BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP015C03 647 bp,

Length=626
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011021095.1|  PREDICTED: uncharacterized protein At1g04910       277   5e-87   Populus euphratica
ref|XP_006373415.1|  hypothetical protein POPTR_0017s13570g             273   1e-85   Populus trichocarpa [western balsam poplar]
ref|XP_010999426.1|  PREDICTED: uncharacterized protein At1g04910...    271   8e-85   Populus euphratica
ref|XP_006384269.1|  hypothetical protein POPTR_0004s11220g             271   2e-84   Populus trichocarpa [western balsam poplar]
ref|XP_010101636.1|  hypothetical protein L484_016665                   271   2e-84   Morus notabilis
gb|EYU44245.1|  hypothetical protein MIMGU_mgv1a004661mg                270   2e-84   Erythranthe guttata [common monkey flower]
ref|XP_010549977.1|  PREDICTED: uncharacterized protein At1g04910...    270   3e-84   Tarenaya hassleriana [spider flower]
ref|XP_009391772.1|  PREDICTED: uncharacterized protein At1g04910...    270   5e-84   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010525131.1|  PREDICTED: uncharacterized protein At1g04910...    268   2e-83   Tarenaya hassleriana [spider flower]
gb|KJB10522.1|  hypothetical protein B456_001G206300                    263   8e-83   Gossypium raimondii
ref|XP_010549974.1|  PREDICTED: uncharacterized protein At1g04910...    266   2e-82   Tarenaya hassleriana [spider flower]
ref|XP_009757587.1|  PREDICTED: uncharacterized protein At1g04910...    265   2e-82   Nicotiana sylvestris
ref|XP_009611732.1|  PREDICTED: uncharacterized protein At1g04910...    265   2e-82   Nicotiana tomentosiformis
ref|XP_011099050.1|  PREDICTED: uncharacterized protein At1g04910       265   3e-82   Sesamum indicum [beniseed]
ref|XP_010257917.1|  PREDICTED: uncharacterized protein At1g04910...    261   3e-82   Nelumbo nucifera [Indian lotus]
ref|XP_007032894.1|  O-fucosyltransferase family protein isoform 1      265   4e-82   Theobroma cacao [chocolate]
emb|CDO98540.1|  unnamed protein product                                265   4e-82   Coffea canephora [robusta coffee]
gb|KHN46676.1|  DUF246 domain-containing protein                        263   7e-82   Glycine soja [wild soybean]
ref|XP_010525130.1|  PREDICTED: uncharacterized protein At1g04910...    264   9e-82   Tarenaya hassleriana [spider flower]
ref|XP_010099296.1|  hypothetical protein L484_018158                   264   1e-81   Morus notabilis
gb|KDP24328.1|  hypothetical protein JCGZ_25624                         263   1e-81   Jatropha curcas
ref|XP_006844075.1|  hypothetical protein AMTR_s00006p00250170          263   1e-81   
ref|XP_002525944.1|  conserved hypothetical protein                     263   1e-81   
ref|XP_010037318.1|  PREDICTED: uncharacterized protein At1g04910...    263   1e-81   Eucalyptus grandis [rose gum]
ref|XP_004241614.1|  PREDICTED: uncharacterized protein At1g04910       263   2e-81   Solanum lycopersicum
gb|KJB10523.1|  hypothetical protein B456_001G206300                    263   2e-81   Gossypium raimondii
ref|XP_009381654.1|  PREDICTED: uncharacterized protein At1g04910...    259   2e-81   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG10689.1|  hypothetical protein F383_03841                         263   2e-81   Gossypium arboreum [tree cotton]
ref|XP_003551780.1|  PREDICTED: uncharacterized protein At1g04910...    262   3e-81   Glycine max [soybeans]
ref|XP_010257916.1|  PREDICTED: uncharacterized protein At1g04910...    262   4e-81   Nelumbo nucifera [Indian lotus]
gb|KDO65637.1|  hypothetical protein CISIN_1g010586mg                   258   5e-81   Citrus sinensis [Valencia orange]
ref|XP_009337866.1|  PREDICTED: uncharacterized protein At1g04910...    261   1e-80   Pyrus x bretschneideri [bai li]
ref|XP_004953767.1|  PREDICTED: uncharacterized protein At1g04910...    261   1e-80   Setaria italica
ref|XP_010943313.1|  PREDICTED: uncharacterized protein At1g04910       261   1e-80   Elaeis guineensis
ref|XP_008788919.1|  PREDICTED: uncharacterized protein At1g04910...    256   2e-80   
ref|XP_006358681.1|  PREDICTED: uncharacterized protein At1g04910...    260   2e-80   Solanum tuberosum [potatoes]
ref|XP_009410297.1|  PREDICTED: uncharacterized protein At1g04910...    260   2e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008393258.1|  PREDICTED: uncharacterized protein At1g04910...    260   2e-80   Malus domestica [apple tree]
gb|KHN15193.1|  DUF246 domain-containing protein                        260   3e-80   Glycine soja [wild soybean]
ref|XP_003525629.1|  PREDICTED: uncharacterized protein At1g04910...    260   3e-80   Glycine max [soybeans]
ref|XP_006354743.1|  PREDICTED: uncharacterized protein At1g04910...    259   3e-80   Solanum tuberosum [potatoes]
ref|XP_009776643.1|  PREDICTED: uncharacterized protein At1g04910...    260   4e-80   Nicotiana sylvestris
ref|XP_004157433.1|  PREDICTED: LOW QUALITY PROTEIN: DUF246 domai...    259   6e-80   
ref|XP_009625954.1|  PREDICTED: uncharacterized protein At1g04910...    259   6e-80   Nicotiana tomentosiformis
ref|XP_004137453.1|  PREDICTED: DUF246 domain-containing protein ...    259   6e-80   Cucumis sativus [cucumbers]
ref|XP_006656001.1|  PREDICTED: uncharacterized protein At1g04910...    256   7e-80   Oryza brachyantha
ref|XP_006440825.1|  hypothetical protein CICLE_v10019790mg             259   7e-80   Citrus clementina
ref|XP_009793270.1|  PREDICTED: uncharacterized protein At1g04910...    258   7e-80   Nicotiana sylvestris
ref|XP_009381653.1|  PREDICTED: uncharacterized protein At1g04910...    259   8e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004236078.1|  PREDICTED: uncharacterized protein At1g04910...    259   8e-80   Solanum lycopersicum
ref|XP_006345092.1|  PREDICTED: uncharacterized protein At1g04910...    259   1e-79   Solanum tuberosum [potatoes]
ref|XP_009587252.1|  PREDICTED: uncharacterized protein At1g04910...    258   1e-79   Nicotiana tomentosiformis
ref|XP_007037671.1|  O-fucosyltransferase family protein isoform 2      258   1e-79   Theobroma cacao [chocolate]
gb|EYU23639.1|  hypothetical protein MIMGU_mgv1a004971mg                258   1e-79   Erythranthe guttata [common monkey flower]
ref|XP_011078675.1|  PREDICTED: uncharacterized protein At1g04910...    258   1e-79   Sesamum indicum [beniseed]
ref|XP_008809674.1|  PREDICTED: uncharacterized protein At1g04910...    258   2e-79   Phoenix dactylifera
ref|XP_007151404.1|  hypothetical protein PHAVU_004G043700g             258   2e-79   Phaseolus vulgaris [French bean]
ref|XP_010261204.1|  PREDICTED: uncharacterized protein At1g04910       258   2e-79   Nelumbo nucifera [Indian lotus]
ref|XP_008454434.1|  PREDICTED: uncharacterized protein At1g04910...    258   3e-79   Cucumis melo [Oriental melon]
ref|XP_006600607.1|  PREDICTED: uncharacterized protein At1g04910...    257   3e-79   Glycine max [soybeans]
gb|KHN18388.1|  DUF246 domain-containing protein                        257   4e-79   Glycine soja [wild soybean]
gb|EEE57726.1|  hypothetical protein OsJ_08224                          256   5e-79   Oryza sativa Japonica Group [Japonica rice]
gb|KEH32061.1|  GDP-fucose O-fucosyltransferase-like protein            256   6e-79   Medicago truncatula
ref|XP_007037670.1|  O-fucosyltransferase family protein isoform 1      258   6e-79   Theobroma cacao [chocolate]
ref|XP_004508647.1|  PREDICTED: uncharacterized protein At1g04910...    256   7e-79   Cicer arietinum [garbanzo]
ref|XP_008788918.1|  PREDICTED: uncharacterized protein At1g04910...    256   7e-79   Phoenix dactylifera
ref|XP_006649007.1|  PREDICTED: uncharacterized protein At1g04910...    255   7e-79   
gb|KHN30744.1|  DUF246 domain-containing protein                        256   8e-79   Glycine soja [wild soybean]
ref|XP_008453320.1|  PREDICTED: uncharacterized protein At1g04910...    256   8e-79   Cucumis melo [Oriental melon]
ref|XP_007211132.1|  hypothetical protein PRUPE_ppa026241mg             256   9e-79   Prunus persica
dbj|BAG93245.1|  unnamed protein product                                248   1e-78   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007139392.1|  hypothetical protein PHAVU_008G025600g             256   1e-78   Phaseolus vulgaris [French bean]
ref|XP_006603936.1|  PREDICTED: uncharacterized protein At1g04910...    256   1e-78   Glycine max [soybeans]
gb|EEC73922.1|  hypothetical protein OsI_08773                          255   1e-78   Oryza sativa Indica Group [Indian rice]
ref|XP_004252254.1|  PREDICTED: uncharacterized protein At1g04910...    255   2e-78   Solanum lycopersicum
gb|EMS52310.1|  hypothetical protein TRIUR3_22833                       253   2e-78   Triticum urartu
dbj|BAD16083.1|  putative auxin-independent growth promoter             255   2e-78   Oryza sativa Japonica Group [Japonica rice]
gb|KHN45098.1|  DUF246 domain-containing protein                        251   2e-78   Glycine soja [wild soybean]
ref|XP_008240072.1|  PREDICTED: uncharacterized protein At1g04910...    255   3e-78   Prunus mume [ume]
ref|XP_002454352.1|  hypothetical protein SORBIDRAFT_04g029280          254   3e-78   Sorghum bicolor [broomcorn]
ref|XP_004138213.1|  PREDICTED: DUF246 domain-containing protein ...    254   4e-78   Cucumis sativus [cucumbers]
ref|XP_002278298.1|  PREDICTED: uncharacterized protein At1g04910       254   4e-78   Vitis vinifera
ref|XP_003570464.2|  PREDICTED: uncharacterized protein At1g04910...    254   4e-78   Brachypodium distachyon [annual false brome]
ref|XP_010694231.1|  PREDICTED: uncharacterized protein At1g04910       255   4e-78   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010928111.1|  PREDICTED: uncharacterized protein At1g04910...    254   5e-78   Elaeis guineensis
ref|XP_008455558.1|  PREDICTED: uncharacterized protein At1g04910...    254   7e-78   Cucumis melo [Oriental melon]
emb|CBI16925.3|  unnamed protein product                                254   7e-78   Vitis vinifera
ref|NP_001057398.1|  Os06g0284200                                       253   8e-78   
gb|EAZ00539.1|  hypothetical protein OsI_22558                          253   8e-78   Oryza sativa Indica Group [Indian rice]
gb|EAZ36643.1|  hypothetical protein OsJ_20989                          253   9e-78   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007045745.1|  O-fucosyltransferase family protein                253   1e-77   Theobroma cacao [chocolate]
ref|XP_006852198.1|  hypothetical protein AMTR_s00049p00119840          252   1e-77   
ref|XP_006430964.1|  hypothetical protein CICLE_v10011493mg             253   1e-77   Citrus clementina
ref|XP_006482442.1|  PREDICTED: uncharacterized protein At1g04910...    253   2e-77   Citrus sinensis [Valencia orange]
ref|XP_004306052.1|  PREDICTED: uncharacterized protein At1g04910...    252   2e-77   Fragaria vesca subsp. vesca
ref|XP_008646193.1|  PREDICTED: uncharacterized protein At1g04910...    252   2e-77   Zea mays [maize]
ref|XP_011072874.1|  PREDICTED: uncharacterized protein At1g04910...    253   3e-77   Sesamum indicum [beniseed]
dbj|BAJ90326.1|  predicted protein                                      251   3e-77   Hordeum vulgare subsp. vulgare [barley]
gb|KHN05195.1|  DUF246 domain-containing protein                        249   4e-77   Glycine soja [wild soybean]
gb|AAM67354.1|  unknown                                                 244   4e-77   Arabidopsis thaliana [mouse-ear cress]
gb|KHG01567.1|  hypothetical protein F383_21541                         252   4e-77   Gossypium arboreum [tree cotton]
gb|KDO72306.1|  hypothetical protein CISIN_1g036592mg                   252   5e-77   Citrus sinensis [Valencia orange]
ref|XP_003530456.1|  PREDICTED: uncharacterized protein At1g04910...    251   5e-77   Glycine max [soybeans]
ref|XP_006661343.1|  PREDICTED: uncharacterized protein At1g04910...    248   5e-77   
gb|EMS67535.1|  hypothetical protein TRIUR3_24224                       249   6e-77   Triticum urartu
gb|EMS61270.1|  hypothetical protein TRIUR3_28898                       249   9e-77   Triticum urartu
gb|ACU20394.1|  unknown                                                 240   1e-76   Glycine max [soybeans]
ref|XP_004488503.1|  PREDICTED: uncharacterized protein At1g04910...    251   1e-76   Cicer arietinum [garbanzo]
gb|EMT16495.1|  hypothetical protein F775_26167                         249   1e-76   Aegilops tauschii
ref|XP_004137143.1|  PREDICTED: DUF246 domain-containing protein ...    250   1e-76   Cucumis sativus [cucumbers]
ref|XP_008362222.1|  PREDICTED: uncharacterized protein At1g04910...    250   2e-76   Malus domestica [apple tree]
ref|XP_009373763.1|  PREDICTED: uncharacterized protein At1g04910...    250   2e-76   Pyrus x bretschneideri [bai li]
gb|EMT03456.1|  hypothetical protein F775_30563                         249   2e-76   Aegilops tauschii
ref|XP_006400095.1|  hypothetical protein EUTSA_v10013286mg             249   3e-76   Eutrema salsugineum
ref|XP_010492420.1|  PREDICTED: uncharacterized protein At1g04910...    249   3e-76   Camelina sativa [gold-of-pleasure]
ref|XP_006287551.1|  hypothetical protein CARUB_v10000760mg             249   4e-76   Capsella rubella
ref|XP_010492421.1|  PREDICTED: uncharacterized protein At1g04910...    249   4e-76   Camelina sativa [gold-of-pleasure]
ref|NP_001159291.1|  hypothetical protein                               249   4e-76   Zea mays [maize]
gb|EAZ09478.1|  hypothetical protein OsI_31750                          249   4e-76   Oryza sativa Indica Group [Indian rice]
gb|KJB19455.1|  hypothetical protein B456_003G103300                    249   5e-76   Gossypium raimondii
ref|XP_009395885.1|  PREDICTED: uncharacterized protein At1g04910...    249   5e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004965235.1|  PREDICTED: uncharacterized protein At1g04910...    249   5e-76   Setaria italica
ref|XP_002514598.1|  conserved hypothetical protein                     249   5e-76   Ricinus communis
ref|XP_010453716.1|  PREDICTED: uncharacterized protein At1g04910...    249   6e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010420248.1|  PREDICTED: uncharacterized protein At1g04910...    249   6e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010453715.1|  PREDICTED: uncharacterized protein At1g04910...    249   7e-76   Camelina sativa [gold-of-pleasure]
ref|XP_007138389.1|  hypothetical protein PHAVU_009G204500g             248   8e-76   Phaseolus vulgaris [French bean]
ref|XP_007215267.1|  hypothetical protein PRUPE_ppa004594mg             248   8e-76   Prunus persica
gb|AES65954.2|  GDP-fucose O-fucosyltransferase-like protein            248   1e-75   Medicago truncatula
ref|XP_006582034.1|  PREDICTED: uncharacterized protein At1g04910...    248   1e-75   Glycine max [soybeans]
emb|CDX78650.1|  BnaA03g05620D                                          248   2e-75   Brassica napus [oilseed rape]
ref|XP_003563952.1|  PREDICTED: uncharacterized protein At1g04910...    247   2e-75   Brachypodium distachyon [annual false brome]
ref|XP_009131494.1|  PREDICTED: uncharacterized protein At1g04910...    247   2e-75   Brassica rapa
gb|AAF02113.1|AC009755_6  putative auxin-independent growth promoter    244   3e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004957108.1|  PREDICTED: uncharacterized protein At1g04910...    246   4e-75   Setaria italica
emb|CDY24821.1|  BnaA08g14890D                                          246   4e-75   Brassica napus [oilseed rape]
ref|XP_009134657.1|  PREDICTED: uncharacterized protein At1g04910...    246   4e-75   Brassica rapa
emb|CAN73548.1|  hypothetical protein VITISV_038182                     246   4e-75   Vitis vinifera
emb|CDX91985.1|  BnaC03g32870D                                          246   4e-75   Brassica napus [oilseed rape]
ref|XP_002438243.1|  hypothetical protein SORBIDRAFT_10g010460          246   5e-75   Sorghum bicolor [broomcorn]
emb|CDX74265.1|  BnaA03g27820D                                          246   5e-75   Brassica napus [oilseed rape]
ref|XP_009131492.1|  PREDICTED: uncharacterized protein At1g04910...    247   5e-75   Brassica rapa
ref|XP_010663502.1|  PREDICTED: uncharacterized protein At1g04910...    246   5e-75   Vitis vinifera
ref|XP_008230306.1|  PREDICTED: uncharacterized protein At1g04910       246   6e-75   Prunus mume [ume]
emb|CDY26456.1|  BnaC09g42120D                                          246   7e-75   Brassica napus [oilseed rape]
ref|XP_008357801.1|  PREDICTED: uncharacterized protein At1g04910...    246   8e-75   Malus domestica [apple tree]
ref|XP_010032573.1|  PREDICTED: uncharacterized protein At1g04910...    245   9e-75   Eucalyptus grandis [rose gum]
ref|XP_002873739.1|  hypothetical protein ARALYDRAFT_488418             245   9e-75   Arabidopsis lyrata subsp. lyrata
ref|NP_197078.2|  O-fucosyltransferase family protein                   245   1e-74   Arabidopsis thaliana [mouse-ear cress]
emb|CAC01773.1|  putative protein                                       245   1e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010032572.1|  PREDICTED: uncharacterized protein At1g04910...    245   1e-74   Eucalyptus grandis [rose gum]
gb|KJB80439.1|  hypothetical protein B456_013G097700                    245   1e-74   Gossypium raimondii
ref|XP_010464948.1|  PREDICTED: uncharacterized protein At1g04910...    245   1e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010485466.1|  PREDICTED: uncharacterized protein At1g04910...    245   1e-74   Camelina sativa [gold-of-pleasure]
ref|XP_009378282.1|  PREDICTED: uncharacterized protein At1g04910       244   2e-74   Pyrus x bretschneideri [bai li]
gb|KHN29942.1|  DUF246 domain-containing protein                        241   2e-74   Glycine soja [wild soybean]
ref|XP_009121550.1|  PREDICTED: uncharacterized protein At1g04910       244   2e-74   Brassica rapa
ref|XP_003522979.2|  PREDICTED: uncharacterized protein At1g04910...    245   2e-74   Glycine max [soybeans]
ref|XP_010463624.1|  PREDICTED: uncharacterized protein At1g04910...    244   3e-74   Camelina sativa [gold-of-pleasure]
gb|KFK37682.1|  hypothetical protein AALP_AA3G015000                    244   3e-74   Arabis alpina [alpine rockcress]
emb|CDX70637.1|  BnaC03g07210D                                          244   3e-74   Brassica napus [oilseed rape]
ref|NP_566168.2|  O-fucosyltransferase-like protein                     244   4e-74   Arabidopsis thaliana [mouse-ear cress]
gb|KFK25799.1|  hypothetical protein AALP_AA8G162600                    244   4e-74   Arabis alpina [alpine rockcress]
ref|XP_006408431.1|  hypothetical protein EUTSA_v10020530mg             244   4e-74   Eutrema salsugineum
ref|XP_006297456.1|  hypothetical protein CARUB_v10013476mg             244   5e-74   Capsella rubella
emb|CDY34713.1|  BnaA01g33120D                                          243   5e-74   Brassica napus [oilseed rape]
ref|XP_002884311.1|  hypothetical protein ARALYDRAFT_896190             244   5e-74   Arabidopsis lyrata subsp. lyrata
ref|XP_008374671.1|  PREDICTED: uncharacterized protein At1g04910...    244   6e-74   Malus domestica [apple tree]
ref|XP_003595703.1|  ATP synthase subunit a chloroplastic               247   8e-74   
emb|CDX69504.1|  BnaA10g18530D                                          243   9e-74   Brassica napus [oilseed rape]
gb|KJB39974.1|  hypothetical protein B456_007G040500                    243   1e-73   Gossypium raimondii
emb|CDX70647.1|  BnaC03g07310D                                          242   2e-73   Brassica napus [oilseed rape]
ref|XP_002462529.1|  hypothetical protein SORBIDRAFT_02g027470          242   2e-73   Sorghum bicolor [broomcorn]
ref|XP_010031163.1|  PREDICTED: uncharacterized protein At1g04910...    241   2e-73   Eucalyptus grandis [rose gum]
ref|XP_004299271.1|  PREDICTED: uncharacterized protein At1g04910...    242   3e-73   Fragaria vesca subsp. vesca
emb|CDY43245.1|  BnaC05g48380D                                          239   4e-73   Brassica napus [oilseed rape]
emb|CDY60465.1|  BnaAnng16790D                                          239   4e-73   Brassica napus [oilseed rape]
ref|XP_006574968.1|  PREDICTED: uncharacterized protein At1g04910...    240   6e-73   Glycine max [soybeans]
gb|KEH25156.1|  GDP-fucose O-fucosyltransferase-like protein            241   7e-73   Medicago truncatula
gb|KHG22838.1|  hypothetical protein F383_00632                         241   9e-73   Gossypium arboreum [tree cotton]
ref|XP_009147366.1|  PREDICTED: uncharacterized protein At1g04910       240   1e-72   Brassica rapa
ref|XP_004507283.1|  PREDICTED: uncharacterized protein At1g04910...    240   1e-72   
gb|EPS59387.1|  hypothetical protein M569_15421                         234   1e-72   Genlisea aurea
ref|XP_008379462.1|  PREDICTED: uncharacterized protein At1g04910       239   2e-72   Malus domestica [apple tree]
ref|XP_004508646.1|  PREDICTED: uncharacterized protein At1g04910...    240   2e-72   
gb|KDP31393.1|  hypothetical protein JCGZ_11769                         239   3e-72   Jatropha curcas
ref|XP_009346329.1|  PREDICTED: uncharacterized protein At1g04910...    239   5e-72   Pyrus x bretschneideri [bai li]
ref|XP_008651776.1|  PREDICTED: uncharacterized protein LOC100384...    238   8e-72   Zea mays [maize]
ref|XP_011012033.1|  PREDICTED: uncharacterized protein At1g04910...    238   9e-72   Populus euphratica
ref|XP_002321469.2|  hypothetical protein POPTR_0015s03540g             237   1e-71   Populus trichocarpa [western balsam poplar]
ref|XP_011012032.1|  PREDICTED: uncharacterized protein At1g04910...    238   1e-71   Populus euphratica
ref|XP_007153464.1|  hypothetical protein PHAVU_003G0377001g            233   1e-71   Phaseolus vulgaris [French bean]
gb|KHN09725.1|  DUF246 domain-containing protein                        234   1e-71   Glycine soja [wild soybean]
ref|XP_002317951.2|  hypothetical protein POPTR_0012s12420g             237   2e-71   Populus trichocarpa [western balsam poplar]
ref|XP_011011552.1|  PREDICTED: uncharacterized protein At1g04910...    236   3e-71   Populus euphratica
ref|NP_001170458.1|  uncharacterized protein LOC100384451               237   3e-71   Zea mays [maize]
gb|KDO83012.1|  hypothetical protein CISIN_1g010411mg                   231   3e-71   Citrus sinensis [Valencia orange]
ref|XP_002973416.1|  hypothetical protein SELMODRAFT_148957             234   6e-71   Selaginella moellendorffii
ref|XP_010678381.1|  PREDICTED: uncharacterized protein At1g04910...    236   7e-71   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_002976491.1|  hypothetical protein SELMODRAFT_105694             234   1e-70   Selaginella moellendorffii
ref|XP_004298341.2|  PREDICTED: uncharacterized protein At1g04910...    233   2e-70   Fragaria vesca subsp. vesca
ref|XP_003517877.1|  PREDICTED: uncharacterized protein At1g04910...    234   3e-70   Glycine max [soybeans]
ref|XP_009592905.1|  PREDICTED: uncharacterized protein At1g04910       233   4e-70   Nicotiana tomentosiformis
gb|KDO83011.1|  hypothetical protein CISIN_1g010411mg                   230   5e-70   Citrus sinensis [Valencia orange]
ref|XP_007224025.1|  hypothetical protein PRUPE_ppa015128mg             234   5e-70   Prunus persica
ref|XP_007224653.1|  hypothetical protein PRUPE_ppa026308mg             233   9e-70   Prunus persica
ref|XP_007045744.1|  O-fucosyltransferase family protein, putative      233   9e-70   Theobroma cacao [chocolate]
ref|XP_004239107.1|  PREDICTED: uncharacterized protein At1g04910       232   2e-69   Solanum lycopersicum
ref|XP_009776724.1|  PREDICTED: uncharacterized protein At1g04910       231   2e-69   Nicotiana sylvestris
ref|XP_009356548.1|  PREDICTED: uncharacterized protein At1g04910...    231   4e-69   Pyrus x bretschneideri [bai li]
gb|KJB06911.1|  hypothetical protein B456_001G066600                    231   4e-69   Gossypium raimondii
ref|XP_006483112.1|  PREDICTED: uncharacterized protein At1g04910...    231   4e-69   Citrus sinensis [Valencia orange]
gb|EMT11779.1|  hypothetical protein F775_16558                         226   4e-69   Aegilops tauschii
ref|XP_010523472.1|  PREDICTED: uncharacterized protein At1g04910       230   6e-69   Tarenaya hassleriana [spider flower]
ref|XP_008243882.1|  PREDICTED: uncharacterized protein At1g04910...    230   8e-69   
gb|KDO83010.1|  hypothetical protein CISIN_1g010411mg                   230   9e-69   Citrus sinensis [Valencia orange]
ref|XP_006438745.1|  hypothetical protein CICLE_v10031276mg             230   9e-69   Citrus clementina
emb|CDY62211.1|  BnaCnng39590D                                          229   9e-69   Brassica napus [oilseed rape]
ref|XP_004968329.1|  PREDICTED: uncharacterized protein At1g04910...    229   9e-69   Setaria italica
gb|KHG17083.1|  hypothetical protein F383_22070                         229   1e-68   Gossypium arboreum [tree cotton]
dbj|BAJ87723.1|  predicted protein                                      229   1e-68   Hordeum vulgare subsp. vulgare [barley]
ref|XP_008793370.1|  PREDICTED: uncharacterized protein At1g04910...    229   1e-68   Phoenix dactylifera
ref|XP_009356547.1|  PREDICTED: uncharacterized protein At1g04910...    229   1e-68   Pyrus x bretschneideri [bai li]
ref|XP_008673663.1|  PREDICTED: uncharacterized protein At1g04910...    227   2e-68   Zea mays [maize]
ref|XP_004968328.1|  PREDICTED: uncharacterized protein At1g04910...    229   2e-68   
ref|XP_003569202.1|  PREDICTED: uncharacterized protein At1g04910...    228   2e-68   Brachypodium distachyon [annual false brome]
ref|XP_002312261.1|  hypothetical protein POPTR_0008s09010g             228   3e-68   Populus trichocarpa [western balsam poplar]
ref|XP_002457274.1|  hypothetical protein SORBIDRAFT_03g004640          228   4e-68   Sorghum bicolor [broomcorn]
gb|EMS47451.1|  hypothetical protein TRIUR3_25287                       224   6e-68   Triticum urartu
ref|XP_002522480.1|  conserved hypothetical protein                     228   7e-68   Ricinus communis
emb|CDP00368.1|  unnamed protein product                                228   8e-68   Coffea canephora [robusta coffee]
ref|XP_006378582.1|  hypothetical protein POPTR_0010s17200g             227   8e-68   Populus trichocarpa [western balsam poplar]
gb|EEC70012.1|  hypothetical protein OsI_00561                          227   1e-67   Oryza sativa Indica Group [Indian rice]
gb|KDP41238.1|  hypothetical protein JCGZ_15645                         227   1e-67   Jatropha curcas
ref|XP_010938112.1|  PREDICTED: uncharacterized protein At1g04910...    227   1e-67   Elaeis guineensis
ref|XP_008673661.1|  PREDICTED: uncharacterized protein At1g04910...    227   1e-67   
ref|XP_011075536.1|  PREDICTED: uncharacterized protein At1g04910...    227   1e-67   Sesamum indicum [beniseed]
ref|XP_002315033.2|  hypothetical protein POPTR_0010s17200g             227   1e-67   Populus trichocarpa [western balsam poplar]
emb|CDM81497.1|  unnamed protein product                                226   2e-67   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010937209.1|  PREDICTED: uncharacterized protein At1g04910       227   2e-67   Elaeis guineensis
ref|XP_006417065.1|  hypothetical protein EUTSA_v10007443mg             226   2e-67   Eutrema salsugineum
ref|XP_004297196.2|  PREDICTED: uncharacterized protein At1g04910...    226   2e-67   Fragaria vesca subsp. vesca
gb|AFW80133.1|  hypothetical protein ZEAMMB73_216816                    226   2e-67   Zea mays [maize]
ref|XP_006348753.1|  PREDICTED: uncharacterized protein At1g04910...    226   3e-67   Solanum tuberosum [potatoes]
ref|XP_006645535.1|  PREDICTED: uncharacterized protein At1g04910...    224   3e-67   
ref|XP_009110564.1|  PREDICTED: uncharacterized protein At1g04910...    225   4e-67   Brassica rapa
ref|XP_008783536.1|  PREDICTED: uncharacterized protein At1g04910...    226   5e-67   Phoenix dactylifera
ref|XP_010683121.1|  PREDICTED: uncharacterized protein At1g04910       225   5e-67   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_006829768.1|  hypothetical protein AMTR_s00119p00025950          226   5e-67   Amborella trichopoda
ref|XP_011012877.1|  PREDICTED: uncharacterized protein At1g04910...    224   5e-67   Populus euphratica
ref|XP_006291038.1|  hypothetical protein CARUB_v10017150mg             224   5e-67   Capsella rubella
ref|XP_011012870.1|  PREDICTED: uncharacterized protein At1g04910...    225   6e-67   Populus euphratica
ref|XP_007223386.1|  hypothetical protein PRUPE_ppa004614mg             225   6e-67   Prunus persica
ref|XP_002890036.1|  hypothetical protein ARALYDRAFT_471563             225   6e-67   Arabidopsis lyrata subsp. lyrata
gb|ABF94189.1|  Axi 1 protein, putative, expressed                      222   8e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010108707.1|  hypothetical protein L484_015696                   224   8e-67   Morus notabilis
ref|XP_011012850.1|  PREDICTED: uncharacterized protein At1g04910...    225   1e-66   Populus euphratica
ref|XP_006827328.1|  hypothetical protein AMTR_s00010p00267640          230   1e-66   
ref|XP_007045743.1|  O-fucosyltransferase family protein                224   1e-66   Theobroma cacao [chocolate]
ref|XP_008221575.1|  PREDICTED: uncharacterized protein At1g04910       224   1e-66   Prunus mume [ume]
ref|XP_009413466.1|  PREDICTED: uncharacterized protein At1g04910...    223   2e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009356549.1|  PREDICTED: uncharacterized protein At1g04910...    224   2e-66   Pyrus x bretschneideri [bai li]
gb|EYU28798.1|  hypothetical protein MIMGU_mgv1a005013mg                220   2e-66   Erythranthe guttata [common monkey flower]
ref|XP_009402423.1|  PREDICTED: uncharacterized protein At1g04910...    224   2e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002265858.1|  PREDICTED: uncharacterized protein At1g04910       223   3e-66   Vitis vinifera
ref|XP_004135163.1|  PREDICTED: DUF246 domain-containing protein ...    223   3e-66   Cucumis sativus [cucumbers]
ref|XP_004155302.1|  PREDICTED: LOW QUALITY PROTEIN: DUF246 domai...    223   4e-66   
ref|XP_009356334.1|  PREDICTED: uncharacterized protein At1g04910       223   4e-66   Pyrus x bretschneideri [bai li]
gb|AAD39288.1|AC007576_11  Similar to auxin-independent growth pr...    223   6e-66   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172855.2|  O-fucosyltransferase family protein                   222   6e-66   Arabidopsis thaliana [mouse-ear cress]
gb|AAF79406.1|AC068197_16  F16A14.24                                    223   6e-66   Arabidopsis thaliana [mouse-ear cress]
gb|AAL84301.1|AC073556_18  putative auxin independent growth-rela...    221   6e-66   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74596.1|  hypothetical protein OsI_10181                          221   7e-66   Oryza sativa Indica Group [Indian rice]
ref|NP_001049097.2|  Os03g0169000                                       221   8e-66   
ref|XP_006307301.1|  hypothetical protein CARUB_v10008919mg             221   1e-65   Capsella rubella
ref|XP_008446397.1|  PREDICTED: uncharacterized protein At1g04910       221   1e-65   Cucumis melo [Oriental melon]
gb|KFK43647.1|  hypothetical protein AALP_AA1G154300                    221   1e-65   Arabis alpina [alpine rockcress]
ref|XP_002988617.1|  hypothetical protein SELMODRAFT_235569             218   2e-65   Selaginella moellendorffii
ref|XP_011072875.1|  PREDICTED: uncharacterized protein At1g04910...    221   2e-65   Sesamum indicum [beniseed]
gb|EEE58399.1|  hypothetical protein OsJ_09568                          222   2e-65   
ref|XP_007046006.1|  O-fucosyltransferase family protein isoform 1      221   2e-65   
ref|XP_004297281.1|  PREDICTED: uncharacterized protein At1g04910       221   3e-65   
gb|EEE53940.1|  hypothetical protein OsJ_00527                          226   3e-65   
gb|EYU28797.1|  hypothetical protein MIMGU_mgv1a005013mg                220   3e-65   
gb|EEE69901.1|  hypothetical protein OsJ_29739                          219   3e-65   
emb|CDY36425.1|  BnaC05g10260D                                          219   4e-65   
ref|XP_010495720.1|  PREDICTED: uncharacterized protein At1g04910...    220   4e-65   
ref|XP_002876872.1|  predicted protein                                  220   4e-65   
gb|KJB30422.1|  hypothetical protein B456_005G142700                    217   5e-65   
gb|AAD17446.1|  similar to axi 1 protein from Nicotiana tabacum         219   5e-65   
gb|EYU28894.1|  hypothetical protein MIMGU_mgv1a005854mg                219   6e-65   
ref|NP_178427.2|  O-fucosyltransferase-like protein                     219   6e-65   
gb|AAO22658.1|  putative axi 1 protein                                  219   6e-65   
ref|XP_010476436.1|  PREDICTED: uncharacterized protein At1g04910...    220   7e-65   
ref|XP_010458874.1|  PREDICTED: uncharacterized protein At1g04910       219   7e-65   
gb|KEH30793.1|  O-fucosyltransferase family protein                     219   8e-65   
gb|KJB50625.1|  hypothetical protein B456_008G179400                    216   8e-65   
gb|KJB50626.1|  hypothetical protein B456_008G179400                    216   1e-64   
ref|NP_001030963.1|  O-fucosyltransferase-like protein                  219   1e-64   
gb|AAT68344.1|  hypothetical protein At2g03280                          219   1e-64   
ref|XP_003613885.1|  DUF246 domain-containing protein                   218   2e-64   
ref|XP_010425111.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    219   2e-64   
ref|XP_002979307.1|  hypothetical protein SELMODRAFT_110454             218   2e-64   
ref|XP_008361777.1|  PREDICTED: uncharacterized protein At1g04910...    218   3e-64   
ref|XP_003529471.1|  PREDICTED: uncharacterized protein At1g04910...    218   3e-64   
ref|XP_006649466.1|  PREDICTED: uncharacterized protein At1g04910...    217   3e-64   
ref|XP_006395723.1|  hypothetical protein EUTSA_v10004114mg             217   4e-64   
ref|XP_004228834.1|  PREDICTED: uncharacterized protein At1g04910...    217   4e-64   
gb|KJB30421.1|  hypothetical protein B456_005G142700                    217   6e-64   
ref|XP_004985558.1|  PREDICTED: uncharacterized protein At1g04910...    216   6e-64   
gb|KJB50624.1|  hypothetical protein B456_008G179400                    216   1e-63   
gb|KJB50621.1|  hypothetical protein B456_008G179400                    216   2e-63   
emb|CDY64492.1|  BnaC09g52330D                                          215   2e-63   
gb|KHN01984.1|  DUF246 domain-containing protein                        214   2e-63   
ref|XP_007045742.1|  O-fucosyltransferase family protein                216   2e-63   
gb|KJB50622.1|  hypothetical protein B456_008G179400                    216   3e-63   
ref|XP_007158635.1|  hypothetical protein PHAVU_002G169300g             215   4e-63   
ref|XP_003516276.1|  PREDICTED: uncharacterized protein At1g04910...    214   6e-63   
ref|XP_002465794.1|  hypothetical protein SORBIDRAFT_01g045900          213   7e-63   
gb|EMT15947.1|  hypothetical protein F775_17480                         214   7e-63   
ref|XP_010258363.1|  PREDICTED: uncharacterized protein At1g04910       214   7e-63   
ref|XP_006365303.1|  PREDICTED: uncharacterized protein At1g04910...    214   7e-63   
ref|XP_008782753.1|  PREDICTED: uncharacterized protein At1g04910...    214   9e-63   
ref|XP_003520091.1|  PREDICTED: uncharacterized protein At1g04910...    214   1e-62   
ref|XP_009356550.1|  PREDICTED: uncharacterized protein At1g04910...    214   1e-62   
ref|XP_008651454.1|  PREDICTED: uncharacterized protein At1g04910...    213   1e-62   
gb|KCW84057.1|  hypothetical protein EUGRSUZ_B00940                     208   2e-62   
gb|EMS59853.1|  hypothetical protein TRIUR3_10817                       216   2e-62   
gb|EPS65549.1|  hypothetical protein M569_09227                         209   2e-62   
gb|AFW89556.1|  hypothetical protein ZEAMMB73_067806                    211   4e-62   
ref|XP_007157709.1|  hypothetical protein PHAVU_002G091700g             212   6e-62   
dbj|BAJ88822.1|  predicted protein                                      211   7e-62   
ref|XP_010045747.1|  PREDICTED: uncharacterized protein At1g04910...    207   8e-62   
ref|XP_008660503.1|  PREDICTED: uncharacterized protein At1g04910       210   9e-62   
ref|XP_007045740.1|  O-fucosyltransferase family protein                211   1e-61   
ref|XP_009114162.1|  PREDICTED: uncharacterized protein At1g04910...    209   3e-61   
gb|EEC75173.1|  hypothetical protein OsI_11400                          208   1e-60   
ref|XP_010066883.1|  PREDICTED: uncharacterized protein At1g04910...    208   2e-60   
gb|AAN65001.1|  Putative growth regulator protein                       207   3e-60   
ref|NP_001049999.1|  Os03g0328100                                       207   4e-60   
gb|EAZ27289.1|  hypothetical protein OsJ_11228                          207   4e-60   
dbj|BAJ93464.1|  predicted protein                                      206   5e-60   
ref|XP_008660796.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    204   3e-59   
ref|XP_004984508.1|  PREDICTED: uncharacterized protein At1g04910...    204   4e-59   
ref|XP_001781998.1|  predicted protein                                  201   8e-59   
ref|XP_008655269.1|  PREDICTED: uncharacterized protein At1g04910...    203   1e-58   
ref|XP_006650024.1|  PREDICTED: uncharacterized protein At1g04910...    202   2e-58   
ref|XP_002465327.1|  hypothetical protein SORBIDRAFT_01g036540          202   2e-58   
ref|XP_010066882.1|  PREDICTED: uncharacterized protein At1g04910...    201   7e-58   
dbj|BAB39917.1|  P0028E10.21                                            196   4e-56   
ref|NP_001042131.2|  Os01g0168600                                       195   4e-56   
dbj|BAD68312.1|  putative axi 1                                         196   8e-56   
ref|XP_010321652.1|  PREDICTED: uncharacterized protein At1g04910...    196   9e-56   
ref|XP_008800521.1|  PREDICTED: uncharacterized protein At1g04910...    184   1e-54   
emb|CDY43246.1|  BnaC05g48390D                                          172   2e-50   
gb|KCW84184.1|  hypothetical protein EUGRSUZ_B01050                     171   1e-48   
ref|XP_002969822.1|  hypothetical protein SELMODRAFT_231467             172   7e-48   
ref|XP_002985158.1|  hypothetical protein SELMODRAFT_234721             172   8e-48   
gb|KCW84172.1|  hypothetical protein EUGRSUZ_B01035                     169   1e-47   
gb|KCW75161.1|  hypothetical protein EUGRSUZ_E03910                     166   5e-46   
ref|XP_011097054.1|  PREDICTED: uncharacterized protein At1g04910...    168   1e-45   
ref|XP_011097053.1|  PREDICTED: uncharacterized protein At1g04910...    168   1e-45   
gb|EYU22398.1|  hypothetical protein MIMGU_mgv1a019313mg                167   2e-45   
ref|XP_002974087.1|  hypothetical protein SELMODRAFT_442298             167   1e-44   
gb|KCW49019.1|  hypothetical protein EUGRSUZ_K02630                     165   1e-44   
ref|XP_002517241.1|  conserved hypothetical protein                     163   2e-44   
ref|XP_010045788.1|  PREDICTED: uncharacterized protein At1g04910...    161   6e-44   
ref|XP_006351036.1|  PREDICTED: uncharacterized protein At1g04910...    164   7e-44   
ref|XP_009588701.1|  PREDICTED: uncharacterized protein At1g04910...    163   9e-44   
ref|XP_004249900.1|  PREDICTED: uncharacterized protein At1g04910       163   1e-43   
ref|XP_011074208.1|  PREDICTED: uncharacterized protein At1g04910       162   3e-43   
gb|EYU18045.1|  hypothetical protein MIMGU_mgv1a006471mg                160   5e-43   
ref|XP_011009571.1|  PREDICTED: uncharacterized protein At1g04910...    160   5e-43   
ref|XP_008805903.1|  PREDICTED: uncharacterized protein At1g04910...    159   1e-42   
gb|KDP42616.1|  hypothetical protein JCGZ_24390                         160   2e-42   
ref|XP_011009570.1|  PREDICTED: uncharacterized protein At1g04910...    160   2e-42   
ref|XP_002306564.2|  hypothetical protein POPTR_0005s17360g             160   2e-42   
ref|XP_007048356.1|  O-fucosyltransferase family protein isoform 2      160   2e-42   
ref|XP_010093500.1|  hypothetical protein L484_001877                   160   3e-42   
ref|XP_010534148.1|  PREDICTED: uncharacterized protein At1g04910...    153   3e-42   
ref|XP_007048355.1|  O-fucosyltransferase family protein isoform 1      159   3e-42   
gb|KHN25054.1|  DUF246 domain-containing protein                        151   3e-42   
ref|XP_008805902.1|  PREDICTED: uncharacterized protein At1g04910...    159   4e-42   
ref|XP_008805901.1|  PREDICTED: uncharacterized protein At1g04910...    159   4e-42   
ref|XP_009789435.1|  PREDICTED: uncharacterized protein At1g04910...    159   4e-42   
gb|KJB39617.1|  hypothetical protein B456_007G021900                    159   4e-42   
gb|KJB39616.1|  hypothetical protein B456_007G021900                    159   4e-42   
ref|XP_001765585.1|  predicted protein                                  159   4e-42   
ref|XP_009789434.1|  PREDICTED: uncharacterized protein At1g04910...    159   4e-42   
ref|XP_010664349.1|  PREDICTED: uncharacterized protein At1g04910       159   5e-42   
gb|KJB39614.1|  hypothetical protein B456_007G021900                    159   5e-42   
emb|CDX81230.1|  BnaC09g06410D                                          158   7e-42   
gb|AAL77666.1|  AT5g64600/MUB3_12                                       156   7e-42   
ref|XP_002527876.1|  conserved hypothetical protein                     159   9e-42   
emb|CDY18704.1|  BnaA09g06910D                                          158   1e-41   
ref|XP_002513963.1|  conserved hypothetical protein                     158   1e-41   
ref|XP_009112144.1|  PREDICTED: uncharacterized protein At1g04910       158   1e-41   
ref|XP_004490941.1|  PREDICTED: uncharacterized protein At1g04910...    156   1e-41   
ref|XP_010267002.1|  PREDICTED: uncharacterized protein At1g04910...    157   2e-41   
ref|XP_002864909.1|  hypothetical protein ARALYDRAFT_496672             157   2e-41   
ref|XP_002893230.1|  hypothetical protein ARALYDRAFT_472486             157   2e-41   
ref|XP_006827996.1|  hypothetical protein AMTR_s00008p00236930          157   3e-41   
ref|XP_010926335.1|  PREDICTED: uncharacterized protein At1g04910...    157   3e-41   
ref|XP_004502925.1|  PREDICTED: uncharacterized protein At1g04910...    157   3e-41   
ref|XP_010926334.1|  PREDICTED: uncharacterized protein At1g04910...    157   3e-41   
ref|XP_009345613.1|  PREDICTED: uncharacterized protein At1g04910...    157   4e-41   
ref|XP_010027681.1|  PREDICTED: uncharacterized protein At1g04910...    156   4e-41   
ref|XP_006433927.1|  hypothetical protein CICLE_v10000706mg             156   5e-41   
ref|XP_004237944.1|  PREDICTED: uncharacterized protein At1g04910       156   5e-41   
ref|XP_010027680.1|  PREDICTED: uncharacterized protein At1g04910...    156   5e-41   
ref|XP_010444397.1|  PREDICTED: uncharacterized protein At1g04910...    154   5e-41   
ref|XP_008383079.1|  PREDICTED: uncharacterized protein At1g04910...    156   5e-41   
ref|XP_010262721.1|  PREDICTED: uncharacterized protein At1g04910...    157   6e-41   
ref|XP_006363293.1|  PREDICTED: uncharacterized protein At1g04910...    156   6e-41   
ref|XP_006280272.1|  hypothetical protein CARUB_v10026194mg             156   6e-41   
ref|XP_004490940.1|  PREDICTED: uncharacterized protein At1g04910...    156   6e-41   
ref|XP_009145339.1|  PREDICTED: uncharacterized protein At1g04910       156   6e-41   
ref|NP_201265.3|  O-fucosyltransferase family protein                   155   7e-41   
ref|XP_006433926.1|  hypothetical protein CICLE_v10000706mg             156   8e-41   
ref|XP_006416197.1|  hypothetical protein EUTSA_v10007232mg             156   8e-41   
dbj|BAB11427.1|  auxin-independent growth promoter-like protein         155   8e-41   
ref|XP_010477505.1|  PREDICTED: uncharacterized protein At1g04910       155   9e-41   
ref|XP_008219343.1|  PREDICTED: uncharacterized protein At1g04910...    155   1e-40   
dbj|BAJ88932.1|  predicted protein                                      150   1e-40   
ref|XP_006664407.1|  PREDICTED: uncharacterized protein At1g04910...    154   1e-40   
ref|XP_007221810.1|  hypothetical protein PRUPE_ppa004094mg             155   1e-40   
gb|EPS70690.1|  hypothetical protein M569_04066                         155   1e-40   
ref|XP_011464606.1|  PREDICTED: uncharacterized protein At1g04910...    155   1e-40   
ref|XP_009379875.1|  PREDICTED: uncharacterized protein At1g04910...    153   1e-40   
ref|XP_011032328.1|  PREDICTED: uncharacterized protein At1g04910...    153   1e-40   
ref|XP_010520421.1|  PREDICTED: uncharacterized protein At1g04910...    153   1e-40   
ref|XP_004299674.1|  PREDICTED: uncharacterized protein At1g04910...    155   1e-40   
gb|AES72844.2|  O-fucosyltransferase family protein                     155   2e-40   
ref|XP_001765567.1|  predicted protein                                  153   2e-40   
gb|KHG20341.1|  hypothetical protein F383_05466                         155   2e-40   
ref|XP_010460001.1|  PREDICTED: uncharacterized protein At1g04910...    155   2e-40   
ref|XP_010460000.1|  PREDICTED: uncharacterized protein At1g04910...    155   2e-40   
gb|KFK28149.1|  hypothetical protein AALP_AA8G479000                    154   2e-40   
gb|KFK28150.1|  hypothetical protein AALP_AA8G479000                    154   2e-40   
ref|XP_010270432.1|  PREDICTED: uncharacterized protein At1g04910       154   2e-40   
ref|XP_010535322.1|  PREDICTED: uncharacterized protein At1g04910...    153   2e-40   
gb|KJB76860.1|  hypothetical protein B456_012G110800                    155   2e-40   
ref|XP_010498715.1|  PREDICTED: uncharacterized protein At1g04910...    153   3e-40   
gb|ABR17811.1|  unknown                                                 155   3e-40   
emb|CDY04814.1|  BnaC05g17750D                                          154   3e-40   
gb|KDP24505.1|  hypothetical protein JCGZ_25069                         155   3e-40   
ref|XP_010543246.1|  PREDICTED: uncharacterized protein At1g04910...    154   3e-40   
ref|XP_007137714.1|  hypothetical protein PHAVU_009G149700g             154   3e-40   
ref|XP_006394134.1|  hypothetical protein EUTSA_v10004008mg             154   4e-40   
ref|XP_010484244.1|  PREDICTED: uncharacterized protein At1g04910...    154   4e-40   
gb|EEE52890.1|  hypothetical protein OsJ_35473                          153   4e-40   
gb|KJB59907.1|  hypothetical protein B456_009G280200                    152   4e-40   
ref|XP_006472560.1|  PREDICTED: uncharacterized protein At1g04910...    154   4e-40   
emb|CDP01105.1|  unnamed protein product                                154   4e-40   
ref|XP_006472559.1|  PREDICTED: uncharacterized protein At1g04910...    154   4e-40   
ref|XP_010444396.1|  PREDICTED: uncharacterized protein At1g04910...    153   5e-40   
ref|NP_001066339.1|  Os12g0190100                                       153   5e-40   
emb|CBI31549.3|  unnamed protein product                                152   5e-40   
ref|XP_009379874.1|  PREDICTED: uncharacterized protein At1g04910...    153   5e-40   
ref|XP_009379872.1|  PREDICTED: uncharacterized protein At1g04910...    153   5e-40   
ref|XP_008782174.1|  PREDICTED: uncharacterized protein At1g04910...    153   6e-40   
ref|XP_010025951.1|  PREDICTED: uncharacterized protein At1g04910...    153   6e-40   
ref|XP_010535312.1|  PREDICTED: uncharacterized protein At1g04910...    153   6e-40   
ref|XP_006382852.1|  hypothetical protein POPTR_0005s06100g             153   6e-40   
ref|XP_010520413.1|  PREDICTED: uncharacterized protein At1g04910...    153   6e-40   
gb|KHN26223.1|  DUF246 domain-containing protein                        153   7e-40   
ref|XP_010025946.1|  PREDICTED: uncharacterized protein At1g04910...    153   7e-40   
emb|CBI30445.3|  unnamed protein product                                153   8e-40   
ref|XP_010553068.1|  PREDICTED: uncharacterized protein At1g04910...    154   8e-40   
ref|XP_010025942.1|  PREDICTED: uncharacterized protein At1g04910...    153   8e-40   
ref|XP_010675873.1|  PREDICTED: uncharacterized protein At1g04910       153   8e-40   
gb|EEC68978.1|  hypothetical protein OsI_37727                          152   9e-40   
ref|XP_010498714.1|  PREDICTED: uncharacterized protein At1g04910...    153   9e-40   
emb|CBI19199.3|  unnamed protein product                                153   9e-40   
gb|KDO58328.1|  hypothetical protein CISIN_1g043543mg                   150   9e-40   
ref|NP_173662.2|  O-fucosyltransferase family protein                   153   9e-40   
ref|XP_010256723.1|  PREDICTED: uncharacterized protein At1g04910...    153   9e-40   
ref|XP_010060050.1|  PREDICTED: uncharacterized protein At1g04910...    153   9e-40   
ref|XP_010039975.1|  PREDICTED: uncharacterized protein At1g04910...    149   1e-39   
ref|XP_009358826.1|  PREDICTED: uncharacterized protein At1g04910...    153   1e-39   
ref|XP_003516326.1|  PREDICTED: uncharacterized protein At1g04910...    153   1e-39   
gb|AAF18531.1|AC006551_17  Similar to auxin-independent growth pr...    153   1e-39   
ref|XP_011032327.1|  PREDICTED: uncharacterized protein At1g04910...    152   1e-39   
ref|XP_006581764.1|  PREDICTED: uncharacterized protein At1g04910...    150   1e-39   
ref|XP_010658485.1|  PREDICTED: uncharacterized protein At1g04910...    152   1e-39   
ref|XP_004288336.1|  PREDICTED: uncharacterized protein At1g04910...    152   1e-39   
ref|XP_009348039.1|  PREDICTED: uncharacterized protein At1g04910...    152   1e-39   
ref|XP_009777243.1|  PREDICTED: uncharacterized protein At1g04910...    152   1e-39   
ref|XP_009777248.1|  PREDICTED: uncharacterized protein At1g04910...    152   1e-39   
gb|KFK36698.1|  hypothetical protein AALP_AA4G157600                    153   1e-39   
ref|XP_010484245.1|  PREDICTED: uncharacterized protein At1g04910...    152   1e-39   
ref|XP_002277149.2|  PREDICTED: uncharacterized protein At1g04910       152   1e-39   
ref|XP_009417593.1|  PREDICTED: uncharacterized protein At1g04910...    152   1e-39   
ref|XP_007141214.1|  hypothetical protein PHAVU_008G176800g             152   2e-39   
gb|KJB59905.1|  hypothetical protein B456_009G280200                    152   2e-39   
ref|XP_009373119.1|  PREDICTED: uncharacterized protein At1g04910...    152   2e-39   
gb|EMT01229.1|  hypothetical protein F775_05435                         150   2e-39   
gb|KJB59906.1|  hypothetical protein B456_009G280200                    152   2e-39   
ref|XP_006306504.1|  hypothetical protein CARUB_v10012492mg             152   2e-39   
ref|XP_009632008.1|  PREDICTED: uncharacterized protein At1g04910...    151   2e-39   



>ref|XP_011021095.1| PREDICTED: uncharacterized protein At1g04910 [Populus euphratica]
Length=504

 Score =   277 bits (709),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALGIDRN QIYIAAGEIYGG+RR++ L++AFPN+V+KE LLGPS LKFFQ
Sbjct  327  TPEETALVLSALGIDRNVQIYIAAGEIYGGKRRMKALASAFPNLVRKETLLGPSDLKFFQ  386

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KTI LDRK++V L DQYN
Sbjct  387  NHSSQMAALDYLVSLESDIFVPTYNGNMAKVVEGHRRFLGFKKTISLDRKLLVGLIDQYN  446

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G+++WD FS+++KE H +RMG PKTR+VI +KPKEED FYANPQEC
Sbjct  447  KGSLSWDEFSSTVKEAHADRMGSPKTRVVIPDKPKEEDYFYANPQEC  493



>ref|XP_006373415.1| hypothetical protein POPTR_0017s13570g [Populus trichocarpa]
 gb|ERP51212.1| hypothetical protein POPTR_0017s13570g [Populus trichocarpa]
Length=501

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALGIDRN QIY+AAGEIYGG+RR+  L++AFPN+V+KE LLGPS LKFFQ
Sbjct  324  TPEETALVLSALGIDRNVQIYVAAGEIYGGKRRMEALASAFPNLVRKETLLGPSDLKFFQ  383

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KTI LDRK++V L DQYN
Sbjct  384  NHSSQMAALDYLVSLESDIFVPTYNGNMAKVVEGHRRFLGFKKTISLDRKLLVGLIDQYN  443

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G+++WD FS+++KE H +RMG PK R+VI +KPKEED FYANPQEC
Sbjct  444  KGSLSWDEFSSTVKEAHADRMGSPKARVVIPDKPKEEDYFYANPQEC  490



>ref|XP_010999426.1| PREDICTED: uncharacterized protein At1g04910-like [Populus euphratica]
Length=504

 Score =   271 bits (694),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALGIDRN QIYIAAGEIYGGERR++ L  AFPN+V+KE+LL PS LKFFQ
Sbjct  327  TPEETALVLTALGIDRNVQIYIAAGEIYGGERRMKTLMEAFPNLVRKEDLLEPSDLKFFQ  386

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KT LLDRK++V L D+YN
Sbjct  387  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGFKKTTLLDRKLLVGLIDEYN  446

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++ WD FS+++KETH +RMG PK R+VI +KPK+ED FYANPQEC
Sbjct  447  KGSLCWDEFSSTVKETHADRMGSPKMRVVIPDKPKDEDYFYANPQEC  493



>ref|XP_006384269.1| hypothetical protein POPTR_0004s11220g [Populus trichocarpa]
 gb|ERP62066.1| hypothetical protein POPTR_0004s11220g [Populus trichocarpa]
Length=504

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALGIDRN QIYIAAGEIYGGERR++ L  AFPN+V+KE+LL PS LKFFQ
Sbjct  327  TPEETALVLTALGIDRNVQIYIAAGEIYGGERRMKTLMEAFPNLVRKEDLLEPSDLKFFQ  386

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KT LLDRK++V L D+YN
Sbjct  387  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGFKKTSLLDRKLLVGLIDEYN  446

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G+++WD FS+++KETH +RMG PK R+VI +KPK+ED FYANPQEC
Sbjct  447  KGSLSWDEFSSTVKETHADRMGSPKRRVVIPDKPKDEDYFYANPQEC  493



>ref|XP_010101636.1| hypothetical protein L484_016665 [Morus notabilis]
 gb|EXB89105.1| hypothetical protein L484_016665 [Morus notabilis]
Length=518

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+ALGIDRN QIYIAAGEIYGGERR+ +L+ ++P +V+KE LL PS L+FFQ
Sbjct  335  TPEETALTLRALGIDRNIQIYIAAGEIYGGERRMSSLALSYPKLVRKETLLDPSDLRFFQ  394

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KTILLDRK+IV L DQY+
Sbjct  395  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGFKKTILLDRKLIVDLIDQYS  454

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G++ WD FS+++KETH +RMG P  RLVI ++PKEED FYANP+EC
Sbjct  455  SGSLNWDEFSSAVKETHADRMGNPTKRLVIPDRPKEEDYFYANPEEC  501



>gb|EYU44245.1| hypothetical protein MIMGU_mgv1a004661mg [Erythranthe guttata]
Length=516

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALGID+N QIYIAAGEIYGGERRLR+LS  FPN+VKKE LL PS L FF+
Sbjct  339  TPEETALVLTALGIDKNVQIYIAAGEIYGGERRLRSLSKVFPNLVKKETLLEPSDLMFFR  398

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVS+ESDIFVPTY GNMA+VVEGHRRYLGF+KTI+LDR+V+V L D+Y+
Sbjct  399  NHSSQMAALDYLVSMESDIFVPTYDGNMAKVVEGHRRYLGFKKTIVLDRRVLVGLIDEYS  458

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYS  508
             G+++W+ FS+S+KE H NRMG PK R+VI++KPKEED FY+NPQEC++
Sbjct  459  DGSLSWNEFSSSVKEAHANRMGSPKNRVVISDKPKEEDYFYSNPQECFA  507



>ref|XP_010549977.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Tarenaya 
hassleriana]
 gb|ABD96844.1| hypothetical protein [Cleome spinosa]
Length=514

 Score =   270 bits (691),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALGIDRN QIYIAAGEIYGGERR++ L+ AFPN+V+KE LL PS LKFFQ
Sbjct  331  TPEETALALNALGIDRNVQIYIAAGEIYGGERRMKALAEAFPNVVRKETLLEPSDLKFFQ  390

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KTILLDRK++V+L DQY 
Sbjct  391  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGFKKTILLDRKLLVNLIDQYT  450

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++WD FS+++KE H +RMG PK RLVI +KPKEED FYANP EC
Sbjct  451  EGLLSWDEFSSTVKEVHEDRMGSPKKRLVIPDKPKEEDYFYANPHEC  497



>ref|XP_009391772.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=512

 Score =   270 bits (689),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 144/170 (85%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEET L L+AL +DR+ QIYIAAGEIYGGERR+  LSA +P +VKKE LLGPS L++FQ
Sbjct  336  TPEETTLVLRALDVDRSIQIYIAAGEIYGGERRMTALSATYPKVVKKETLLGPSDLRYFQ  395

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLGFRKTILLDRK++V L DQYN
Sbjct  396  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGFRKTILLDRKLLVDLIDQYN  455

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYSH  511
             G ++WD FS+S+KETH NRMG P  R++I +KPKEED FYANP+EC+  
Sbjct  456  NGTLSWDEFSSSVKETHANRMGNPVRRVMIPDKPKEEDYFYANPEECFPQ  505



>ref|XP_010525131.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Tarenaya 
hassleriana]
 gb|ABD96934.1| hypothetical protein [Cleome spinosa]
Length=509

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALGID+N QIYIAAGEIYGGERR++ L+ AFPN+V+KE LL PS LKFFQ
Sbjct  332  TPEETALALTALGIDQNVQIYIAAGEIYGGERRMKALTEAFPNVVRKETLLEPSDLKFFQ  391

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KTI+LDRK++V+L DQY 
Sbjct  392  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGFKKTIILDRKLLVNLIDQYK  451

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++WD FS+++KE H +RMG PK RLVIT+KPKEED FY+NP EC
Sbjct  452  EGLLSWDEFSSTVKEVHEDRMGSPKKRLVITDKPKEEDYFYSNPHEC  498



>gb|KJB10522.1| hypothetical protein B456_001G206300 [Gossypium raimondii]
Length=396

 Score =   263 bits (672),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+ALGIDRN QIYIAAGEIYGGERR+  L+ AFPN+V+KE LL  S LKFFQ
Sbjct  221  TPEETALVLRALGIDRNVQIYIAAGEIYGGERRMAPLAEAFPNLVRKETLLVRSDLKFFQ  280

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KTILLDRK++V L D+Y 
Sbjct  281  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGFKKTILLDRKLLVKLIDEYQ  340

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G+++WD FS ++KE H +RMG PK R+VI ++PKEED FY+NP EC
Sbjct  341  SGSLSWDEFSETVKEVHSDRMGNPKKRVVIPDRPKEEDYFYSNPHEC  387



>ref|XP_010549974.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010549975.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010549976.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Tarenaya 
hassleriana]
Length=515

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNM-VKKENLLGPSALKFF  178
            TPEETAL L ALGIDRN QIYIAAGEIYGGERR++ L+ AFPN+ V+KE LL PS LKFF
Sbjct  331  TPEETALALNALGIDRNVQIYIAAGEIYGGERRMKALAEAFPNVQVRKETLLEPSDLKFF  390

Query  179  QGHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQY  358
            Q H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KTILLDRK++V+L DQY
Sbjct  391  QNHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGFKKTILLDRKLLVNLIDQY  450

Query  359  NAGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
              G ++WD FS+++KE H +RMG PK RLVI +KPKEED FYANP EC
Sbjct  451  TEGLLSWDEFSSTVKEVHEDRMGSPKKRLVIPDKPKEEDYFYANPHEC  498



>ref|XP_009757587.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=519

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL ID + Q+YIAAGEIYGG+RR+ +L+AA+PN+V+KE LL PS L FFQ
Sbjct  339  TPEETALTLRALDIDPSIQVYIAAGEIYGGKRRMASLTAAYPNLVRKETLLEPSDLMFFQ  398

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLG+RKTILLDRK++V L DQ+N
Sbjct  399  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGYRKTILLDRKLLVDLIDQHN  458

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            AG++TWD FSNS+KE H  RMG P  RLVI ++PKEED FY+NP EC
Sbjct  459  AGSLTWDEFSNSVKEAHAERMGNPTKRLVIPDRPKEEDYFYSNPWEC  505



>ref|XP_009611732.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
tomentosiformis]
Length=519

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL ID + Q+YIAAGEIYGG+RR+ +L+AA+PN+V+KE LL PS L FFQ
Sbjct  339  TPEETALTLRALDIDPSIQVYIAAGEIYGGKRRMASLTAAYPNLVRKETLLEPSDLMFFQ  398

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLG+RKTILLDRK++V L DQ+N
Sbjct  399  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGYRKTILLDRKLLVDLIDQHN  458

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            AG++TWD FSNS+KE H  RMG P  RLVI ++PKEED FY+NP EC
Sbjct  459  AGSLTWDEFSNSVKEAHAERMGNPMKRLVIPDRPKEEDYFYSNPWEC  505



>ref|XP_011099050.1| PREDICTED: uncharacterized protein At1g04910 [Sesamum indicum]
Length=505

 Score =   265 bits (677),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALGID + QIYIAAGEIYGG+RRLR+L+ AFPN+VKKE LL PS L FF+
Sbjct  338  TPEETALVLSALGIDSHIQIYIAAGEIYGGKRRLRSLAKAFPNLVKKETLLEPSDLLFFR  397

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLGF+KTILLDR+V++ L DQYN
Sbjct  398  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGFKKTILLDRRVLIDLIDQYN  457

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G+++WD FS S+K+ H +RMG P+ R++I ++PKEED FY+NPQEC
Sbjct  458  SGSLSWDEFSYSVKDAHADRMGSPRKRVMIPDRPKEEDYFYSNPQEC  504



>ref|XP_010257917.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Nelumbo nucifera]
Length=398

 Score =   261 bits (668),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 142/170 (84%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL LKAL IDRNFQI+IAAGEIYGG++R+ +L+ A+PN+V+KE LL P  L+FFQ
Sbjct  221  TPEETALVLKALDIDRNFQIFIAAGEIYGGQKRMESLAEAYPNLVRKETLLEPPDLRFFQ  280

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIF+PTY GNMA+VVEGHRR+LGF+KTILLDRK++V L DQYN
Sbjct  281  NHSSQMAALDYLVSLESDIFIPTYDGNMAKVVEGHRRFLGFKKTILLDRKLLVDLIDQYN  340

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYSH  511
             G + W+ FS  +KE H NRMG P  R+VI ++PKEED FYANPQEC  H
Sbjct  341  DGLLDWNKFSFLVKEAHENRMGSPTRRVVIPDRPKEEDYFYANPQECLGH  390



>ref|XP_007032894.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOY03820.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
Length=511

 Score =   265 bits (676),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL LKALGIDRN QIY AAGEIYGGERR+  ++ AFPN+V+KE LLGPS LKFFQ
Sbjct  334  TPEETALVLKALGIDRNVQIYTAAGEIYGGERRMAPMAEAFPNLVRKETLLGPSDLKFFQ  393

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KTILL+RK++V+L DQY 
Sbjct  394  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGFKKTILLERKLLVNLIDQYQ  453

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G+++WD FS+++KE H +RMG PK R V+ ++PKEED FY+NP EC
Sbjct  454  NGSLSWDEFSSTVKEAHADRMGSPKKRNVLPDRPKEEDYFYSNPHEC  500



>emb|CDO98540.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   265 bits (676),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL ID N QIYIAAGEIYGGERRL +L+AA+PN+V+KE LL PS L+FFQ
Sbjct  332  TPEETALTLRALDIDHNIQIYIAAGEIYGGERRLASLAAAYPNLVRKETLLDPSDLRFFQ  391

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYL ++KTILLDRK++V L DQYN
Sbjct  392  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLEYKKTILLDRKLLVDLIDQYN  451

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++TWD FS ++KE+H  RMG P  R+VI ++PKEED FYANP EC
Sbjct  452  MGSLTWDEFSAAVKESHSERMGNPVKRVVIPDRPKEEDYFYANPWEC  498



>gb|KHN46676.1| DUF246 domain-containing protein [Glycine soja]
Length=488

 Score =   263 bits (673),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALGIDRN QIYIA+GEIYGGE+R+ +L   FPN+++KE LLGPS L +FQ
Sbjct  311  TPEETALVLSALGIDRNVQIYIASGEIYGGEKRMASLLGEFPNLIRKETLLGPSELMYFQ  370

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAA+DYLVSLESDIF+PTY GNMA+VVEGHRR+LGF+KTILLDR+++VHL DQY 
Sbjct  371  NHSSQMAAVDYLVSLESDIFIPTYDGNMAKVVEGHRRFLGFKKTILLDRRLLVHLIDQYY  430

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++WD FS +MKE H  RMG PK R++I +KPKEED FYANPQEC
Sbjct  431  NGLLSWDEFSTAMKEAHAYRMGSPKRRVIIPDKPKEEDYFYANPQEC  477



>ref|XP_010525130.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Tarenaya 
hassleriana]
Length=510

 Score =   264 bits (674),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNM-VKKENLLGPSALKFF  178
            TPEETAL L ALGID+N QIYIAAGEIYGGERR++ L+ AFPN+ V+KE LL PS LKFF
Sbjct  332  TPEETALALTALGIDQNVQIYIAAGEIYGGERRMKALTEAFPNVQVRKETLLEPSDLKFF  391

Query  179  QGHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQY  358
            Q H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KTI+LDRK++V+L DQY
Sbjct  392  QNHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGFKKTIILDRKLLVNLIDQY  451

Query  359  NAGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
              G ++WD FS+++KE H +RMG PK RLVIT+KPKEED FY+NP EC
Sbjct  452  KEGLLSWDEFSSTVKEVHEDRMGSPKKRLVITDKPKEEDYFYSNPHEC  499



>ref|XP_010099296.1| hypothetical protein L484_018158 [Morus notabilis]
 gb|EXB77642.1| hypothetical protein L484_018158 [Morus notabilis]
Length=514

 Score =   264 bits (674),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL LKALGIDRN QIYIAAGEIYGG+RR+ +L AAFPN+V+KE LL PS L+FFQ
Sbjct  335  TPEETALVLKALGIDRNVQIYIAAGEIYGGKRRMESLVAAFPNLVRKETLLEPSDLRFFQ  394

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF++TILLDR++++ L DQYN
Sbjct  395  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGFKRTILLDRRLLIGLIDQYN  454

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYSHI  514
             G+++WD FS ++K++H +RMG P  R+VI ++PKEED FY+NPQEC   I
Sbjct  455  NGSLSWDDFSFTIKKSHADRMGNPIKRVVIPDRPKEEDYFYSNPQECLQLI  505



>gb|KDP24328.1| hypothetical protein JCGZ_25624 [Jatropha curcas]
Length=501

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALGID N QIYIAAGEIYGGE+R++ L+A FPN+V+KE LL  S LKFFQ
Sbjct  324  TPEETALVLSALGIDHNIQIYIAAGEIYGGEKRMKTLAATFPNVVRKETLLESSDLKFFQ  383

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLE DIFVPTY GNMA+VVEGHRR+LGF+KTI LDRK++V L DQYN
Sbjct  384  NHSSQMAALDYLVSLEGDIFVPTYDGNMAKVVEGHRRFLGFKKTISLDRKLLVGLIDQYN  443

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G+++WD FS ++K+ H +RMG PKTR+VI +KPKEED FYANP EC
Sbjct  444  KGSLSWDEFSTTLKQVHADRMGNPKTRVVIPDKPKEEDYFYANPHEC  490



>ref|XP_006844075.1| hypothetical protein AMTR_s00006p00250170 [Amborella trichopoda]
 gb|ERN05750.1| hypothetical protein AMTR_s00006p00250170 [Amborella trichopoda]
Length=493

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE AL L+AL  DRN +IYIAAGEIYGG++R+ +LS A+PN+V+KE LL PS L+ FQ
Sbjct  317  TPEEIALVLRALDFDRNVRIYIAAGEIYGGQKRMSSLSTAYPNIVRKEMLLEPSDLQLFQ  376

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDY+VSLESD+F+PTY GNMA+VVEGHRR+LGFRKTILLDRK+IV L DQYN
Sbjct  377  NHSSQMAALDYMVSLESDVFIPTYDGNMAKVVEGHRRFLGFRKTILLDRKLIVELVDQYN  436

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++ WD FS+++KETH NRMGKP  R+VI E+PKEED FY+NPQEC
Sbjct  437  NGSLGWDEFSSAIKETHSNRMGKPSKRVVIPERPKEEDYFYSNPQEC  483



>ref|XP_002525944.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36464.1| conserved hypothetical protein [Ricinus communis]
Length=502

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALGID N QIYIA+GEIYGGERR++ LSA FPN+V+KE LL  S LKFFQ
Sbjct  325  TPEETALVLSALGIDHNVQIYIASGEIYGGERRMKTLSATFPNVVRKETLLESSDLKFFQ  384

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLE DIFVPTY GNMA+VVEGHRR+LGF+KTI LDRK+++ L DQY+
Sbjct  385  NHSSQMAALDYLVSLEGDIFVPTYDGNMAKVVEGHRRFLGFKKTISLDRKLLIGLIDQYS  444

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G+++WD FS ++KETH +RMG PK R+VI +KPKEED FYANP EC
Sbjct  445  KGSLSWDEFSTTVKETHADRMGSPKARVVIADKPKEEDYFYANPHEC  491



>ref|XP_010037318.1| PREDICTED: uncharacterized protein At1g04910-like [Eucalyptus 
grandis]
Length=518

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+A+GIDRN QIYIAAGEIYGGERR+ +L+ A+P +V+KE LL  S L+FFQ
Sbjct  341  TPEETALTLRAMGIDRNIQIYIAAGEIYGGERRMASLAEAYPRLVRKETLLESSDLRFFQ  400

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLGF+KTILLDR+++V L DQYN
Sbjct  401  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGFKKTILLDRRLLVGLIDQYN  460

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            AG ++WD FS+ +KE H NRMG P  RLVI ++PKEED FY+NP EC
Sbjct  461  AGALSWDEFSSIVKEAHANRMGNPVKRLVIPDRPKEEDYFYSNPYEC  507



>ref|XP_004241614.1| PREDICTED: uncharacterized protein At1g04910 [Solanum lycopersicum]
Length=494

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL ID + Q+YIAAGEIYGGERR+ +L+AA+PN+V+KE LL PS L+FFQ
Sbjct  319  TPEETALTLRALNIDPSIQVYIAAGEIYGGERRMASLAAAYPNLVRKETLLEPSELRFFQ  378

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLG++KTILLDRK +V L DQ+N
Sbjct  379  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGYKKTILLDRKHLVDLIDQHN  438

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            AG++TWD FS ++KE H  RMG P  RLVI ++PKEED FY+NP EC
Sbjct  439  AGSLTWDEFSTAVKEAHSERMGNPTKRLVIQDRPKEEDYFYSNPWEC  485



>gb|KJB10523.1| hypothetical protein B456_001G206300 [Gossypium raimondii]
Length=512

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+ALGIDRN QIYIAAGEIYGGERR+  L+ AFPN+V+KE LL  S LKFFQ
Sbjct  337  TPEETALVLRALGIDRNVQIYIAAGEIYGGERRMAPLAEAFPNLVRKETLLVRSDLKFFQ  396

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KTILLDRK++V L D+Y 
Sbjct  397  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGFKKTILLDRKLLVKLIDEYQ  456

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G+++WD FS ++KE H +RMG PK R+VI ++PKEED FY+NP EC
Sbjct  457  SGSLSWDEFSETVKEVHSDRMGNPKKRVVIPDRPKEEDYFYSNPHEC  503



>ref|XP_009381654.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=395

 Score =   259 bits (663),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L AL IDRN Q+YIAAGEIYGG+RR+  LS A+PN+V+KE LLGPS L +FQ
Sbjct  204  TPEETALILGALDIDRNIQVYIAAGEIYGGKRRMAALSDAYPNVVRKEILLGPSDLGYFQ  263

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDY+VSLESD+F+PTY GNMA+VVEGHRRYLGF+KTI LDRK++V L DQYN
Sbjct  264  NHSSQMAALDYMVSLESDVFIPTYDGNMAKVVEGHRRYLGFKKTITLDRKLLVELIDQYN  323

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G + WD FS+S+K TH NRMG+P  R+VI ++PKEED FYANPQEC
Sbjct  324  NGTLGWDDFSSSVKATHANRMGRPTRRVVIPDRPKEEDYFYANPQEC  370



>gb|KHG10689.1| hypothetical protein F383_03841 [Gossypium arboreum]
Length=512

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+ALGIDRN QIYIAAGEIYGGERR+  L+ AFPN+V+KE LL  S LKFFQ
Sbjct  337  TPEETALVLRALGIDRNVQIYIAAGEIYGGERRMAPLAEAFPNLVRKETLLVRSDLKFFQ  396

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KTILLDRK++V L D+Y 
Sbjct  397  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGFKKTILLDRKLLVKLIDEYQ  456

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G+++WD FS ++KE H +RMG PK R+VI ++PKEED FY+NP EC
Sbjct  457  SGSLSWDEFSETVKEVHSDRMGNPKKRVVIPDRPKEEDYFYSNPHEC  503



>ref|XP_003551780.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=505

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALGIDRN QIYIA+GEIYGGE+R+ +L   FPN+++KE LLGPS L +FQ
Sbjct  328  TPEETALVLSALGIDRNVQIYIASGEIYGGEKRMASLLGEFPNLIRKEILLGPSELMYFQ  387

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAA+DYLVSLESDIF+PTY GNMA+VVEGHRR+LGF+KTILLDR+++VHL DQY 
Sbjct  388  NHSSQMAAVDYLVSLESDIFIPTYDGNMAKVVEGHRRFLGFKKTILLDRRLLVHLIDQYY  447

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++WD FS +MKE H  RMG PK R++I +KPKEED FYANPQEC
Sbjct  448  NGLLSWDEFSTAMKEAHAYRMGSPKRRVIIPDKPKEEDYFYANPQEC  494



>ref|XP_010257916.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nelumbo nucifera]
Length=515

 Score =   262 bits (670),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 142/170 (84%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL LKAL IDRNFQI+IAAGEIYGG++R+ +L+ A+PN+V+KE LL P  L+FFQ
Sbjct  338  TPEETALVLKALDIDRNFQIFIAAGEIYGGQKRMESLAEAYPNLVRKETLLEPPDLRFFQ  397

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIF+PTY GNMA+VVEGHRR+LGF+KTILLDRK++V L DQYN
Sbjct  398  NHSSQMAALDYLVSLESDIFIPTYDGNMAKVVEGHRRFLGFKKTILLDRKLLVDLIDQYN  457

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYSH  511
             G + W+ FS  +KE H NRMG P  R+VI ++PKEED FYANPQEC  H
Sbjct  458  DGLLDWNKFSFLVKEAHENRMGSPTRRVVIPDRPKEEDYFYANPQECLGH  507



>gb|KDO65637.1| hypothetical protein CISIN_1g010586mg [Citrus sinensis]
Length=399

 Score =   258 bits (660),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+AL ID N QIYIAAGEIYGGERR+ NL+ A+P +V+KE LL PS L+FFQ
Sbjct  221  TPEETALILRALDIDPNMQIYIAAGEIYGGERRMANLAKAYPKLVRKETLLEPSDLRFFQ  280

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LG++KTILL+RK++V L DQY+
Sbjct  281  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGYKKTILLERKLLVDLIDQYS  340

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++TWD FS ++KE+H +RMG P  RLVI +KPKEED FY+NP+EC
Sbjct  341  NGSLTWDEFSAAVKESHADRMGGPTNRLVIPDKPKEEDYFYSNPEEC  387



>ref|XP_009337866.1| PREDICTED: uncharacterized protein At1g04910-like [Pyrus x bretschneideri]
Length=516

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL AL IDR+ QIYIAAGEIYG ERR+ +L  AFP +V+KE LL PS L+FFQ
Sbjct  339  TPEETALTLSALDIDRDIQIYIAAGEIYGAERRMASLGKAFPKLVRKETLLEPSDLRFFQ  398

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KTILLDRK++V L DQY 
Sbjct  399  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGFKKTILLDRKLLVDLIDQYT  458

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G++ WD FS+++KE H NRMG P  RL+I ++PKEED FYANP+EC
Sbjct  459  SGSLHWDEFSSAVKEAHANRMGNPTNRLMIQDRPKEEDYFYANPEEC  505



>ref|XP_004953767.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=507

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 141/170 (83%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE AL L+AL ID+N QIYIAAGEIYGG+RR+ +L++A+PNMV+KE LL PS L FFQ
Sbjct  331  TPEEIALVLRALDIDKNMQIYIAAGEIYGGKRRMASLTSAYPNMVRKETLLEPSDLMFFQ  390

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRY+GF+KTILLDRK+IV L DQY 
Sbjct  391  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYMGFKKTILLDRKLIVELVDQYT  450

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYSH  511
            +G++ WD FS+ +K  H NRMG   TR VI ++PKEED FYANPQEC  H
Sbjct  451  SGSLRWDEFSSLIKAVHANRMGSATTRTVIPDRPKEEDYFYANPQECLRH  500



>ref|XP_010943313.1| PREDICTED: uncharacterized protein At1g04910 [Elaeis guineensis]
Length=522

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 142/167 (85%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+AL IDRN +IYIAAGE+YGG+RR+  L+AA+PN+V+KE LL PS L+FFQ
Sbjct  346  TPEETALVLRALDIDRNVRIYIAAGEMYGGQRRMAALTAAYPNVVRKETLLEPSDLRFFQ  405

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLGFRKTI LDRK++V L DQYN
Sbjct  406  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGFRKTIQLDRKLLVELIDQYN  465

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++ WD FS+ +K  H NRMGKP  R+VI ++PKEED FYANPQEC
Sbjct  466  NGSLGWDEFSSLVKAAHVNRMGKPTRRVVIPDRPKEEDYFYANPQEC  512



>ref|XP_008788919.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Phoenix 
dactylifera]
Length=380

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 142/171 (83%), Gaps = 0/171 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEET+L L+AL IDR+  IYIAAGE+YGG+RR+  L++A+PN+V+KE LL PS L+FFQ
Sbjct  204  TPEETSLILRALDIDRSVPIYIAAGEMYGGQRRMAALTSAYPNVVRKETLLEPSDLRFFQ  263

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLGFRKTI LDRK++V L DQYN
Sbjct  264  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGFRKTIQLDRKLLVELIDQYN  323

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYSHI  514
             G++ WD FS+S+K  H  RMGKP  R+VI ++PKEED FYANPQEC   +
Sbjct  324  NGSLGWDEFSSSVKAAHVTRMGKPTRRVVIPDRPKEEDYFYANPQECLHQL  374



>ref|XP_006358681.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum tuberosum]
Length=507

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 142/167 (85%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL ID + Q+YIAAGEIYGG RR+ +L+AA+PN+V+KE LL PS L+FFQ
Sbjct  328  TPEETALTLRALDIDSSIQVYIAAGEIYGGTRRMASLAAAYPNLVRKETLLEPSELRFFQ  387

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KTILLDRK++V L DQYN
Sbjct  388  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRHLGFKKTILLDRKLLVDLIDQYN  447

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            AG+ TW+ FS ++KE H  RMG P  RLVI ++PKEED FY+NP EC
Sbjct  448  AGSFTWNEFSAAVKEAHTERMGNPAKRLVIPDRPKEEDYFYSNPWEC  494



>ref|XP_009410297.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=515

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE AL LKAL ID N Q+YIAAGEIYGGERR+  LS A+PN+V+KE LLGPS L++FQ
Sbjct  339  TPEEIALILKALDIDHNIQVYIAAGEIYGGERRMSALSDAYPNVVRKELLLGPSDLRYFQ  398

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDY+VSLESDIFVPTY GNMA+VVEGHRRYLGF+KTI+LDRK++V L DQY+
Sbjct  399  NHSSQMAALDYMVSLESDIFVPTYDGNMAKVVEGHRRYLGFKKTIILDRKLLVELIDQYS  458

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G I WD FS+S+K  H NRMG+P  R VI ++PKEED FYANPQEC
Sbjct  459  NGTIGWDDFSSSVKAAHANRMGRPTRRAVIPDRPKEEDYFYANPQEC  505



>ref|XP_008393258.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=516

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL AL IDR+ QIYIAAGEIYG ERR+ +L  AFP +V+KE LL PS L+FFQ
Sbjct  339  TPEETALTLSALDIDRDIQIYIAAGEIYGAERRMASLGKAFPKLVRKETLLEPSDLRFFQ  398

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KTILLDRK++V L DQY 
Sbjct  399  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGFKKTILLDRKLLVDLIDQYT  458

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G++ WD FS+++KE H NRMG P  RL+I ++PKEED FYANP EC
Sbjct  459  SGSLGWDEFSSAVKEAHANRMGNPTNRLMIQDRPKEEDYFYANPXEC  505



>gb|KHN15193.1| DUF246 domain-containing protein [Glycine soja]
Length=515

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTLKAL ID+N QIYIAAGEIYGGERR+ +L+  +P +V+KE LL PS L+FFQ
Sbjct  335  TPEETALTLKALDIDQNIQIYIAAGEIYGGERRMASLAKEYPKLVRKETLLEPSDLQFFQ  394

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLGF+KTILL+RK++V L DQYN
Sbjct  395  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGFKKTILLNRKLLVELIDQYN  454

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G + WD FS+++KE H NRMG    R VI +KPKEED FYANPQEC
Sbjct  455  NGVLNWDEFSSAVKEAHANRMGSQTKRFVIPDKPKEEDYFYANPQEC  501



>ref|XP_003525629.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=515

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTLKAL ID+N QIYIAAGEIYGGERR+ +L+  +P +V+KE LL PS L+FFQ
Sbjct  335  TPEETALTLKALDIDQNIQIYIAAGEIYGGERRMASLAKEYPKLVRKETLLEPSDLQFFQ  394

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLGF+KTILL+RK++V L DQYN
Sbjct  395  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGFKKTILLNRKLLVELIDQYN  454

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G + WD FS+++KE H NRMG    R VI +KPKEED FYANPQEC
Sbjct  455  NGVLNWDEFSSAVKEAHANRMGSQTKRFVIPDKPKEEDYFYANPQEC  501



>ref|XP_006354743.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum tuberosum]
Length=494

 Score =   259 bits (662),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 142/167 (85%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL ID + Q+YIAAGEIYGGERR+ +L+AA+PN+V+KE LL  S L+FFQ
Sbjct  319  TPEETALTLRALDIDPSIQVYIAAGEIYGGERRMASLAAAYPNLVRKETLLESSELRFFQ  378

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLG++KTILLDRK +V L DQ+N
Sbjct  379  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGYKKTILLDRKHLVDLIDQHN  438

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            AG++TWD FS ++KE H  RMG P  RLVI ++PKEED FY+NP EC
Sbjct  439  AGSLTWDEFSTAVKEAHAERMGNPTKRLVIQDRPKEEDYFYSNPWEC  485



>ref|XP_009776643.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=521

 Score =   260 bits (664),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL ID + Q+YIAAGEIYGG RR+ +L+AA+PN+V+KE LL PS L+FFQ
Sbjct  342  TPEETALTLRALDIDPSIQVYIAAGEIYGGTRRMASLTAAYPNLVRKETLLEPSELRFFQ  401

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLGF+KTILLDRK +V L DQY 
Sbjct  402  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGFKKTILLDRKHLVDLIDQYY  461

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            AG++TWD FS ++KE H  RMG P  RLVI ++PKEED FY+NP EC
Sbjct  462  AGSLTWDEFSAAVKEAHTERMGNPTKRLVIPDRPKEEDYFYSNPWEC  508



>ref|XP_004157433.1| PREDICTED: LOW QUALITY PROTEIN: DUF246 domain-containing protein 
At1g04910-like [Cucumis sativus]
Length=524

 Score =   259 bits (663),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 142/167 (85%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPE+TALTL+AL ID NFQIYIAAGEIYGG+RR+++L+ A+P +VKKE LL PS L FFQ
Sbjct  338  TPEDTALTLRALDIDPNFQIYIAAGEIYGGKRRMQSLAKAYPKLVKKETLLKPSDLSFFQ  397

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLGF++TILLDRK++ +L DQY 
Sbjct  398  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGFKETILLDRKILFNLIDQYK  457

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +  ++WD FS ++KE H +RMGKP  R VI +KPKEED FYANP+EC
Sbjct  458  SEKLSWDEFSWAVKEAHSDRMGKPTKRTVIPDKPKEEDYFYANPEEC  504



>ref|XP_009625954.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
tomentosiformis]
Length=521

 Score =   259 bits (662),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETA TL+AL ID + Q+YIAAGEIYGG RR+ +L+AA+PN+V+KE LL PS L+FFQ
Sbjct  342  TPEETAFTLRALDIDPSIQVYIAAGEIYGGTRRMASLTAAYPNLVRKETLLEPSELRFFQ  401

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLGF+KTILLDRK +V L DQYN
Sbjct  402  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGFKKTILLDRKHLVDLIDQYN  461

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            AG +TWD FS ++KE H  RMG P  RLVI ++PKEED FY+NP EC
Sbjct  462  AGFLTWDEFSAAVKEAHAERMGNPTKRLVIPDRPKEEDYFYSNPWEC  508



>ref|XP_004137453.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 gb|KGN64083.1| hypothetical protein Csa_1G039970 [Cucumis sativus]
Length=524

 Score =   259 bits (663),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 142/167 (85%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPE+TALTL+AL ID NFQIYIAAGEIYGG+RR+++L+ A+P +VKKE LL PS L FFQ
Sbjct  338  TPEDTALTLRALDIDPNFQIYIAAGEIYGGKRRMQSLAKAYPKLVKKETLLKPSDLSFFQ  397

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLGF++TILLDRK++ +L DQY 
Sbjct  398  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGFKETILLDRKILFNLIDQYK  457

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +  ++WD FS ++KE H +RMGKP  R VI +KPKEED FYANP+EC
Sbjct  458  SEKLSWDEFSWAVKEAHSDRMGKPTKRTVIPDKPKEEDYFYANPEEC  504



>ref|XP_006656001.1| PREDICTED: uncharacterized protein At1g04910-like [Oryza brachyantha]
Length=397

 Score =   256 bits (653),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+AL IDR+ QIYIAAGEIYGG+RR+  L++A+PN+V+KE LL PS L FFQ
Sbjct  221  TPEETALVLRALDIDRSMQIYIAAGEIYGGKRRMAALTSAYPNVVRKETLLEPSDLMFFQ  280

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRY+GF+KTILLDRK+IV L DQYN
Sbjct  281  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYMGFKKTILLDRKLIVELVDQYN  340

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++ WD FS  +K  H NRMG    R VI ++PKEED FYANPQEC
Sbjct  341  NGSLRWDEFSLMIKAAHANRMGSASKRTVIPDRPKEEDYFYANPQEC  387



>ref|XP_006440825.1| hypothetical protein CICLE_v10019790mg [Citrus clementina]
 ref|XP_006485715.1| PREDICTED: uncharacterized protein At1g04910-like [Citrus sinensis]
 gb|ESR54065.1| hypothetical protein CICLE_v10019790mg [Citrus clementina]
 gb|KDO65636.1| hypothetical protein CISIN_1g010586mg [Citrus sinensis]
Length=506

 Score =   259 bits (661),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+AL ID N QIYIAAGEIYGGERR+ NL+ A+P +V+KE LL PS L+FFQ
Sbjct  328  TPEETALILRALDIDPNMQIYIAAGEIYGGERRMANLAKAYPKLVRKETLLEPSDLRFFQ  387

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LG++KTILL+RK++V L DQY+
Sbjct  388  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGYKKTILLERKLLVDLIDQYS  447

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++TWD FS ++KE+H +RMG P  RLVI +KPKEED FY+NP+EC
Sbjct  448  NGSLTWDEFSAAVKESHADRMGGPTNRLVIPDKPKEEDYFYSNPEEC  494



>ref|XP_009793270.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=498

 Score =   258 bits (660),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL ID + Q+YIAAGEIYGGERR+ +L+AA+PN+V+KE LL PS L+FFQ
Sbjct  319  TPEETALTLRALDIDPSIQVYIAAGEIYGGERRMASLAAAYPNLVRKETLLEPSELRFFQ  378

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLG++KTILL R+++V L DQ+N
Sbjct  379  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGYKKTILLHRRLLVDLIDQHN  438

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G++TWD FS ++KE H  RMG P  RLVI ++PKEED FY+NP EC
Sbjct  439  SGSLTWDEFSTAVKEAHAERMGNPTKRLVIPDRPKEEDYFYSNPWEC  485



>ref|XP_009381653.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=531

 Score =   259 bits (662),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L AL IDRN Q+YIAAGEIYGG+RR+  LS A+PN+V+KE LLGPS L +FQ
Sbjct  340  TPEETALILGALDIDRNIQVYIAAGEIYGGKRRMAALSDAYPNVVRKEILLGPSDLGYFQ  399

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDY+VSLESD+F+PTY GNMA+VVEGHRRYLGF+KTI LDRK++V L DQYN
Sbjct  400  NHSSQMAALDYMVSLESDVFIPTYDGNMAKVVEGHRRYLGFKKTITLDRKLLVELIDQYN  459

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G + WD FS+S+K TH NRMG+P  R+VI ++PKEED FYANPQEC
Sbjct  460  NGTLGWDDFSSSVKATHANRMGRPTRRVVIPDRPKEEDYFYANPQEC  506



>ref|XP_004236078.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum lycopersicum]
Length=524

 Score =   259 bits (662),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL ID + Q+YIAAGEIYGG RR+ +L+AA+PN+V+KE LL PS L FFQ
Sbjct  344  TPEETALTLRALDIDSSIQVYIAAGEIYGGRRRMASLAAAYPNLVRKETLLEPSDLMFFQ  403

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLG++KTILLDRK++V L DQ+ 
Sbjct  404  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGYKKTILLDRKLLVDLIDQHT  463

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            AG++TWD FSN++K  H  RMG P  RLVI ++PKEED FY+NP EC
Sbjct  464  AGSLTWDEFSNAVKHAHAERMGNPTKRLVIPDRPKEEDYFYSNPWEC  510



>ref|XP_006345092.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum tuberosum]
Length=524

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL ID + Q+YIAAGEIYGG RR+ +L+AA+PN+V+KE LL PS L FFQ
Sbjct  344  TPEETALTLRALDIDSSIQVYIAAGEIYGGRRRMASLAAAYPNLVRKETLLEPSDLMFFQ  403

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLG++KTILLDRK++V L DQ+ 
Sbjct  404  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGYKKTILLDRKLLVDLIDQHT  463

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            AG++TWD FSN++K  H  RMG P  RLVI ++PKEED FY+NP EC
Sbjct  464  AGSLTWDEFSNAVKHAHAERMGNPTKRLVIPDRPKEEDYFYSNPWEC  510



>ref|XP_009587252.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
tomentosiformis]
Length=498

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 142/167 (85%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL ID + Q+YIAAGEIYGGERR+ NL+AA+PN+V+KE LL PS L+FFQ
Sbjct  319  TPEETALTLRALDIDPSIQVYIAAGEIYGGERRMANLAAAYPNLVRKETLLEPSELRFFQ  378

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESD+FVPTY GNMA+VVEGHRRYLG++KTILL R+++V L DQ+N
Sbjct  379  NHSSQMAALDYLVSLESDVFVPTYDGNMAKVVEGHRRYLGYKKTILLHRRLLVDLIDQHN  438

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++TWD FS ++KE H  RMG P  RLVI ++PKEED FY+NP EC
Sbjct  439  GGSLTWDEFSTAVKEAHVERMGNPIQRLVIQDRPKEEDYFYSNPCEC  485



>ref|XP_007037671.1| O-fucosyltransferase family protein isoform 2 [Theobroma cacao]
 gb|EOY22172.1| O-fucosyltransferase family protein isoform 2 [Theobroma cacao]
Length=508

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTLKAL ID ++QIYIAAGEIYGGERR+ +LSAA+P +V+KE LL  S L+FFQ
Sbjct  331  TPEETALTLKALDIDTSYQIYIAAGEIYGGERRMASLSAAYPKLVRKETLLEASDLRFFQ  390

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIF+PTY GNMA+VVEGHRR+LGF++TILLDR+++V L DQYN
Sbjct  391  NHSSQMAALDYLVSLESDIFIPTYDGNMAKVVEGHRRFLGFKRTILLDRRLLVELIDQYN  450

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++ WD FS ++KETH +R G+P  RLV  ++PKEED FYANP+EC
Sbjct  451  GGSLNWDEFSAAVKETHESRKGQPTKRLVTPDRPKEEDYFYANPEEC  497



>gb|EYU23639.1| hypothetical protein MIMGU_mgv1a004971mg [Erythranthe guttata]
Length=502

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL IDRN QIYIAAGEIYGGERRL +L+A++PN+V+KE LL  S L+FFQ
Sbjct  321  TPEETALTLRALDIDRNIQIYIAAGEIYGGERRLSSLTASYPNLVRKETLLESSDLRFFQ  380

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLG++KTILL+R+++V + D+YN
Sbjct  381  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGYKKTILLERRLLVDIIDKYN  440

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G+++WD FSN++K+ H  RMG P  R VI ++PKEED FYANP EC
Sbjct  441  TGSLSWDEFSNAVKDVHAERMGNPIRRSVIPDRPKEEDYFYANPWEC  487



>ref|XP_011078675.1| PREDICTED: uncharacterized protein At1g04910-like [Sesamum indicum]
Length=523

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 142/167 (85%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL ID N QIYIAAGEIYGGERRL +L++ +PN+V+KE LL PS L+FFQ
Sbjct  342  TPEETALTLRALDIDPNIQIYIAAGEIYGGERRLSSLTSFYPNLVRKETLLEPSDLRFFQ  401

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLG++KTILLDR+++V L D+YN
Sbjct  402  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGYKKTILLDRRMLVDLIDKYN  461

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++TWD FS ++K+ H  RMG P  RLVI ++PKEED FYANP EC
Sbjct  462  FGSLTWDEFSAAVKDAHALRMGNPSKRLVIPDRPKEEDYFYANPWEC  508



>ref|XP_008809674.1| PREDICTED: uncharacterized protein At1g04910-like [Phoenix dactylifera]
 ref|XP_008809675.1| PREDICTED: uncharacterized protein At1g04910-like [Phoenix dactylifera]
Length=520

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+AL  DR+  IYIAAGEIYGGERR+  L+AA+PN+V+KE LL PS L+FFQ
Sbjct  344  TPEETALVLRALHFDRSIPIYIAAGEIYGGERRMAALTAAYPNVVRKETLLEPSDLRFFQ  403

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIF+PTY GNMA+VVEGHRR+LGFRKTILLDRK++V L DQYN
Sbjct  404  NHSSQMAALDYLVSLESDIFIPTYDGNMAKVVEGHRRFLGFRKTILLDRKLLVELIDQYN  463

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++ WD FS+S+K  H +RMGKP  R+VI  +PKEED F+ANPQEC
Sbjct  464  NGSLGWDEFSSSVKAAHVHRMGKPTRRIVIPNRPKEEDYFFANPQEC  510



>ref|XP_007151404.1| hypothetical protein PHAVU_004G043700g [Phaseolus vulgaris]
 gb|ESW23398.1| hypothetical protein PHAVU_004G043700g [Phaseolus vulgaris]
Length=514

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEET L L ALGID++ QIYIAAGEIY GERR+ +L A FPN+V+KE LL PS LK+FQ
Sbjct  337  TPEETTLVLTALGIDQSIQIYIAAGEIYDGERRMASLRATFPNVVRKETLLEPSDLKYFQ  396

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIF+PTY GNMA+VVEGHRR+LGF++T+LLDRK +VHL DQY 
Sbjct  397  NHSSQMAALDYLVSLESDIFIPTYDGNMAKVVEGHRRFLGFKRTMLLDRKHVVHLIDQYT  456

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECY  505
             G+++WD FS  +K+TH NRMG PK R++I ++PKEED FY+NPQEC+
Sbjct  457  NGSLSWDEFSIMVKKTHANRMGNPKRRIIIPDRPKEEDYFYSNPQECF  504



>ref|XP_010261204.1| PREDICTED: uncharacterized protein At1g04910 [Nelumbo nucifera]
Length=516

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL LKAL IDRN QIYIAAGEIYGG++R+ +L+ A+PN+V+KE LL PS L FF 
Sbjct  338  TPEETALVLKALDIDRNIQIYIAAGEIYGGQKRIASLAEAYPNLVRKETLLEPSDLMFFL  397

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIF+PTY GNMA+VVEGHRR+LGF+KTILLDRK++V L DQY 
Sbjct  398  NHSSQMAALDYLVSLESDIFIPTYDGNMAKVVEGHRRFLGFKKTILLDRKLLVDLIDQYE  457

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G + W+ FS+S+KE H+NRMG P  R+VI ++PKEED FYANPQEC
Sbjct  458  DGLLDWNEFSSSVKEAHQNRMGSPNRRVVIPDRPKEEDYFYANPQEC  504



>ref|XP_008454434.1| PREDICTED: uncharacterized protein At1g04910-like [Cucumis melo]
Length=524

 Score =   258 bits (658),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPE+TALTL+AL ID NFQIYIAAGEIYGG+RR+ +L+ A+P +VKKE LL PS L FFQ
Sbjct  338  TPEDTALTLRALDIDPNFQIYIAAGEIYGGKRRMESLAKAYPKLVKKETLLKPSDLSFFQ  397

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLGF+ TILLDRK++ +L DQY 
Sbjct  398  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGFKTTILLDRKILFNLIDQYK  457

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +  ++WD FS ++KE H +RMGKP  R VI +KPKEED FYANP+EC
Sbjct  458  SEKLSWDEFSLAVKEAHADRMGKPSKRTVIPDKPKEEDYFYANPEEC  504



>ref|XP_006600607.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=510

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTLKAL ID+N QIYIAAGEIYGGERR+  L+  +P +V+KE LL PS L+FFQ
Sbjct  329  TPEETALTLKALDIDQNIQIYIAAGEIYGGERRMAGLAKEYPKLVRKETLLEPSDLRFFQ  388

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLGF++TILL+RK++V L DQYN
Sbjct  389  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGFKRTILLNRKLLVELIDQYN  448

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G + WD FS+++KE H +RMG    R VI E+PKEED FYANPQEC
Sbjct  449  NGVLNWDEFSSAVKEAHADRMGSQTKRFVIPERPKEEDYFYANPQEC  495



>gb|KHN18388.1| DUF246 domain-containing protein [Glycine soja]
Length=519

 Score =   257 bits (657),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTLKAL ID+N QIYIAAGEIYGGERR+  L+  +P +V+KE LL PS L+FFQ
Sbjct  338  TPEETALTLKALDIDQNIQIYIAAGEIYGGERRMAGLAKEYPKLVRKETLLEPSDLRFFQ  397

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLGF++TILL+RK++V L DQYN
Sbjct  398  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGFKRTILLNRKLLVELIDQYN  457

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G + WD FS+++KE H +RMG    R VI E+PKEED FYANPQEC
Sbjct  458  NGVLNWDEFSSAVKEAHADRMGSQTKRFVIPERPKEEDYFYANPQEC  504



>gb|EEE57726.1| hypothetical protein OsJ_08224 [Oryza sativa Japonica Group]
Length=481

 Score =   256 bits (653),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE AL L+AL IDR+ QIYIAAGEIYGG+RR+  L++A+PN+V+KE LL PS L FFQ
Sbjct  305  TPEEIALVLRALDIDRSMQIYIAAGEIYGGKRRMAALTSAYPNVVRKETLLQPSDLMFFQ  364

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR++GF+KTILLDRK+IV L DQYN
Sbjct  365  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFMGFKKTILLDRKLIVELVDQYN  424

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G++ WD FS+ +K  H NRMG    R VI +KPKEED FYANPQEC
Sbjct  425  SGSMLWDEFSSLIKSVHANRMGAASKRTVIHDKPKEEDYFYANPQEC  471



>gb|KEH32061.1| GDP-fucose O-fucosyltransferase-like protein [Medicago truncatula]
Length=518

 Score =   256 bits (655),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL ID+N QIYIAAGEIYGGERR  +LS  +P +V+KE LL PS L+FFQ
Sbjct  341  TPEETALTLRALDIDQNIQIYIAAGEIYGGERRRASLSKEYPKLVRKETLLEPSDLQFFQ  400

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VV GHRRYLGF+KTILLDRK++V L DQY 
Sbjct  401  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVAGHRRYLGFKKTILLDRKLLVDLIDQYY  460

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G + WD FS+++KE+H +RMG P  RLVI +KPKEED FY+NP+EC
Sbjct  461  NGALNWDQFSSAVKESHAHRMGNPSKRLVIPDKPKEEDYFYSNPEEC  507



>ref|XP_007037670.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOY22171.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
Length=557

 Score =   258 bits (658),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTLKAL ID ++QIYIAAGEIYGGERR+ +LSAA+P +V+KE LL  S L+FFQ
Sbjct  331  TPEETALTLKALDIDTSYQIYIAAGEIYGGERRMASLSAAYPKLVRKETLLEASDLRFFQ  390

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIF+PTY GNMA+VVEGHRR+LGF++TILLDR+++V L DQYN
Sbjct  391  NHSSQMAALDYLVSLESDIFIPTYDGNMAKVVEGHRRFLGFKRTILLDRRLLVELIDQYN  450

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++ WD FS ++KETH +R G+P  RLV  ++PKEED FYANP+EC
Sbjct  451  GGSLNWDEFSAAVKETHESRKGQPTKRLVTPDRPKEEDYFYANPEEC  497



>ref|XP_004508647.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Cicer arietinum]
Length=513

 Score =   256 bits (655),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL IDRN QIYIAAGEIYGGERR  +LS  +P +V+KE LL PS L+FFQ
Sbjct  336  TPEETALTLRALDIDRNIQIYIAAGEIYGGERRTTSLSKEYPKLVRKETLLEPSDLRFFQ  395

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLGF+KTILL+RK++V L DQYN
Sbjct  396  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGFKKTILLNRKLLVDLIDQYN  455

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G + WD FS+++K+ H  RMG    RLVI +KPKEED FY+NP+EC
Sbjct  456  NGVLNWDQFSSAVKKAHARRMGSSSKRLVILDKPKEEDYFYSNPEEC  502



>ref|XP_008788918.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Phoenix 
dactylifera]
Length=522

 Score =   256 bits (655),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 142/171 (83%), Gaps = 0/171 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEET+L L+AL IDR+  IYIAAGE+YGG+RR+  L++A+PN+V+KE LL PS L+FFQ
Sbjct  346  TPEETSLILRALDIDRSVPIYIAAGEMYGGQRRMAALTSAYPNVVRKETLLEPSDLRFFQ  405

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLGFRKTI LDRK++V L DQYN
Sbjct  406  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGFRKTIQLDRKLLVELIDQYN  465

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYSHI  514
             G++ WD FS+S+K  H  RMGKP  R+VI ++PKEED FYANPQEC   +
Sbjct  466  NGSLGWDEFSSSVKAAHVTRMGKPTRRVVIPDRPKEEDYFYANPQECLHQL  516



>ref|XP_006649007.1| PREDICTED: uncharacterized protein At1g04910-like [Oryza brachyantha]
Length=478

 Score =   255 bits (652),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE AL L+AL IDR+ QIYIAAGEIYGG+RR+  L++A+PN+V+KE LL PS L FFQ
Sbjct  302  TPEEIALVLRALDIDRSMQIYIAAGEIYGGKRRMAALTSAYPNVVRKETLLEPSDLMFFQ  361

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR++GF+KTILLDRK+IV L DQYN
Sbjct  362  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFMGFKKTILLDRKLIVELVDQYN  421

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G++ WD FS+ +K  H NRMG    R VI +KPKEED FYANPQEC
Sbjct  422  SGSMGWDEFSSLIKSVHANRMGAASKRTVILDKPKEEDYFYANPQEC  468



>gb|KHN30744.1| DUF246 domain-containing protein [Glycine soja]
Length=493

 Score =   256 bits (653),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEET L L ALGID+N QIYIAAGEIYGG+RR+ +L AAFPN+V+KE LL PS L +FQ
Sbjct  316  TPEETTLILTALGIDQNIQIYIAAGEIYGGQRRMASLQAAFPNLVRKETLLEPSDLMYFQ  375

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIF+PTY GNMA+VVEGHRR+LGF++TILLDRK +VHL D Y 
Sbjct  376  NHSSQMAALDYLVSLESDIFIPTYDGNMAKVVEGHRRFLGFKRTILLDRKHLVHLIDLYT  435

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G+++WD FS  +K++H NRMG PK R++I  +PKEED FYANPQEC
Sbjct  436  KGSLSWDEFSIMVKKSHANRMGNPKRRVIIPGRPKEEDYFYANPQEC  482



>ref|XP_008453320.1| PREDICTED: uncharacterized protein At1g04910-like [Cucumis melo]
Length=515

 Score =   256 bits (654),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL ID N QIYIAAGEIYGG+RR+  L+ AFP +V+KE LL PS L FFQ
Sbjct  338  TPEETALTLRALDIDPNIQIYIAAGEIYGGDRRMAALAKAFPKLVRKETLLEPSELSFFQ  397

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQM+ALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KTILLDRKV+V L DQYN
Sbjct  398  NHSSQMSALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGFKKTILLDRKVLVDLIDQYN  457

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
               + WD FS ++KE H NR G P  RLVI +KPKEED FY+NP+EC
Sbjct  458  RELLNWDEFSTAVKEAHANRWGSPTKRLVIPDKPKEEDYFYSNPEEC  504



>ref|XP_007211132.1| hypothetical protein PRUPE_ppa026241mg [Prunus persica]
 gb|EMJ12331.1| hypothetical protein PRUPE_ppa026241mg [Prunus persica]
Length=515

 Score =   256 bits (654),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL AL IDR+ QIYIAAGEIYG ERR+ +L+ A+P +V+KE LL PS L+FFQ
Sbjct  338  TPEETALTLSALDIDRDIQIYIAAGEIYGAERRMASLAKAYPKLVRKETLLEPSDLRFFQ  397

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KTILLDRK++V L DQY 
Sbjct  398  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGFKKTILLDRKLLVDLIDQYT  457

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            + ++ WD FS+++KE H  RMG P  RL+I ++PKEED FYANP+EC
Sbjct  458  SESVNWDEFSSAVKEAHAGRMGNPTNRLMIQDRPKEEDYFYANPEEC  504



>dbj|BAG93245.1| unnamed protein product [Oryza sativa Japonica Group]
Length=271

 Score =   248 bits (634),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 140/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETA+ LKAL ID ++QIYIAAGEIYGG+RR+  L++A+PN+V+KE LL PS L+FFQ
Sbjct  96   TPEETAMVLKALDIDSSYQIYIAAGEIYGGQRRMSALTSAYPNVVRKETLL-PSDLRFFQ  154

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDY+VSLESDIF+PTY GNMA+VVEGHRRYLGF+KT+LLDRK+IV L DQY 
Sbjct  155  NHSSQMAALDYIVSLESDIFIPTYDGNMAKVVEGHRRYLGFKKTVLLDRKLIVELVDQYK  214

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G + W+ FS+++K +H +RMG P  R +I +KPKEED FYANP EC
Sbjct  215  NGTMRWNHFSSAVKASHSSRMGAPSRRQMIPDKPKEEDYFYANPHEC  261



>ref|XP_007139392.1| hypothetical protein PHAVU_008G025600g [Phaseolus vulgaris]
 gb|ESW11386.1| hypothetical protein PHAVU_008G025600g [Phaseolus vulgaris]
Length=511

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEET+L L ALGID N QIYIAAGEIYGGE+R+ +L   FPN+V+KE LL PS L +FQ
Sbjct  334  TPEETSLVLTALGIDHNVQIYIAAGEIYGGEKRMESLQGDFPNLVRKETLLEPSELMYFQ  393

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAA+DYLV+LESDIF+PTY GNMA+VVEGHRR+LGF+KT+LL+R+V+V L DQY 
Sbjct  394  NHSSQMAAVDYLVALESDIFIPTYDGNMAKVVEGHRRFLGFKKTVLLNRRVLVDLIDQYY  453

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++WD FS ++KE H NRMG PK R++I EKPKEED FYANPQEC
Sbjct  454  NGLLSWDEFSTAVKEVHANRMGSPKRRVIIPEKPKEEDYFYANPQEC  500



>ref|XP_006603936.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Glycine 
max]
 ref|XP_006603937.1| PREDICTED: uncharacterized protein At1g04910 isoform X3 [Glycine 
max]
 ref|XP_003554945.2| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Glycine 
max]
Length=515

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEET L L ALGID+N QIYIAAGEIYGG+RR+ +L AAFPN+V+KE LL PS L +FQ
Sbjct  338  TPEETTLILTALGIDQNIQIYIAAGEIYGGQRRMASLQAAFPNLVRKETLLEPSDLMYFQ  397

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIF+PTY GNMA+VVEGHRR+LGF++TILLDRK +VHL D Y 
Sbjct  398  NHSSQMAALDYLVSLESDIFIPTYDGNMAKVVEGHRRFLGFKRTILLDRKHLVHLIDLYT  457

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G+++WD FS  +K++H NRMG PK R++I  +PKEED FYANPQEC
Sbjct  458  KGSLSWDEFSIMVKKSHANRMGNPKRRVIIPGRPKEEDYFYANPQEC  504



>gb|EEC73922.1| hypothetical protein OsI_08773 [Oryza sativa Indica Group]
Length=504

 Score =   255 bits (652),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE AL L+AL IDR+ QIYIAAGEIYGG+RR+  L++A+PN+V+KE LL PS L FFQ
Sbjct  328  TPEEIALVLRALDIDRSMQIYIAAGEIYGGKRRMAALTSAYPNVVRKETLLQPSDLMFFQ  387

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR++GF+KTILLDRK+IV L DQYN
Sbjct  388  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFMGFKKTILLDRKLIVELVDQYN  447

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G++ WD FS+ +K  H NRMG    R VI +KPKEED FYANPQEC
Sbjct  448  SGSMLWDEFSSLIKSVHANRMGAASKRTVIHDKPKEEDYFYANPQEC  494



>ref|XP_004252254.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum lycopersicum]
Length=510

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL ID + Q+YIAAGEIYGG RR+ +L+AA+PN+V+KE LL PS L+FFQ
Sbjct  331  TPEETALTLRALDIDSSIQVYIAAGEIYGGTRRMASLAAAYPNLVRKETLLEPSELRFFQ  390

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KT L+DRK++V L DQYN
Sbjct  391  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRHLGFKKTFLVDRKLLVDLIDQYN  450

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            AG  TW+ FS ++KE H  RMG P  RLVI ++PKEED FY+NP EC
Sbjct  451  AGLFTWNEFSAAVKEAHTERMGNPTKRLVIPDRPKEEDYFYSNPWEC  497



>gb|EMS52310.1| hypothetical protein TRIUR3_22833 [Triticum urartu]
Length=420

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE AL L+AL +DR+ QIYIAAGEIYGG+RR+ +L++A+PN+V+KE LL PS L+FFQ
Sbjct  244  TPEEIALVLRALEVDRSMQIYIAAGEIYGGKRRMASLTSAYPNVVRKETLLEPSDLRFFQ  303

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR++GF+KTILLDRK+IV L D+Y 
Sbjct  304  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFMGFKKTILLDRKIIVDLVDRYK  363

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G++ WD FS  +K  H NRMG    R VI +KPKEED FYANPQEC
Sbjct  364  SGSLPWDEFSKLIKSVHANRMGSASRRTVIPDKPKEEDYFYANPQEC  410



>dbj|BAD16083.1| putative auxin-independent growth promoter [Oryza sativa Japonica 
Group]
 dbj|BAH01367.1| unnamed protein product [Oryza sativa Japonica Group]
Length=510

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE AL L+AL IDR+ QIYIAAGEIYGG+RR+  L++A+PN+V+KE LL PS L FFQ
Sbjct  334  TPEEIALVLRALDIDRSMQIYIAAGEIYGGKRRMAALTSAYPNVVRKETLLQPSDLMFFQ  393

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR++GF+KTILLDRK+IV L DQYN
Sbjct  394  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFMGFKKTILLDRKLIVELVDQYN  453

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G++ WD FS+ +K  H NRMG    R VI +KPKEED FYANPQEC
Sbjct  454  SGSMLWDEFSSLIKSVHANRMGAASKRTVIHDKPKEEDYFYANPQEC  500



>gb|KHN45098.1| DUF246 domain-containing protein [Glycine soja]
Length=388

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALGID N QIYIA+GEIYGGE+R+ +L   FPN+V+KE LL PS L +FQ
Sbjct  211  TPEETALVLSALGIDHNVQIYIASGEIYGGEKRMASLLGEFPNLVRKETLLEPSELMYFQ  270

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAA+DYLVSLESDIF+PTY GNMA+VVEGHRR+LGF+KTILLDR+++V+L DQY 
Sbjct  271  NHSSQMAAVDYLVSLESDIFIPTYDGNMAKVVEGHRRFLGFKKTILLDRRLLVNLIDQYY  330

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++WD F  ++KE H  RMG PK R++I +KPKEED FYANPQEC
Sbjct  331  NGLLSWDEFFTAVKEAHAYRMGSPKRRIIIPDKPKEEDYFYANPQEC  377



>ref|XP_008240072.1| PREDICTED: uncharacterized protein At1g04910-like [Prunus mume]
Length=517

 Score =   255 bits (651),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETA+TL AL IDR+ QIYIAAGEIYG ERR+ +L+ A+P +V+KE LL PS L+FFQ
Sbjct  340  TPEETAITLSALDIDRDIQIYIAAGEIYGAERRMASLAKAYPKLVRKETLLEPSDLRFFQ  399

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSL+SDIFVPTY GNMA+VVEGHRR+LGF+KTILLDRK++V L DQY 
Sbjct  400  NHSSQMAALDYLVSLKSDIFVPTYDGNMAKVVEGHRRFLGFKKTILLDRKLLVDLIDQYT  459

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G++ WD FS+++K+ H  RMG P  RL+I ++PKEED FYANP+EC
Sbjct  460  SGSLNWDEFSSAVKDAHAGRMGNPTNRLMIQDRPKEEDYFYANPEEC  506



>ref|XP_002454352.1| hypothetical protein SORBIDRAFT_04g029280 [Sorghum bicolor]
 gb|EES07328.1| hypothetical protein SORBIDRAFT_04g029280 [Sorghum bicolor]
Length=499

 Score =   254 bits (649),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE AL LKAL ID++ QIYIAAGEIYGG+RR+ +L++A+PN+V+KE LL PS L FFQ
Sbjct  323  TPEEVALVLKALDIDKSMQIYIAAGEIYGGKRRMASLTSAYPNVVRKETLLEPSDLMFFQ  382

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRY+GF+KTILLDRK+IV L DQY 
Sbjct  383  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYMGFKKTILLDRKLIVELVDQYT  442

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G++ WD F++ +K  H NRMG   TR  I ++PKEED FYANPQEC
Sbjct  443  SGSLRWDEFASLIKAVHSNRMGSATTRAAIPDRPKEEDYFYANPQEC  489



>ref|XP_004138213.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 ref|XP_004169858.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 gb|KGN63763.1| hypothetical protein Csa_1G015580 [Cucumis sativus]
Length=515

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL ID + QIYIAAGEIYGG+RR+  L+ AFP +V+KE LL PS L FFQ
Sbjct  338  TPEETALTLRALDIDPDIQIYIAAGEIYGGDRRMAALAKAFPKLVRKETLLEPSELSFFQ  397

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQM+ALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KTILLDRKV+V L DQYN
Sbjct  398  NHSSQMSALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGFKKTILLDRKVLVDLIDQYN  457

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
               + WD FS ++KE H NR G P  RLVI +KPKEED FY+NP+EC
Sbjct  458  RELLNWDEFSTAVKEAHANRWGSPTKRLVIPDKPKEEDYFYSNPEEC  504



>ref|XP_002278298.1| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera]
Length=496

 Score =   254 bits (648),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEET L L ALGIDRN QIYIAAG+IYGGERR+  L+ AFPN+V+KE LL PS L+FFQ
Sbjct  322  TPEETGLILSALGIDRNVQIYIAAGQIYGGERRMATLATAFPNLVRKETLLEPSDLRFFQ  381

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KTI LDR+++V+L D+Y 
Sbjct  382  NHTSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGFKKTIQLDRRLLVNLVDEYK  441

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G+++WD FS+++KE H  R+G P  R+VI ++PKEED FY+NP EC
Sbjct  442  NGSLSWDEFSSTVKEAHAYRVGSPSRRVVIPDRPKEEDYFYSNPHEC  488



>ref|XP_003570464.2| PREDICTED: uncharacterized protein At1g04910-like [Brachypodium 
distachyon]
Length=506

 Score =   254 bits (649),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE AL L+ALGIDR+ QIYIAAGEIYGG+RR+ +L++ +PN+V+KE LL PS LKFFQ
Sbjct  330  TPEEIALVLRALGIDRSMQIYIAAGEIYGGKRRMSSLTSEYPNVVRKETLLEPSDLKFFQ  389

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR +GF+ TILLDRK+IV L D+YN
Sbjct  390  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRIMGFKNTILLDRKLIVDLVDRYN  449

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G++ WD FS  +K  H NRMG    R VI +KPKEED FYANPQEC
Sbjct  450  SGSLPWDEFSKQIKSVHANRMGSASRRTVIPDKPKEEDYFYANPQEC  496



>ref|XP_010694231.1| PREDICTED: uncharacterized protein At1g04910 [Beta vulgaris subsp. 
vulgaris]
Length=543

 Score =   255 bits (651),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGID N QIYIA+GEIYGG+RR+ +L+++FPN+V+KE LL PS LK+FQ
Sbjct  364  TPEETALTLSALGIDPNIQIYIASGEIYGGKRRMASLASSFPNLVRKETLLEPSDLKYFQ  423

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMARVVEGHRR++ F+KTI LDRK++VHL D+YN
Sbjct  424  NHSSQMAALDYLVSLESDIFVPTYDGNMARVVEGHRRFMNFKKTISLDRKLLVHLIDEYN  483

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++ WD FS ++K  H NRMG P TR VI  KPKEED F+ NP EC
Sbjct  484  DGSLEWDEFSAAVKAAHANRMGTPHTRTVIPNKPKEEDYFHTNPYEC  530



>ref|XP_010928111.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
 ref|XP_010928112.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=520

 Score =   254 bits (649),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+AL  D++  IYIAAGEIYGG+RR+  L+AA+PN+V+KE LL PS L+FFQ
Sbjct  344  TPEETALVLRALDFDQSIPIYIAAGEIYGGKRRMAALTAAYPNVVRKETLLEPSDLRFFQ  403

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESD+FVPTY GNMA+VVEGHRR+LGFRKTILLDRK++V L D Y+
Sbjct  404  NHSSQMAALDYLVSLESDVFVPTYDGNMAKVVEGHRRFLGFRKTILLDRKLLVELIDLYS  463

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++ WD FS+S+K TH NRMGKP  R+VI  +PKEED F+ANPQEC
Sbjct  464  NGSLGWDEFSSSVKATHVNRMGKPARRVVIPNRPKEEDYFFANPQEC  510



>ref|XP_008455558.1| PREDICTED: uncharacterized protein At1g04910-like [Cucumis melo]
Length=508

 Score =   254 bits (648),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEET+L L ALG+DRN QIYIA+GEIYGGERR+ +L++AFPN+V+KE LL PS L+FFQ
Sbjct  337  TPEETSLVLSALGVDRNVQIYIASGEIYGGERRMESLASAFPNLVRKETLLKPSDLRFFQ  396

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
               SQMAALDYLVSLESDI+VPTY GNMA+VVEGHRR+LGF+KT+LLDRK++V L DQY+
Sbjct  397  NRSSQMAALDYLVSLESDIYVPTYDGNMAKVVEGHRRFLGFKKTVLLDRKLVVSLIDQYS  456

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G + WD FS++MKE H +  G  KTR+VI ++PKEED FY+NP EC
Sbjct  457  NGLLGWDEFSSAMKEGHSDHNGSSKTRVVIPDRPKEEDYFYSNPHEC  503



>emb|CBI16925.3| unnamed protein product [Vitis vinifera]
Length=520

 Score =   254 bits (648),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEET L L ALGIDRN QIYIAAG+IYGGERR+  L+ AFPN+V+KE LL PS L+FFQ
Sbjct  346  TPEETGLILSALGIDRNVQIYIAAGQIYGGERRMATLATAFPNLVRKETLLEPSDLRFFQ  405

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KTI LDR+++V+L D+Y 
Sbjct  406  NHTSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGFKKTIQLDRRLLVNLVDEYK  465

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G+++WD FS+++KE H  R+G P  R+VI ++PKEED FY+NP EC
Sbjct  466  NGSLSWDEFSSTVKEAHAYRVGSPSRRVVIPDRPKEEDYFYSNPHEC  512



>ref|NP_001057398.1| Os06g0284200 [Oryza sativa Japonica Group]
 dbj|BAD69015.1| putative auxin-independent growth promoter [Oryza sativa Japonica 
Group]
 dbj|BAF19312.1| Os06g0284200 [Oryza sativa Japonica Group]
 dbj|BAG92025.1| unnamed protein product [Oryza sativa Japonica Group]
Length=508

 Score =   253 bits (647),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+AL IDR+ QIYIAAGEIYGG+RR+  L++A+PN+V+KE LL PS L FFQ
Sbjct  332  TPEETALVLRALDIDRSMQIYIAAGEIYGGKRRMSALTSAYPNVVRKETLLEPSDLMFFQ  391

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRY+GF+KTILLDRK+IV L DQYN
Sbjct  392  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYMGFKKTILLDRKLIVELVDQYN  451

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
              ++ WD FS  +K  H NRMG    R VI ++PKEED FYANPQEC
Sbjct  452  NSSLRWDEFSLMLKAAHANRMGSASKRTVILDRPKEEDYFYANPQEC  498



>gb|EAZ00539.1| hypothetical protein OsI_22558 [Oryza sativa Indica Group]
Length=502

 Score =   253 bits (647),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+AL IDR+ QIYIAAGEIYGG+RR+  L++A+PN+V+KE LL PS L FFQ
Sbjct  326  TPEETALVLRALDIDRSMQIYIAAGEIYGGKRRMSALTSAYPNVVRKETLLEPSDLMFFQ  385

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRY+GF+KTILLDRK+IV L DQYN
Sbjct  386  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYMGFKKTILLDRKLIVELVDQYN  445

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
              ++ WD FS  +K  H NRMG    R VI ++PKEED FYANPQEC
Sbjct  446  NSSLRWDEFSLMLKAAHANRMGSASKRTVILDRPKEEDYFYANPQEC  492



>gb|EAZ36643.1| hypothetical protein OsJ_20989 [Oryza sativa Japonica Group]
Length=502

 Score =   253 bits (646),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+AL IDR+ QIYIAAGEIYGG+RR+  L++A+PN+V+KE LL PS L FFQ
Sbjct  326  TPEETALVLRALDIDRSMQIYIAAGEIYGGKRRMSALTSAYPNVVRKETLLEPSDLMFFQ  385

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRY+GF+KTILLDRK+IV L DQYN
Sbjct  386  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYMGFKKTILLDRKLIVELVDQYN  445

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
              ++ WD FS  +K  H NRMG    R VI ++PKEED FYANPQEC
Sbjct  446  NSSLRWDEFSLMLKAAHANRMGSASKRTVILDRPKEEDYFYANPQEC  492



>ref|XP_007045745.1| O-fucosyltransferase family protein [Theobroma cacao]
 gb|EOY01577.1| O-fucosyltransferase family protein [Theobroma cacao]
Length=518

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 139/171 (81%), Gaps = 0/171 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTLKALGIDRN Q+YIAAG+IYGGERRL  L AA+PN+VKKE LL PS L  F+
Sbjct  332  TPEETALTLKALGIDRNIQVYIAAGDIYGGERRLATLRAAYPNLVKKETLLPPSDLDPFR  391

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDY V++ESDIFVPT  GNMA+VVEGHRRYLGF++TILLDRK IV L D + 
Sbjct  392  NHSNQMAALDYYVAVESDIFVPTNGGNMAKVVEGHRRYLGFKETILLDRKAIVDLVDLFR  451

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYSHI  514
            AG+I+W+ FS+ MKE H +RMG P  RLVI  KPKEED FY NP+EC + +
Sbjct  452  AGSISWEEFSSEMKEAHADRMGNPAKRLVIPGKPKEEDYFYTNPEECLARL  502



>ref|XP_006852198.1| hypothetical protein AMTR_s00049p00119840 [Amborella trichopoda]
 gb|ERN13665.1| hypothetical protein AMTR_s00049p00119840 [Amborella trichopoda]
Length=468

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 142/170 (84%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+ALG D++ Q+YIAAGEIYGGERR+ +L +AFPN V+KE LL PS LK FQ
Sbjct  290  TPEETALVLRALGFDKDIQVYIAAGEIYGGERRMSSLYSAFPNTVQKEMLLEPSNLKPFQ  349

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSL SD+FVPTY GNMA+VVEGHRR+LGFR+T+LLDRK++VHL DQ+ 
Sbjct  350  NHSSQMAALDYLVSLASDVFVPTYDGNMAKVVEGHRRFLGFRRTVLLDRKLLVHLLDQHT  409

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYSH  511
            +G + WD FS ++K  H NRMG+P  RLVI++KPKEE  FY+NP+EC S+
Sbjct  410  SGLLPWDEFSLAVKAAHTNRMGQPARRLVISDKPKEEGYFYSNPEECLSY  459



>ref|XP_006430964.1| hypothetical protein CICLE_v10011493mg [Citrus clementina]
 gb|ESR44204.1| hypothetical protein CICLE_v10011493mg [Citrus clementina]
Length=519

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 142/171 (83%), Gaps = 1/171 (1%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALGID N QIYIAAGEIYGG+RR+  L+ AFPN+V+KE LL  S LKFFQ
Sbjct  343  TPEETALVLTALGIDHNVQIYIAAGEIYGGQRRMAALAEAFPNLVRKETLLK-SDLKFFQ  401

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIF+PTY GNMA+VVEGHRR+LGF+KTILL+R+++V L DQYN
Sbjct  402  NHSSQMAALDYLVSLESDIFIPTYDGNMAKVVEGHRRFLGFKKTILLNRRLLVDLIDQYN  461

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYSHI  514
             G+++WD F++++KE H + MG PK R+VI +KPKEED FYANP EC   +
Sbjct  462  NGSMSWDEFASTVKEVHVDLMGNPKARVVIPDKPKEEDYFYANPHECLQQL  512



>ref|XP_006482442.1| PREDICTED: uncharacterized protein At1g04910-like [Citrus sinensis]
Length=519

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 142/171 (83%), Gaps = 1/171 (1%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALGID N QIYIAAGEIYGG+RR+  L+ AFPN+V+KE LL  S LKFFQ
Sbjct  343  TPEETALVLTALGIDHNVQIYIAAGEIYGGQRRMAALAEAFPNLVRKETLLK-SDLKFFQ  401

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIF+PTY GNMA+VVEGHRR+LGF+KTILL+R+ +V L DQYN
Sbjct  402  NHSSQMAALDYLVSLESDIFIPTYDGNMAKVVEGHRRFLGFKKTILLNRRQLVDLIDQYN  461

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYSHI  514
             G+++WD FS+++KE H + MG PK R+VI +KPKEED FYANP+EC   +
Sbjct  462  NGSMSWDEFSSTVKEVHVDLMGNPKARVVIPDKPKEEDYFYANPRECLQQL  512



>ref|XP_004306052.1| PREDICTED: uncharacterized protein At1g04910-like [Fragaria vesca 
subsp. vesca]
 ref|XP_011467864.1| PREDICTED: uncharacterized protein At1g04910-like [Fragaria vesca 
subsp. vesca]
Length=500

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEET L L ALGID N QIYIAAGEIYGG+RRL  L +AFPN+V+KE LL PS L+FF 
Sbjct  323  TPEETTLVLVALGIDHNVQIYIAAGEIYGGDRRLEGLKSAFPNVVRKETLLDPSDLRFFP  382

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KTILL+R++++ L DQ+ 
Sbjct  383  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGFKKTILLNRRLLIGLIDQFT  442

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G+++WD FS+ +KE H +RMG PK R+ I +KPKEED FY+NP EC
Sbjct  443  SGSLSWDEFSSIVKEAHADRMGSPKKRVSIVDKPKEEDYFYSNPHEC  489



>ref|XP_008646193.1| PREDICTED: uncharacterized protein At1g04910-like [Zea mays]
 gb|AFW73230.1| hypothetical protein ZEAMMB73_904500 [Zea mays]
Length=498

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE A+ L+AL ID++ QIYIAAGEIYGG+RR+ +L+ A+PN+V+KE LL PS L FFQ
Sbjct  322  TPEEVAIVLRALDIDKSMQIYIAAGEIYGGKRRMASLTLAYPNVVRKETLLEPSDLMFFQ  381

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLGF+KTI+LDRK+IV L DQY 
Sbjct  382  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGFKKTIMLDRKLIVELVDQYT  441

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G++ WD F++ +K  H NRMG   TR  I ++PKEED FYANPQEC
Sbjct  442  SGSLRWDEFASLIKAVHSNRMGSAATRAAIPDRPKEEDYFYANPQEC  488



>ref|XP_011072874.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Sesamum indicum]
Length=522

 Score =   253 bits (645),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTLKAL IDRN QIYIAAGEIYGG+RRL  L+ ++P +V+KE LL  S L+FFQ
Sbjct  343  TPEETALTLKALDIDRNIQIYIAAGEIYGGKRRLSTLAVSYPKLVRKETLLDSSDLRFFQ  402

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LG++KTILLDRK+++   D+YN
Sbjct  403  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGYKKTILLDRKLLIDFIDRYN  462

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G++TWD FS +++  H  RMG P  RLVI  +PKEED FYANP EC
Sbjct  463  SGSLTWDEFSAAVRNAHAERMGHPTKRLVIPYRPKEEDYFYANPWEC  509



>dbj|BAJ90326.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=500

 Score =   251 bits (642),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+AL IDR+ QIYIAAGEIYGG RR+  L++A+PN+V+KE LL PS L FFQ
Sbjct  324  TPEETALVLRALDIDRSMQIYIAAGEIYGGRRRMAALTSAYPNVVRKETLLEPSDLMFFQ  383

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDY+VSLESDIFVPTY GNMA+VVEGHRR++GF+KTILLDRK+IV LTDQYN
Sbjct  384  NHSSQMAALDYMVSLESDIFVPTYDGNMAKVVEGHRRFMGFKKTILLDRKLIVDLTDQYN  443

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++ WD FS  +K  H  RMG    R VI ++PKEED FYANPQEC
Sbjct  444  NGSLRWDEFSLLIKAAHAGRMGSASKRTVIPDRPKEEDYFYANPQEC  490



>gb|KHN05195.1| DUF246 domain-containing protein [Glycine soja]
Length=398

 Score =   249 bits (635),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL ID+N QIYIAAGEIYGG+RR+ +L+  +P +V+KE LL PS L+FFQ
Sbjct  221  TPEETALTLRALDIDQNIQIYIAAGEIYGGDRRMASLAKNYPKLVRKETLLEPSDLQFFQ  280

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLGF+KTILL+RK++V L DQY+
Sbjct  281  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGFKKTILLNRKLLVDLIDQYH  340

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G + W+ FS+++KE H +RMG    RLV+ ++PKEED FYANP+EC
Sbjct  341  DGILNWNEFSSAVKEVHADRMGGATKRLVMPDRPKEEDYFYANPEEC  387



>gb|AAM67354.1| unknown [Arabidopsis thaliana]
Length=260

 Score =   244 bits (622),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RRL+ L+  FPN+V+KE LL  S L F +
Sbjct  79   TPEETALTLSALGIDRNVQIYIAAGEIYGGKRRLKALTDVFPNVVRKETLLDSSDLSFCK  138

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYL+SLESDIFVPTY GNMA+VVEGHRR+LGF+KTI L+RK++V L D+Y 
Sbjct  139  NHSSQMAALDYLISLESDIFVPTYYGNMAKVVEGHRRFLGFKKTIELNRKLLVKLIDEYY  198

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W++FS ++K  H  RMG PK RLVI  KPKEED FYANP EC
Sbjct  199  EGLLSWEVFSTTVKAFHATRMGGPKRRLVIPNKPKEEDYFYANPYEC  245



>gb|KHG01567.1| hypothetical protein F383_21541 [Gossypium arboreum]
Length=514

 Score =   252 bits (643),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+AL ID ++QIYIAAGEIYGG+RR+  L+AA+P +V+KE+LL PS L FFQ
Sbjct  333  TPEETALILRALDIDNSYQIYIAAGEIYGGQRRMATLAAAYPKLVRKESLLEPSDLGFFQ  392

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIF+PTY GNMA+VVEGHRR+LGF++TILL+R+++V L DQYN
Sbjct  393  NHSSQMAALDYLVSLESDIFIPTYDGNMAKVVEGHRRFLGFKQTILLERRLLVDLIDQYN  452

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G ++W  FS+++KE+H +R G+P  RLVI ++PKEED FYANP+EC
Sbjct  453  SGTLSWYEFSDAVKESHESRKGQPTQRLVIPDRPKEEDYFYANPEEC  499



>gb|KDO72306.1| hypothetical protein CISIN_1g036592mg [Citrus sinensis]
Length=519

 Score =   252 bits (643),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 141/171 (82%), Gaps = 1/171 (1%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALGID N QIYIAAGEIYGG+RR+  L+ AFPN+V+KE LL  S LKFFQ
Sbjct  343  TPEETALVLTALGIDHNVQIYIAAGEIYGGQRRMAALAEAFPNLVRKETLLK-SDLKFFQ  401

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIF+PTY GNMA+VVEGHRR+LGF+KTILL+R+ +V L DQYN
Sbjct  402  NHSSQMAALDYLVSLESDIFIPTYDGNMAKVVEGHRRFLGFKKTILLNRRQLVDLIDQYN  461

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYSHI  514
             G+++WD F++++KE H + MG PK R+VI +KPKEED FYANP EC   +
Sbjct  462  NGSMSWDEFASTVKEVHVDLMGNPKARVVIPDKPKEEDYFYANPHECLQQL  512



>ref|XP_003530456.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=499

 Score =   251 bits (641),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALGID N QIYIA+GEIYGGE+R+ +L   FPN+V+KE LL PS L +FQ
Sbjct  322  TPEETALVLSALGIDHNVQIYIASGEIYGGEKRMASLLGEFPNLVRKETLLEPSELMYFQ  381

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAA+DYLVSLESDIF+PTY GNMA+VVEGHRR+LGF+KTILLDR+++V+L DQY 
Sbjct  382  NHSSQMAAVDYLVSLESDIFIPTYDGNMAKVVEGHRRFLGFKKTILLDRRLLVNLIDQYY  441

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++WD F  ++KE H  RMG PK R++I +KPKEED FYANPQEC
Sbjct  442  NGLLSWDEFFTAVKEAHAYRMGSPKRRIIIPDKPKEEDYFYANPQEC  488



>ref|XP_006661343.1| PREDICTED: uncharacterized protein At1g04910-like, partial [Oryza 
brachyantha]
Length=409

 Score =   248 bits (634),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETA+ LKAL ID ++QIYIAAGEIYGG+RR+  L++A+PN+V+KE LL PS L+FFQ
Sbjct  234  TPEETAMVLKALDIDSSYQIYIAAGEIYGGQRRMAALTSAYPNVVRKETLL-PSDLRFFQ  292

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDY+VSLESDIF+PTY GNMA+VVEGHRRYLGF+KT+LLDRK+IV L DQY 
Sbjct  293  NHSSQMAALDYIVSLESDIFIPTYDGNMAKVVEGHRRYLGFKKTVLLDRKLIVELVDQYK  352

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W+ FS+++K +H +RMG P  R +I +KPKEED FYANP EC
Sbjct  353  NGTMSWNHFSSAVKVSHSSRMGAPSRRQMIPDKPKEEDYFYANPHEC  399



>gb|EMS67535.1| hypothetical protein TRIUR3_24224 [Triticum urartu]
Length=433

 Score =   249 bits (636),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 140/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE A+ LKAL IDR++QIYIAAGEIYGG+RR+  L++A+PN+V+KE LL PS L+FFQ
Sbjct  258  TPEEIAMVLKALDIDRHYQIYIAAGEIYGGQRRMAALTSAYPNVVRKETLL-PSGLRFFQ  316

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDY+VSLESD+F+PTY GNMA+VVEGHRRYLGF+KT+LLDRK+IV L D+Y 
Sbjct  317  NHSSQMAALDYMVSLESDVFIPTYDGNMAKVVEGHRRYLGFKKTVLLDRKLIVELVDEYK  376

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W  FS+S+K +H +RMG P  R VI +KPKEED FYANP EC
Sbjct  377  NGTLSWADFSSSVKASHTSRMGAPSRRQVIPDKPKEEDYFYANPHEC  423



>gb|EMS61270.1| hypothetical protein TRIUR3_28898 [Triticum urartu]
Length=469

 Score =   249 bits (637),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+AL IDR+ QIYIAAGEIYGG+RR+  L++A+PN+V+KE LL PS L FFQ
Sbjct  293  TPEETALVLRALDIDRSMQIYIAAGEIYGGKRRMAALTSAYPNVVRKETLLEPSDLMFFQ  352

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDY+VSLESDIFVPTY GNMA+VVEGHRR++GF+KTILLDRK+IV L DQYN
Sbjct  353  NHSSQMAALDYMVSLESDIFVPTYDGNMAKVVEGHRRFMGFKKTILLDRKLIVDLADQYN  412

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++ WD FS  +K  H  RMG    R VI ++PKEED FYANPQEC
Sbjct  413  NGSLRWDEFSLLIKAAHAGRMGSASKRTVIPDRPKEEDYFYANPQEC  459



>gb|ACU20394.1| unknown [Glycine max]
Length=186

 Score =   240 bits (613),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  14   TALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQGHLS  193
              + L ALGID+N QIYIAAGEIYGG+RR+ +L AAFPN+V+KE LL PS L +FQ H S
Sbjct  13   CVVQLTALGIDQNIQIYIAAGEIYGGQRRMASLQAAFPNLVRKETLLEPSDLMYFQNHSS  72

Query  194  QMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYNAGNI  373
            QMAALDYLVSLESDIF+PTY GNMA+VVE HRR+LGF++TILLDRK +VHL D Y  G++
Sbjct  73   QMAALDYLVSLESDIFIPTYDGNMAKVVESHRRFLGFKRTILLDRKHLVHLIDLYTKGSL  132

Query  374  TWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +WD FS  +K++H NRMG PK  ++I  +PKEED FYANPQEC
Sbjct  133  SWDEFSIMVKKSHANRMGNPKRGVIIPGRPKEEDYFYANPQEC  175



>ref|XP_004488503.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum]
Length=515

 Score =   251 bits (640),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+A  ID+N QIYIAAGEIYGG RR+ +L+  +P +V+KE LL PS L+FFQ
Sbjct  336  TPEETALALRAFDIDQNIQIYIAAGEIYGGNRRMASLAKNYPKLVRKETLLEPSELQFFQ  395

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLGF+KTILL+RK++V L DQYN
Sbjct  396  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGFKKTILLNRKLLVDLIDQYN  455

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G + WD FS+++KETH +RMG    RLVI ++PKEED FYANP EC
Sbjct  456  NGVMNWDEFSSAVKETHADRMGGATKRLVIPDRPKEEDYFYANPDEC  502



>gb|EMT16495.1| hypothetical protein F775_26167 [Aegilops tauschii]
Length=465

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 140/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE A+ LKAL IDR++QIYIAAGEIYGG+RR+  L++A+PN+V+KE LL PS L+FFQ
Sbjct  290  TPEEIAMVLKALDIDRHYQIYIAAGEIYGGQRRMAALTSAYPNVVRKETLL-PSGLRFFQ  348

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDY+VSLESD+F+PTY GNMA+VVEGHRRYLGF+KT+LLDRK+IV L D+Y 
Sbjct  349  NHSSQMAALDYMVSLESDVFIPTYDGNMAKVVEGHRRYLGFKKTVLLDRKLIVELVDEYK  408

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W  FS+S+K +H +RMG P  R VI +KPKEED FYANP EC
Sbjct  409  NGTLSWTDFSSSVKASHTSRMGAPSRRQVIPDKPKEEDYFYANPHEC  455



>ref|XP_004137143.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 gb|KGN53771.1| hypothetical protein Csa_4G125420 [Cucumis sativus]
Length=514

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEET+L L ALGID N QIYIA+GEIYGGERR+  L++AFPN+V+KE LL PS L+FFQ
Sbjct  337  TPEETSLVLSALGIDHNVQIYIASGEIYGGERRMEALASAFPNLVRKETLLKPSDLRFFQ  396

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
               SQMAALDYLVSLESDI++PTY GNMA+VVEGHRR+LGF+KT+LLDRK++V L DQY+
Sbjct  397  NRSSQMAALDYLVSLESDIYIPTYDGNMAKVVEGHRRFLGFKKTVLLDRKLVVSLIDQYS  456

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G + WD FS++MKE H ++ G  KTR+VI ++PKEED FY+NP EC
Sbjct  457  NGLLGWDEFSSAMKEGHSDQNGSSKTRVVIPDRPKEEDYFYSNPHEC  503



>ref|XP_008362222.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=503

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALG+D N QIYIAAGE+YGG RR+  L AAFPN+V+KE LL PS L+FF 
Sbjct  326  TPEETALVLVALGVDHNVQIYIAAGEMYGGNRRMEGLKAAFPNLVRKETLLEPSDLRFFP  385

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIF+PTY GNMA+VVEGHRR+LGF+KT+LLDR++++ L +Q++
Sbjct  386  NHSSQMAALDYLVSLESDIFIPTYDGNMAKVVEGHRRFLGFKKTVLLDRRLLIGLIEQFS  445

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G+++WD FS  +KE H NRMG PK R+ + +KPKEED FY+NP EC
Sbjct  446  TGSLSWDEFSXIVKEAHANRMGNPKERVSVPDKPKEEDYFYSNPHEC  492



>ref|XP_009373763.1| PREDICTED: uncharacterized protein At1g04910-like [Pyrus x bretschneideri]
Length=503

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALGID N QIYIAAGE+YGG RR+  L AAFPN+V+KE LL PS L+FF 
Sbjct  326  TPEETALVLVALGIDHNVQIYIAAGEMYGGNRRMEGLKAAFPNLVRKETLLEPSDLRFFP  385

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIF+PTY GNMA+VVEGHRR+LGF+KT+LLDR++++ L +Q++
Sbjct  386  NHSSQMAALDYLVSLESDIFIPTYDGNMAKVVEGHRRFLGFKKTVLLDRRLLIGLIEQFS  445

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G+++WD FS  +KE H  RMG PK R++I +KPKEED FY+NP EC
Sbjct  446  TGSLSWDEFSYIVKEAHAKRMGSPKQRVLIPDKPKEEDYFYSNPHEC  492



>gb|EMT03456.1| hypothetical protein F775_30563 [Aegilops tauschii]
Length=493

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+AL IDR+ QIYIAAGEIYGG+RR+  L++A+PN+V+KE LL PS L FFQ
Sbjct  317  TPEETALVLRALDIDRSMQIYIAAGEIYGGKRRMAALTSAYPNVVRKETLLEPSDLMFFQ  376

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDY+VSLESDIFVPTY GNMA+VVEGHRR++GF+KTILLDRK+IV L DQYN
Sbjct  377  NHSSQMAALDYMVSLESDIFVPTYDGNMAKVVEGHRRFMGFKKTILLDRKLIVDLADQYN  436

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++ WD FS  +K  H  RMG    R VI ++PKEED FYANPQEC
Sbjct  437  NGSLRWDEFSLLIKAAHAGRMGSASKRTVIPDRPKEEDYFYANPQEC  483



>ref|XP_006400095.1| hypothetical protein EUTSA_v10013286mg [Eutrema salsugineum]
 gb|ESQ41548.1| hypothetical protein EUTSA_v10013286mg [Eutrema salsugineum]
Length=512

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RR++ L+ AFPN+V+KE LL PS L F +
Sbjct  335  TPEETALTLTALGIDRNVQIYIAAGEIYGGQRRMKALTDAFPNVVRKETLLEPSDLDFCR  394

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLV+LESDIFVPT  GNMARVVEGHRR+LGF+KTI L+R+ +V L D+Y 
Sbjct  395  NHSSQMAALDYLVALESDIFVPTNDGNMARVVEGHRRFLGFKKTIQLNRRFLVKLIDEYT  454

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G +TWD+FS+++K  H  RMG PK RLVI  KPKEED FY+NPQEC
Sbjct  455  EGLLTWDVFSSTVKAFHYTRMGSPKRRLVIPNKPKEEDYFYSNPQEC  501



>ref|XP_010492420.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
Length=522

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RR++ L+ AFPN+V+KE LL PS L F +
Sbjct  345  TPEETALTLTALGIDRNVQIYIAAGEIYGGQRRMKALTDAFPNVVRKETLLEPSDLDFCR  404

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLV+LESDIFVPT  GNMARVVEGHRR+LGF+KTI L+RK +V L D+Y 
Sbjct  405  NHSSQMAALDYLVALESDIFVPTNDGNMARVVEGHRRFLGFKKTIQLNRKFLVKLIDEYT  464

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++WD+FS+S+K  H +RMG PK RLVI  +PKEED FYANP EC
Sbjct  465  EGLLSWDVFSSSVKAFHSSRMGSPKRRLVIPNRPKEEDYFYANPHEC  511



>ref|XP_006287551.1| hypothetical protein CARUB_v10000760mg [Capsella rubella]
 gb|EOA20449.1| hypothetical protein CARUB_v10000760mg [Capsella rubella]
Length=508

 Score =   249 bits (636),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RR++ L+ AFPN+V+KE LL PS L F +
Sbjct  331  TPEETALTLTALGIDRNVQIYIAAGEIYGGQRRMKALTDAFPNVVRKETLLEPSDLDFCR  390

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLV+LESDIFVPT  GNMARVVEGHRR+LGF+KTI L+RK +V L D+Y 
Sbjct  391  NHSSQMAALDYLVALESDIFVPTNDGNMARVVEGHRRFLGFKKTIQLNRKFLVKLIDEYT  450

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G +TWD+FS+S+K  H  RMG PK RLV+  +PKEED FYANP EC
Sbjct  451  EGLLTWDVFSSSVKAFHSTRMGSPKRRLVVPNRPKEEDYFYANPHEC  497



>ref|XP_010492421.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Camelina sativa]
Length=511

 Score =   249 bits (636),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RR++ L+ AFPN+V+KE LL PS L F +
Sbjct  334  TPEETALTLTALGIDRNVQIYIAAGEIYGGQRRMKALTDAFPNVVRKETLLEPSDLDFCR  393

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLV+LESDIFVPT  GNMARVVEGHRR+LGF+KTI L+RK +V L D+Y 
Sbjct  394  NHSSQMAALDYLVALESDIFVPTNDGNMARVVEGHRRFLGFKKTIQLNRKFLVKLIDEYT  453

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++WD+FS+S+K  H +RMG PK RLVI  +PKEED FYANP EC
Sbjct  454  EGLLSWDVFSSSVKAFHSSRMGSPKRRLVIPNRPKEEDYFYANPHEC  500



>ref|NP_001159291.1| hypothetical protein [Zea mays]
 gb|ACN25705.1| unknown [Zea mays]
 gb|AFW76982.1| hypothetical protein ZEAMMB73_344359 [Zea mays]
Length=500

 Score =   249 bits (635),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+AL IDR+ QIYIAAGEIYGG+RR+ +L++A+PN+V+KE LL PS L FFQ
Sbjct  324  TPEETALVLRALDIDRSMQIYIAAGEIYGGKRRMASLTSAYPNVVRKETLLEPSDLMFFQ  383

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR++G++KT+LLDRK+IV L D+Y 
Sbjct  384  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFMGYKKTVLLDRKLIVELVDRYT  443

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++ WD FS+ +K  H  RMG    R+VI ++PKEED FYANPQEC
Sbjct  444  NGSLLWDEFSSLIKVAHAKRMGSASKRMVIPDRPKEEDYFYANPQEC  490



>gb|EAZ09478.1| hypothetical protein OsI_31750 [Oryza sativa Indica Group]
Length=512

 Score =   249 bits (636),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETA+ LKAL ID ++QIYIAAGEIYGG+RR+  L++A+PN+V+KE LL PS L+FFQ
Sbjct  337  TPEETAMVLKALDIDSSYQIYIAAGEIYGGQRRMAALTSAYPNVVRKETLL-PSDLRFFQ  395

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDY+VSLESDIF+PTY GNMA+VVEGHRRYLGF+KT+LLDRK+IV L DQY 
Sbjct  396  NHSSQMAALDYIVSLESDIFIPTYDGNMAKVVEGHRRYLGFKKTVLLDRKLIVELVDQYK  455

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W+ FS+++K +H +RMG P  R +I +KPKEED FYANP EC
Sbjct  456  NGTMSWNHFSSAVKASHSSRMGAPSRRQMIPDKPKEEDYFYANPHEC  502



>gb|KJB19455.1| hypothetical protein B456_003G103300 [Gossypium raimondii]
 gb|KJB19456.1| hypothetical protein B456_003G103300 [Gossypium raimondii]
Length=514

 Score =   249 bits (636),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 142/167 (85%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+AL ID ++QIYIAAGEIYGG+RR+  L+AA+P +V+KE LL PS L FFQ
Sbjct  333  TPEETALILRALDIDNSYQIYIAAGEIYGGQRRMATLAAAYPKLVRKETLLEPSDLGFFQ  392

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIF+PTY GNMA+VVEGHRR+LGF++TILL+R+++V L DQYN
Sbjct  393  NHSSQMAALDYLVSLESDIFIPTYDGNMAKVVEGHRRFLGFKQTILLERRLLVDLIDQYN  452

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G ++W  FS+++ E+H +R G+P  RLVI ++PKEED FYANP+EC
Sbjct  453  SGTLSWYEFSDAVNESHESRKGQPTQRLVIPDRPKEEDYFYANPEEC  499



>ref|XP_009395885.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=516

 Score =   249 bits (636),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+AL ID + Q+YIAAGEIYGG+RR+  LS A+PN+V+KE LLGPS L++FQ
Sbjct  340  TPEETALILRALDIDGSIQVYIAAGEIYGGKRRMAVLSDAYPNVVRKEKLLGPSHLRYFQ  399

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDY+VSLESDIFVPTY GNMARVVEGHRRY+GF+KTI LDRK++V L DQY+
Sbjct  400  NHSSQMAALDYIVSLESDIFVPTYDGNMARVVEGHRRYMGFKKTITLDRKLLVDLIDQYS  459

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G + WD FS+ +K  H + MG+P  RLVI ++PKEED FY NPQEC
Sbjct  460  NGTLGWDDFSSLVKAAHADHMGRPTRRLVIPDRPKEEDYFYTNPQEC  506



>ref|XP_004965235.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=508

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+AL IDR+ QIYIAAGEIYGG+RR+  L++A+PN+V+KE LL PS L FFQ
Sbjct  332  TPEETALVLRALDIDRSMQIYIAAGEIYGGKRRMAALTSAYPNVVRKETLLEPSDLMFFQ  391

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR++GF+KT+LLDRK+IV L D+Y 
Sbjct  392  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFMGFKKTVLLDRKLIVELVDRYT  451

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++ WD FS+ +K  H  RMG    R VI ++PKEED FYANPQEC
Sbjct  452  NGSLQWDEFSSLIKAAHAKRMGSASKRTVIPDRPKEEDYFYANPQEC  498



>ref|XP_002514598.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47704.1| conserved hypothetical protein [Ricinus communis]
Length=510

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL ID + QIYIAAGEIYGG+RR+ +L+AAFP +V+KE LL P  L+FFQ
Sbjct  330  TPEETALTLRALDIDPDMQIYIAAGEIYGGDRRMASLAAAFPKLVRKETLLEPLDLRFFQ  389

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLGF+KTILL+R+ +V L D+Y 
Sbjct  390  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGFKKTILLERRHLVDLIDRYT  449

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G+++WD FS ++K+ H  RMG P  RLVI ++PKEED FY+NP+EC
Sbjct  450  NGSLSWDEFSYAVKQAHAERMGNPMKRLVIPDRPKEEDYFYSNPEEC  496



>ref|XP_010453716.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Camelina sativa]
Length=508

 Score =   249 bits (635),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RR++ L+ AFPN+V+KE LL PS L F +
Sbjct  331  TPEETALTLTALGIDRNVQIYIAAGEIYGGQRRMKALTDAFPNVVRKETLLEPSDLDFCR  390

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLV+LESDIFVPT  GNMARVVEGHRR+LGF+KTI L+RK +V L D+Y 
Sbjct  391  NHSSQMAALDYLVALESDIFVPTNDGNMARVVEGHRRFLGFKKTIQLNRKFLVKLIDEYT  450

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++WD+FS+S+K  H  RMG PK RLVI  +PKEED FYANP EC
Sbjct  451  EGLLSWDVFSSSVKAFHSTRMGSPKRRLVIPNRPKEEDYFYANPHEC  497



>ref|XP_010420248.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=510

 Score =   249 bits (635),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RR++ L+ AFPN+V+KE LL PS L F +
Sbjct  333  TPEETALTLTALGIDRNVQIYIAAGEIYGGQRRMKALTDAFPNVVRKETLLEPSDLDFCR  392

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLV+LESDIFVPT  GNMARVVEGHRR+LGF+KTI L+RK +V L D+Y 
Sbjct  393  NHSSQMAALDYLVALESDIFVPTNDGNMARVVEGHRRFLGFKKTIQLNRKFLVKLIDEYT  452

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++WD+FS+S+K  H  RMG PK RLVI  +PKEED FYANP EC
Sbjct  453  EGLLSWDVFSSSVKAFHSTRMGSPKRRLVIPNRPKEEDYFYANPHEC  499



>ref|XP_010453715.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
Length=535

 Score =   249 bits (636),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RR++ L+ AFPN+V+KE LL PS L F +
Sbjct  358  TPEETALTLTALGIDRNVQIYIAAGEIYGGQRRMKALTDAFPNVVRKETLLEPSDLDFCR  417

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLV+LESDIFVPT  GNMARVVEGHRR+LGF+KTI L+RK +V L D+Y 
Sbjct  418  NHSSQMAALDYLVALESDIFVPTNDGNMARVVEGHRRFLGFKKTIQLNRKFLVKLIDEYT  477

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++WD+FS+S+K  H  RMG PK RLVI  +PKEED FYANP EC
Sbjct  478  EGLLSWDVFSSSVKAFHSTRMGSPKRRLVIPNRPKEEDYFYANPHEC  524



>ref|XP_007138389.1| hypothetical protein PHAVU_009G204500g [Phaseolus vulgaris]
 gb|ESW10383.1| hypothetical protein PHAVU_009G204500g [Phaseolus vulgaris]
Length=513

 Score =   248 bits (634),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL ID+N QIYIAAGEIYGG RR+ +L+  +P +V+KE LL PS L+FFQ
Sbjct  341  TPEETALTLRALDIDQNIQIYIAAGEIYGGNRRMASLAKNYPRLVRKETLLEPSDLQFFQ  400

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRY GF+KTILL+RK++V L DQY+
Sbjct  401  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYNGFKKTILLNRKLLVDLIDQYH  460

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G + WD FS+++KE H +RMG    RLVI ++PKEED FYANP+EC
Sbjct  461  NGELNWDEFSSAVKEAHADRMGSATKRLVIPDRPKEEDYFYANPEEC  507



>ref|XP_007215267.1| hypothetical protein PRUPE_ppa004594mg [Prunus persica]
 gb|EMJ16466.1| hypothetical protein PRUPE_ppa004594mg [Prunus persica]
Length=501

 Score =   248 bits (633),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALGID N QIYIAAGEIYGG RR+ +L +AFPN+V+KE LL PS L+ F 
Sbjct  324  TPEETALVLVALGIDHNVQIYIAAGEIYGGNRRMESLKSAFPNLVRKETLLEPSDLRLFP  383

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQ AALDYLVSLESDIF+PTY GNMA+VVEGHRR+LGF+KT+LLDR++++ L +Q++
Sbjct  384  NHSSQRAALDYLVSLESDIFIPTYDGNMAKVVEGHRRFLGFKKTVLLDRRLLIGLIEQFS  443

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G+++WD FS+ +KE H +RMG+PK R+ I +KPKEED FY+NP EC
Sbjct  444  SGSLSWDEFSSIVKEAHADRMGRPKKRVSIADKPKEEDYFYSNPHEC  490



>gb|AES65954.2| GDP-fucose O-fucosyltransferase-like protein [Medicago truncatula]
Length=520

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+A  ID+N QIYIAAGEIYGG RR+ +L+  +P +V+KE LL PS L+FFQ
Sbjct  340  TPEETALALRAFDIDQNIQIYIAAGEIYGGSRRMASLAKNYPKLVRKETLLEPSELQFFQ  399

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLGFRKTILL+RK++V L DQY 
Sbjct  400  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGFRKTILLNRKLLVELIDQYT  459

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G + W+ FS+++K++H +RMG    RLVI ++PKEED FYANP EC
Sbjct  460  SGALNWEEFSSAVKQSHADRMGGATKRLVIPDRPKEEDYFYANPDEC  506



>ref|XP_006582034.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=526

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL ID+N QIYIAAGEIYGG+RR+ +L+  +P +V+KE LL PS L+FFQ
Sbjct  349  TPEETALTLRALDIDQNIQIYIAAGEIYGGDRRMASLAKNYPKLVRKETLLEPSDLQFFQ  408

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLGF+KTILL+RK++V L DQY+
Sbjct  409  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGFKKTILLNRKLLVDLIDQYH  468

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G + W+ FS+++KE H +RMG    RLV+ ++PKEED FYANP+EC
Sbjct  469  DGILNWNEFSSAVKEVHADRMGGATKRLVMPDRPKEEDYFYANPEEC  515



>emb|CDX78650.1| BnaA03g05620D [Brassica napus]
Length=508

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN Q+YIAAGEIYGGERR++ L+ AFPN+V+KE LL  S L F +
Sbjct  331  TPEETALTLTALGIDRNVQLYIAAGEIYGGERRMKALTDAFPNVVRKETLLDSSDLDFCR  390

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLV++ESDIFVPT  GNMARVVEGHRR+LGF+KTI L+RK +V L D+Y 
Sbjct  391  NHSSQMAALDYLVAVESDIFVPTNDGNMARVVEGHRRFLGFKKTIQLNRKFLVKLIDEYT  450

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G +TWD+FS+ +K  H  RMG PK RLVI  KPKEED FYANPQEC
Sbjct  451  EGLLTWDVFSSMVKAFHSTRMGSPKRRLVIPNKPKEEDYFYANPQEC  497



>ref|XP_003563952.1| PREDICTED: uncharacterized protein At1g04910-like [Brachypodium 
distachyon]
Length=504

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+AL IDR+ QIYIAAGEIYGG+RR+  L++A+PN+V+KE LL PS L FFQ
Sbjct  328  TPEETALVLRALDIDRSMQIYIAAGEIYGGKRRMAALTSAYPNVVRKETLLEPSDLMFFQ  387

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDY+VSLESDIFVPTY GNMA+VVEGHRR++GF+KTILLDRK+IV L DQYN
Sbjct  388  NHSSQMAALDYMVSLESDIFVPTYDGNMAKVVEGHRRFMGFKKTILLDRKLIVDLVDQYN  447

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++ WD FS  +K  H  RMG    R V  ++PKEED FYANPQEC
Sbjct  448  NGSLRWDEFSLLIKAAHAGRMGSASKRTVFPDRPKEEDYFYANPQEC  494



>ref|XP_009131494.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Brassica rapa]
Length=508

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN Q+YIAAGEIYGGERR++ L+ AFPN+V+KE LL  S L F +
Sbjct  331  TPEETALTLTALGIDRNVQLYIAAGEIYGGERRMKALTDAFPNVVRKETLLDSSDLDFCR  390

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLV++ESDIFVPT  GNMARVVEGHRR+LGF+KTI L+RK +V L D+Y 
Sbjct  391  NHSSQMAALDYLVAVESDIFVPTNDGNMARVVEGHRRFLGFKKTIQLNRKFLVKLIDEYT  450

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G +TWD+FS+ +K  H  RMG PK RLVI  KPKEED FYANPQEC
Sbjct  451  EGLLTWDVFSSMVKAFHSTRMGSPKRRLVIPNKPKEEDYFYANPQEC  497



>gb|AAF02113.1|AC009755_6 putative auxin-independent growth promoter [Arabidopsis thaliana]
Length=402

 Score =   244 bits (622),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RRL+ L+  FPN+V+KE LL  S L F +
Sbjct  221  TPEETALTLSALGIDRNVQIYIAAGEIYGGKRRLKALTDVFPNVVRKETLLDSSDLSFCK  280

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYL+SLESDIFVPTY GNMA+VVEGHRR+LGF+KTI L+RK++V L D+Y 
Sbjct  281  NHSSQMAALDYLISLESDIFVPTYYGNMAKVVEGHRRFLGFKKTIELNRKLLVKLIDEYY  340

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W++FS ++K  H  RMG PK RLVI  KPKEED FYANP EC
Sbjct  341  EGLLSWEVFSTTVKAFHATRMGGPKRRLVIPNKPKEEDYFYANPYEC  387



>ref|XP_004957108.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=492

 Score =   246 bits (628),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 138/167 (83%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+ALGIDR++QIYIAAGEIYGG+RR+  L+ A+PN+V+KE LL PS L  FQ
Sbjct  317  TPEETALVLQALGIDRSYQIYIAAGEIYGGQRRMAALTLAYPNVVRKETLL-PSDLNLFQ  375

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDY+VSLESDIF+PTY GNMA+VVEGHRRYLGF+KT+LLDR++IV L DQY 
Sbjct  376  NHSSQMAALDYMVSLESDIFIPTYDGNMAKVVEGHRRYLGFKKTVLLDRRLIVELVDQYR  435

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G + W  FS+++K +H +RMG+P  R  I +KPKEED FYANP EC
Sbjct  436  NGTLRWADFSSAVKASHTSRMGEPSRRQAIPDKPKEEDYFYANPHEC  482



>emb|CDY24821.1| BnaA08g14890D [Brassica napus]
Length=515

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RRL+ L+  FPN+V+KE LL  S L F Q
Sbjct  332  TPEETALTLSALGIDRNVQIYIAAGEIYGGKRRLKALTDVFPNVVRKETLLDSSDLSFCQ  391

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYL+SLESDIFVPTY GNMA+VVEGHRR+LGF+KTI L+RK +V+L D+Y 
Sbjct  392  NHSSQMAALDYLISLESDIFVPTYYGNMAKVVEGHRRFLGFKKTIELNRKFLVNLIDEYY  451

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W++FS ++K  H  RMG PK RLVI  KPKEED FYANP EC
Sbjct  452  QGMLSWEVFSTTVKSFHATRMGGPKKRLVIPNKPKEEDYFYANPYEC  498



>ref|XP_009134657.1| PREDICTED: uncharacterized protein At1g04910-like [Brassica rapa]
Length=514

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RRL+ L+  FPN+V+KE LL  S L F Q
Sbjct  331  TPEETALTLSALGIDRNVQIYIAAGEIYGGKRRLKALTDVFPNVVRKETLLDSSDLSFCQ  390

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYL+SLESDIFVPTY GNMA+VVEGHRR+LGF+KTI L+RK +V+L D+Y 
Sbjct  391  NHSSQMAALDYLISLESDIFVPTYYGNMAKVVEGHRRFLGFKKTIELNRKFLVNLIDEYY  450

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W++FS ++K  H  RMG PK RLVI  KPKEED FYANP EC
Sbjct  451  QGMLSWEVFSTTVKSFHATRMGGPKKRLVIPNKPKEEDYFYANPYEC  497



>emb|CAN73548.1| hypothetical protein VITISV_038182 [Vitis vinifera]
Length=511

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL IDRN QIYIAAGEIYGGERR+  L+AA+P +V+KE LL  S L+FFQ
Sbjct  333  TPEETALTLRALDIDRNIQIYIAAGEIYGGERRMATLAAAYPKLVRKETLLESSDLRFFQ  392

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KTILLDR+++V L DQY 
Sbjct  393  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGFKKTILLDRRLLVDLIDQYT  452

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G+++WD FS+++KE+H +RMG P  RLVI ++PKEED FYANPQEC
Sbjct  453  KGSLSWDEFSSAVKESHGDRMGNPIKRLVIPDRPKEEDYFYANPQEC  499



>emb|CDX91985.1| BnaC03g32870D [Brassica napus]
Length=514

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RRL+ L+  FPN+V+KE LL  S L F Q
Sbjct  331  TPEETALTLSALGIDRNVQIYIAAGEIYGGKRRLKALTDVFPNVVRKETLLDSSDLSFCQ  390

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYL+SLESDIFVPTY GNMA+VVEGHRR+LGF+KTI L+RK +V+L D+Y 
Sbjct  391  NHSSQMAALDYLISLESDIFVPTYYGNMAKVVEGHRRFLGFKKTIELNRKFLVNLIDEYY  450

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W++FS ++K  H  RMG PK RLVI  KPKEED FYANP EC
Sbjct  451  QGMLSWEVFSTTVKSFHATRMGGPKKRLVIPNKPKEEDYFYANPYEC  497



>ref|XP_002438243.1| hypothetical protein SORBIDRAFT_10g010460 [Sorghum bicolor]
 gb|EER89610.1| hypothetical protein SORBIDRAFT_10g010460 [Sorghum bicolor]
Length=513

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+AL IDR+ QIYIAAGEIYGG+RR+  L++A+PN+V+KE LL PS L FFQ
Sbjct  337  TPEETALVLRALDIDRSMQIYIAAGEIYGGKRRMAALTSAYPNVVRKETLLEPSDLMFFQ  396

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR++G++KT+LLDRK+IV L D+Y 
Sbjct  397  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFMGYKKTVLLDRKLIVELVDRYT  456

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++ WD FS  +K  H  RMG    R+VI ++PKEED FYANPQEC
Sbjct  457  NGSLRWDEFSALIKVAHAKRMGSASKRMVIPDRPKEEDYFYANPQEC  503



>emb|CDX74265.1| BnaA03g27820D [Brassica napus]
Length=514

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RRL+ L+  FPN+V+KE LL  S L F Q
Sbjct  331  TPEETALTLSALGIDRNVQIYIAAGEIYGGKRRLKALTDVFPNVVRKETLLDSSDLSFCQ  390

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYL+SLESDIFVPTY GNMA+VVEGHRR+LGF+KTI L+RK +V+L D+Y 
Sbjct  391  NHSSQMAALDYLISLESDIFVPTYYGNMAKVVEGHRRFLGFKKTIELNRKFLVNLIDEYY  450

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W++FS ++K  H  RMG PK RLVI  KPKEED FYANP EC
Sbjct  451  QGMLSWEVFSTTVKSFHATRMGGPKKRLVIPNKPKEEDYFYANPYEC  497



>ref|XP_009131492.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Brassica rapa]
Length=535

 Score =   247 bits (630),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN Q+YIAAGEIYGGERR++ L+ AFPN+V+KE LL  S L F +
Sbjct  358  TPEETALTLTALGIDRNVQLYIAAGEIYGGERRMKALTDAFPNVVRKETLLDSSDLDFCR  417

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLV++ESDIFVPT  GNMARVVEGHRR+LGF+KTI L+RK +V L D+Y 
Sbjct  418  NHSSQMAALDYLVAVESDIFVPTNDGNMARVVEGHRRFLGFKKTIQLNRKFLVKLIDEYT  477

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G +TWD+FS+ +K  H  RMG PK RLVI  KPKEED FYANPQEC
Sbjct  478  EGLLTWDVFSSMVKAFHSTRMGSPKRRLVIPNKPKEEDYFYANPQEC  524



>ref|XP_010663502.1| PREDICTED: uncharacterized protein At1g04910-like [Vitis vinifera]
 emb|CBI15357.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL IDRN QIYIAAGEIYGGERR+  L+AA+P +V+KE LL  S L+FFQ
Sbjct  336  TPEETALTLRALDIDRNIQIYIAAGEIYGGERRMATLAAAYPKLVRKETLLESSDLRFFQ  395

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KTILLDR+++V L DQY 
Sbjct  396  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGFKKTILLDRRLLVDLIDQYT  455

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G+++WD FS+++KE+H +RMG P  RLVI ++PKEED FYANPQEC
Sbjct  456  KGSLSWDEFSSAVKESHGDRMGNPIKRLVIPDRPKEEDYFYANPQEC  502



>ref|XP_008230306.1| PREDICTED: uncharacterized protein At1g04910 [Prunus mume]
Length=501

 Score =   246 bits (627),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALGID N QIYIAAGEIYGG RR+ +L +AFPN+V+KE LL PS L+ F 
Sbjct  324  TPEETALVLVALGIDHNVQIYIAAGEIYGGNRRMESLKSAFPNLVRKETLLEPSDLRLFP  383

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQ AALDYLVSLESDIF+PTY GNMA+VVEGHRR+LGF+KT+LLDRK+++   +Q++
Sbjct  384  NHSSQRAALDYLVSLESDIFIPTYDGNMAKVVEGHRRFLGFKKTVLLDRKLLIGSIEQFS  443

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G+++WD FS+ +KE H +RMG PK R+ I +KPKEED FY+NP EC
Sbjct  444  SGSLSWDEFSSIVKEAHADRMGSPKKRVSIADKPKEEDYFYSNPHEC  490



>emb|CDY26456.1| BnaC09g42120D [Brassica napus]
Length=508

 Score =   246 bits (627),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGGERR++ L+ AFPN+V+KE +L  S L F +
Sbjct  331  TPEETALTLTALGIDRNVQIYIAAGEIYGGERRMKALTDAFPNVVRKETILESSDLDFCR  390

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLV++ESDIFVPT  GNMARVVEGHRR+LGF+KTI L+RK +V L D+Y 
Sbjct  391  NHSSQMAALDYLVAVESDIFVPTNDGNMARVVEGHRRFLGFKKTIQLNRKFLVKLIDEYT  450

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G +TWD+FS+ +K  H  RMG PK RLVI  KPKEED FY+NPQEC
Sbjct  451  EGLLTWDVFSSMVKAFHSTRMGSPKRRLVIPNKPKEEDYFYSNPQEC  497



>ref|XP_008357801.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=504

 Score =   246 bits (627),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALGID N QIYIA+GE+YGG RR++ L AAFPN+V+KE LL PS L+FF 
Sbjct  325  TPEETALVLVALGIDHNVQIYIASGEMYGGNRRMQGLKAAFPNLVRKETLLEPSDLRFFL  384

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIF+PTY GNMA+VVEG RR+LGF+KT+LLDR++++ L +Q++
Sbjct  385  NHSSQMAALDYLVSLESDIFIPTYDGNMAKVVEGQRRFLGFKKTVLLDRRLLIGLIEQFS  444

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G+++WD FS  +KE H NR+G PK R+ I +KPKEED FY+NP EC
Sbjct  445  TGSLSWDEFSYIVKEAHANRIGSPKKRVSIPDKPKEEDYFYSNPHEC  491



>ref|XP_010032573.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Eucalyptus 
grandis]
Length=495

 Score =   245 bits (626),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALGIDRN QIYIAAGEIYGGERR+  L ++F N+V+KE LL    LK FQ
Sbjct  318  TPEETALVLDALGIDRNVQIYIAAGEIYGGERRMATLKSSFHNLVRKETLLKTVDLKSFQ  377

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSL SDIF+PTY GNMA+VVEGHRR+LGF+KTI LDRK++V L D+Y 
Sbjct  378  NHSSQMAALDYLVSLASDIFIPTYDGNMAKVVEGHRRFLGFKKTISLDRKLLVGLVDRYM  437

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++ WD FS  +KETH  RMG PK R+VI ++PKEED FYANPQEC
Sbjct  438  NGSLAWDEFSYLVKETHSLRMGSPKLRVVIPDRPKEEDYFYANPQEC  484



>ref|XP_002873739.1| hypothetical protein ARALYDRAFT_488418 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49998.1| hypothetical protein ARALYDRAFT_488418 [Arabidopsis lyrata subsp. 
lyrata]
Length=505

 Score =   245 bits (626),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RR++ L+ AFPN+V+KE LL  S L F +
Sbjct  328  TPEETALTLTALGIDRNVQIYIAAGEIYGGQRRMKALTDAFPNVVRKETLLESSDLDFCR  387

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLV+LESDIFVPT  GNMARVVEGHRR+LGF+KTI L+R+ +V L D+Y 
Sbjct  388  NHSSQMAALDYLVALESDIFVPTNDGNMARVVEGHRRFLGFKKTIQLNRRFLVKLIDEYT  447

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++WD+FS+++K  H  RMG PK RLVI  +PKEED FYANPQEC
Sbjct  448  EGLLSWDVFSSTVKAFHSTRMGSPKRRLVIPNRPKEEDYFYANPQEC  494



>ref|NP_197078.2| O-fucosyltransferase family protein [Arabidopsis thaliana]
 gb|AAY56449.1| At5g15740 [Arabidopsis thaliana]
 dbj|BAE99696.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED92200.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=508

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RR++ L+ AFPN+V+KE LL  S L F +
Sbjct  331  TPEETALTLTALGIDRNVQIYIAAGEIYGGQRRMKALTDAFPNVVRKETLLESSDLDFCR  390

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLV+LESDIFVPT  GNMARVVEGHRR+LGF+KTI L+R+ +V L D+Y 
Sbjct  391  NHSSQMAALDYLVALESDIFVPTNDGNMARVVEGHRRFLGFKKTIQLNRRFLVKLIDEYT  450

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++WD+FS+++K  H  RMG PK RLVI  +PKEED FYANPQEC
Sbjct  451  EGLLSWDVFSSTVKAFHSTRMGSPKRRLVIPNRPKEEDYFYANPQEC  497



>emb|CAC01773.1| putative protein [Arabidopsis thaliana]
Length=505

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RR++ L+ AFPN+V+KE LL  S L F +
Sbjct  328  TPEETALTLTALGIDRNVQIYIAAGEIYGGQRRMKALTDAFPNVVRKETLLESSDLDFCR  387

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLV+LESDIFVPT  GNMARVVEGHRR+LGF+KTI L+R+ +V L D+Y 
Sbjct  388  NHSSQMAALDYLVALESDIFVPTNDGNMARVVEGHRRFLGFKKTIQLNRRFLVKLIDEYT  447

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++WD+FS+++K  H  RMG PK RLVI  +PKEED FYANPQEC
Sbjct  448  EGLLSWDVFSSTVKAFHSTRMGSPKRRLVIPNRPKEEDYFYANPQEC  494



>ref|XP_010032572.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Eucalyptus 
grandis]
 gb|KCW51969.1| hypothetical protein EUGRSUZ_J01413 [Eucalyptus grandis]
Length=511

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALGIDRN QIYIAAGEIYGGERR+  L ++F N+V+KE LL    LK FQ
Sbjct  334  TPEETALVLDALGIDRNVQIYIAAGEIYGGERRMATLKSSFHNLVRKETLLKTVDLKSFQ  393

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSL SDIF+PTY GNMA+VVEGHRR+LGF+KTI LDRK++V L D+Y 
Sbjct  394  NHSSQMAALDYLVSLASDIFIPTYDGNMAKVVEGHRRFLGFKKTISLDRKLLVGLVDRYM  453

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++ WD FS  +KETH  RMG PK R+VI ++PKEED FYANPQEC
Sbjct  454  NGSLAWDEFSYLVKETHSLRMGSPKLRVVIPDRPKEEDYFYANPQEC  500



>gb|KJB80439.1| hypothetical protein B456_013G097700 [Gossypium raimondii]
Length=516

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 134/167 (80%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+ALGID N Q+YIAAG+IYGGERRL  L AA+PN+VKKE LL  S L  F+
Sbjct  324  TPEETALTLRALGIDHNIQVYIAAGDIYGGERRLATLRAAYPNLVKKETLLPSSELDPFR  383

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDY V+++S+ FVPT  GNMA+VVEGHRRYLGF+KTILLDRK +V L D Y 
Sbjct  384  NHSNQMAALDYYVAVQSETFVPTNGGNMAKVVEGHRRYLGFKKTILLDRKAVVDLVDLYK  443

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            AG+I+WD FS+ MKE H +RMG P  RLVI  KPKEED FY NP+EC
Sbjct  444  AGSISWDKFSSEMKEAHADRMGNPAERLVIPGKPKEEDYFYTNPEEC  490



>ref|XP_010464948.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=515

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RRL+ L+  FPN+VKKE LL  S L F Q
Sbjct  333  TPEETALTLSALGIDRNVQIYIAAGEIYGGKRRLKALTDVFPNVVKKETLLDSSDLSFCQ  392

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYL+SLESDIFVPTY GNMA+VVEGHRR+LGF+KTI L+RK +V L D+Y 
Sbjct  393  NHSSQMAALDYLISLESDIFVPTYYGNMAKVVEGHRRFLGFKKTIELNRKFLVKLIDEYY  452

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W++FS+++K  H  RMG PK RLVI  +PKEED FYANP EC
Sbjct  453  EGLLSWEVFSSTVKAFHATRMGGPKRRLVIPNRPKEEDYFYANPYEC  499



>ref|XP_010485466.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=516

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RRL+ L+  FPN+VKKE LL  S L F Q
Sbjct  334  TPEETALTLSALGIDRNVQIYIAAGEIYGGKRRLKALTDVFPNVVKKETLLDSSDLSFCQ  393

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYL+SLESDIFVPTY GNMA+VVEGHRR+LGF+KTI L+RK +V L D+Y 
Sbjct  394  NHSSQMAALDYLISLESDIFVPTYYGNMAKVVEGHRRFLGFKKTIELNRKFLVKLIDEYY  453

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W++FS+++K  H  RMG PK RLVI  +PKEED FYANP EC
Sbjct  454  EGLLSWEVFSSTVKAFHATRMGGPKRRLVIPNRPKEEDYFYANPYEC  500



>ref|XP_009378282.1| PREDICTED: uncharacterized protein At1g04910 [Pyrus x bretschneideri]
Length=505

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALGID N QIYIA+GE+YGG RR++ L AAFPN+V+KE LL PS L++F 
Sbjct  326  TPEETALVLVALGIDHNVQIYIASGEMYGGNRRMQGLKAAFPNLVRKETLLEPSDLRYFP  385

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIF+PTY GNMA+VVEG RR+LGF++T+LLDR++++ L +Q++
Sbjct  386  NHSSQMAALDYLVSLESDIFIPTYDGNMAKVVEGQRRFLGFKRTVLLDRRLLIGLIEQFS  445

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G+++WD FS  +KE H NRMG PK R+ I +KPKEED FY+NP EC
Sbjct  446  TGSLSWDEFSYIVKEAHANRMGNPKKRVPILDKPKEEDYFYSNPHEC  492



>gb|KHN29942.1| DUF246 domain-containing protein [Glycine soja]
Length=383

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 136/171 (80%), Gaps = 0/171 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL IDRN Q+YIAAG+IY  E+R+ +L  AFPN+VKKE LL PS L  F+
Sbjct  210  TPEETALTLRALDIDRNIQVYIAAGDIYKPEKRMASLREAFPNLVKKETLLEPSELDPFR  269

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDY VS+ESDIFVP+Y GNMA++VEGHRRYLGF+KTILL+RK++V L DQY 
Sbjct  270  NHSNQMAALDYYVSIESDIFVPSYKGNMAKLVEGHRRYLGFKKTILLNRKILVKLIDQYK  329

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYSHI  514
             G I W+ FS S+K  H +R+G P TR V+  KPKEED FY+NPQEC S +
Sbjct  330  NGTINWNQFSTSVKVAHSDRVGNPSTRSVVPGKPKEEDYFYSNPQECLSPV  380



>ref|XP_009121550.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
Length=509

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGGERR++ L+ AFPN+V+KE +L  S L F +
Sbjct  332  TPEETALTLTALGIDRNVQIYIAAGEIYGGERRMKALTDAFPNVVRKETILESSDLDFCR  391

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLV++ESDIFVPT  GNMARVVEGHRR+LGF+KTI L+RK +V L D+Y 
Sbjct  392  NHSSQMAALDYLVAVESDIFVPTNEGNMARVVEGHRRFLGFKKTIQLNRKFLVKLIDEYT  451

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G +TWD+FS+ +K  H  RMG PK RL+I  KPKEED FY+NPQEC
Sbjct  452  EGLLTWDVFSSMVKAFHSTRMGSPKRRLLIPNKPKEEDYFYSNPQEC  498



>ref|XP_003522979.2| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
 gb|KHN02637.1| DUF246 domain-containing protein [Glycine soja]
Length=523

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL I ++ QIYIAAGEIYGG++R+ +L+  +P +V+KE LL PS L+FFQ
Sbjct  346  TPEETALTLRALDIGQSIQIYIAAGEIYGGDKRMASLAKNYPKLVRKETLLEPSDLQFFQ  405

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLGF+KTILL+RK++V L D+Y+
Sbjct  406  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGFKKTILLNRKLLVDLIDRYH  465

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECY  505
             G + WD FS+++KE H +RMG    RLVI ++PKEED FYANP+EC+
Sbjct  466  DGILNWDEFSSAVKEVHADRMGGATKRLVIPDRPKEEDYFYANPEECF  513



>ref|XP_010463624.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=515

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RRL+ L+  FPN+V+KE LL  S L F Q
Sbjct  333  TPEETALTLSALGIDRNVQIYIAAGEIYGGKRRLKALTDVFPNVVRKETLLDSSDLSFCQ  392

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYL+SLESDIFVPTY GNMA+VVEGHRR+LGF+KTI L+RK +V L D+Y 
Sbjct  393  NHSSQMAALDYLISLESDIFVPTYYGNMAKVVEGHRRFLGFKKTIELNRKFLVKLIDEYY  452

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W++FS+++K  H  RMG PK RLVI  +PKEED FYANP EC
Sbjct  453  EGLLSWEVFSSTVKAFHSTRMGGPKRRLVIPNRPKEEDYFYANPYEC  499



>gb|KFK37682.1| hypothetical protein AALP_AA3G015000 [Arabis alpina]
Length=514

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RRL+ L+  FPN+V+KE LL  S L F Q
Sbjct  332  TPEETALTLSALGIDRNVQIYIAAGEIYGGKRRLKALTDVFPNVVRKETLLDSSDLSFCQ  391

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYL+SLESDIFVPTY GNMA+VVEGHRR+LGF+KTI L+RK +V L D+Y 
Sbjct  392  NHSSQMAALDYLISLESDIFVPTYYGNMAKVVEGHRRFLGFKKTIELNRKFLVELIDEYY  451

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W++FS ++K  H  RMG PK RLVI  +PKEED FYANP EC
Sbjct  452  EGLLSWEVFSTTVKAFHATRMGGPKKRLVIPNRPKEEDYFYANPYEC  498



>emb|CDX70637.1| BnaC03g07210D [Brassica napus]
Length=510

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN Q+YIAAGEIYGGERR++ L+ AFPN+V+KE LL  S L F +
Sbjct  333  TPEETALTLTALGIDRNVQLYIAAGEIYGGERRMKALTDAFPNVVRKETLLDSSDLDFCR  392

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLV++ESDIFVPT  GNMARVVEGHRR+LGF+KT+ L+RK +V L D++ 
Sbjct  393  NHSSQMAALDYLVAVESDIFVPTNDGNMARVVEGHRRFLGFKKTVQLNRKFLVKLIDEFI  452

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G +TWD+FS+ +K  H  RMG PK RLVI  KPKEED FYANPQEC
Sbjct  453  EGLLTWDVFSSMVKAFHSTRMGSPKRRLVIPNKPKEEDYFYANPQEC  499



>ref|NP_566168.2| O-fucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAL07153.1| putative auxin-independent growth promoter protein [Arabidopsis 
thaliana]
 gb|AAM98167.1| putative auxin-independent growth promoter [Arabidopsis thaliana]
 gb|AEE73784.1| O-fucosyltransferase-like protein [Arabidopsis thaliana]
Length=512

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RRL+ L+  FPN+V+KE LL  S L F +
Sbjct  331  TPEETALTLSALGIDRNVQIYIAAGEIYGGKRRLKALTDVFPNVVRKETLLDSSDLSFCK  390

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYL+SLESDIFVPTY GNMA+VVEGHRR+LGF+KTI L+RK++V L D+Y 
Sbjct  391  NHSSQMAALDYLISLESDIFVPTYYGNMAKVVEGHRRFLGFKKTIELNRKLLVKLIDEYY  450

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W++FS ++K  H  RMG PK RLVI  KPKEED FYANP EC
Sbjct  451  EGLLSWEVFSTTVKAFHATRMGGPKRRLVIPNKPKEEDYFYANPYEC  497



>gb|KFK25799.1| hypothetical protein AALP_AA8G162600 [Arabis alpina]
Length=505

 Score =   244 bits (622),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RR++ L+ AFPN+V+KE LL  S L F +
Sbjct  328  TPEETALTLTALGIDRNVQIYIAAGEIYGGQRRMKALTDAFPNVVRKETLLASSDLDFCR  387

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLV+LESDIFVPT  GNMARVVEGHRR+LGF+KTI L+R+ +V L D+Y 
Sbjct  388  NHSSQMAALDYLVALESDIFVPTNDGNMARVVEGHRRFLGFKKTIQLNRRFLVKLIDEYT  447

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
               +TWD+FS+++K  H  RMG PK RLVI  +PKEED FYANPQEC
Sbjct  448  ERLLTWDVFSSTVKAFHSPRMGSPKRRLVIPNRPKEEDYFYANPQEC  494



>ref|XP_006408431.1| hypothetical protein EUTSA_v10020530mg [Eutrema salsugineum]
 gb|ESQ49884.1| hypothetical protein EUTSA_v10020530mg [Eutrema salsugineum]
Length=513

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 134/167 (80%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RRL+ L+  FPN+V+KE LL  S L F Q
Sbjct  331  TPEETALTLSALGIDRNVQIYIAAGEIYGGKRRLKALTDVFPNVVRKETLLDSSDLSFCQ  390

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYL+SLESDIFVPTY GNMA+VVEGHRR+LGF+KTI L+RK +V L D+Y 
Sbjct  391  NHSSQMAALDYLISLESDIFVPTYYGNMAKVVEGHRRFLGFKKTIELNRKFLVKLIDEYY  450

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W++FS  +K  H  RMG PK RLVI  KPKEED FYANP EC
Sbjct  451  EGLLSWEVFSTMVKAFHATRMGGPKKRLVIPNKPKEEDYFYANPYEC  497



>ref|XP_006297456.1| hypothetical protein CARUB_v10013476mg [Capsella rubella]
 gb|EOA30354.1| hypothetical protein CARUB_v10013476mg [Capsella rubella]
Length=513

 Score =   244 bits (622),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RRL+ L+  FPN+V+KE LL  S L F Q
Sbjct  331  TPEETALTLSALGIDRNVQIYIAAGEIYGGKRRLKALTDVFPNVVRKETLLDSSDLSFCQ  390

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYL+SLESDIFVPTY GNMA+VVEGHRR+LGF+KTI L+RK +V L D+Y 
Sbjct  391  NHSSQMAALDYLISLESDIFVPTYYGNMAKVVEGHRRFLGFKKTIELNRKFLVKLIDEYY  450

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W++FS ++K  H  RMG PK RLVI  +PKEED FYANP EC
Sbjct  451  EGLLSWEVFSTTVKAFHATRMGGPKRRLVIPNRPKEEDYFYANPYEC  497



>emb|CDY34713.1| BnaA01g33120D [Brassica napus]
Length=466

 Score =   243 bits (619),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RRL+ L+  FPN+V+KE LL  S L F +
Sbjct  283  TPEETALTLSALGIDRNVQIYIAAGEIYGGKRRLKALTDVFPNVVRKETLLDSSDLSFCK  342

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYL+SLESDIFVPTY GNMA+VVEGHRR+LGF+KTI L+RK +V+L D+Y 
Sbjct  343  NHSSQMAALDYLISLESDIFVPTYYGNMAKVVEGHRRFLGFKKTIELNRKFLVNLIDEYY  402

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W++FS  +K  H  RMG PK RLVI  KPKEED FYANP EC
Sbjct  403  QGLVSWEVFSTRVKAFHATRMGGPKKRLVIPNKPKEEDYFYANPYEC  449



>ref|XP_002884311.1| hypothetical protein ARALYDRAFT_896190 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60570.1| hypothetical protein ARALYDRAFT_896190 [Arabidopsis lyrata subsp. 
lyrata]
Length=513

 Score =   244 bits (622),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RRL+ L+  FPN+V+KE LL  S L F Q
Sbjct  331  TPEETALTLSALGIDRNVQIYIAAGEIYGGKRRLKALTDVFPNVVRKETLLDSSDLSFCQ  390

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYL+SLESDIFVPTY GNMA+VVEGHRR+LGF+KTI L+RK +V L D+Y 
Sbjct  391  NHSSQMAALDYLISLESDIFVPTYYGNMAKVVEGHRRFLGFKKTIELNRKFLVKLIDEYY  450

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W++FS ++K  H  RMG PK RLVI  +PKEED FYANP EC
Sbjct  451  EGLLSWEVFSTTVKAFHATRMGGPKRRLVIPNRPKEEDYFYANPYEC  497



>ref|XP_008374671.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=529

 Score =   244 bits (623),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 142/167 (85%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL AL IDR+ QIYIAAGEIYG ERR+ +L  AFP +V+KE LL PS L+FFQ
Sbjct  352  TPEETALTLSALDIDRDIQIYIAAGEIYGAERRMASLREAFPKLVRKETLLEPSDLRFFQ  411

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KTILLDR+++V L D+Y 
Sbjct  412  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGFKKTILLDRRLLVDLIDRYT  471

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G++ WD FS+++KE H NRMGKP  RL+I ++PKEED FYANP+EC
Sbjct  472  SGSLNWDEFSSAVKEAHANRMGKPTNRLMIQDRPKEEDYFYANPEEC  518



>ref|XP_003595703.1| ATP synthase subunit a chloroplastic [Medicago truncatula]
Length=698

 Score =   247 bits (631),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+A  ID+N QIYIAAGEIYGG RR+ +L+  +P +V+KE LL PS L+FFQ
Sbjct  340  TPEETALALRAFDIDQNIQIYIAAGEIYGGSRRMASLAKNYPKLVRKETLLEPSELQFFQ  399

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLGFRKTILL+RK++V L DQY 
Sbjct  400  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGFRKTILLNRKLLVELIDQYT  459

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G + W+ FS+++K++H +RMG    RLVI ++PKEED FYANP EC
Sbjct  460  SGALNWEEFSSAVKQSHADRMGGATKRLVIPDRPKEEDYFYANPDEC  506



>emb|CDX69504.1| BnaA10g18530D [Brassica napus]
Length=509

 Score =   243 bits (620),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RR++ L+ AFPN+V+KE +L  S L F +
Sbjct  332  TPEETALTLTALGIDRNVQIYIAAGEIYGGDRRMKALTDAFPNVVRKETILESSDLDFCR  391

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLV++ESDIFVPT  GNMARVVEGHRR+LGF+KTI L+RK +V L D+Y 
Sbjct  392  NHSSQMAALDYLVAVESDIFVPTNDGNMARVVEGHRRFLGFKKTIQLNRKFLVKLIDEYT  451

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G +TWD+FS+ +K  H  RMG PK RL+I  KPKEED FY+NPQEC
Sbjct  452  EGLLTWDVFSSMVKAFHSTRMGSPKRRLLIPNKPKEEDYFYSNPQEC  498



>gb|KJB39974.1| hypothetical protein B456_007G040500 [Gossypium raimondii]
Length=511

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+AL ID+N+QIYIAAGEIYGG++R+ +L+AA+P +V+KE LLGPS L FFQ
Sbjct  334  TPEETALILRALDIDKNYQIYIAAGEIYGGDKRMASLAAAYPKLVRKETLLGPSDLGFFQ  393

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIF+PTY GNMA+VV+GHRRYLGF++TILLDR+++V L DQYN
Sbjct  394  NHSSQMAALDYLVSLESDIFIPTYDGNMAKVVQGHRRYLGFKQTILLDRRLLVDLIDQYN  453

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G+++W  FS+++KETH  R G+P  RLVI ++PKEED FYANP+EC
Sbjct  454  NGSLSWIQFSDAVKETHERRRGQPSKRLVIPDRPKEEDYFYANPEEC  500



>emb|CDX70647.1| BnaC03g07310D [Brassica napus]
Length=507

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN Q+YIAAGEIYGGERR++ L+ AFPN V+KE LL  S L F +
Sbjct  331  TPEETALTLTALGIDRNVQLYIAAGEIYGGERRMKALTDAFPN-VRKETLLDSSDLDFCR  389

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLV++ESDIFVPT  GNMARVVEGHRR+LGF+KTI L+RK +V L D+Y 
Sbjct  390  NHSSQMAALDYLVAVESDIFVPTNDGNMARVVEGHRRFLGFKKTIQLNRKFLVKLIDEYT  449

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G +TWD+FS+ +K  H  RMG PK RLVI  KPKEED FYANPQEC
Sbjct  450  EGLLTWDVFSSMVKAFHSTRMGSPKRRLVIPNKPKEEDYFYANPQEC  496



>ref|XP_002462529.1| hypothetical protein SORBIDRAFT_02g027470 [Sorghum bicolor]
 gb|EER99050.1| hypothetical protein SORBIDRAFT_02g027470 [Sorghum bicolor]
Length=498

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 139/167 (83%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+ALGIDR++QIYIAAGEIYGG+RR+  L++A+P++V+KE LL PS L  FQ
Sbjct  324  TPEETALVLQALGIDRSYQIYIAAGEIYGGQRRMAALTSAYPSVVRKETLL-PSELSLFQ  382

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDY+VSLESDIF+PTY GNMA+VVEGHRRYLGF+KT+LLDR+ IV L D+Y 
Sbjct  383  NHSSQMAALDYMVSLESDIFIPTYDGNMAKVVEGHRRYLGFKKTVLLDRRHIVELVDEYR  442

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W  FS+++  +H +RMG+P  R +I +KPKEED FYANP EC
Sbjct  443  NGTLSWTDFSSAVMASHISRMGEPSRRQMIPDKPKEEDYFYANPHEC  489



>ref|XP_010031163.1| PREDICTED: uncharacterized protein At1g04910-like [Eucalyptus 
grandis]
 gb|KCW83773.1| hypothetical protein EUGRSUZ_B00644 [Eucalyptus grandis]
Length=496

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTLKAL IDR  QIYIAAGEIYGGE R+  L+  +P +VKKE +L  S LK F 
Sbjct  329  TPEETALTLKALDIDRKMQIYIAAGEIYGGEERMATLARTYPKLVKKETILESSDLKAFH  388

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESD+FVPTY GNMA+VVEGHRR+LGF+KT+LLDR+++V L DQ++
Sbjct  389  NHSSQMAALDYLVSLESDVFVPTYNGNMAKVVEGHRRFLGFKKTLLLDRRLLVELIDQFS  448

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             GN++W+ FS+++KE H  R+G P  RLVI ++PKEE+ FYANPQEC
Sbjct  449  NGNLSWEDFSSAVKEAHAFRVGNPTRRLVIPDRPKEEEYFYANPQEC  495



>ref|XP_004299271.1| PREDICTED: uncharacterized protein At1g04910-like [Fragaria vesca 
subsp. vesca]
Length=516

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL AL ID N QIYIAAGEIYG ERR+ +L+ AFP +V+KE LL PS L+FFQ
Sbjct  333  TPEETALTLSALEIDPNIQIYIAAGEIYGAERRMASLAKAFPKLVRKETLLEPSDLRFFQ  392

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KTILLDR+++V L DQYN
Sbjct  393  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGFKKTILLDRRLLVDLIDQYN  452

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G + WD FS+++KE H  RMG P  RL+I ++PKEED FYANP+EC
Sbjct  453  SGELNWDEFSSAVKEAHAERMGNPTKRLMIQDRPKEEDYFYANPEEC  499



>emb|CDY43245.1| BnaC05g48380D [Brassica napus]
Length=450

 Score =   239 bits (611),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 133/167 (80%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RRL+ L+  FPN+V+KE LL  S L F +
Sbjct  268  TPEETALTLSALGIDRNVQIYIAAGEIYGGKRRLKALTDVFPNVVRKETLLDSSDLSFCK  327

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
               SQMAALDYL+SLESDIFVPTY GNMA+VVEGHRR+LGF+KTI L RK +V L D+Y 
Sbjct  328  NRSSQMAALDYLISLESDIFVPTYYGNMAKVVEGHRRFLGFKKTIELKRKFLVDLIDEYY  387

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W++FS  +K +H  RMG PK RLVI  KPKEED FYANP EC
Sbjct  388  EGLLSWEVFSTRVKASHGTRMGGPKKRLVIPSKPKEEDYFYANPYEC  434



>emb|CDY60465.1| BnaAnng16790D [Brassica napus]
Length=450

 Score =   239 bits (611),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 133/167 (80%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RRL+ L+  FPN+V+KE LL  S L F +
Sbjct  268  TPEETALTLSALGIDRNVQIYIAAGEIYGGKRRLKALTDVFPNVVRKETLLDSSDLSFCK  327

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
               SQMAALDYL+SLESDIFVPTY GNMA+VVEGHRR+LGF+KTI L RK +V L D+Y 
Sbjct  328  NRSSQMAALDYLISLESDIFVPTYYGNMAKVVEGHRRFLGFKKTIELKRKFLVDLIDEYY  387

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W++FS  +K +H  RMG PK RLVI  KPKEED FYANP EC
Sbjct  388  EGLLSWEVFSTRVKASHGTRMGGPKKRLVIPSKPKEEDYFYANPYEC  434



>ref|XP_006574968.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=493

 Score =   240 bits (613),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 136/171 (80%), Gaps = 0/171 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL IDRN Q+YIAAG+IY  E+R+ +L  AFPN+VKKE LL PS L  F+
Sbjct  320  TPEETALTLRALDIDRNIQVYIAAGDIYKPEKRMASLREAFPNLVKKETLLEPSELDPFR  379

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDY VS+ESDIFVP+Y GNMA++VEGHRRYLGF+KTILL+RK++V L DQY 
Sbjct  380  NHSNQMAALDYYVSIESDIFVPSYKGNMAKLVEGHRRYLGFKKTILLNRKILVKLIDQYK  439

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYSHI  514
             G I W+ FS S+K  H +R+G P TR V+  KPKEED FY+NPQEC S +
Sbjct  440  NGTINWNQFSTSVKVAHSDRVGNPSTRSVVPGKPKEEDYFYSNPQECLSPV  490



>gb|KEH25156.1| GDP-fucose O-fucosyltransferase-like protein [Medicago truncatula]
Length=513

 Score =   241 bits (614),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL LKAL ID+N QIYIAAGEI+GG+RR+  L A +PN+V+KE LL PS L +FQ
Sbjct  340  TPEETALILKALDIDQNIQIYIAAGEIFGGKRRMARLRATYPNLVRKETLLEPSDLMYFQ  399

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF++TILLDRK +V L D Y 
Sbjct  400  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGFKRTILLDRKHLVPLIDLYM  459

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
              +++WD FS  +K++H  RMG PK R++I  +PKEED FY+NP EC
Sbjct  460  NKSLSWDEFSIKVKKSHAKRMGNPKRRVIIPNRPKEEDYFYSNPHEC  506



>gb|KHG22838.1| hypothetical protein F383_00632 [Gossypium arboreum]
Length=548

 Score =   241 bits (616),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+AL ID+N+ IYIAAGEIYGG+RR+ +L+AA+P +V+KE LLGPS L FFQ
Sbjct  334  TPEETALILRALDIDKNYHIYIAAGEIYGGDRRMASLAAAYPKLVRKETLLGPSDLGFFQ  393

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIF+PTY GNMA+VV+GHRRYLGF++TILLDR+++V L DQYN
Sbjct  394  NHSSQMAALDYLVSLESDIFIPTYDGNMAKVVQGHRRYLGFKQTILLDRRLLVDLIDQYN  453

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G+++W  FS+++KETH  R G+P  RLVI ++PKEED FYANP+EC
Sbjct  454  NGSLSWIQFSDTVKETHERRRGQPSKRLVIPDRPKEEDYFYANPEEC  500



>ref|XP_009147366.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
Length=514

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 133/167 (80%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL ALGIDRN QIYIAAGEIYGG+RRL+ L+  FPN+V+KE LL  S L F +
Sbjct  332  TPEETALTLSALGIDRNVQIYIAAGEIYGGKRRLKALTDVFPNVVRKETLLDSSDLSFCK  391

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
               SQMAALDYL+SLESDIFVPTY GNMA+VVEGHRR+LGF+KTI L RK +V L D+Y 
Sbjct  392  NRSSQMAALDYLISLESDIFVPTYYGNMAKVVEGHRRFLGFKKTIELKRKFLVDLIDEYY  451

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W++FS  +K +H  RMG PK RLVI  KPKEED FYANP EC
Sbjct  452  EGLLSWEVFSTRVKASHGTRMGGPKKRLVIPSKPKEEDYFYANPYEC  498



>ref|XP_004507283.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Cicer arietinum]
 ref|XP_004507284.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Cicer arietinum]
 ref|XP_004507285.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Cicer arietinum]
Length=517

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 134/167 (80%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L AL IDR+ QIYIAAGEI+GGE+R+  L A +PN+V+KE LL PS L++FQ
Sbjct  340  TPEETALILTALDIDRSIQIYIAAGEIFGGEKRMAPLRATYPNLVRKETLLEPSDLRYFQ  399

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LG+++TILLDRK +V L D Y 
Sbjct  400  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGYKRTILLDRKQLVPLIDLYT  459

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
              +++W  FS  +K+ H  RMG PKTR+VI  KPKEED FYANP EC
Sbjct  460  NNSLSWGDFSIKVKKVHAKRMGNPKTRIVIPYKPKEEDYFYANPHEC  506



>gb|EPS59387.1| hypothetical protein M569_15421, partial [Genlisea aurea]
Length=301

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 143/172 (83%), Gaps = 1/172 (1%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL ID ++QIYIAAGEIYGGERRL  L+ ++PN+V+KE LLG S L+FFQ
Sbjct  122  TPEETALTLRALKIDPSYQIYIAAGEIYGGERRLAALTFSYPNLVRKETLLGSSELRFFQ  181

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESD+FVPTY GNMA+VVEGHRRYLG++KTILLDR+++V L D+YN
Sbjct  182  NHSSQMAALDYLVSLESDVFVPTYDGNMAKVVEGHRRYLGYKKTILLDRRLLVDLIDKYN  241

Query  362  AGNITWDMFSNSMKETHRNRMGKP-KTRLVITEKPKEEDNFYANPQECYSHI  514
            AG ++WD FS  +++ H  RMG P + R+ I ++PKEED FYANP EC S +
Sbjct  242  AGMVSWDEFSTKVQQIHSERMGNPTRRRVAIPDRPKEEDYFYANPVECLSTL  293



>ref|XP_008379462.1| PREDICTED: uncharacterized protein At1g04910 [Malus domestica]
Length=503

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALGID N QIYIA+GE+YGG RR++ L AAFPN+V K NLL PS L+FF 
Sbjct  325  TPEETALVLVALGIDHNVQIYIASGEMYGGNRRMQGLKAAFPNLVSK-NLLEPSDLRFFL  383

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIF+PTY GNMA+VVEG RR+LGF+KT+LLDR++++ L +Q++
Sbjct  384  NHSSQMAALDYLVSLESDIFIPTYDGNMAKVVEGQRRFLGFKKTVLLDRRLLIGLIEQFS  443

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G+++WD FS  +KE H NR G PK R+ I +KPKEED FY+NP EC
Sbjct  444  TGSLSWDEFSYIVKEAHANRXGSPKKRVSIPDKPKEEDYFYSNPHEC  490



>ref|XP_004508646.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Cicer arietinum]
Length=544

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 139/198 (70%), Gaps = 31/198 (16%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMV---------------  136
            TPEETALTL+AL IDRN QIYIAAGEIYGGERR  +LS  +P +V               
Sbjct  336  TPEETALTLRALDIDRNIQIYIAAGEIYGGERRTTSLSKEYPKLVNFIAKGSMVNFVLLL  395

Query  137  ----------------KKENLLGPSALKFFQGHLSQMAALDYLVSLESDIFVPTYAGNMA  268
                            +KE LL PS L+FFQ H SQMAALDYLVSLESDIFVPTY GNMA
Sbjct  396  FYVLTVCLSTLLFVQVRKETLLEPSDLRFFQNHSSQMAALDYLVSLESDIFVPTYDGNMA  455

Query  269  RVVEGHRRYLGFRKTILLDRKVIVHLTDQYNAGNITWDMFSNSMKETHRNRMGKPKTRLV  448
            +VVEGHRRYLGF+KTILL+RK++V L DQYN G + WD FS+++K+ H  RMG    RLV
Sbjct  456  KVVEGHRRYLGFKKTILLNRKLLVDLIDQYNNGVLNWDQFSSAVKKAHARRMGSSSKRLV  515

Query  449  ITEKPKEEDNFYANPQEC  502
            I +KPKEED FY+NP+EC
Sbjct  516  ILDKPKEEDYFYSNPEEC  533



>gb|KDP31393.1| hypothetical protein JCGZ_11769 [Jatropha curcas]
Length=491

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 142/167 (85%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL ID N QIYIAAGEIYGGERR+ +L+ A+P +V+KE LL PS L+FFQ
Sbjct  310  TPEETALTLRALDIDPNIQIYIAAGEIYGGERRMASLATAYPKLVRKETLLEPSDLRFFQ  369

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KTILLDR+++V L D+Y+
Sbjct  370  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGFKKTILLDRRLLVDLIDRYS  429

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++WD FS +++E H NRMG P  RLVI ++PKEED FY+NP+EC
Sbjct  430  NGLLSWDEFSYAVREAHSNRMGNPTKRLVIPDRPKEEDYFYSNPEEC  476



>ref|XP_009346329.1| PREDICTED: uncharacterized protein At1g04910-like [Pyrus x bretschneideri]
Length=531

 Score =   239 bits (609),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL AL IDR+ QIYIAAGEIYG ERR+ +L  AFP +V+KE LL PS L+FFQ
Sbjct  354  TPEETALTLSALDIDRDIQIYIAAGEIYGAERRMASLREAFPKLVRKETLLEPSDLRFFQ  413

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRR+LGF+KTILLDR+++V L D+Y 
Sbjct  414  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRFLGFKKTILLDRRLLVDLIDRYT  473

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G + WD FS+++K  H NRMGKP  RL+I ++PKEED FYANP+EC
Sbjct  474  SGLLNWDEFSSAVKGAHANRMGKPTNRLMIQDRPKEEDYFYANPEEC  520



>ref|XP_008651776.1| PREDICTED: uncharacterized protein LOC100384451 isoform X1 [Zea 
mays]
 tpg|DAA61926.1| TPA: hypothetical protein ZEAMMB73_619275 [Zea mays]
Length=497

 Score =   238 bits (606),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+ALGIDR +QIYIAAGEIYGG+RR+  L++A+PN+V+KE LL P  +  FQ
Sbjct  322  TPEETALVLQALGIDRGYQIYIAAGEIYGGQRRMAALTSAYPNVVRKETLL-PWEVGLFQ  380

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDY+VSLESD+F+PTY GNMA+VVEGHRRYLGFRKT+LLDR+ IV L D+Y 
Sbjct  381  NHSSQMAALDYMVSLESDVFIPTYDGNMAKVVEGHRRYLGFRKTVLLDRRRIVELVDEYR  440

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G + W  FS+++  +H +RMG+P  R  + ++PKEED FYANP EC
Sbjct  441  NGTLRWTDFSSAVMASHTSRMGEPSRRQTVPDRPKEEDYFYANPHEC  487



>ref|XP_011012033.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Populus euphratica]
Length=509

 Score =   238 bits (606),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL ID N Q+YIAAGEIYGGERR+ +L++A+P +V+KE LL PS LK+FQ
Sbjct  333  TPEETALTLRALDIDPNMQVYIAAGEIYGGERRMSSLASAYPKLVRKETLLEPSDLKYFQ  392

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLV+LESDIFVPTY GNMA+VVEGHRR+LGF+KTILLDR+++V L D+Y 
Sbjct  393  NHSSQMAALDYLVALESDIFVPTYDGNMAKVVEGHRRFLGFKKTILLDRRLLVDLIDRYT  452

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++ WD FS ++KE+H +RMG P  RLVI ++PKEED FY+NP+EC
Sbjct  453  NGSLNWDEFSYAVKESHSDRMGGPMKRLVIPDRPKEEDYFYSNPEEC  499



>ref|XP_002321469.2| hypothetical protein POPTR_0015s03540g [Populus trichocarpa]
 gb|EEF05596.2| hypothetical protein POPTR_0015s03540g [Populus trichocarpa]
Length=487

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL ID N QIY+AAGEIYGG+RR+ +L+A++P +V+KE LL PS L+FFQ
Sbjct  310  TPEETALTLRALDIDPNMQIYVAAGEIYGGDRRMASLAASYPKLVRKETLLEPSDLRFFQ  369

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLV+LESDIFVPTY GNMA+VVEGHRR+LGF+KTILLDR+++V L D+Y 
Sbjct  370  NHSSQMAALDYLVALESDIFVPTYDGNMAKVVEGHRRFLGFKKTILLDRRLLVDLIDRYT  429

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++TWD FS  +KE+H +RMG P  RLVI ++PKEED FY+NP+EC
Sbjct  430  NGSLTWDEFSYYVKESHADRMGGPTKRLVILDRPKEEDYFYSNPEEC  476



>ref|XP_011012032.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Populus euphratica]
Length=509

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL ID N Q+YIAAGEIYGGERR+ +L++A+P +V+KE LL PS LK+FQ
Sbjct  333  TPEETALTLRALDIDPNMQVYIAAGEIYGGERRMSSLASAYPKLVRKETLLEPSDLKYFQ  392

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLV+LESDIFVPTY GNMA+VVEGHRR+LGF+KTILLDR+++V L D+Y 
Sbjct  393  NHSSQMAALDYLVALESDIFVPTYDGNMAKVVEGHRRFLGFKKTILLDRRLLVDLIDRYT  452

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++ WD FS ++KE+H +RMG P  RLVI ++PKEED FY+NP+EC
Sbjct  453  NGSLNWDEFSYAVKESHSDRMGGPMKRLVIPDRPKEEDYFYSNPEEC  499



>ref|XP_007153464.1| hypothetical protein PHAVU_003G0377001g, partial [Phaseolus vulgaris]
 gb|ESW25458.1| hypothetical protein PHAVU_003G0377001g, partial [Phaseolus vulgaris]
Length=351

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 132/167 (79%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL AL ID N Q+YIAAG+ Y  E+R+ +L  AFPNMVKKE LL PS L  F+
Sbjct  177  TPEETALTLSALNIDSNIQVYIAAGDTYKSEKRMASLKEAFPNMVKKETLLEPSELDPFR  236

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDY VS+ESDIFVP+Y GNMA++VEG+RRYLGF+KTILL+RK++V+L DQY 
Sbjct  237  NHANQMAALDYCVSIESDIFVPSYQGNMAKLVEGNRRYLGFKKTILLNRKLLVNLIDQYK  296

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G+I+W+ FS S+K  H  R+G P TR V+  KPKEED FY NPQEC
Sbjct  297  NGSISWNQFSMSVKVAHAERIGNPTTRSVVPGKPKEEDYFYTNPQEC  343



>gb|KHN09725.1| DUF246 domain-containing protein [Glycine soja]
Length=394

 Score =   234 bits (597),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 135/171 (79%), Gaps = 0/171 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL IDRN Q+YIAAG+IY  E+R+ +L  AFPN+VKKE LL P+ L  F+
Sbjct  221  TPEETALTLRALDIDRNIQVYIAAGDIYKPEKRMASLKEAFPNLVKKETLLEPTELDPFR  280

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDY VS+ESDIFVP+Y GNMA++VEGHRRYLGF+KTILL+RK++V L D+Y 
Sbjct  281  NHSNQMAALDYYVSIESDIFVPSYIGNMAKLVEGHRRYLGFKKTILLNRKILVKLIDKYK  340

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYSHI  514
             G I W+ FS S+K  H +R+G P TR ++  KPKEED FY NPQEC S +
Sbjct  341  NGIINWNQFSTSVKVAHADRVGNPITRSMVPGKPKEEDYFYTNPQECLSPV  391



>ref|XP_002317951.2| hypothetical protein POPTR_0012s12420g [Populus trichocarpa]
 gb|EEE96171.2| hypothetical protein POPTR_0012s12420g [Populus trichocarpa]
Length=509

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL ID N Q+YIAAGEIYGGERR+ +L++A+P +V+KE LL PS L++FQ
Sbjct  333  TPEETALTLRALDIDPNIQVYIAAGEIYGGERRMSSLASAYPKLVRKETLLEPSDLRYFQ  392

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLV+LESDIFVPTY GNMA+VVEGHRR+LGF+KTILLDR+++V L D+Y 
Sbjct  393  NHSSQMAALDYLVALESDIFVPTYDGNMAKVVEGHRRFLGFKKTILLDRRLLVDLIDRYT  452

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++ WD FS ++KE+H +RMG P  RLVI ++PKEED FY+NP+EC
Sbjct  453  NGSLNWDEFSYAVKESHSDRMGGPMKRLVIPDRPKEEDYFYSNPEEC  499



>ref|XP_011011552.1| PREDICTED: uncharacterized protein At1g04910-like [Populus euphratica]
 ref|XP_011011553.1| PREDICTED: uncharacterized protein At1g04910-like [Populus euphratica]
Length=487

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL ID N QIY+AAGEIYGG+RR+ +L+A++P +V+KE LL PS LK+FQ
Sbjct  310  TPEETALTLRALDIDPNMQIYVAAGEIYGGDRRMASLAASYPKLVRKETLLEPSDLKYFQ  369

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLV+LESDIFVPTY GNMA+VVEGHRR+LGF+KTILLDR+++V L D+Y 
Sbjct  370  NHSSQMAALDYLVALESDIFVPTYDGNMAKVVEGHRRFLGFKKTILLDRRLLVDLIDRYT  429

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++TWD FS+ +KE+H +RMG P  R VI ++PKEED FY+NP+EC
Sbjct  430  NGSLTWDEFSSYVKESHSDRMGGPTKRSVILDRPKEEDYFYSNPEEC  476



>ref|NP_001170458.1| uncharacterized protein LOC100384451 [Zea mays]
 gb|ACN37056.1| unknown [Zea mays]
 tpg|DAA61925.1| TPA: hypothetical protein ZEAMMB73_619275 [Zea mays]
Length=527

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+ALGIDR +QIYIAAGEIYGG+RR+  L++A+PN+V+KE LL P  +  FQ
Sbjct  352  TPEETALVLQALGIDRGYQIYIAAGEIYGGQRRMAALTSAYPNVVRKETLL-PWEVGLFQ  410

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDY+VSLESD+F+PTY GNMA+VVEGHRRYLGFRKT+LLDR+ IV L D+Y 
Sbjct  411  NHSSQMAALDYMVSLESDVFIPTYDGNMAKVVEGHRRYLGFRKTVLLDRRRIVELVDEYR  470

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G + W  FS+++  +H +RMG+P  R  + ++PKEED FYANP EC
Sbjct  471  NGTLRWTDFSSAVMASHTSRMGEPSRRQTVPDRPKEEDYFYANPHEC  517



>gb|KDO83012.1| hypothetical protein CISIN_1g010411mg [Citrus sinensis]
 gb|KDO83013.1| hypothetical protein CISIN_1g010411mg [Citrus sinensis]
Length=319

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE AL L+ALGID++  IYIAAGEIYGGE+RL  L AAFP +V+KE LL P+ L+ FQ
Sbjct  124  TPEEAALVLQALGIDKDTHIYIAAGEIYGGEKRLAALRAAFPRIVRKEMLLDPAELQLFQ  183

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALD++VS  SDIF+PTY GNMA+VVEGHRRYLGF+K+ILLDRK++V L D ++
Sbjct  184  NHSSQMAALDFMVSTASDIFIPTYDGNMAKVVEGHRRYLGFKKSILLDRKILVGLLDMHH  243

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYS  508
             G ++++ F+ +++  H  RMG+P  R VI +KPKEED FYANPQEC+ 
Sbjct  244  NGTLSFNEFTVAVRLAHEKRMGQPTRRRVIADKPKEEDYFYANPQECFC  292



>ref|XP_002973416.1| hypothetical protein SELMODRAFT_148957 [Selaginella moellendorffii]
 gb|EFJ25790.1| hypothetical protein SELMODRAFT_148957 [Selaginella moellendorffii]
Length=470

 Score =   234 bits (598),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+ALG   + Q+YIAAGEIYG +RR+  L AAFPN+V+KE LL P+ L+ F 
Sbjct  292  TPEETALVLRALGYSNSTQLYIAAGEIYGSQRRMLALQAAFPNIVRKEMLLTPAELRPFY  351

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESD+FVPTY GNMA+V EGHRRYLGFRKT+ LDRKVI+ L DQ  
Sbjct  352  NHSSQMAALDYLVSLESDVFVPTYDGNMAKVAEGHRRYLGFRKTVQLDRKVIIDLVDQLR  411

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G I+WD FS ++K+ H+ RMG PK R V  ++PKEED FY+NP EC
Sbjct  412  DGAISWDEFSIAIKQAHKFRMGMPKRRRVFPDRPKEEDYFYSNPHEC  458



>ref|XP_010678381.1| PREDICTED: uncharacterized protein At1g04910-like [Beta vulgaris 
subsp. vulgaris]
Length=526

 Score =   236 bits (601),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEET L L+AL ID ++QIYIAAGEIYGGERR  +L+ A+P +V+KE LL P+ L+FFQ
Sbjct  350  TPEETTLALRALDIDPSYQIYIAAGEIYGGERRTASLAEAYPKLVRKETLLDPADLRFFQ  409

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIFVPTY GNMA+VVEGHRRYLG++KTILLDR+++V L D+Y 
Sbjct  410  NHSSQMAALDYLVSLESDIFVPTYDGNMAKVVEGHRRYLGYKKTILLDRRLLVDLIDKYT  469

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G++TWD FS ++KETH +R G+P  RLVI ++PKEED FY+NPQEC
Sbjct  470  VGSLTWDEFSLAVKETHAHRSGQPTKRLVIPDRPKEEDYFYSNPQEC  516



>ref|XP_002976491.1| hypothetical protein SELMODRAFT_105694 [Selaginella moellendorffii]
 gb|EFJ22160.1| hypothetical protein SELMODRAFT_105694 [Selaginella moellendorffii]
Length=486

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+ALG   + Q+YIAAGEIYG +RR+  L AAFPN+V+KE LL P+ L+ F 
Sbjct  308  TPEETALVLRALGYSNSTQLYIAAGEIYGSQRRMLALQAAFPNIVRKEMLLTPAELRPFY  367

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESD+FVPTY GNMA+V EGHRRYLGFRKT+ LDRKVI+ L DQ  
Sbjct  368  NHSSQMAALDYLVSLESDVFVPTYDGNMAKVAEGHRRYLGFRKTVQLDRKVIIDLVDQLR  427

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G I+WD FS ++K+ H+ RMG PK R V  ++PKEED FY+NP EC
Sbjct  428  DGAISWDEFSIAIKQAHKFRMGMPKRRRVFPDRPKEEDYFYSNPHEC  474



>ref|XP_004298341.2| PREDICTED: uncharacterized protein At1g04910-like [Fragaria vesca 
subsp. vesca]
Length=490

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 132/171 (77%), Gaps = 0/171 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+AL ID + QIYIAAG+IYGGE+R+ +L  AFP++VKKE LL  S L+ F+
Sbjct  313  TPEETALALRALDIDPSMQIYIAAGDIYGGEKRMASLRLAFPHIVKKETLLEASELEPFR  372

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDYLVSLESDIF PTY GNMARVVEGHRRYLGFR TI LDR ++V+L DQY 
Sbjct  373  NHSNQMAALDYLVSLESDIFAPTYGGNMARVVEGHRRYLGFRTTIRLDRMLLVNLIDQYK  432

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYSHI  514
             G ++WD FS ++K  H +RMG P  RL I  KPKEED FY NPQEC   I
Sbjct  433  KGRLSWDEFSQAVKTGHADRMGTPTRRLEIPGKPKEEDYFYNNPQECLPPI  483



>ref|XP_003517877.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=521

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 135/171 (79%), Gaps = 0/171 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETALTL+AL IDRN Q+YIAAG+IY  E+R+ +L  AFPN+VKKE LL P+ L  F+
Sbjct  348  TPEETALTLRALDIDRNIQVYIAAGDIYKPEKRMASLKEAFPNLVKKETLLEPTELDPFR  407

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDY VS+ESDIFVP+Y GNMA++VEGHRRYLGF+KTILL+RK++V L D+Y 
Sbjct  408  NHSNQMAALDYYVSIESDIFVPSYIGNMAKLVEGHRRYLGFKKTILLNRKILVKLIDKYK  467

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYSHI  514
             G I W+ FS S+K  H +R+G P TR ++  KPKEED FY NPQEC S +
Sbjct  468  NGIINWNQFSTSVKVAHADRVGNPITRSMVPGKPKEEDYFYTNPQECLSPV  518



>ref|XP_009592905.1| PREDICTED: uncharacterized protein At1g04910 [Nicotiana tomentosiformis]
Length=502

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 132/167 (79%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE AL L+ALG +++ QIYIA+G+IYGGERRL  L AAFP +VKKE LL P  L+ FQ
Sbjct  316  TPEEAALILQALGFEKDIQIYIASGDIYGGERRLAALRAAFPKIVKKEMLLDPGELRQFQ  375

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALD++VS  S++FVPTY GNMA+VVEGHRRYLGFRKTI LDRK +V L D + 
Sbjct  376  NHSSQMAALDFIVSTASNVFVPTYDGNMAKVVEGHRRYLGFRKTIRLDRKRLVQLLDLHQ  435

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G +TWD F+ +++++H  RMG+P  R VI +KPKEED FYANPQEC
Sbjct  436  NGTLTWDEFTAAVRQSHEGRMGQPTRRRVIADKPKEEDYFYANPQEC  482



>gb|KDO83011.1| hypothetical protein CISIN_1g010411mg [Citrus sinensis]
Length=398

 Score =   230 bits (587),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE AL L+ALGID++  IYIAAGEIYGGE+RL  L AAFP +V+KE LL P+ L+ FQ
Sbjct  203  TPEEAALVLQALGIDKDTHIYIAAGEIYGGEKRLAALRAAFPRIVRKEMLLDPAELQLFQ  262

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALD++VS  SDIF+PTY GNMA+VVEGHRRYLGF+K+ILLDRK++V L D ++
Sbjct  263  NHSSQMAALDFMVSTASDIFIPTYDGNMAKVVEGHRRYLGFKKSILLDRKILVGLLDMHH  322

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYS  508
             G ++++ F+ +++  H  RMG+P  R VI +KPKEED FYANPQEC+ 
Sbjct  323  NGTLSFNEFTVAVRLAHEKRMGQPTRRRVIADKPKEEDYFYANPQECFC  371



>ref|XP_007224025.1| hypothetical protein PRUPE_ppa015128mg [Prunus persica]
 gb|EMJ25224.1| hypothetical protein PRUPE_ppa015128mg [Prunus persica]
Length=526

 Score =   234 bits (596),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+AL ID N Q+YIAAG+IY  ERR+  L  AFPN+VKKE L+  S L  FQ
Sbjct  347  TPEETALALRALDIDPNIQVYIAAGDIYRAERRMAPLKEAFPNLVKKETLVEASDLVPFQ  406

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDY VS+ESDIFVPTY GNMA+VVEGHRRYLG++KTILLDR+V+V L DQYN
Sbjct  407  NHSNQMAALDYYVSIESDIFVPTYGGNMAKVVEGHRRYLGYKKTILLDRRVLVDLIDQYN  466

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W+ FS  +K  H +RMG P TRL +  KPKEED F++NPQEC
Sbjct  467  NGTLSWNQFSVRVKAAHADRMGNPTTRLEVPGKPKEEDYFHSNPQEC  513



>ref|XP_007224653.1| hypothetical protein PRUPE_ppa026308mg [Prunus persica]
 gb|EMJ25852.1| hypothetical protein PRUPE_ppa026308mg [Prunus persica]
Length=522

 Score =   233 bits (594),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 132/167 (79%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+AL ID   Q+YIAAG+IYGGERR+ +L  AFP+MVKKE+LL  S L+ F+
Sbjct  345  TPEETALALRALDIDPGIQVYIAAGDIYGGERRMTSLRLAFPHMVKKESLLRASDLEPFR  404

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDY+VSLESDIFVPTY GNMARVVEGHRRYLGFR TI +DR ++V L DQY 
Sbjct  405  KHSNQMAALDYIVSLESDIFVPTYGGNMARVVEGHRRYLGFRTTIRVDRMLLVDLIDQYK  464

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++WD FS ++K  H +RMG P  RL I  KPKEE+NFY NP+EC
Sbjct  465  NGTLSWDEFSQAVKTGHADRMGIPTQRLEIPGKPKEEENFYNNPEEC  511



>ref|XP_007045744.1| O-fucosyltransferase family protein, putative [Theobroma cacao]
 gb|EOY01576.1| O-fucosyltransferase family protein, putative [Theobroma cacao]
Length=527

 Score =   233 bits (594),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETA+ L+A GI+ N QIYIAAG+IYGGERRL +L A +PN+VKKE LL PS LK FQ
Sbjct  340  TPEETAIALRAFGINPNIQIYIAAGDIYGGERRLASLRAFYPNLVKKETLLPPSDLKPFQ  399

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             + +QMAALDYLVSL+SDIF+PTY GNMA++VEGHRR+LG+++TI LDR V++ L DQY 
Sbjct  400  NYSNQMAALDYLVSLDSDIFLPTYGGNMAKLVEGHRRFLGYKRTISLDRLVLISLIDQYK  459

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W  FS S+K  H NRMG P  RL    KPK+ED FY NPQEC
Sbjct  460  NGTLSWSEFSQSVKAAHANRMGNPSQRLQFPGKPKQEDYFYTNPQEC  506



>ref|XP_004239107.1| PREDICTED: uncharacterized protein At1g04910 [Solanum lycopersicum]
Length=503

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 133/167 (80%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE AL L+ALG D++ QIYIA+G+IYGGERRL +L AAFP +VKK+ LL P  L+ FQ
Sbjct  317  TPEEAALILQALGFDKDIQIYIASGDIYGGERRLASLRAAFPKIVKKDMLLAPGELQHFQ  376

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALD++VS  S++FVPTY GNMA+VVEGHRRYLGF+KTILLDRK +V L D + 
Sbjct  377  NHSSQMAALDFIVSTASNVFVPTYDGNMAKVVEGHRRYLGFKKTILLDRKRLVELLDLHQ  436

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++WD F+ +++++H  RMG+   R VI +KPKEED FYANPQEC
Sbjct  437  NGTLSWDEFTATVRQSHEGRMGQLSRRRVIADKPKEEDYFYANPQEC  483



>ref|XP_009776724.1| PREDICTED: uncharacterized protein At1g04910 [Nicotiana sylvestris]
Length=502

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE AL L+ALG +++ QIYIA+G+IYGGERRL  L AAFP +VKKE LL P  L+ FQ
Sbjct  316  TPEEAALILQALGFEKDVQIYIASGDIYGGERRLAALRAAFPKIVKKEMLLDPGELRQFQ  375

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALD++VS  S++FVPTY GNMA+VVEGHRRYLGFRKTI LDRK +V L D + 
Sbjct  376  NHSSQMAALDFIVSTASNVFVPTYDGNMAKVVEGHRRYLGFRKTIRLDRKRLVQLLDMHQ  435

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G + WD F+ +++++H  RMG+P  R VI +KPKEED FYANPQEC
Sbjct  436  NGTLPWDEFTTAVRQSHEGRMGQPTRRKVIADKPKEEDYFYANPQEC  482



>ref|XP_009356548.1| PREDICTED: uncharacterized protein At1g04910-like [Pyrus x bretschneideri]
Length=519

 Score =   231 bits (589),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 131/172 (76%), Gaps = 0/172 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+AL ID   Q+YIAAG+IYGGERR+ +L  AFP+MVKKE LL  S L+ F 
Sbjct  342  TPEETALALRALDIDPGIQVYIAAGDIYGGERRMASLRLAFPHMVKKETLLQSSDLEPFW  401

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDY+VSLESDIFV +Y GNMA VVEGHRRYLGFR TI L RK++V LTDQY 
Sbjct  402  NHSNQMAALDYMVSLESDIFVSSYKGNMASVVEGHRRYLGFRTTIRLHRKLLVELTDQYK  461

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYSHIL  517
             G+++WD FS ++K  H NRMG P  RL I  KPKEE+ FY NPQEC   I+
Sbjct  462  NGSLSWDEFSQAVKTGHANRMGSPTQRLEIPGKPKEEEYFYNNPQECLPQIV  513



>gb|KJB06911.1| hypothetical protein B456_001G066600 [Gossypium raimondii]
 gb|KJB06913.1| hypothetical protein B456_001G066600 [Gossypium raimondii]
Length=492

 Score =   231 bits (588),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEET L L+AL I+ ++QIYIAAGEIYGG RR+ +L++A+P +V+KE LL PS L FFQ
Sbjct  314  TPEETVLILRALDIENSYQIYIAAGEIYGGNRRMASLASAYPKLVRKETLLEPSDLGFFQ  373

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIF+PTY GNMA+VVEGHRR+LG+++TILLDR+++V L DQYN
Sbjct  374  NHSSQMAALDYLVSLESDIFIPTYDGNMAKVVEGHRRFLGYKQTILLDRRLLVDLIDQYN  433

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G+++W+ FSN++KE+H+ R G+P  R VI ++PKEED FYANP+EC
Sbjct  434  SGSLSWNEFSNAVKESHKYRKGQPTQRSVIPDRPKEEDYFYANPEEC  480



>ref|XP_006483112.1| PREDICTED: uncharacterized protein At1g04910-like [Citrus sinensis]
Length=511

 Score =   231 bits (589),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE AL L+ALGID++  IYIAAGEIYGGE+RL  L AAFP +V+KE LL P+ L+ FQ
Sbjct  316  TPEEAALVLQALGIDKDAHIYIAAGEIYGGEKRLAALRAAFPRIVRKEMLLDPAELQLFQ  375

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALD++VS  SDIF+PTY GNMA+VVEGHRRYLGF+K+ILLDRK++V L D ++
Sbjct  376  NHSSQMAALDFMVSTASDIFIPTYDGNMAKVVEGHRRYLGFKKSILLDRKILVGLLDMHH  435

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYS  508
             G ++++ F+ +++  H+ RMG+P  R VI +KPKEED FYANPQEC+ 
Sbjct  436  NGTLSFNEFTVAVRLAHKKRMGQPTRRRVIADKPKEEDYFYANPQECFC  484



>gb|EMT11779.1| hypothetical protein F775_16558 [Aegilops tauschii]
Length=352

 Score =   226 bits (577),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 128/167 (77%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE AL LKALG  ++  IYIA+GEIYGGERRL  L AA+PN+V+KE LL    L  FQ
Sbjct  173  TPEEIALVLKALGFSKDTLIYIASGEIYGGERRLAALKAAYPNLVRKEKLLSSDELWPFQ  232

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDY+VS+ S++F+P+Y GNMARVVEGHRRY GFRKTILLDR  +V L D + 
Sbjct  233  NHSTQMAALDYMVSIASNVFIPSYDGNMARVVEGHRRYSGFRKTILLDRTKLVELLDHFQ  292

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G+++WD FS ++KE H+ RMG+P  R  I  +PKEED FYANPQEC
Sbjct  293  GGSLSWDEFSAAVKEAHQYRMGQPTDRRAIPGRPKEEDYFYANPQEC  339



>ref|XP_010523472.1| PREDICTED: uncharacterized protein At1g04910 [Tarenaya hassleriana]
Length=500

 Score =   230 bits (587),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE AL LKALG  ++ QIYIAAGEIYG ERRL  L  AFP +VKKE LLGP+ L+ FQ
Sbjct  315  TPEEAALALKALGFQKDIQIYIAAGEIYGSERRLAVLREAFPRIVKKEMLLGPAELQQFQ  374

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALD++VS+ S+ F+PTY GNMA++VEGHRRYLGF+KTILLDRK +V L D + 
Sbjct  375  NHSSQMAALDFIVSVASNTFIPTYYGNMAKLVEGHRRYLGFKKTILLDRKRLVGLIDLHQ  434

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
               ++WD F+ +++E H  RMG+P  R VI++KPKEED FYANPQEC
Sbjct  435  NKTLSWDQFAEAVREAHEGRMGEPTHRRVISDKPKEEDYFYANPQEC  481



>ref|XP_008243882.1| PREDICTED: uncharacterized protein At1g04910-like [Prunus mume]
Length=497

 Score =   230 bits (586),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+AL ID   Q+YIAAG+IYGGERR+ +L  AFP+MVKKE+LL  S L+ F+
Sbjct  320  TPEETALALRALDIDPGIQVYIAAGDIYGGERRMASLRLAFPHMVKKESLLRASDLEPFR  379

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDY+VSLESDIFVPTY GNMARVVEGHRRYLGFR TI +DR ++V L DQY 
Sbjct  380  KHSNQMAALDYIVSLESDIFVPTYGGNMARVVEGHRRYLGFRTTIRVDRMLLVDLIDQYK  439

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++WD FS ++K  H + MG P  RL I  KPKEE+NFY NP+EC
Sbjct  440  NGTLSWDEFSQAVKTGHADCMGIPTQRLEIPGKPKEEENFYNNPEEC  486



>gb|KDO83010.1| hypothetical protein CISIN_1g010411mg [Citrus sinensis]
Length=511

 Score =   230 bits (586),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE AL L+ALGID++  IYIAAGEIYGGE+RL  L AAFP +V+KE LL P+ L+ FQ
Sbjct  316  TPEEAALVLQALGIDKDTHIYIAAGEIYGGEKRLAALRAAFPRIVRKEMLLDPAELQLFQ  375

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALD++VS  SDIF+PTY GNMA+VVEGHRRYLGF+K+ILLDRK++V L D ++
Sbjct  376  NHSSQMAALDFMVSTASDIFIPTYDGNMAKVVEGHRRYLGFKKSILLDRKILVGLLDMHH  435

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYS  508
             G ++++ F+ +++  H  RMG+P  R VI +KPKEED FYANPQEC+ 
Sbjct  436  NGTLSFNEFTVAVRLAHEKRMGQPTRRRVIADKPKEEDYFYANPQECFC  484



>ref|XP_006438745.1| hypothetical protein CICLE_v10031276mg [Citrus clementina]
 gb|ESR51985.1| hypothetical protein CICLE_v10031276mg [Citrus clementina]
Length=511

 Score =   230 bits (586),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE AL L+ALGID++  IYIAAGEIYGGE+RL  L AAFP +V+KE LL P+ L+ FQ
Sbjct  316  TPEEAALVLQALGIDKDAHIYIAAGEIYGGEKRLAALRAAFPRIVRKEMLLDPAELQLFQ  375

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALD++VS  SDIF+PTY GNMA+VVEGHRRYLGF+K+ILLDRK++V L D ++
Sbjct  376  NHSSQMAALDFMVSTASDIFIPTYDGNMAKVVEGHRRYLGFKKSILLDRKILVGLLDMHH  435

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYS  508
             G ++++ F+ +++  H  RMG+P  R VI +KPKEED FYANPQEC+ 
Sbjct  436  NGTLSFNEFTVAVRLAHEKRMGQPTRRRVIADKPKEEDYFYANPQECFC  484



>emb|CDY62211.1| BnaCnng39590D [Brassica napus]
Length=499

 Score =   229 bits (585),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 128/167 (77%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE AL LKALG D+N QIYIAAGEIYG E RL  L  AFP +VKKE LL  S L+ FQ
Sbjct  311  TPEEVALVLKALGFDKNTQIYIAAGEIYGSEHRLSVLREAFPRIVKKEMLLESSELQQFQ  370

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALD++VS+ S+ F+PTY GNMA+VVEGHRRYLGF+KTILLDRK +V L D +N
Sbjct  371  NHSSQMAALDFMVSVASNTFIPTYDGNMAKVVEGHRRYLGFKKTILLDRKRLVELLDLHN  430

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
               +TWD F+ ++KE H  R G P  R VI++KPKEED FYANPQEC
Sbjct  431  NSTLTWDQFAVAVKEAHERRTGAPTHRRVISDKPKEEDYFYANPQEC  477



>ref|XP_004968329.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Setaria italica]
Length=493

 Score =   229 bits (585),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE  L LKALG  ++  IYIA+GEIYGGERRL  L  A+P +V+KE +L P  L+ FQ
Sbjct  316  TPEEITLVLKALGFTKDTLIYIASGEIYGGERRLAALKTAYPKLVRKEKILSPDELRPFQ  375

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDY+VSL SDIF+P+Y GNMARVVEGHRR++GFRKTI+LDRK +V L D + 
Sbjct  376  NHSTQMAALDYMVSLASDIFIPSYDGNMARVVEGHRRHMGFRKTIVLDRKKLVELLDLFQ  435

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++WD FS+++KE H++RMG+P  R ++  +PKEED FYANPQEC
Sbjct  436  GGALSWDEFSDAVKEAHKSRMGQPTERKIMPGQPKEEDYFYANPQEC  482



>gb|KHG17083.1| hypothetical protein F383_22070 [Gossypium arboreum]
Length=492

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+AL ID ++QIYIAAGEIY G RR+ +L++A+P +V+KE LL PS L FFQ
Sbjct  314  TPEETALILRALDIDNSYQIYIAAGEIYSGNRRMASLASAYPKLVRKETLLEPSDLGFFQ  373

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDYLVSLESDIF+PTY GNMA+VVEGHRR+LG+++TILLDR+++V L DQYN
Sbjct  374  NHSSQMAALDYLVSLESDIFIPTYDGNMAKVVEGHRRFLGYKQTILLDRRLLVDLIDQYN  433

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            +G+++W+ FSN++KE+H+ R G+P  R V+ ++PKEED F+ANP+EC
Sbjct  434  SGSLSWNEFSNAVKESHKYRKGQPTQRSVLPDRPKEEDYFFANPEEC  480



>dbj|BAJ87723.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=488

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 130/167 (78%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE AL LKALG  ++  IYIA+GEIYGGERRL  L AA+PN+V+KE LL P  L+ FQ
Sbjct  311  TPEEIALVLKALGFSKDTLIYIASGEIYGGERRLAALRAAYPNLVRKEKLLSPDELRPFQ  370

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDY+VS+ S++F+P+Y GNMARVVEGHRRY GFRKTILLDR  +V L D + 
Sbjct  371  NHSTQMAALDYMVSIASNVFIPSYDGNMARVVEGHRRYSGFRKTILLDRTKLVELLDHFQ  430

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G+++W  FS ++KE H+NRMG+P  R  I  +PKEED FY+NPQEC
Sbjct  431  GGSLSWVEFSAAVKEAHQNRMGQPTDRRAIPGRPKEEDYFYSNPQEC  477



>ref|XP_008793370.1| PREDICTED: uncharacterized protein At1g04910-like [Phoenix dactylifera]
Length=499

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 132/167 (79%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE +L L+ALG  R+ QIYIA+GEIYGGERRL  L AA+P M +KE LL P  L+ FQ
Sbjct  330  TPEEISLVLQALGFTRDTQIYIASGEIYGGERRLAALRAAYPKMARKEMLLSPDELRPFQ  389

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDYLVS+ SD+F+P+Y GNMA+VVEGHRR+ GFRKTILLDRK +V L D   
Sbjct  390  NHSTQMAALDYLVSVASDVFIPSYDGNMAKVVEGHRRFTGFRKTILLDRKELVKLLDLLG  449

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++WD FSN+++E H+NRMG+P  R VI  +PKEEDNFYANPQEC
Sbjct  450  DGKLSWDQFSNAVQEVHKNRMGRPTVRKVIPGQPKEEDNFYANPQEC  496



>ref|XP_009356547.1| PREDICTED: uncharacterized protein At1g04910-like [Pyrus x bretschneideri]
Length=499

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 130/171 (76%), Gaps = 0/171 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+AL ID N Q+YIAAG+IY  ERR+  L  AFPN+V+KE L   S L  FQ
Sbjct  320  TPEETALALRALDIDPNIQLYIAAGDIYKAERRMAPLKEAFPNLVRKETLAEASDLLPFQ  379

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDY VS++SDIFVPTY GNMA+VVEGHRRYLGF+KTILLDRKV+V L D YN
Sbjct  380  SHSNQMAALDYYVSIKSDIFVPTYGGNMAKVVEGHRRYLGFKKTILLDRKVLVDLVDLYN  439

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYSHI  514
             G+++W+ FS  +K  H +RMG P TRL +  KPK ED FY NPQEC + I
Sbjct  440  NGSVSWNEFSFGVKAAHADRMGNPTTRLEVPGKPKLEDYFYTNPQECLAPI  490



>ref|XP_008673663.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Zea mays]
Length=415

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE  L LKALG  ++  IYIA+GEIYGGERRL  L AA+P +V+KE +L P  L+ FQ
Sbjct  238  TPEEITLVLKALGFTKDTLIYIASGEIYGGERRLAVLKAAYPKLVRKEKILSPDELRPFQ  297

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDY+VSL SDIF+P+Y GNMARVVEGHRRY+ FRKTI+LDRK +V L D + 
Sbjct  298  NHSTQMAALDYMVSLASDIFIPSYDGNMARVVEGHRRYMDFRKTIVLDRKKLVELLDLFQ  357

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++WD FS+++KE HR+R G+P  R V+  +PKEED FYANP EC
Sbjct  358  GGALSWDEFSDAVKEAHRSRTGQPAERKVVPGQPKEEDYFYANPLEC  404



>ref|XP_004968328.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Setaria italica]
Length=521

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE  L LKALG  ++  IYIA+GEIYGGERRL  L  A+P +V+KE +L P  L+ FQ
Sbjct  344  TPEEITLVLKALGFTKDTLIYIASGEIYGGERRLAALKTAYPKLVRKEKILSPDELRPFQ  403

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDY+VSL SDIF+P+Y GNMARVVEGHRR++GFRKTI+LDRK +V L D + 
Sbjct  404  NHSTQMAALDYMVSLASDIFIPSYDGNMARVVEGHRRHMGFRKTIVLDRKKLVELLDLFQ  463

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++WD FS+++KE H++RMG+P  R ++  +PKEED FYANPQEC
Sbjct  464  GGALSWDEFSDAVKEAHKSRMGQPTERKIMPGQPKEEDYFYANPQEC  510



>ref|XP_003569202.1| PREDICTED: uncharacterized protein At1g04910-like [Brachypodium 
distachyon]
Length=479

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 127/167 (76%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE  L LKALG  ++  IYIA+GEIYGGERRL  L AA+P +V+KE LL P  L+ FQ
Sbjct  302  TPEEITLVLKALGFTKDTLIYIASGEIYGGERRLATLKAAYPKLVRKERLLSPDELRPFQ  361

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDY+VS+ SD+F+P+Y GNMARVVEGHRRY GFRKTILLDR  +V L D + 
Sbjct  362  NHSTQMAALDYMVSIASDVFIPSYDGNMARVVEGHRRYTGFRKTILLDRVKLVELLDLFK  421

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++WD FS ++ E H+NRMG+P  R  I  +PKEED FYANPQEC
Sbjct  422  GGALSWDEFSAAVMEAHQNRMGQPTDRRTIPGRPKEEDYFYANPQEC  468



>ref|XP_002312261.1| hypothetical protein POPTR_0008s09010g [Populus trichocarpa]
 gb|EEE89628.1| hypothetical protein POPTR_0008s09010g [Populus trichocarpa]
Length=493

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 128/167 (77%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+ALG D++ QIYIAAGEIYG ERRL  L AA+P  V+KE LL    L+ FQ
Sbjct  307  TPEETALILQALGFDKDTQIYIAAGEIYGSERRLAVLRAAYPRTVRKEMLLDSGELQQFQ  366

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALD++VS+ SD F+PTY GNMA+VVEGHRRYLGF+KT+LLDRK +V L D + 
Sbjct  367  NHSSQMAALDFMVSIASDTFIPTYDGNMAKVVEGHRRYLGFKKTVLLDRKRLVELMDLHQ  426

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G +TW+ F  +++  H  RMGKP  R VI +KPKEED FYANPQEC
Sbjct  427  IGTLTWNEFVFAVRSAHEKRMGKPTRRRVIADKPKEEDYFYANPQEC  473



>ref|XP_002457274.1| hypothetical protein SORBIDRAFT_03g004640 [Sorghum bicolor]
 gb|EES02394.1| hypothetical protein SORBIDRAFT_03g004640 [Sorghum bicolor]
Length=493

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE  L LKALG  ++  IYIA+GEIYGGERRL  L  A+P +V+KE +L P  L+ FQ
Sbjct  316  TPEEITLVLKALGFTKDTLIYIASGEIYGGERRLAVLKDAYPKLVRKEKILSPDELRPFQ  375

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDY+VSL SDIF+P+Y GNMARVVEGHRRY+GF KTI LDRK +V L D + 
Sbjct  376  NHSTQMAALDYMVSLASDIFIPSYDGNMARVVEGHRRYMGFHKTIGLDRKKLVELLDLFQ  435

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++WD FS+++KE H++RMG+P  R VI  +PKEED FYANPQEC
Sbjct  436  GGALSWDEFSDAVKEAHKSRMGQPTERKVIPGQPKEEDYFYANPQEC  482



>gb|EMS47451.1| hypothetical protein TRIUR3_25287 [Triticum urartu]
Length=393

 Score =   224 bits (572),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE AL LKALG  ++  IYIA+GEIYGGERRL  L AA+PN+V+KE LL  + L  FQ
Sbjct  214  TPEEIALVLKALGFSKDTLIYIASGEIYGGERRLAALKAAYPNLVRKEKLLSSNELWPFQ  273

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDY+VS+ S++F+P+Y GNMAR+VEGHRRY GFRKTILLDR  +V L D + 
Sbjct  274  NHSTQMAALDYMVSIASNVFIPSYDGNMARLVEGHRRYSGFRKTILLDRTKLVELLDHFQ  333

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G+++WD FS ++KE H+ RMG+P  R  I  +PKEED FYANPQEC
Sbjct  334  GGSLSWDEFSAAVKEAHQYRMGQPTDRRAIPGQPKEEDYFYANPQEC  380



>ref|XP_002522480.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39972.1| conserved hypothetical protein [Ricinus communis]
Length=520

 Score =   228 bits (581),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 130/167 (78%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+ALG D+  QIYIAAGEIYG E RL  L AAFP +V+KE LL P+ L+ FQ
Sbjct  320  TPEETALILQALGFDKETQIYIAAGEIYGSESRLAALRAAFPLIVRKEMLLDPAELQQFQ  379

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALD++VS+ S+ F+PTY GNMA+VVEGHRRYLGF+KTILLDRK +V L D + 
Sbjct  380  NHSSQMAALDFMVSIASNTFIPTYDGNMAKVVEGHRRYLGFKKTILLDRKKLVELLDLHQ  439

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G +TW+ F+ +++  H  RMG+P  R VI +KPKEED FYANPQEC
Sbjct  440  NGTLTWNKFAVAVQAAHEKRMGQPSRRKVIADKPKEEDYFYANPQEC  486



>emb|CDP00368.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   228 bits (580),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEET+L LKALG DR+ QIYIA+GEIYG  RRL  L  AFP +VKKE LL P  L+ FQ
Sbjct  322  TPEETSLILKALGFDRDTQIYIASGEIYGSARRLAALRTAFPRIVKKEMLLDPEDLRQFQ  381

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALD++VS+ S+ FVPTY GNMARVVEGHRRYLGF++TI LDRK +V L D + 
Sbjct  382  NHSSQMAALDFIVSVASNTFVPTYDGNMARVVEGHRRYLGFKRTIQLDRKRLVALLDLHQ  441

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G I+WD FS +++  H +RMG+P  R V+ +KPKEED FYANPQEC
Sbjct  442  NGTISWDEFSVAVRLAHESRMGQPARRRVLVDKPKEEDYFYANPQEC  488



>ref|XP_006378582.1| hypothetical protein POPTR_0010s17200g [Populus trichocarpa]
 gb|ERP56379.1| hypothetical protein POPTR_0010s17200g [Populus trichocarpa]
Length=496

 Score =   227 bits (579),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALG D++ QIYIAAGEIYG ERRL  LSAA+P +V+KE LL P  L+ FQ
Sbjct  310  TPEETALILLALGFDKDTQIYIAAGEIYGSERRLAVLSAAYPRIVRKEMLLDPGELQQFQ  369

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALD++VS+ SD F+PTY GNMA+VVEGHRRY GF+KTILLDRK +V L D + 
Sbjct  370  NHSSQMAALDFMVSIASDTFIPTYDGNMAKVVEGHRRYRGFKKTILLDRKRLVELLDLHQ  429

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W+ F+ ++   H  RMG+P  R VI +KPKEED FYANPQEC
Sbjct  430  NGTLSWNEFAVAVGSAHEKRMGQPTRRRVIADKPKEEDYFYANPQEC  476



>gb|EEC70012.1| hypothetical protein OsI_00561 [Oryza sativa Indica Group]
Length=486

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE  L LKALG  ++  IYIA+GEIYGGERRL  L AA+P +V+KE LL P  L+ FQ
Sbjct  309  TPEEITLVLKALGFKKDTLIYIASGEIYGGERRLAALKAAYPRLVRKEKLLSPEELQPFQ  368

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDY+VS+ SD+F+P+Y GNMARVVEGHRRY GFRKTILLDR  +V L D + 
Sbjct  369  NHSTQMAALDYMVSIASDVFIPSYDGNMARVVEGHRRYTGFRKTILLDRVKLVELLDSFQ  428

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W+ FS ++K+ H++RMG+P  R VI  +PKEED FYANPQEC
Sbjct  429  GGAMSWNEFSAAVKKAHQHRMGQPTERKVIPGRPKEEDYFYANPQEC  475



>gb|KDP41238.1| hypothetical protein JCGZ_15645 [Jatropha curcas]
Length=506

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L+ALG ++  QIYIAAGEIYG ERRL  L AAFP +V+KE LL P  L+ FQ
Sbjct  320  TPEETALVLQALGFNKETQIYIAAGEIYGSERRLTALRAAFPWIVRKEMLLDPVELQLFQ  379

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALD++VS+ S  F+PTY GNMA+VVEGHRRYLGF+KTILLDRK IV L D + 
Sbjct  380  NHSSQMAALDFMVSIASTTFIPTYDGNMAKVVEGHRRYLGFKKTILLDRKRIVELVDLHQ  439

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W+ F+ +++ TH  R G+P  R VI +KPKEED FYANPQEC
Sbjct  440  NGTLSWNEFAAAVQATHEKRRGQPTHRRVIADKPKEEDYFYANPQEC  486



>ref|XP_010938112.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=511

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 137/173 (79%), Gaps = 0/173 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE +L L+ALG   + QIYIA+GEIYGGERRL  L AA+PN+V+KE LL P  L+ FQ
Sbjct  329  TPEEISLVLQALGFAGDTQIYIASGEIYGGERRLAALRAAYPNIVRKEMLLSPDELRPFQ  388

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDYLVS+ SD+F+P+Y GNMA+VVEGHRR+ GFR+TILLDRK +V+L D  N
Sbjct  389  NHSTQMAALDYLVSVASDVFIPSYDGNMAKVVEGHRRFAGFRQTILLDRKELVNLLDLLN  448

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYSHILS  520
             G ++WD FSN+++E H+NRMG+P  R VI  +PKEEDNFYANPQEC   + S
Sbjct  449  DGKLSWDEFSNAVQEVHKNRMGQPTVRKVIPGRPKEEDNFYANPQECLPPLRS  501



>ref|XP_008673661.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Zea mays]
 tpg|DAA53288.1| TPA: hypothetical protein ZEAMMB73_126891 [Zea mays]
Length=491

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE  L LKALG  ++  IYIA+GEIYGGERRL  L AA+P +V+KE +L P  L+ FQ
Sbjct  314  TPEEITLVLKALGFTKDTLIYIASGEIYGGERRLAVLKAAYPKLVRKEKILSPDELRPFQ  373

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDY+VSL SDIF+P+Y GNMARVVEGHRRY+ FRKTI+LDRK +V L D + 
Sbjct  374  NHSTQMAALDYMVSLASDIFIPSYDGNMARVVEGHRRYMDFRKTIVLDRKKLVELLDLFQ  433

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++WD FS+++KE HR+R G+P  R V+  +PKEED FYANP EC
Sbjct  434  GGALSWDEFSDAVKEAHRSRTGQPAERKVVPGQPKEEDYFYANPLEC  480



>ref|XP_011075536.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Sesamum indicum]
Length=500

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 130/167 (78%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE AL L+ALG D+  QIYIA+GEIYGGERRL  L AAFP ++KKE LL P  L+ FQ
Sbjct  314  TPEEMALILQALGFDKETQIYIASGEIYGGERRLAALRAAFPRILKKEMLLDPDDLRQFQ  373

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALD++VS+ S+IF+PTY GNMARVVEGHRR+ GF+KTI LDR+ +V L D + 
Sbjct  374  NHSSQMAALDFMVSVASNIFIPTYDGNMARVVEGHRRFRGFKKTIQLDRRRLVELLDLHQ  433

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             GN++WD FS +++  H  RMG+P  R VI +KPKEED FYANPQEC
Sbjct  434  NGNLSWDGFSVAVRLAHERRMGQPTLRRVIADKPKEEDYFYANPQEC  480



>ref|XP_002315033.2| hypothetical protein POPTR_0010s17200g [Populus trichocarpa]
 gb|EEF01204.2| hypothetical protein POPTR_0010s17200g [Populus trichocarpa]
Length=508

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALG D++ QIYIAAGEIYG ERRL  LSAA+P +V+KE LL P  L+ FQ
Sbjct  322  TPEETALILLALGFDKDTQIYIAAGEIYGSERRLAVLSAAYPRIVRKEMLLDPGELQQFQ  381

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALD++VS+ SD F+PTY GNMA+VVEGHRRY GF+KTILLDRK +V L D + 
Sbjct  382  NHSSQMAALDFMVSIASDTFIPTYDGNMAKVVEGHRRYRGFKKTILLDRKRLVELLDLHQ  441

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W+ F+ ++   H  RMG+P  R VI +KPKEED FYANPQEC
Sbjct  442  NGTLSWNEFAVAVGSAHEKRMGQPTRRRVIADKPKEEDYFYANPQEC  488



>emb|CDM81497.1| unnamed protein product [Triticum aestivum]
Length=490

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 128/167 (77%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE AL LKALG  ++  IYIA+GEIYGGERRL  L AA+PN+V+KE LL    L  FQ
Sbjct  311  TPEEIALVLKALGFSKDTLIYIASGEIYGGERRLAALKAAYPNLVRKEKLLSSDELWPFQ  370

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDY+VS+ S++F+P+Y GNMARVVEGHRRY GFRKTILLDR  +V L D + 
Sbjct  371  NHSTQMAALDYMVSIASNVFIPSYDGNMARVVEGHRRYSGFRKTILLDRTKLVELLDHFQ  430

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G+++WD FS ++KE H+ RMG+P  R  I  +PKEED FYANPQEC
Sbjct  431  GGSLSWDEFSAAVKEAHQYRMGQPTDRRAIPGRPKEEDYFYANPQEC  477



>ref|XP_010937209.1| PREDICTED: uncharacterized protein At1g04910 [Elaeis guineensis]
Length=520

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 131/171 (77%), Gaps = 0/171 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL LKALG + N QIYIA+GEIYGG+RRL  L AAFP +V+KE LL P  L+ FQ
Sbjct  337  TPEETALVLKALGFENNTQIYIASGEIYGGDRRLTALRAAFPKLVRKEMLLDPEDLRQFQ  396

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDY+VS+ SD+F+PTY GNM +VVEGHRRYLGF+K+ILLDR+ +V L D + 
Sbjct  397  NHSSQMAALDYMVSIASDVFIPTYDGNMGKVVEGHRRYLGFKKSILLDRRNLVKLVDLHK  456

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYSHI  514
               ++WD F +++ + H  R G+P  R V+ +KPKEED FYANPQEC  ++
Sbjct  457  NRMLSWDAFVSAVSQAHEGRFGQPTCRKVVIDKPKEEDYFYANPQECLVNV  507



>ref|XP_006417065.1| hypothetical protein EUTSA_v10007443mg [Eutrema salsugineum]
 gb|ESQ35418.1| hypothetical protein EUTSA_v10007443mg [Eutrema salsugineum]
Length=498

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 130/167 (78%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE AL LKALG ++N QIYIAAGEIYG E RL  L  AFP +VKKE LL  + L+ FQ
Sbjct  312  TPEEVALVLKALGFEKNTQIYIAAGEIYGSEHRLSVLREAFPRIVKKEMLLESAELQQFQ  371

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALD++VS+ S+ F+PTY GNMA+VVEGHRRYLGF+KTILLDRK +V L D ++
Sbjct  372  NHSSQMAALDFMVSVASNTFIPTYDGNMAKVVEGHRRYLGFKKTILLDRKKLVELLDLHH  431

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
            + ++TWD F+ ++KE H  R G P  R VI++KPKEED FYANPQEC
Sbjct  432  SKSLTWDQFAVAVKEAHERRTGAPTHRRVISDKPKEEDYFYANPQEC  478



>ref|XP_004297196.2| PREDICTED: uncharacterized protein At1g04910-like [Fragaria vesca 
subsp. vesca]
Length=514

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 126/169 (75%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEET L L+ALGIDRN Q+YIAAG+IY  ERRL  L  AFPN+V+KE L+  S L   Q
Sbjct  335  TPEETTLALRALGIDRNIQVYIAAGDIYKAERRLAPLKEAFPNLVRKETLVDASDLLPLQ  394

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDY VS+ESDIFVPTY GNMA+VVEGHRRYLGF+KTILLDRK +V L DQYN
Sbjct  395  NHSNQMAALDYYVSIESDIFVPTYGGNMAKVVEGHRRYLGFKKTILLDRKALVDLIDQYN  454

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYS  508
             G ++W+ F+  +   H +RMG P  RL +  KPK ED FY NP EC +
Sbjct  455  NGTLSWNEFAVGVNTVHADRMGNPTWRLEVPGKPKLEDYFYTNPTECLT  503



>gb|AFW80133.1| hypothetical protein ZEAMMB73_216816 [Zea mays]
Length=498

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 131/174 (75%), Gaps = 1/174 (1%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE  L LKALG  ++  IYIA+GEIYGGERRL  L AA+P +V+KE +L P  L+ FQ
Sbjct  307  TPEEITLVLKALGFTKDTLIYIASGEIYGGERRLAVLKAAYPKLVRKEKILSPDELRPFQ  366

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDY+VSL SDIF+P+Y GNMARVVEGHRRY+GFRKTI LDRK +V L D + 
Sbjct  367  NHSTQMAALDYMVSLASDIFIPSYDGNMARVVEGHRRYMGFRKTIALDRKKLVELLDLFQ  426

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECY-SHILS  520
               ++WD FS ++KE H++R G+P  R  I  +PKEED FYANPQEC  S IL+
Sbjct  427  GRALSWDEFSGAVKEAHKSRTGQPTDRKAIPGQPKEEDYFYANPQECLGSSILT  480



>ref|XP_006348753.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum tuberosum]
Length=502

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE AL L+ALG D++ QIYIA+G+IYGGERRL +L AAFP +VKK+ LL P  L+ FQ
Sbjct  316  TPEEAALILQALGFDKDIQIYIASGDIYGGERRLASLRAAFPKIVKKDMLLKPGELQHFQ  375

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALD++VS  S++FVPTY GNMA+VVEGHRRYLGF+KTI L RK +V L D + 
Sbjct  376  NHSSQMAALDFIVSTASNVFVPTYDGNMAKVVEGHRRYLGFKKTIRLYRKKLVELLDLHQ  435

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G +TWD F+ +++++H  RMG+   R VI +KPKEED FYANPQEC
Sbjct  436  NGTLTWDEFTATVRQSHEGRMGQLARRRVIADKPKEEDYFYANPQEC  482



>ref|XP_006645535.1| PREDICTED: uncharacterized protein At1g04910-like [Oryza brachyantha]
Length=446

 Score =   224 bits (571),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE  L LKALG  ++  IYIA+GEIYGGE+RL  L AA+P +V+KE LL P  L+ FQ
Sbjct  269  TPEEITLVLKALGFTKDTLIYIASGEIYGGEKRLAALKAAYPRLVRKEKLLSPDELQPFQ  328

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDY+VS+ SD+F+P+Y GNMARVVEGHRRY GFRKTI+LDR  +V L D + 
Sbjct  329  NHSTQMAALDYMVSIASDVFIPSYDGNMARVVEGHRRYTGFRKTIVLDRMKLVELLDNFQ  388

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W+ FS ++KE H++RMG+P  R VI  +PKEED FYANPQEC
Sbjct  389  GGAMSWNEFSAAVKEAHQHRMGQPMDRKVIPGRPKEEDYFYANPQEC  435



>ref|XP_009110564.1| PREDICTED: uncharacterized protein At1g04910-like [Brassica rapa]
 emb|CDX96871.1| BnaA08g24140D [Brassica napus]
Length=498

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 128/167 (77%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEE AL LKALG D+N QIYIAAGEIYG E RL  L  AFP +VKKE LL  + L+ FQ
Sbjct  311  TPEEVALVLKALGFDKNTQIYIAAGEIYGSEHRLSVLREAFPRIVKKEMLLESAELQQFQ  370

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALD++VS+ S+ F+PTY GNMA+VVEGHRRYLGF+KTILLDRK +V L D ++
Sbjct  371  NHSSQMAALDFMVSVASNTFIPTYDGNMAKVVEGHRRYLGFKKTILLDRKRLVELLDLHH  430

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
               +TWD F+ ++KE H  R G P  R VI++KPKEED FYANPQEC
Sbjct  431  NKTLTWDQFAVAVKEAHERRTGAPTHRRVISDKPKEEDYFYANPQEC  477



>ref|XP_008783536.1| PREDICTED: uncharacterized protein At1g04910-like [Phoenix dactylifera]
Length=520

 Score =   226 bits (575),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 130/171 (76%), Gaps = 0/171 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL LKALG   N QIYIA+GEIYGG+RRL  L AAFP +V+KE LL P  L  FQ
Sbjct  337  TPEETALVLKALGFKNNTQIYIASGEIYGGDRRLTALRAAFPKLVRKEMLLDPEDLHQFQ  396

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALDY+VS+ SD+F+PTY GNM +VVEGHRRYLGF+K+ILLDR+ +V L D + 
Sbjct  397  NHSSQMAALDYMVSIASDVFIPTYDGNMGKVVEGHRRYLGFKKSILLDRRKLVKLVDLHE  456

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQECYSHI  514
               ++WD F +++++ H  R G+P  R V+ +KPKEED FYANP EC+ ++
Sbjct  457  NKTLSWDAFVSAVRQDHEGRSGQPACRKVVIDKPKEEDYFYANPHECFVNV  507



>ref|XP_010683121.1| PREDICTED: uncharacterized protein At1g04910 [Beta vulgaris subsp. 
vulgaris]
Length=502

 Score =   225 bits (574),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 128/167 (77%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEET L L+ALG D++ Q+YIA+GEIYG ERRL  L AAFPN +KK+ LL P  L+ F+
Sbjct  316  TPEETTLILQALGFDKDTQVYIASGEIYGSERRLAALRAAFPNTIKKDMLLNPDDLRQFR  375

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALD+LVS+ S+ F+PTY GNMAR+VEGHRRYLGF+KTILLDRK +V L D   
Sbjct  376  NHSSQMAALDFLVSVASNTFIPTYDGNMARLVEGHRRYLGFKKTILLDRKKLVELVDLQQ  435

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G + WD F   +K+ H NR+G+P  R VI ++PKEED FYANPQEC
Sbjct  436  NGTLPWDNFVAGVKDVHLNRLGQPVLRKVIPDRPKEEDYFYANPQEC  482



>ref|XP_006829768.1| hypothetical protein AMTR_s00119p00025950 [Amborella trichopoda]
 gb|ERM97184.1| hypothetical protein AMTR_s00119p00025950 [Amborella trichopoda]
Length=527

 Score =   226 bits (575),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL LKALG +++  IYIA+GEIYGGERRL +L AA+P +V+KE LL P  LK F 
Sbjct  339  TPEETALVLKALGFEKDTLIYIASGEIYGGERRLASLRAAYPKIVRKEMLLSPDELKPFL  398

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H +QMAALDYLV++ESD+FVP+Y GNMA++VEGHRRYLGFRKT  LDR+ +V L D + 
Sbjct  399  NHSTQMAALDYLVAIESDVFVPSYDGNMAKLVEGHRRYLGFRKTAQLDRRELVELIDMHR  458

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
               +TWD F ++++  HR R+G+P  R VI E+PKEED FYANP+EC
Sbjct  459  NNTLTWDEFLDAVRRVHRQRIGQPTKRKVIAERPKEEDYFYANPEEC  505



>ref|XP_011012877.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Populus euphratica]
Length=452

 Score =   224 bits (570),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 128/167 (77%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    TPEETALTLKALGIDRNFQIYIAAGEIYGGERRLRNLSAAFPNMVKKENLLGPSALKFFQ  181
            TPEETAL L ALG D++ QIYIAAGEIYG ERRL  L AA+P +V+KE LL P  L+ FQ
Sbjct  266  TPEETALILLALGFDKDTQIYIAAGEIYGSERRLAVLRAAYPRIVRKEMLLDPGELQQFQ  325

Query  182  GHLSQMAALDYLVSLESDIFVPTYAGNMARVVEGHRRYLGFRKTILLDRKVIVHLTDQYN  361
             H SQMAALD++VS+ SD F+PTY GNMA+VVEGHRRY GF+KTILLDRK +V L D + 
Sbjct  326  NHSSQMAALDFMVSIASDTFIPTYYGNMAKVVEGHRRYRGFKKTILLDRKRLVELLDLHQ  385

Query  362  AGNITWDMFSNSMKETHRNRMGKPKTRLVITEKPKEEDNFYANPQEC  502
             G ++W+ F+ ++   H  RMG+P  R VI +KPKEED FYANPQEC
Sbjct  386  NGTLSWNEFAVAVGSAHEKRMGQPTRRRVIADKPKEEDYFYANPQEC  432



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380