGRNDSAIRLFDEMRENNLEPTEKIYTTLLGVY  278

Query  179  ISNDQLDAVKDLFDEMRADGILPGRAMQWSLQR-MQEAGYGESVDELIREMLPDG  340
                 +D   DLF+EMR +G LP       L + + +AG  E    L + M+ DG
Sbjct  279  FKVGGVDKALDLFEEMRREGCLPSVYTYTELVKGLGKAGRVEEAYGLYKNMVRDG  333



>ref|XP_006487353.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial-like isoform X1 [Citrus sinensis]
Length=650

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 38/119 (32%), Positives = 59/119 (50%), Gaps = 12/119 (10%)
 Frame = +2

Query  44   RTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISNDQLDAVKDLFDE  223
            R Y  +ID L KSG+ + A E+FR LP   +   +  YSIM+G   ++ Q+D  +DLF +
Sbjct  508  RAYNSLIDGLCKSGRLEIALELFRSLPCGVLVPNVVTYSIMIGGLCNDGQMDKARDLFLD  567

Query  224  MRADGILPG----RAMQWSLQRMQEAGYGESVDELIREM-----LPDGRIKSIACSMDA  373
            M  + ++P       +     R+ E      V EL+ +M     +PD  I SI   + A
Sbjct  568  MEENAVVPNVITFDMLIRGFIRINEP---SKVIELLHKMKEINVMPDASIVSIVVDLLA  623


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 33/114 (29%), Positives = 57/114 (50%), Gaps = 1/114 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            + D MI  G  P++ TY  ++D    +G+ + A E+F  +  M  K T+  YSI++  + 
Sbjct  354  LLDLMIQHGVRPDAFTYNTLLDGFCLTGRVNHAKELFVSMESMGCKHTVFSYSILINGYC  413

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDG  340
             N +++    L+ EM + GI P   +  +L   + E    E   +L+ EM  DG
Sbjct  414  KNKEIEGALTLYSEMLSKGIKPDVVIHNTLFVGLFEIHQVERAFKLLDEMQRDG  467



>ref|XP_009138046.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, 
chloroplastic [Brassica rapa]
Length=1098

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +  RM  +G  P+  TYTV+ID L  +GK D A EVF  +   R K     Y  ++  F 
Sbjct  268  ILKRMDEEGCGPDVVTYTVLIDALCTAGKLDCAKEVFEKMKTGRHKPDRVTYITLLDRFS  327

Query  182  SNDQLDAVKDLFDEMRADGILP  247
             N  LD+V+  + EM  DG +P
Sbjct  328  DNRDLDSVRRFWSEMEKDGHVP  349


 Score = 48.5 bits (114),  Expect = 0.001, Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +2

Query  2     VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
             +F RM+ +G  P+ +TY+V++D L   G+ D     FR L +  +   +  Y++++    
Sbjct  933   LFKRMVKEGVRPDLKTYSVLVDCLCMVGRVDEGLHYFRELKESGLDPDVVCYNLIINGLG  992

Query  182   SNDQLDAVKDLFDEMR-ADGIL  244
              + +L+   +L++EM+ + GIL
Sbjct  993   KSQRLEEALELYNEMKNSRGIL  1014



>emb|CDY13456.1| BnaA03g51740D [Brassica napus]
Length=1098

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +  RM  +G  P+  TYTV+ID L  +GK D A EVF  +   R K     Y  ++  F 
Sbjct  268  ILKRMDEEGCGPDVVTYTVLIDALCTAGKLDCAKEVFEKMKTGRHKPDRVTYITLLDRFS  327

Query  182  SNDQLDAVKDLFDEMRADGILP  247
             N  LD+V+  + EM  DG +P
Sbjct  328  DNRDLDSVRRFWSEMEKDGHVP  349


 Score = 48.5 bits (114),  Expect = 0.001, Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +2

Query  2     VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
             +F RM+ +G  P+ +TY+V++D L   G+ D     FR L +  +   +  Y++++    
Sbjct  933   LFKRMVKEGVRPDLKTYSVLVDCLCMVGRVDEGLHYFRELKESGLDPDVVCYNLIINGLG  992

Query  182   SNDQLDAVKDLFDEMR-ADGIL  244
              + +L+   +L++EM+ + GIL
Sbjct  993   KSQRLEEALELYNEMKNSRGIL  1014



>ref|XP_002531063.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF31324.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=533

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 49/88 (56%), Gaps = 7/88 (8%)
 Frame = +2

Query  8    DRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQM----RIKRTLKQYSIMVGA  175
            D M   G  PNSRTY +I+ HL+K+ K    TE F V  +M      + T+  Y I+V  
Sbjct  380  DEMRKSGVGPNSRTYDIILHHLIKAEK---TTEAFSVFEKMSSEEECEPTVSTYDIIVRM  436

Query  176  FISNDQLDAVKDLFDEMRADGILPGRAM  259
            F + D++++   ++D M+A G+ PG  M
Sbjct  437  FCNMDKVESAIKVWDRMKAKGVHPGMHM  464



>ref|XP_008781836.1| PREDICTED: pentatricopeptide repeat-containing protein At2g18940, 
chloroplastic isoform X2 [Phoenix dactylifera]
Length=739

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 61/115 (53%), Gaps = 3/115 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            V D+M N G +PNS TYT +I+   K+GK + A  +F  + ++     +  Y+ ++G   
Sbjct  380  VLDKMTNKGIMPNSVTYTTVINAYGKAGKENEALALFDRMKKLGCVPNVCTYNTILGMLG  439

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWS--LQRMQEAGYGESVDELIREMLPDG  340
               QL+ + ++  EM+++G +P R + W+  L    + G  + V ++  EM   G
Sbjct  440  KKSQLEEMLNILCEMKSNGCVPNR-ITWNTMLAMCGKRGMEKYVSQVFGEMKNRG  493



>gb|KFK22834.1| hypothetical protein AALP_AAs49566U000200 [Arabis alpina]
Length=628

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 59/114 (52%), Gaps = 1/114 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF +MI+DG  PN  TY++++D L  +GK + A  VF+ L +  ++  +  YSI++    
Sbjct  451  VFKQMISDGVPPNIWTYSILLDGLCSNGKLEKALVVFQDLQKSEMELNIFTYSIIIDGMC  510

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDG  340
               +++   DLF  +   G+ P      ++   +   G  E  ++L REM  DG
Sbjct  511  KAGKVEDGWDLFRSLSLKGLKPNVVTYTTMISGLCRKGLMEEANDLFREMKEDG  564


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 53/103 (51%), Gaps = 3/103 (3%)
 Frame = +2

Query  38   NSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISNDQLDAVKDLF  217
            N  TY++IID + K+GK +   ++FR L    +K  +  Y+ M+        ++   DLF
Sbjct  498  NIFTYSIIIDGMCKAGKVEDGWDLFRSLSLKGLKPNVVTYTTMISGLCRKGLMEEANDLF  557

Query  218  DEMRADGILPGRAMQWSL--QRMQEAGYGESVDELIREMLPDG  340
             EM+ DG LP  +   +L   R++E     SV ELI EM   G
Sbjct  558  REMKEDGPLPNSSTYNTLIRARLRECDTTASV-ELIEEMKSCG  599



>gb|KDO38524.1| hypothetical protein CISIN_1g011362mg [Citrus sinensis]
Length=487

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 47/90 (52%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            + D MI  G  P++ TY  ++D    +G+ + A E+F  +  M  K T+  YSI++  + 
Sbjct  191  LLDLMIQHGVRPDAFTYNTLLDGFCLTGRVNHAKELFVSMESMGCKHTVFSYSILINGYC  250

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL  271
             N +++    L+ EM + GI P   +  +L
Sbjct  251  KNKEIEGALSLYSEMLSKGIKPDVVIHNTL  280


 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 59/119 (50%), Gaps = 12/119 (10%)
 Frame = +2

Query  44   RTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISNDQLDAVKDLFDE  223
            R Y  +ID L KSG+ + A E+FR LP   +   +  YSIM+G   ++ Q+D  +DLF +
Sbjct  345  RAYNSLIDGLCKSGRLEIALELFRSLPCGVLVPNVVTYSIMIGGLCNDGQMDKARDLFLD  404

Query  224  MRADGILPGRA----MQWSLQRMQEAGYGESVDELIREM-----LPDGRIKSIACSMDA  373
            M  + ++P       +     R+ E      V EL+ +M     +PD  I SI   + A
Sbjct  405  MEENAVVPNVITFDMLIRGFIRINEP---SKVIELLHKMKEINVMPDASIVSIVVDLLA  460



>gb|KHN42388.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine 
soja]
Length=369

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 49/85 (58%), Gaps = 5/85 (6%)
 Frame = +2

Query  11   RMIND----GALPNSRTYTVIIDHLVKSGKFDSATEVF-RVLPQMRIKRTLKQYSIMVGA  175
            RM+ +    G  PNSRT+ +I+ HL++  + + A  VF R+  +   K ++  Y IMV  
Sbjct  213  RMVGEMKKCGIGPNSRTFDIILHHLIEGRRVEEACSVFQRMSGEFGCKASVTTYEIMVRM  272

Query  176  FISNDQLDAVKDLFDEMRADGILPG  250
              + ++LD    ++DEM+  GILPG
Sbjct  273  LCNEERLDMAVAVWDEMKGKGILPG  297



>ref|XP_004976824.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14580, 
mitochondrial-like [Setaria italica]
Length=363

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F  M ++G  PNS TY V++D L+ SGKF  A  +  V+    ++ + + Y +++    
Sbjct  269  LFKSMTSEGCYPNSGTYQVLLDGLISSGKFGEAKNLISVMSTESVRPSFQSYKLLIDGLC  328

Query  182  SNDQLDAVKDLFDEMRADGILP  247
            S+D LD    +  +M   G +P
Sbjct  329  SDDCLDDAHLVLKQMVGQGFVP  350



>ref|XP_008222885.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62910-like 
[Prunus mume]
Length=522

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/124 (27%), Positives = 60/124 (48%), Gaps = 2/124 (2%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F+RM+++G  PN  T+  +I  L K  + + A  V  ++ Q  ++  +  Y+ ++    
Sbjct  314  LFNRMLDEGIAPNVVTFNTVIHALYKERRTEEAFSVLELMSQRGMRLNIVTYNSLIFGMC  373

Query  182  SNDQLDAVKDLFDEMRADGILPG-RAMQWSLQRMQEAGYGESVDELIREMLPDG-RIKSI  355
              DQ D    LFDEM   G+LP    ++  L  + + G  E   +++   +  G  +  I
Sbjct  374  LTDQWDEATRLFDEMVGQGVLPNITTLRILLDALCKGGMTEEAHKMLEARVKYGMELSKI  433

Query  356  ACSM  367
             CSM
Sbjct  434  TCSM  437



>ref|XP_006300966.1| hypothetical protein CARUB_v10021355mg, partial [Capsella rubella]
 gb|EOA33864.1| hypothetical protein CARUB_v10021355mg, partial [Capsella rubella]
Length=750

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   RMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISND  190
            +M +D   PN RTYTV+I+ L  SG+   A  +F+ + +  I+  +  Y++++ +F S D
Sbjct  275  KMKDDNCCPNVRTYTVLINALCGSGRKSEALNLFKQMSESSIRPDVCMYTVLIQSFCSGD  334

Query  191  QLDAVKDLFDEMRADGILP  247
             LD    L D M   G+ P
Sbjct  335  NLDEASGLLDHMLEFGLTP  353



>ref|XP_008781835.1| PREDICTED: pentatricopeptide repeat-containing protein At2g18940, 
chloroplastic isoform X1 [Phoenix dactylifera]
Length=834

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 61/115 (53%), Gaps = 3/115 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            V D+M N G +PNS TYT +I+   K+GK + A  +F  + ++     +  Y+ ++G   
Sbjct  380  VLDKMTNKGIMPNSVTYTTVINAYGKAGKENEALALFDRMKKLGCVPNVCTYNTILGMLG  439

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWS--LQRMQEAGYGESVDELIREMLPDG  340
               QL+ + ++  EM+++G +P R + W+  L    + G  + V ++  EM   G
Sbjct  440  KKSQLEEMLNILCEMKSNGCVPNR-ITWNTMLAMCGKRGMEKYVSQVFGEMKNRG  493



>ref|XP_008358091.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Malus domestica]
Length=174

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 57/117 (49%), Gaps = 7/117 (6%)
 Frame = +2

Query  26   GALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISNDQLDAV  205
            G LPN +TY V++D L K+ +   A E+F  +    +   +  YSI++     + +++  
Sbjct  5    GXLPNVQTYAVLLDGLCKNQQLSKAIELFEEMKGKNLDPNIVVYSILIEGLCISGKVECA  64

Query  206  KDLFDEMRADGI-LPGRAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSIACSMDA  373
            KDLF  + + G+ L  +     +  +  AG  +  + L+ EM      K+I CS D 
Sbjct  65   KDLFSSLSSKGLQLNVKTFTIMISGLCNAGLIDEAESLLSEM------KAIGCSPDG  115


 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/135 (26%), Positives = 61/135 (45%), Gaps = 21/135 (16%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F+ M      PN   Y+++I+ L  SGK + A ++F  L    ++  +K ++IM+    
Sbjct  32   LFEEMKGKNLDPNIVVYSILIEGLCISGKVECAKDLFSSLSSKGLQLNVKTFTIMISGLC  91

Query  182  SNDQLDAVKDLFDEMRADGILP------------------GRAMQWSLQRMQEAGYG--E  301
            +   +D  + L  EM+A G  P                   RAM   +Q+M E G+    
Sbjct  92   NAGLIDEAESLLSEMKAIGCSPDGCTYNTIIRGLFNNNETSRAMGL-IQQMVENGFSADA  150

Query  302  SVDELIREMLPDGRI  346
            S  EL+ E+L   ++
Sbjct  151  STAELVLELLSKDKV  165



>ref|XP_009417258.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, 
mitochondrial [Musa acuminata subsp. malaccensis]
Length=688

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VFDRM  DG  P+  T+  +ID   K+G+ D A E+F+ + Q         Y+IM+ +  
Sbjct  446  VFDRMRLDGITPDEITWNTLIDAHCKAGRHDRAMELFKQMQQSGCIPCATTYNIMINSLG  505

Query  182  SNDQLDAVKDLFDEMRADGILPG  250
              ++ + +K++F++M+  G+LP 
Sbjct  506  EQEKWEELKEMFEKMKGQGLLPN  528


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F++M   G LPN  TYT ++D   KSG+F  A E    +    +K +   Y  +V A+ 
Sbjct  516  MFEKMKGQGLLPNVVTYTTLVDVYGKSGRFKEAIEFLEAMKASGMKPSPTMYHALVNAYA  575

Query  182  SNDQLDAVKDLFDEMRADGILP  247
                 +   + F  MRADGI P
Sbjct  576  QRGLSEQAINAFRVMRADGIKP  597



>ref|XP_006382763.1| hypothetical protein POPTR_0005s05190g [Populus trichocarpa]
 gb|ERP60560.1| hypothetical protein POPTR_0005s05190g [Populus trichocarpa]
Length=590

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 35/125 (28%), Positives = 68/125 (54%), Gaps = 4/125 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMV-GAF  178
            +F  M + G  PN  TY +++D   K G  D A ++ + + +  ++  +  Y+I++ G F
Sbjct  347  LFKEMCSYGPHPNLVTYVILLDGFCKHGHLDEALKLLKSMQEKNLEPNIVHYTILIEGMF  406

Query  179  ISNDQLDAVKDLFDEMRADGILPG-RAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSI  355
            I+  +L+  K+LF ++ ADGI P  R     ++ + + G  +   +L R+M  DG + + 
Sbjct  407  IAG-KLEVAKELFSKLFADGIRPPIRTYTVMIKGLLKEGLSDEAYDLFRKMEDDGFLPN-  464

Query  356  ACSMD  370
            +CS +
Sbjct  465  SCSYN  469



>gb|KCW64612.1| hypothetical protein EUGRSUZ_G02199 [Eucalyptus grandis]
Length=517

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLP-QMRIKRTLKQYSIMVGAF  178
            V D M   G  PNSRTY +I+ HLVK+ +   A  VF+ +  +   + TL  Y I+V  F
Sbjct  361  VLDEMRKCGVGPNSRTYDIILHHLVKARRSKEAYSVFQKMSNEPGCEPTLSTYEIIVRMF  420

Query  179  ISNDQLDAVKDLFDEMRADGILPGRAM  259
             + D+ D    ++ +M+  G+LPG  M
Sbjct  421  CNEDRTDMALRVWKQMKEKGVLPGMHM  447



>ref|XP_010066642.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial [Eucalyptus grandis]
 ref|XP_010066643.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial [Eucalyptus grandis]
 ref|XP_010066644.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial [Eucalyptus grandis]
 ref|XP_010066645.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial [Eucalyptus grandis]
 ref|XP_010066646.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial [Eucalyptus grandis]
Length=528

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLP-QMRIKRTLKQYSIMVGAF  178
            V D M   G  PNSRTY +I+ HLVK+ +   A  VF+ +  +   + TL  Y I+V  F
Sbjct  372  VLDEMRKCGVGPNSRTYDIILHHLVKARRSKEAYSVFQKMSNEPGCEPTLSTYEIIVRMF  431

Query  179  ISNDQLDAVKDLFDEMRADGILPGRAM  259
             + D+ D    ++ +M+  G+LPG  M
Sbjct  432  CNEDRTDMALRVWKQMKEKGVLPGMHM  458



>ref|XP_008802945.1| PREDICTED: protein Rf1, mitochondrial-like [Phoenix dactylifera]
Length=771

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VFD M+ +G  PNS TY+V+I+  VK+ K D A ++F  + +  +K  +  YS ++    
Sbjct  341  VFDSMLVEGPAPNSHTYSVLINGFVKNQKMDEAMDLFEKMQREGVKPDIVTYSTILDGLC  400

Query  182  SNDQLDAVKDLFDEMRADGILP  247
               +++ V+ L DEM + GI P
Sbjct  401  HLGKMEDVRGLLDEMMSRGIHP  422


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            V D M++ G  P++ TY ++I+   KSG+ D A  +F  +P   ++ T+  Y+ ++    
Sbjct  516  VRDLMVSKGHEPDAFTYNILINSYCKSGRIDEALSLFNAMPHKGVQPTVITYNTVLTGLY  575

Query  182  SNDQLDAVKDLFDEMRADGILP  247
               ++   + L D+M A GI P
Sbjct  576  RVGRVADAEKLRDKMLAAGICP  597



>ref|XP_004137973.1| PREDICTED: pentatricopeptide repeat-containing protein At2g32630-like 
[Cucumis sativus]
Length=606

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 51/91 (56%), Gaps = 4/91 (4%)
 Frame = +2

Query  11   RMIND----GALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAF  178
            ++IN+    G +P++ TYT +ID    SG  D A E+F  +PQ+ + R +  Y++++   
Sbjct  493  KLINEMQERGLMPDTYTYTSLIDGERASGNVDRALELFNEMPQLGLNRNVVTYTVIISGL  552

Query  179  ISNDQLDAVKDLFDEMRADGILPGRAMQWSL  271
              + + D    L+DEM  +GI+P   +  SL
Sbjct  553  SKDGRADEAFKLYDEMNKEGIVPDDGIYSSL  583



>ref|XP_006285538.1| hypothetical protein CARUB_v10006979mg [Capsella rubella]
 gb|EOA18436.1| hypothetical protein CARUB_v10006979mg [Capsella rubella]
Length=801

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 56/107 (52%), Gaps = 1/107 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            ++D M++ G  PN  TY  ++D L+K  +   ATE+F+++    IK  +  Y+IM+  + 
Sbjct  339  MYDSMVSRGPAPNVETYNSLLDGLLKGCRLTDATELFKLMRHGDIKLDVVTYNIMISGYC  398

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRM-QEAGYGESVDELI  319
             N +++    L  EM  +G+ P      +L  +  +AG  E   E+I
Sbjct  399  KNGKIEEAVQLIREMNCEGLKPDNYTYSALILIVNQAGDSEVAKEVI  445


 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 54/111 (49%), Gaps = 1/111 (1%)
 Frame = +2

Query  11   RMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISND  190
            RMI  G   +   YT++I   +++   D A  VFR + +  +   +  + +M+    S  
Sbjct  202  RMIASGCKSDRVIYTLMISSFIRNRSLDEAMAVFREMAENGVSPDINVFRVMIYGLSSAR  261

Query  191  QLDAVKDLFDEMRADGILPGRAMQWS-LQRMQEAGYGESVDELIREMLPDG  340
            + +     FDEM A GI P   +  S +  + +AG  E V E+I+EM+  G
Sbjct  262  RFNEALRYFDEMIAQGISPDLGIYNSFIYGLCKAGLWEDVTEMIKEMVSKG  312



>ref|XP_004514198.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Cicer arietinum]
Length=147

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 53/106 (50%), Gaps = 1/106 (1%)
 Frame = +2

Query  26   GALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISNDQLDAV  205
            G  PN  TY ++++ L KSG+   + ++F  L        +  Y+IM+  F +   LD  
Sbjct  40   GIQPNMCTYNILLNGLCKSGRIKDSQKIFEYLLVKGYNLDVYAYTIMIQGFCNKGLLDEA  99

Query  206  KDLFDEMRADGILP-GRAMQWSLQRMQEAGYGESVDELIREMLPDG  340
             DLF +M+ +G +P     +  +  + E    E  ++L+REM+  G
Sbjct  100  LDLFSKMKDNGCIPDALTYEIVIHSLFEKYEIEKAEKLLREMIVRG  145



>emb|CDX72330.1| BnaC07g43520D [Brassica napus]
Length=1099

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +  RM  +G  P+  TYTV+ID L  +GK D A EVF  +   R K     Y  ++  F 
Sbjct  269  ILKRMDEEGCGPDVVTYTVLIDALCTAGKLDCAKEVFAKMKTGRHKPDRVTYITLLDRFS  328

Query  182  SNDQLDAVKDLFDEMRADGILP  247
             N  LD+V+  + EM  DG +P
Sbjct  329  DNRDLDSVRRFWSEMEKDGHVP  350



>ref|XP_006364273.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, 
mitochondrial-like isoform X1 [Solanum tuberosum]
 ref|XP_006364274.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, 
mitochondrial-like isoform X2 [Solanum tuberosum]
Length=854

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/112 (26%), Positives = 56/112 (50%), Gaps = 1/112 (1%)
 Frame = +2

Query  8    DRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISN  187
            D+M+ +G LP   +Y  II    ++G  D A ++F  LP+  +K  +  YSI++  +   
Sbjct  468  DKMVANGILPTITSYNNIILGNCRNGNMDKALDLFSQLPERHLKANVVTYSILIDGYFRK  527

Query  188  DQLDAVKDLFDEMRADGILPG-RAMQWSLQRMQEAGYGESVDELIREMLPDG  340
               D  +++FD+M + GI P        +  M + G      +L+++++  G
Sbjct  528  GDADKAENMFDQMVSSGISPTDYTFNTVISGMSKVGKTSEAKDLLKKIVEGG  579


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            V+  M N G  P+  TYT +ID L KS   + A ++ + +    IK  +  Y++++  F 
Sbjct  607  VYREMCNSGISPDVVTYTTLIDGLCKSNNINLALKLLKEMRNKEIKLDVIAYAVLIDGFC  666

Query  182  SNDQLDAVKDLFDEMRADGILP  247
                + +  +LFDE+   GI P
Sbjct  667  KRRDMKSASELFDEILQVGISP  688



>ref|XP_010548153.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like 
[Tarenaya hassleriana]
 ref|XP_010548154.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like 
[Tarenaya hassleriana]
Length=876

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 54/111 (49%), Gaps = 1/111 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F  M+ +   P+S  Y + I H  K GK  SA  V + + +    ++L+ Y+ ++    
Sbjct  548  LFVEMMGEKLRPDSAVYNIFIHHFCKQGKISSAFRVLKDMEKKGCSKSLQTYNSLILGLG  607

Query  182  SNDQLDAVKDLFDEMRADGILPG-RAMQWSLQRMQEAGYGESVDELIREML  331
              +Q+  +  L DEMR + ILP       +++ + E G  E    L+ EML
Sbjct  608  KENQIFEIHGLMDEMRENNILPNVYTYNTAIKYLCEGGKAEDATYLLGEML  658



>ref|XP_010673763.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 
[Beta vulgaris subsp. vulgaris]
Length=735

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 56/123 (46%), Gaps = 6/123 (5%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            V D+M   G  P+ RTYT I+D L + GK + A  +   + +      +  YS ++  F 
Sbjct  204  VMDQMKRAGCCPDLRTYTTILDGLCRIGKIEDAMGLMEEMKKKGFDVDVVAYSTLIKGFC  263

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWS-LQRMQEAGYGESVDELIREM-----LPDGR  343
                +D VK+LF EM   G+ P      S LQ     G  E V  ++++M      PDG 
Sbjct  264  CEGDVDKVKELFHEMLEHGVTPDVITYSSVLQFFSAKGQREEVAAMVKDMTERGVYPDGS  323

Query  344  IKS  352
              S
Sbjct  324  TYS  326



>ref|XP_011031385.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial isoform X1 [Populus euphratica]
Length=593

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F  M  +G LPN RTY+++ID   K G    A  +FR +    +K  L  Y+I+V A  
Sbjct  432  LFRNMRTNGNLPNLRTYSILIDGFCKQGYLGKAFRLFRAMQSTHLKPNLVMYTILVHAMC  491

Query  182  SNDQLDAVKDLFDEMRADGILP  247
             +  L   + LF E+   G+ P
Sbjct  492  KSGNLKDARKLFSELFVQGLQP  513


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +FD M+  G  PN  TYT II+ L K+G+   A  +F+ + +   +  +  YS ++ +  
Sbjct  187  LFDDMVARGCQPNVYTYTTIINGLCKTGEAAEAAGLFKKMEEAGCQPDVVTYSTLIDSLC  246

Query  182  SNDQLDAVKDLFDEMRADGILP  247
             +  ++   D+F  M+A GI P
Sbjct  247  KDRLVNEALDIFSYMKAKGISP  268



>ref|XP_004172473.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g19290-like [Cucumis sativus]
Length=347

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 55/117 (47%), Gaps = 1/117 (1%)
 Frame = +2

Query  8    DRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISN  187
            D MIN G +PN   Y  +I+ L KSG  D A  +F  L +  +  T+  Y+ ++  +   
Sbjct  210  DDMINAGLVPNIVVYNALINGLCKSGNLDRARRLFNKLARKGLSPTVVTYNTLIDGYCKG  269

Query  188  DQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDGRIKSI  355
             +     +L D+MR +GI P      +L   +   G  E    L+ EM+  G+  S+
Sbjct  270  GRTTEALELKDKMREEGICPSSITYSTLIHGLYMEGKSEQSMGLLNEMMKAGKGSSV  326



>ref|XP_006303621.1| hypothetical protein CARUB_v10011428mg [Capsella rubella]
 gb|EOA36519.1| hypothetical protein CARUB_v10011428mg [Capsella rubella]
Length=620

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 34/111 (31%), Positives = 58/111 (52%), Gaps = 1/111 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            + D+M+ +G  P+  TY  +++ L KSGK   A E+ R + +  IKR   +Y+I++    
Sbjct  198  LIDQMVENGCKPDGVTYGPVLNVLCKSGKTALAIELLRKMEERNIKRNAAKYNIIIDGLC  257

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQR-MQEAGYGESVDELIREML  331
             ++ LD    LF+EM   GI        +L R    AG  +   +L+R+M+
Sbjct  258  KDENLDDALKLFNEMEMKGIKANVVTYNTLVRGFCNAGRWDDGAKLMRDMI  308



>ref|XP_009628783.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, 
mitochondrial-like [Nicotiana tomentosiformis]
 ref|XP_009628784.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, 
mitochondrial-like [Nicotiana tomentosiformis]
 ref|XP_009628785.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, 
mitochondrial-like [Nicotiana tomentosiformis]
 ref|XP_009628786.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, 
mitochondrial-like [Nicotiana tomentosiformis]
Length=523

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            V+D+M+++G +P+  +Y  +I    ++G  D A +VF  LP+ ++K  +  YSI++  + 
Sbjct  136  VWDKMVDNGVVPSIDSYNNMILGNCRNGNMDKALDVFSQLPERQLKANIVTYSILIDGYF  195

Query  182  SNDQLDAVKDLFDEMRADGILP  247
                 D   + FD+M + GI P
Sbjct  196  RKGDTDKAGNTFDQMVSSGIAP  217



>ref|XP_006487359.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial-like [Citrus sinensis]
Length=601

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 36/115 (31%), Positives = 58/115 (50%), Gaps = 12/115 (10%)
 Frame = +2

Query  50   YTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISNDQLDAVKDLFDEMR  229
            Y+ +ID L K GK ++A E+F+ LP++ +   +  Y+IM+  F ++ Q+D   DLF +M 
Sbjct  472  YSCLIDGLCKIGKLETAWELFQSLPRVGLMPNVVTYNIMIHGFCNDGQMDKAHDLFLDME  531

Query  230  ADGILPG----RAMQWSLQRMQEAGYGESVDELI-----REMLPDGRIKSIACSM  367
            A G+ P       +     R  E      V EL+     R ++PD  I SI   +
Sbjct  532  AKGVEPDFVIFNTLMLGFIRCNET---SKVIELLHGMDKRNVMPDASILSIVVDL  583



>ref|XP_006487360.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial-like [Citrus sinensis]
Length=630

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 36/115 (31%), Positives = 58/115 (50%), Gaps = 12/115 (10%)
 Frame = +2

Query  50   YTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISNDQLDAVKDLFDEMR  229
            Y+ +ID L K GK ++A E+F+ LP++ +   +  Y+IM+  F ++ Q+D   DLF +M 
Sbjct  501  YSCLIDGLCKIGKLETAWELFQSLPRVGLMPNVVTYNIMIHGFCNDGQMDKAHDLFLDME  560

Query  230  ADGILPG----RAMQWSLQRMQEAGYGESVDELI-----REMLPDGRIKSIACSM  367
            A G+ P       +     R  E      V EL+     R ++PD  I SI   +
Sbjct  561  AKGVEPDFVIFNTLMLGFIRCNET---SKVIELLHGMDKRNVMPDASILSIVVDL  612


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            + D MI  G  PN+  Y  ++D    +G+ + A E+F  +  M  K T+  YSI++  + 
Sbjct  345  LLDLMIQIGVRPNAFVYNTLMDGFCLTGRVNRAKELFVSMESMGCKHTVFSYSILINGYC  404

Query  182  SNDQLDAVKDLFDEMRADGILP  247
             N +++    L+ EM + GI P
Sbjct  405  KNKEIEGALSLYSEMLSKGIRP  426



>ref|XP_002283327.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, 
chloroplastic [Vitis vinifera]
 ref|XP_010648751.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, 
chloroplastic [Vitis vinifera]
 ref|XP_010648752.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, 
chloroplastic [Vitis vinifera]
 ref|XP_010648753.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, 
chloroplastic [Vitis vinifera]
 ref|XP_010648754.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, 
chloroplastic [Vitis vinifera]
 ref|XP_010648755.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, 
chloroplastic [Vitis vinifera]
 emb|CBI21147.3| unnamed protein product [Vitis vinifera]
Length=1113

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 30/82 (37%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +  RM + G  P+  TYTV+ID L  +GK ++A E+F  +     K     Y  ++  F 
Sbjct  284  ILKRMDDAGCGPDVVTYTVLIDALCNAGKLNNAKELFLKMKASSHKPDRVTYITLLDKFS  343

Query  182  SNDQLDAVKDLFDEMRADGILP  247
             +  LDA+K+ + EM ADG LP
Sbjct  344  DHGDLDAIKEFWSEMEADGYLP  365


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/82 (32%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2     VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
             +F RM+ +G  P+ ++Y++++D L   GK D A   F  L    +   L  Y++M+    
Sbjct  950   LFRRMVKEGIRPDLKSYSIMVDCLCMVGKVDDALHYFEELKLSGLDPDLVCYNLMINGLG  1009

Query  182   SNDQLDAVKDLFDEMRADGILP  247
              + +++    LFDEMR  GI P
Sbjct  1010  RSQRVEEALSLFDEMRNRGITP  1031


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/81 (31%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    FDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFIS  184
            F+ M++ G +PN   Y ++++   K G  ++A E+FR + +  I+  LK YSIMV     
Sbjct  916  FEEMLDYGCMPNCPLYNILMNGFGKQGDVETACELFRRMVKEGIRPDLKSYSIMVDCLCM  975

Query  185  NDQLDAVKDLFDEMRADGILP  247
              ++D     F+E++  G+ P
Sbjct  976  VGKVDDALHYFEELKLSGLDP  996


 Score = 48.9 bits (115),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 42/79 (53%), Gaps = 0/79 (0%)
 Frame = +2

Query  5    FDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFIS  184
            +  M  DG LP+  T+T++ID L K GK D A     V+ +  +   L  Y+ ++   + 
Sbjct  355  WSEMEADGYLPDVVTFTILIDALCKVGKVDEAFGTLDVMKKQGVAPNLHTYNTLICGLLR  414

Query  185  NDQLDAVKDLFDEMRADGI  241
             ++LD   +LF+ M + G+
Sbjct  415  LNRLDEALELFNSMESLGL  433



>ref|XP_006423451.1| hypothetical protein CICLE_v10030082mg, partial [Citrus clementina]
 gb|ESR36691.1| hypothetical protein CICLE_v10030082mg, partial [Citrus clementina]
Length=514

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 56/114 (49%), Gaps = 12/114 (11%)
 Frame = +2

Query  44   RTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISNDQLDAVKDLFDE  223
            R Y  +ID L KSG+ + A E+FR LP++ +   +  Y+IM+    ++ Q+D  + LF +
Sbjct  400  RAYNCLIDGLCKSGRLEIAWELFRSLPRVGLMADVVTYNIMIHGLCNDGQMDKARGLFLD  459

Query  224  MRADGILPG----RAMQWSLQRMQEAGYGESVDELI-----REMLPDGRIKSIA  358
            M A G+ P       +     R  E      V EL+     R ++PD  I SI 
Sbjct  460  MEAKGLEPNFVIFNTLMLGFIRCNET---SKVIELLHRMDKRNVMPDASILSIV  510


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 55/114 (48%), Gaps = 1/114 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            + D MI  G  PN+  Y  ++D    +G+ + A E+F  +  M  K T+  YSI++  + 
Sbjct  246  LLDLMIQFGVRPNAFVYNTLMDGFCLTGRVNRAEELFVSMESMGCKHTVFSYSILINGYC  305

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDG  340
             N +++    L+ EM + GI P   +  +L   + E    E   +L  EM  DG
Sbjct  306  KNKEIEGALTLYSEMLSKGIKPDVVIYNTLFIGLFEIHQVERAFKLFDEMQCDG  359



>ref|XP_010243796.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial [Nelumbo nucifera]
Length=570

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 51/87 (59%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVF-RVLPQMRIKRTLKQYSIMVGAF  178
            + D M   G  PNSRT+ +I+ HL+K+ +   A  VF R+  ++  + +L  Y+I+V  F
Sbjct  405  IVDEMKRCGVGPNSRTFDIILHHLIKARRTKEAYTVFQRMGSEVGCEPSLSTYTIIVAMF  464

Query  179  ISNDQLDAVKDLFDEMRADGILPGRAM  259
               +++D    ++D+M++ G+LP   M
Sbjct  465  CKEERVDMALKVWDQMKSKGVLPSMHM  491



>ref|XP_011034889.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, 
mitochondrial [Populus euphratica]
Length=709

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 50/90 (56%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
             FDRM+++G  P++ T+  +ID   K+GK D A E+F  + +         ++IM+ +F 
Sbjct  468  TFDRMLSEGIEPDTITWNTLIDCHCKAGKHDRAEELFEEMMEKGYLPCNTTFNIMINSFG  527

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL  271
              ++ D VK+L   MR+ G+LP      +L
Sbjct  528  DQERWDDVKNLLTNMRSQGLLPNAVTYTTL  557



>gb|EYU30048.1| hypothetical protein MIMGU_mgv1a021243mg [Erythranthe guttata]
Length=408

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLP-QMRIKRTLKQYSIMVGAF  178
            V + M   GA PN+RTY +I+ HLVK  K   A  VFR +  +   + ++  Y I+V  F
Sbjct  253  VVEEMRKCGAGPNTRTYDIILHHLVKHKKTKEAYIVFRKMNGEPGCEPSVSTYEIIVRMF  312

Query  179  ISNDQLDAVKDLFDEMRADGILPGRAM  259
                + D    +++EM+ +G+LPG  M
Sbjct  313  CKEGRTDMALGVWEEMKGNGVLPGMHM  339



>ref|XP_006605955.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial-like [Glycine max]
Length=512

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 49/85 (58%), Gaps = 5/85 (6%)
 Frame = +2

Query  11   RMIND----GALPNSRTYTVIIDHLVKSGKFDSATEVF-RVLPQMRIKRTLKQYSIMVGA  175
            RM+ +    G  PNSRT+ +I+ HL++  + + A  VF R+  +   K ++  Y IMV  
Sbjct  356  RMVGEMKKCGIGPNSRTFDIILHHLIEGRRVEEACSVFQRMSGEFGCKASVTTYEIMVRM  415

Query  176  FISNDQLDAVKDLFDEMRADGILPG  250
              + ++LD    ++DEM+  GILPG
Sbjct  416  LCNEERLDMAVAVWDEMKGKGILPG  440



>ref|XP_011092997.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, 
mitochondrial [Sesamum indicum]
Length=742

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 62/130 (48%), Gaps = 19/130 (15%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F++M N+G   N  T  V+++ + K G+  SA E F  +    +K     Y+I++ AF 
Sbjct  415  LFEQMSNEGVKSNVITLNVLLNGMCKHGRVSSAMEFFGSMRGKGVKGNGVTYTILISAFC  474

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL-----------------QRMQEAGYGESVD  310
            + + +D    LFDEM+ +G      + +SL                  +M+EAG+G  +D
Sbjct  475  NANNIDKAMKLFDEMQKNGCSRDAVVYYSLISGLNQAGRMDDATFIVSKMKEAGFG--LD  532

Query  311  ELIREMLPDG  340
             +   ML  G
Sbjct  533  IVCYNMLISG  542



>ref|XP_008662715.1| PREDICTED: pentatricopeptide repeat-containing protein At3g59040 
[Zea mays]
 gb|AFW56940.1| plastid transcriptionally active 12-like protein [Zea mays]
Length=600

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF+ M++ G  P  ++Y +++D    SG  + A  VFR + + R++  L  Y+ MV A++
Sbjct  337  VFEEMLDAGVRPTRKSYNILLDAFAISGLVEEANTVFRAMRRHRVEPDLCSYTTMVLAYV  396

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQR  277
            +  +++  +  F  ++ DG+ P   +  +L +
Sbjct  397  NASEMNGAEKFFRRIKEDGLKPNVVVYGTLMK  428



>ref|XP_010933042.1| PREDICTED: protein Rf1, mitochondrial-like [Elaeis guineensis]
Length=769

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VFD M+  G  PN+ TY ++ID   KSGK D A  +F  +P   ++ T+  Y+ M+    
Sbjct  514  VFDLMVLKGHEPNAFTYNILIDSYSKSGKIDEALSLFNAMPHKGVQHTVITYNTMLAGLY  573

Query  182  SNDQLDAVKDLFDEMRADGILP  247
               ++   + L ++M A GI P
Sbjct  574  HVGRVADAEKLRNKMLAAGICP  595


 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VFD M+  G  P+S TY+V+I+  VK+ K D A E+F  + Q  IK     Y  ++    
Sbjct  339  VFDSMLVKGPAPDSCTYSVLINGFVKNQKMDEAIELFNKMQQRGIKPNTIIYGTVLDGLC  398

Query  182  SNDQLDAVKDLFDEMRADGILP  247
               +++ V+ L DEM + GI P
Sbjct  399  HLGKMEDVRGLLDEMMSRGIHP  420



>gb|ACU25557.1| pentatricopeptide repeat-containing protein [Verbena perennis]
Length=418

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 48/90 (53%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +FD M+++G +PN  T+T +ID   K+G+ D A E+++++    +   L  Y+ ++    
Sbjct  228  LFDEMLDNGLVPNGVTFTTLIDGHCKNGRVDLAMEIYKLMLSQSLSPDLITYNTLIYGLC  287

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL  271
                L   +DL DEM   G+ P +    +L
Sbjct  288  KKGDLKQAQDLIDEMSMKGLKPDKITYTTL  317



>gb|AES76395.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=543

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 31/114 (27%), Positives = 56/114 (49%), Gaps = 1/114 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +  +M ++G  P+  TYT++ID L K G+   A  +F  L       T+  Y++M+  F 
Sbjct  428  LLTKMKDEGIQPDMYTYTILIDGLCKGGRLKDAQNIFEDLLVKGYNITVYTYTVMIQGFC  487

Query  182  SNDQLDAVKDLFDEMRADGILP-GRAMQWSLQRMQEAGYGESVDELIREMLPDG  340
             ND  D    L  +M  +G +P  +  +  +  + E    +  ++L+REM+  G
Sbjct  488  DNDLFDKALALLSKMEDNGCIPNAKTYEIIILSLFEKDENDMAEKLLREMIARG  541



>gb|AIU48581.1| tetratricopeptide repeat-like superfamily protein, partial [Zea 
mays]
Length=470

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF+ M++ G  P  ++Y +++D    SG  + A  VFR + + R++  L  Y+ MV A++
Sbjct  296  VFEEMLDAGVRPTRKSYNILLDAFAISGLVEEANTVFRAMRRHRVEPDLCSYTTMVLAYV  355

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQR  277
            +  +++  +  F  ++ DG+ P   +  +L +
Sbjct  356  NASEMNGAEKFFRRIKEDGLKPNVVVYGTLMK  387



>ref|NP_001061174.1| Os08g0191900 [Oryza sativa Japonica Group]
 dbj|BAD05595.1| putative pentatricopeptide (PPR) repeat-containing protein [Oryza 
sativa Japonica Group]
 dbj|BAF23088.1| Os08g0191900 [Oryza sativa Japonica Group]
 gb|EAZ41777.1| hypothetical protein OsJ_26318 [Oryza sativa Japonica Group]
 dbj|BAG90486.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93870.1| unnamed protein product [Oryza sativa Japonica Group]
Length=609

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/109 (27%), Positives = 59/109 (54%), Gaps = 6/109 (6%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF+ M++ G  P  ++Y ++ID    SG  + A  VF+ + + R++  L  Y+ MV A++
Sbjct  339  VFEEMLDAGVRPTRKSYNILIDAFAISGLVEEAHTVFKAMRRHRVEPDLCSYTTMVLAYV  398

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGE--SVDELIR  322
            +   +D  +  F  ++ DG+ P   +  +L +    GY +  +V+ ++R
Sbjct  399  NASDMDGAEKFFRRIKEDGLKPNVVVYGTLMK----GYSKLNNVERVMR  443



>ref|XP_011070642.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial [Sesamum indicum]
Length=554

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLP-QMRIKRTLKQYSIMVGAF  178
            V D M   G  PN+RTY +I+ HL+K  K   A  VF+ +  +   + T+  Y IMV  F
Sbjct  399  VIDEMRQCGVGPNARTYDIILHHLIKLQKTKEAYCVFQKMSDEPGCEPTVSTYEIMVRMF  458

Query  179  ISNDQLDAVKDLFDEMRADGILPGRAM  259
             +  + D    ++D+M+A G+LPG  M
Sbjct  459  CNEGRTDMALRVWDQMKARGVLPGMHM  485



>ref|XP_003620177.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
Length=612

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 31/114 (27%), Positives = 56/114 (49%), Gaps = 1/114 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +  +M ++G  P+  TYT++ID L K G+   A  +F  L       T+  Y++M+  F 
Sbjct  428  LLTKMKDEGIQPDMYTYTILIDGLCKGGRLKDAQNIFEDLLVKGYNITVYTYTVMIQGFC  487

Query  182  SNDQLDAVKDLFDEMRADGILP-GRAMQWSLQRMQEAGYGESVDELIREMLPDG  340
             ND  D    L  +M  +G +P  +  +  +  + E    +  ++L+REM+  G
Sbjct  488  DNDLFDKALALLSKMEDNGCIPNAKTYEIIILSLFEKDENDMAEKLLREMIARG  541



>ref|XP_001776359.1| predicted protein [Physcomitrella patens]
 gb|EDQ58858.1| predicted protein, partial [Physcomitrella patens]
Length=499

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 58/114 (51%), Gaps = 1/114 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F+ M N    PN  TY+++ID + K G  + A +VF  +     +  +  Y+ M+    
Sbjct  146  LFEEMQNQNCSPNVITYSILIDAVCKCGGVEKALKVFLDMKSRGCRPNIFTYTSMIDGLG  205

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSL-QRMQEAGYGESVDELIREMLPDG  340
             +  +D    LF+EM ++G++  R +  SL   +  +G  ++  +L REML  G
Sbjct  206  KSGHVDKAFFLFEEMTSEGLVATRVVYNSLIHGLGRSGRADAAAKLFREMLSKG  259



>gb|EAZ05871.1| hypothetical protein OsI_28108 [Oryza sativa Indica Group]
Length=608

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/109 (27%), Positives = 59/109 (54%), Gaps = 6/109 (6%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VF+ M++ G  P  ++Y ++ID    SG  + A  VF+ + + R++  L  Y+ MV A++
Sbjct  339  VFEEMLDAGVRPTRKSYNILIDAFAISGLVEEAHTVFKAMRRHRVEPDLCSYTTMVLAYV  398

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGE--SVDELIR  322
            +   +D  +  F  ++ DG+ P   +  +L +    GY +  +V+ ++R
Sbjct  399  NASDMDGAEKFFRRIKEDGLKPNVVVYGTLMK----GYSKLNNVERVMR  443



>ref|XP_010935645.1| PREDICTED: protein Rf1, mitochondrial-like [Elaeis guineensis]
Length=794

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 38/138 (28%), Positives = 66/138 (48%), Gaps = 20/138 (14%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            VFD M + G  PN  TY+ +I+  VK+ K D A E+F+ + +  +K ++  Y+ ++    
Sbjct  363  VFDSMSDKGLSPNCHTYSALINGFVKNQKMDDAMELFKKMQRQGLKPSVVTYNTLLDGLC  422

Query  182  SNDQLDAVKDLFDEMRADGILP------------GRAMQWS-----LQRMQEAGYGESV-  307
               +++ V  L DEM A GI P            GR  +W      L  M E G   ++ 
Sbjct  423  HLGRVEDVGSLLDEMVARGIHPNVITYTSMICGFGRFGKWKEAFQFLNEMIERGIHPNIT  482

Query  308  --DELIREMLPDGRIKSI  355
              + LI  +  +G+++ +
Sbjct  483  TLNALINFICKEGKVQEV  500



>ref|XP_006382762.1| hypothetical protein POPTR_0005s05180g [Populus trichocarpa]
 gb|ERP60559.1| hypothetical protein POPTR_0005s05180g [Populus trichocarpa]
Length=390

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 67/126 (53%), Gaps = 4/126 (3%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMV-GAF  178
            +F  M + G  PN  TY +++D   K G  D A ++ + + + +++  +  Y+I++ G F
Sbjct  207  LFKEMCSYGPRPNLVTYVILLDGFCKHGHLDEALKLLKSMKEKKLEPNIVHYTILIEGMF  266

Query  179  ISNDQLDAVKDLFDEMRADGILPG-RAMQWSLQRMQEAGYGESVDELIREMLPDGRIKSI  355
            I+  +L+  K+LF ++  DG  P  R     ++ + + G  +   +L R+M  DG + + 
Sbjct  267  IAG-KLEVAKELFSKLFGDGTRPDIRTYTVMIKGLLKEGLSDEAYDLFRKMEDDGFLPN-  324

Query  356  ACSMDA  373
            +CS + 
Sbjct  325  SCSYNV  330


 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 51/110 (46%), Gaps = 6/110 (5%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F ++  DG  P+ RTYTV+I  L+K G  D A ++FR +           Y++++  F+
Sbjct  277  LFSKLFGDGTRPDIRTYTVMIKGLLKEGLSDEAYDLFRKMEDDGFLPNSCSYNVIIQGFL  336

Query  182  SNDQLDAVKDLFDEMRADGILPGRAMQWSLQRMQEAGYGESVDELIREML  331
             N        L DEM       G+    +L   Q     ES DE+I + +
Sbjct  337  QNQDSSTAIRLIDEM------VGKRFSVNLSTFQMLLDLESQDEIISQFM  380



>ref|NP_194913.1| proton gradient regulation 3 [Arabidopsis thaliana]
 sp|Q9SZ52.1|PP344_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g31850, 
chloroplastic; AltName: Full=Protein PROTON GRADIENT 
REGULATION 3; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB40755.1| putative protein [Arabidopsis thaliana]
 emb|CAB79903.1| putative protein [Arabidopsis thaliana]
 gb|AEE85967.1| proton gradient regulation 3 [Arabidopsis thaliana]
Length=1112

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +  RM ++G  P+  TYTV+ID L  + K D A EVF  +   R K     Y  ++  F 
Sbjct  280  ILKRMDDEGCGPDVVTYTVLIDALCTARKLDCAKEVFEKMKTGRHKPDRVTYITLLDRFS  339

Query  182  SNDQLDAVKDLFDEMRADGILP  247
             N  LD+VK  + EM  DG +P
Sbjct  340  DNRDLDSVKQFWSEMEKDGHVP  361



>ref|XP_010447486.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, 
chloroplastic isoform X1 [Camelina sativa]
 ref|XP_010447487.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, 
chloroplastic isoform X2 [Camelina sativa]
Length=1118

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +  RM ++G  P+  TYTV+ID L  + K D A EVF  +   R K     Y  ++  F 
Sbjct  286  ILKRMDDEGCGPDVVTYTVLIDALCTARKLDCAKEVFEKMKTGRHKPDRVTYITLLDRFS  345

Query  182  SNDQLDAVKDLFDEMRADGILP  247
             N  LD+VK  + EM  DG +P
Sbjct  346  DNRDLDSVKQFWSEMEKDGHVP  367


 Score = 48.9 bits (115),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 29/111 (26%), Positives = 54/111 (49%), Gaps = 1/111 (1%)
 Frame = +2

Query  26   GALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISNDQLDAV  205
            G  PN  T+T+ I  L ++GK D A E+ + +        +  Y++++ A  +  +LD  
Sbjct  259  GLKPNVYTFTICIRVLGRAGKIDEAYEILKRMDDEGCGPDVVTYTVLIDALCTARKLDCA  318

Query  206  KDLFDEMRADGILPGRAMQWS-LQRMQEAGYGESVDELIREMLPDGRIKSI  355
            K++F++M+     P R    + L R  +    +SV +   EM  DG +  +
Sbjct  319  KEVFEKMKTGRHKPDRVTYITLLDRFSDNRDLDSVKQFWSEMEKDGHVPDV  369



>gb|AFV61022.1| pentatricopeptide repeat-containing protein 11, partial [Coelocarpum 
swinglei]
Length=429

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 45/84 (54%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +FD M++ G +PN  T+T +ID   K+G+ D A EV++ +    +   L  Y+ ++    
Sbjct  232  LFDEMLDKGLVPNGVTFTTLIDGHCKNGRVDLAMEVYKQMLSQSLSPDLITYNTLIYGLC  291

Query  182  SNDQLDAVKDLFDEMRADGILPGR  253
                L   +DL DEMR  G+ P +
Sbjct  292  KKGDLKQAQDLIDEMRMKGLKPDK  315



>ref|XP_009625048.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009625049.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009625050.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009625051.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009625052.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009625053.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009625054.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009625055.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009625056.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009625057.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009625058.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009625059.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009625061.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009625062.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009625063.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009625064.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009625065.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009625066.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009625067.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009625068.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Nicotiana tomentosiformis]
Length=590

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            V   MI  G  PN  TY VIID     G+ D A  +F  +    IK  +  YS ++  + 
Sbjct  303  VMRHMIGKGVEPNVVTYNVIIDGYCLRGQMDKARRLFDSMIDKSIKPDIVSYSTLINGYC  362

Query  182  SNDQLDAVKDLFDEMRADGILP  247
             N++LD   DLF E+  +G+ P
Sbjct  363  KNNKLDEAMDLFHEISRNGLRP  384


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 40/82 (49%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F  M+N    PN RT  ++ D L K GK   A EV R +    ++  +  Y++++  + 
Sbjct  268  LFFEMVNLNIYPNVRTLAIVTDGLCKEGKVRDAEEVMRHMIGKGVEPNVVTYNVIIDGYC  327

Query  182  SNDQLDAVKDLFDEMRADGILP  247
               Q+D  + LFD M    I P
Sbjct  328  LRGQMDKARRLFDSMIDKSIKP  349



>ref|XP_006837809.1| hypothetical protein AMTR_s00104p00122950 [Amborella trichopoda]
 gb|ERN00378.1| hypothetical protein AMTR_s00104p00122950 [Amborella trichopoda]
Length=706

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    DRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFISN  187
            D M+ +G  P+  T+T +ID  VK    + A  VFR + + +    +  Y++++  F   
Sbjct  431  DAMVREGLCPDKFTFTTLIDGYVKGNNMEEAQRVFRDMMKQKTIPNVVTYTVLINGFCRM  490

Query  188  DQLDAVKDLFDEMRADGILP  247
             +LD+ +DLF EM++ G  P
Sbjct  491  RRLDSARDLFQEMQSGGCAP  510



>ref|XP_010458712.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Camelina sativa]
Length=633

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            + DRMI +G  PN  T+  +++ + KSGK   A E+ R + + +IK  +  YSI++    
Sbjct  211  LIDRMIENGCQPNEVTFGPVLNVMCKSGKTALAMELLRKMEERKIKLNVVHYSIIIDGLC  270

Query  182  SNDQLDAVKDLFDEMRADGI  241
             ++ LD   +LF+EM   G 
Sbjct  271  KDENLDDALNLFNEMEVKGF  290


 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 59/114 (52%), Gaps = 1/114 (1%)
 Frame = +2

Query  2    VFDRMINDGALPNSRTYTVIIDHLVKSGKFDSATEVFRVLPQMRIKRTLKQYSIMVGAFI  181
            +F  M++    P+  TY++++D L  +G+ + A E+F  + +  +K  +  YSI++    
Sbjct  456  LFQTMVSRRVPPDIVTYSILLDGLCDNGELEKAMEIFEKMQKSEMKLDISTYSIIIHGMC  515

Query  182  SNDQLDAVKDLFDEMRADGI-LPGRAMQWSLQRMQEAGYGESVDELIREMLPDG  340
            +  ++D   DLF  +   G+ L  RA    +  + + G     ++L R+M+ DG
Sbjct  516  NASKVDDAWDLFCRLPLKGMQLDNRAYTIMISGLCKKGSLSEANKLFRKMVEDG  569



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561572122600