BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP015B09 601 bp,

Length=575
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KFL94796.1|  putative YSIRK type signal peptide                    94.7    1e-18   Lactobacillus gasseri SJ-9E-US
gb|ABJ60955.1|  hypothetical protein LGAS_1663                        94.7    1e-18   Lactobacillus gasseri ATCC 33323 = JCM 1131
gb|KFL96555.1|  putative LPXTG-motif cell wall anchor domain protein  94.0    2e-18   Lactobacillus gasseri SV-16A-US
gb|EFB61571.1|  LPXTG-motif cell wall anchor domain protein           93.6    3e-18   Lactobacillus gasseri 224-1
ref|WP_021314972.1|  hypothetical protein                             81.3    4e-15   
ref|WP_002460604.1|  hypothetical protein                             83.2    1e-14   Staphylococcus lugdunensis
ref|WP_037540934.1|  hypothetical protein                             82.4    2e-14   Staphylococcus lugdunensis
ref|WP_002492503.1|  hypothetical protein                             81.6    3e-14   Staphylococcus lugdunensis
ref|WP_037555315.1|  hypothetical protein                             81.3    4e-14   Staphylococcus lugdunensis
ref|WP_037545809.1|  hypothetical protein                             80.5    7e-14   Staphylococcus lugdunensis
ref|WP_042802751.1|  hypothetical protein                             80.1    1e-13   Mannheimia haemolytica
ref|WP_001083120.1|  alpha-L-fucosidase                               74.3    7e-12   Streptococcus oralis
gb|EFJ68906.1|  LPXTG-motif cell wall anchor domain protein           73.2    2e-11   Lactobacillus gasseri JV-V03
ref|WP_001083124.1|  alpha-L-fucosidase                               73.2    2e-11   Streptococcus sp. GMD5S
ref|WP_001083116.1|  alpha-L-fucosidase                               72.8    2e-11   Streptococcus sp. GMD3S
ref|WP_001083117.1|  alpha-L-fucosidase                               72.4    4e-11   Streptococcus oralis
emb|CCB52766.1|  putative LPXTG cell wall-anchored protein (pseud...  71.2    6e-11   Staphylococcus lugdunensis N920143
dbj|BAA77828.1|  trappin                                              67.4    8e-11   Hippopotamus amphibius
ref|WP_015431801.1|  hypothetical protein                             70.9    1e-10   Bibersteinia trehalosi
ref|WP_042902012.1|  alpha-L-fucosidase                               70.5    1e-10   Streptococcus oralis
ref|WP_039156450.1|  adhesin                                          69.7    2e-10   
ref|WP_001083121.1|  alpha-L-fucosidase                               69.7    2e-10   Streptococcus oralis
ref|WP_001083118.1|  alpha-L-fucosidase                               69.7    2e-10   Streptococcus oralis
ref|WP_001083119.1|  alpha-L-fucosidase                               69.7    3e-10   Streptococcus oralis
ref|WP_032847157.1|  hypothetical protein                             69.3    3e-10   Mannheimia granulomatis
ref|WP_001083127.1|  alpha-L-fucosidase                               69.3    3e-10   Streptococcus oralis
gb|AAQ92320.1|  elafin                                                66.6    3e-10   Ovis aries [domestic sheep]
ref|WP_042749347.1|  cell wall anchor protein                         68.9    4e-10   
ref|WP_035423195.1|  cell wall anchor protein                         68.2    5e-10   
ref|WP_001083110.1|  MULTISPECIES: alpha-L-fucosidase                 68.2    7e-10   Streptococcus
ref|WP_035425140.1|  cell wall anchor protein                         67.8    8e-10   Lactobacillus gasseri
ref|WP_001083125.1|  alpha-L-fucosidase                               68.2    8e-10   Streptococcus oralis
ref|WP_035430318.1|  cell wall anchor protein                         65.1    8e-10   
ref|WP_042768039.1|  alpha-L-fucosidase                               67.8    1e-09   
ref|WP_035426675.1|  cell wall anchor protein                         67.4    1e-09   Lactobacillus gasseri
ref|WP_041807453.1|  cell wall anchor protein                         67.4    1e-09   Lactobacillus gasseri
ref|WP_003646770.1|  cell wall anchor protein                         67.4    1e-09   
ref|XP_007932588.1|  hypothetical protein MYCFIDRAFT_45664            63.5    1e-09   Cercospora fijiensis CIRAD86
ref|WP_003144797.1|  gram-positive signal peptide, ysirk family       67.0    2e-09   Gemella haemolysans
ref|WP_025267364.1|  hypothetical protein                             66.2    3e-09   Bibersteinia trehalosi
ref|WP_001083113.1|  alpha-L-fucosidase                               65.9    4e-09   Streptococcus mitis
ref|WP_001083112.1|  hypothetical protein                             65.9    4e-09   Streptococcus oralis
ref|WP_040443091.1|  hypothetical protein                             61.6    5e-09   
ref|WP_038804553.1|  alpha-L-fucosidase                               65.5    6e-09   Streptococcus oralis
ref|WP_036967957.1|  ribonuclease                                     63.5    2e-08   Pseudoalteromonas lipolytica
ref|XP_003647604.1|  hypothetical protein Ecym_6415                   62.0    6e-08   Eremothecium cymbalariae DBVPG#7215
gb|KFY54418.1|  hypothetical protein V496_07262                       61.6    8e-08   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
ref|WP_013355917.1|  cell surface protein precursor                   61.6    8e-08   Lactobacillus plantarum
gb|KFY75885.1|  hypothetical protein V498_09857                       61.6    9e-08   Pseudogymnoascus sp. VKM F-4517 (FW-2822)
ref|WP_013746171.1|  phospholipase/lecithinase/hemolysin              61.6    9e-08   Gallibacterium anatis
gb|AHA42334.1|  neurofilament triplet H1 protein                      58.9    9e-08   Andrias davidianus ranavirus
ref|WP_042907582.1|  hypothetical protein                             60.8    1e-07   
ref|WP_039155889.1|  hypothetical protein                             60.5    1e-07   
ref|WP_010389626.1|  ribonuclease                                     60.8    1e-07   Pseudoalteromonas undina
ref|WP_039090727.1|  hypothetical protein                             60.8    1e-07   Gallibacterium anatis
gb|KGN58216.1|  hypothetical protein Csa_3G593190                     59.7    2e-07   Cucumis sativus [cucumbers]
ref|WP_028835972.1|  ribonuclease                                     60.5    2e-07   Pseudoalteromonas sp. 23_GOM-1509m
gb|EGV03550.1|  alpha-L-fucosidase                                    60.5    2e-07   Streptococcus infantis SK970
gb|AGV20596.1|  neurofilament triplet H1-like protein                 57.8    2e-07   Andrias davidianus ranavirus
ref|WP_016359640.1|  hypothetical protein                             60.5    2e-07   Gemella sanguinis
gb|AFR22934.1|  cell surface protein precursor                        60.5    2e-07   Lactobacillus helveticus R0052
ref|WP_018379564.1|  hypothetical protein                             60.1    2e-07   Streptococcus thoraltensis
gb|KGQ47133.1|  hypothetical protein IO46_13420                       60.1    2e-07   Gallibacterium anatis
ref|XP_808638.1|  hypothetical protein                                59.7    2e-07   Trypanosoma cruzi strain CL Brener
ref|WP_042907803.1|  hypothetical protein                             58.2    2e-07   
ref|WP_039153091.1|  hypothetical protein                             59.7    3e-07   Gallibacterium anatis
ref|WP_033587337.1|  hypothetical protein                             58.9    3e-07   
ref|WP_039083408.1|  hypothetical protein                             59.7    3e-07   Gallibacterium anatis
ref|XP_011196264.1|  PREDICTED: probable serine/threonine-protein...  58.2    3e-07   Bactrocera cucurbitae [melon fruit fly]
ref|WP_000300357.1|  hypothetical protein                             58.9    4e-07   
ref|WP_039081894.1|  hypothetical protein                             59.3    4e-07   Gallibacterium anatis
ref|WP_011328491.1|  ribonuclease                                     59.3    4e-07   Pseudoalteromonas haloplanktis
ref|WP_039163635.1|  hypothetical protein                             58.9    6e-07   Gallibacterium anatis
ref|WP_039157809.1|  hypothetical protein                             58.9    6e-07   Gallibacterium anatis
ref|WP_021461970.1|  hypothetical protein                             58.9    6e-07   Gallibacterium anatis
ref|WP_039156382.1|  hypothetical protein                             58.9    6e-07   Gallibacterium anatis
ref|WP_009013731.1|  TolA domain protein                              58.5    7e-07   Streptococcus sp. C300
gb|EAR66038.1|  cell wall-anchored protein                            56.6    7e-07   Bacillus sp. NRRL B-14911
ref|WP_039490054.1|  MULTISPECIES: ribonuclease                       58.5    7e-07   Pseudoalteromonas
gb|KDA98464.1|  cell wall anchor protein                              58.5    8e-07   Lactobacillus gasseri K7
gb|AGL65247.2|  Cell surface protein                                  58.5    9e-07   Lactobacillus plantarum subsp. plantarum P-8
ref|XP_006659167.1|  PREDICTED: uncharacterized protein LOC102702307  57.8    9e-07   Oryza brachyantha
ref|WP_021032005.1|  RNase E                                          58.2    9e-07   Pseudoalteromonas arctica
gb|EHJ52010.1|  agglutinin receptor                                   58.2    9e-07   Streptococcus macacae NCTC 11558
ref|WP_001083114.1|  alpha-L-fucosidase                               58.2    1e-06   Streptococcus oralis
gb|KFY94434.1|  hypothetical protein V500_03260                       58.2    1e-06   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
ref|WP_024593398.1|  ribonuclease                                     57.8    1e-06   Pseudoalteromonas haloplanktis
ref|WP_039145306.1|  hypothetical protein                             57.4    1e-06   
ref|WP_014567818.1|  mucin binding protein                            57.8    1e-06   Lactobacillus johnsonii
ref|WP_000300356.1|  hypothetical protein                             57.4    1e-06   
gb|EPD62247.1|  hypothetical protein HMPREF1211_03881                 57.4    2e-06   Streptomyces sp. HGB0020
ref|WP_004897948.1|  mucin binding protein                            57.4    2e-06   Lactobacillus johnsonii
ref|WP_039085890.1|  hypothetical protein                             57.0    2e-06   
ref|WP_025288912.1|  hypothetical protein                             57.4    2e-06   Bibersteinia trehalosi
ref|WP_024002328.1|  cell surface protein precursor                   57.0    2e-06   Lactobacillus plantarum
ref|WP_003642311.1|  cell surface protein precursor                   57.0    2e-06   Lactobacillus plantarum
ref|WP_033037822.1|  ribonuclease                                     57.0    2e-06   Pseudoalteromonas sp. S3431
ref|WP_033032426.1|  hypothetical protein                             53.5    2e-06   
gb|AHG85653.1|  hypothetical protein F544_4210                        57.0    2e-06   Bibersteinia trehalosi USDA-ARS-USMARC-190
ref|WP_035425692.1|  cell wall anchor protein                         57.0    2e-06   
ref|WP_039167092.1|  hypothetical protein                             57.0    3e-06   Gallibacterium anatis
ref|WP_039946191.1|  hypothetical protein                             54.7    3e-06   
ref|WP_033615607.1|  cell wall anchor protein                         56.6    3e-06   Lactobacillus plantarum
ref|WP_023599945.1|  mucin binding protein                            56.6    3e-06   Lactobacillus johnsonii
ref|XP_002736705.2|  PREDICTED: uncharacterized protein C1orf173-...  56.6    3e-06   Saccoglossus kowalevskii
ref|WP_024600481.1|  ribonuclease                                     56.6    3e-06   Pseudoalteromonas haloplanktis
gb|KFL87002.1|  hypothetical protein LpDm1_2602                       56.6    3e-06   Lactobacillus plantarum
ref|WP_024601393.1|  ribonuclease                                     56.6    3e-06   Pseudoalteromonas atlantica
gb|EJP18773.1|  LPXTG cell wall anchor domain protein                 55.8    4e-06   Streptococcus oralis SK304
gb|ACF42267.1|  neurofilament triplet H1 protein                      54.3    4e-06   Soft-shelled turtle iridovirus
gb|KGK34316.1|  hypothetical protein JL09_g6537                       52.8    4e-06   Pichia kudriavzevii
ref|WP_039161440.1|  hypothetical protein                             55.8    4e-06   
ref|XP_002940580.2|  PREDICTED: uncharacterized protein LOC100379885  56.2    5e-06   
ref|WP_034371226.1|  cell surface protein                             55.8    5e-06   Dermabacter hominis
ref|WP_040539980.1|  hypothetical protein                             55.1    6e-06   
ref|WP_007375272.1|  ribonuclease E                                   55.8    6e-06   
gb|EMC77394.1|  putative serine/threonine-protein kinase kinX         55.5    6e-06   Columba livia [carrier pigeon]
gb|EFB22434.1|  hypothetical protein PANDA_020193                     52.4    6e-06   Ailuropoda melanoleuca
ref|WP_016527324.1|  adherence-associated mucus-binding protein,L...  55.5    7e-06   Lactobacillus plantarum
gb|KEK46499.1|  LPXTG cell wall anchor domain protein                 55.5    8e-06   Staphylococcus warneri Lyso 1 2011
ref|XP_001622881.1|  predicted protein                                52.8    8e-06   Nematostella vectensis
gb|AHM26124.1|  RGI orf47L-like protein                               53.5    8e-06   Frog virus 3
ref|XP_004916500.1|  PREDICTED: salivary glue protein Sgs-4-like      54.7    9e-06   Xenopus tropicalis [western clawed frog]
gb|AJI79873.1|  hypothetical protein CSING_11890                      55.1    9e-06   Corynebacterium singulare
ref|WP_024596135.1|  ribonuclease                                     55.1    9e-06   Pseudoalteromonas haloplanktis
ref|WP_010557308.1|  ribonuclease                                     54.7    1e-05   Pseudoalteromonas marina
ref|XP_005531742.1|  PREDICTED: collagen alpha-1(XXIV) chain-like     53.1    1e-05   
ref|XP_011194718.1|  PREDICTED: uncharacterized protein LOC105220036  54.7    1e-05   Bactrocera cucurbitae [melon fruit fly]
ref|XP_008310537.1|  PREDICTED: protein SPT2 homolog isoform X2       54.7    1e-05   Cynoglossus semilaevis
ref|XP_008310536.1|  PREDICTED: protein SPT2 homolog isoform X1       54.7    1e-05   Cynoglossus semilaevis
gb|EMC77213.1|  Ovarian abundant message protein                      52.8    1e-05   Columba livia [carrier pigeon]
ref|WP_034092386.1|  hypothetical protein                             52.0    1e-05   
gb|EKB57246.1|  LPXTG-domain-containing protein cell wall anchor ...  54.3    1e-05   Facklamia ignava CCUG 37419
gb|KDS93254.1|  surface protein                                       54.7    2e-05   Dermabacter hominis 1368
ref|WP_039162097.1|  hypothetical protein                             54.3    2e-05   Gallibacterium anatis
ref|WP_028835759.1|  ribonuclease                                     54.3    2e-05   Pseudoalteromonas sp. 6BO_GOM-1096m
ref|WP_010188733.1|  hypothetical protein                             53.5    2e-05   
ref|WP_018346332.1|  hypothetical protein                             53.9    2e-05   Gallibacterium anatis
ref|WP_024590363.1|  MULTISPECIES: ribonuclease                       53.9    2e-05   Pseudoalteromonas
ref|WP_039152156.1|  hypothetical protein                             53.9    2e-05   
ref|WP_033102701.1|  MULTISPECIES: ribonuclease                       53.9    2e-05   Alteromonadales
gb|AGC91524.1|  putative biofilm-associated protein                   53.9    2e-05   Staphylococcus warneri SG1
ref|WP_039147361.1|  hypothetical protein                             53.9    3e-05   Gallibacterium anatis
ref|WP_016085848.1|  hypothetical protein                             52.0    3e-05   Bacillus cereus
gb|ETN66453.1|  Unc-89 protein                                        53.5    3e-05   Anopheles darlingi [American malaria mosquito]
ref|WP_037886013.1|  hypothetical protein                             51.2    3e-05   
ref|WP_033608953.1|  cell wall anchor protein                         53.5    3e-05   Lactobacillus plantarum
gb|KEZ12787.1|  LPXTG-motif cell wall anchor containing protein       53.1    4e-05   Lactobacillus plantarum
ref|XP_007182705.1|  PREDICTED: LOW QUALITY PROTEIN: G2/mitotic-s...  53.1    4e-05   Balaenoptera acutorostrata scammoni
gb|EWZ85759.1|  hypothetical protein FOWG_10855                       52.8    4e-05   Fusarium oxysporum f. sp. lycopersici MN25
ref|WP_039141203.1|  hypothetical protein                             53.1    5e-05   Gallibacterium anatis
ref|WP_003657303.1|  Hypothetical protein                             51.2    5e-05   
gb|ACB11440.1|  neurofilament triplet H1-like protein                 52.4    5e-05   Ambystoma tigrinum virus
gb|EXA35697.1|  hypothetical protein FOVG_12852                       52.8    5e-05   Fusarium oxysporum f. sp. pisi HDV247
ref|WP_008126344.1|  ribonuclease                                     52.8    5e-05   Pseudoalteromonas sp. BSi20480
ref|WP_024604127.1|  ribonuclease                                     52.8    5e-05   Pseudoalteromonas haloplanktis
gb|EGU75460.1|  hypothetical protein FOXB_14029                       52.8    5e-05   Fusarium oxysporum Fo5176
gb|ACB11439.1|  neurofilament triplet H1-like protein                 52.0    5e-05   Ambystoma tigrinum virus
ref|WP_039139264.1|  hypothetical protein                             52.8    6e-05   
ref|XP_002780730.1|  conserved hypothetical protein                   52.4    6e-05   Perkinsus marinus ATCC 50983
ref|WP_014940697.1|  signal peptide protein                           52.4    6e-05   Lactobacillus buchneri
gb|EMC89538.1|  Collagen-like protein 2                               50.1    7e-05   Columba livia [carrier pigeon]
ref|WP_035427023.1|  cell wall anchor protein                         52.4    7e-05   Lactobacillus gasseri
gb|ERS35519.1|  hypothetical protein HMPREF1275_00471                 52.4    7e-05   Propionibacterium sp. KPL1844
gb|EHJ07815.1|  accumulation-associated protein                       50.1    8e-05   Staphylococcus simiae CCM 7213
ref|WP_011082576.1|  accumulation-associated protein                  52.0    9e-05   Staphylococcus epidermidis
ref|XP_004646348.1|  PREDICTED: G2/mitotic-specific cyclin-B3         52.0    1e-04   Octodon degus
ref|WP_039093011.1|  hypothetical protein                             52.0    1e-04   
gb|EPD15416.1|  accumulation-associated protein                       52.0    1e-04   Streptococcus pneumoniae MNZ11b
ref|WP_007585714.1|  ribonuclease                                     52.0    1e-04   Pseudoalteromonas sp. BSi20429
ref|WP_036322739.1|  hypothetical protein                             49.3    1e-04   
ref|WP_032667851.1|  hypothetical protein                             48.9    1e-04   
gb|AIN82002.1|  hypothetical protein DR71_1244                        51.6    1e-04   Corynebacterium sp. ATCC 6931
ref|WP_040802052.1|  hypothetical protein                             48.9    1e-04   
ref|XP_002777995.1|  conserved hypothetical protein                   51.6    1e-04   Perkinsus marinus ATCC 50983
gb|EPQ06187.1|  Sialidase                                             50.1    1e-04   Myotis brandtii
ref|WP_033605890.1|  alpha-L-fucosidase                               51.6    1e-04   Streptococcus sp. CM6
ref|WP_009730655.1|  LPXTG-domain-containing protein                  50.8    1e-04   
gb|ACB11429.1|  neurofilament triplet H1-like protein                 50.4    2e-04   Ambystoma tigrinum virus
gb|ACB11433.1|  neurofilament triplet H1-like protein                 50.8    2e-04   Ambystoma tigrinum virus
ref|WP_036903336.1|  hypothetical protein                             48.1    2e-04   
ref|WP_012715328.1|  hypothetical protein                             51.2    2e-04   Corynebacterium aurimucosum
gb|ACB11441.1|  neurofilament triplet H1-like protein                 50.1    2e-04   Ambystoma tigrinum virus
gb|KEK51840.1|  LPXTG cell wall anchor domain protein                 50.8    2e-04   Staphylococcus warneri Lyso 2 2011
ref|WP_035756719.1|  hypothetical protein                             48.5    2e-04   
gb|ACB11434.1|  neurofilament triplet H1-like protein                 50.1    3e-04   Ambystoma tigrinum virus
ref|XP_010871682.1|  PREDICTED: sporozoite surface protein 2-like     50.1    3e-04   Esox lucius
ref|WP_044019725.1|  hypothetical protein                             50.1    3e-04   Staphylococcus lugdunensis
ref|XP_007812695.1|  Neurofilament triplet H protein                  50.1    3e-04   Metarhizium acridum CQMa 102
gb|KFY21541.1|  hypothetical protein V493_07318                       50.1    4e-04   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
gb|ACX55818.1|  Aap                                                   47.8    4e-04   Staphylococcus epidermidis
emb|CCC17559.1|  cell surface protein                                 50.1    4e-04   Lactobacillus pentosus IG1
ref|XP_011244138.1|  PREDICTED: endochitinase A-like                  49.7    4e-04   
gb|ELT92048.1|  hypothetical protein CAPTEDRAFT_227575                50.1    4e-04   Capitella teleta
ref|XP_007582940.1|  putative gelsolin repeat protein                 50.1    4e-04   Neofusicoccum parvum UCRNP2
ref|WP_042132036.1|  hypothetical protein                             49.7    5e-04   Paenibacillus sp. FSL R5-0345
gb|AAA29628.1|  interspersed repeat antigen                           49.7    5e-04   Plasmodium falciparum
gb|ACB11427.1|  neurofilament triplet H1-like protein                 49.3    5e-04   Ambystoma tigrinum virus
ref|XP_008820989.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  49.7    5e-04   
ref|XP_009134942.1|  PREDICTED: proline-rich extensin-like protei...  48.1    6e-04   Brassica rapa
ref|WP_037683329.1|  hypothetical protein                             49.7    6e-04   
ref|WP_041896497.1|  hypothetical protein                             48.9    6e-04   
gb|ACX55817.1|  Aap                                                   47.0    7e-04   Staphylococcus epidermidis
ref|WP_037540642.1|  hypothetical protein                             48.9    7e-04   
gb|ETW50981.1|  hypothetical protein PFMALIP_00929                    49.3    7e-04   Plasmodium falciparum MaliPS096_E11
ref|XP_001270917.1|  cell surface protein, putative                   49.3    7e-04   Aspergillus clavatus NRRL 1
ref|XP_009317823.1|  PREDICTED: neurofilament medium polypeptide      49.3    7e-04   Pygoscelis adeliae
gb|ADK78216.1|  accumulation associated protein                       49.3    0.001   Staphylococcus epidermidis



>gb|KFL94796.1| putative YSIRK type signal peptide [Lactobacillus gasseri SJ-9E-US]
Length=2449

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 52/120 (43%), Positives = 57/120 (48%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P   D PA  +EPT P  P   D PA  SEPT P  P+  + PA  SEP
Sbjct  2210  AQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEP  2269

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             T P      D PA  +EPT P  P   D PA  SEP  P  P   D PA  SEPT P  P
Sbjct  2270  TKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEP  2329


 Score = 94.4 bits (233),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 52/117 (44%), Positives = 55/117 (47%), Gaps = 0/117 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             ARP        P   D PA  SEPT P  P+  D PA  SEPT P  P   + PA  +EP
Sbjct  2228  ARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDKPARPTEP  2287

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
             T P      D PA  SEP  P  P   D PA  SEPT P  P   D P   SEPT P
Sbjct  2288  TKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEPTTPDKPTQPSEPTKP  2344


 Score = 94.0 bits (232),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 50/109 (46%), Positives = 54/109 (50%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P   D PA  SEPT P  P   D PA  +EPT P  P   + PA  SEPT P   +  D 
Sbjct  2203  PTTPDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDK  2262

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             PA  SEPT P  P   D PA  +EPT P  P   D PA  SEP  P  P
Sbjct  2263  PAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEP  2311


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 43/94 (46%), Positives = 47/94 (50%), Gaps = 0/94 (0%)
 Frame = +1

Query  202   PNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLK  381
             P  P   D PA  SEPT P  P   + PA  +EPT P      D PA  SEPT P  P+ 
Sbjct  2200  PVEPTTPDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPIT  2259

Query  382   YDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              D PA  SEPT P  P   D PA  +EPT P  P
Sbjct  2260  PDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEP  2293


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 30/63 (48%), Positives = 32/63 (51%), Gaps = 6/63 (10%)
 Frame = +1

Query  298   EPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPN  477
             EPT P      D PA  SEPT P  P   D PA  +EPT P  P   D PA  SEPT P 
Sbjct  2202  EPTTP------DKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPE  2255

Query  478   HPL  486
              P+
Sbjct  2256  EPI  2258



>gb|ABJ60955.1| hypothetical protein LGAS_1663 [Lactobacillus gasseri ATCC 33323 
= JCM 1131]
Length=2449

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 52/120 (43%), Positives = 57/120 (48%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P   D PA  +EPT P  P   D PA  SEPT P  P+  + PA  SEP
Sbjct  2210  AQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEP  2269

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             T P      D PA  +EPT P  P   D PA  SEP  P  P   D PA  SEPT P  P
Sbjct  2270  TKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEP  2329


 Score = 94.4 bits (233),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 52/117 (44%), Positives = 55/117 (47%), Gaps = 0/117 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             ARP        P   D PA  SEPT P  P+  D PA  SEPT P  P   + PA  +EP
Sbjct  2228  ARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDKPARPTEP  2287

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
             T P      D PA  SEP  P  P   D PA  SEPT P  P   D P   SEPT P
Sbjct  2288  TKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEPTTPDKPTQPSEPTKP  2344


 Score = 94.0 bits (232),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 50/109 (46%), Positives = 54/109 (50%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P   D PA  SEPT P  P   D PA  +EPT P  P   + PA  SEPT P   +  D 
Sbjct  2203  PTTPDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDK  2262

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             PA  SEPT P  P   D PA  +EPT P  P   D PA  SEP  P  P
Sbjct  2263  PAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEP  2311


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 43/94 (46%), Positives = 47/94 (50%), Gaps = 0/94 (0%)
 Frame = +1

Query  202   PNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLK  381
             P  P   D PA  SEPT P  P   + PA  +EPT P      D PA  SEPT P  P+ 
Sbjct  2200  PVEPTTPDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPIT  2259

Query  382   YDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              D PA  SEPT P  P   D PA  +EPT P  P
Sbjct  2260  PDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEP  2293


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 30/63 (48%), Positives = 32/63 (51%), Gaps = 6/63 (10%)
 Frame = +1

Query  298   EPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPN  477
             EPT P      D PA  SEPT P  P   D PA  +EPT P  P   D PA  SEPT P 
Sbjct  2202  EPTTP------DKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPE  2255

Query  478   HPL  486
              P+
Sbjct  2256  EPI  2258



>gb|KFL96555.1| putative LPXTG-motif cell wall anchor domain protein [Lactobacillus 
gasseri SV-16A-US]
Length=2206

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 52/117 (44%), Positives = 55/117 (47%), Gaps = 0/117 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             ARP        P   D PA  SEPT P  P+  D PA  SEPT P  P   + PA  +EP
Sbjct  1985  ARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDKPARPTEP  2044

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
             T P      D PA  SEP  P  P   D PA  SEPT P  P   D P   SEPT P
Sbjct  2045  TKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEPTTPDKPTQPSEPTKP  2101


 Score = 93.6 bits (231),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 50/109 (46%), Positives = 54/109 (50%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P   D PA  +EPT P  P   D PA  SEPT P  P+  + PA  SEPT P      D 
Sbjct  1978  PTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDK  2037

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             PA  +EPT P  P   D PA  SEP  P  P   D PA  SEPT P  P
Sbjct  2038  PARPTEPTKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEP  2086


 Score = 92.4 bits (228),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 49/109 (45%), Positives = 53/109 (49%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P   D P   SEPT P  P   D PA  +EPT P  P   + PA  SEPT P   +  D 
Sbjct  1960  PTTPDKPTQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDK  2019

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             PA  SEPT P  P   D PA  +EPT P  P   D PA  SEP  P  P
Sbjct  2020  PAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEP  2068


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 42/94 (45%), Positives = 46/94 (49%), Gaps = 0/94 (0%)
 Frame = +1

Query  202   PNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLK  381
             P  P   D P   SEPT P  P   + PA  +EPT P      D PA  SEPT P  P+ 
Sbjct  1957  PVEPTTPDKPTQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPIT  2016

Query  382   YDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              D PA  SEPT P  P   D PA  +EPT P  P
Sbjct  2017  PDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEP  2050


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 31/63 (49%), Gaps = 6/63 (10%)
 Frame = +1

Query  298   EPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPN  477
             EPT P      D P   SEPT P  P   D PA  +EPT P  P   D PA  SEPT P 
Sbjct  1959  EPTTP------DKPTQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPE  2012

Query  478   HPL  486
              P+
Sbjct  2013  EPI  2015



>gb|EFB61571.1| LPXTG-motif cell wall anchor domain protein [Lactobacillus gasseri 
224-1]
Length=1929

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 52/117 (44%), Positives = 55/117 (47%), Gaps = 0/117 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             ARP        P   D PA  SEPT P  P+  D PA  SEPT P  P   + PA  +EP
Sbjct  1708  ARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDKPARPTEP  1767

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
             T P      D PA  SEP  P  P   D PA  SEPT P  P   D P   SEPT P
Sbjct  1768  TKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEPTTPDKPTQPSEPTKP  1824


 Score = 93.2 bits (230),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 50/109 (46%), Positives = 54/109 (50%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P   D PA  +EPT P  P   D PA  SEPT P  P+  + PA  SEPT P      D 
Sbjct  1701  PTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDK  1760

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             PA  +EPT P  P   D PA  SEP  P  P   D PA  SEPT P  P
Sbjct  1761  PARPTEPTKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEP  1809


 Score = 92.0 bits (227),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 49/109 (45%), Positives = 53/109 (49%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P   D P   SEPT P  P   D PA  +EPT P  P   + PA  SEPT P   +  D 
Sbjct  1683  PTTPDKPTQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDK  1742

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             PA  SEPT P  P   D PA  +EPT P  P   D PA  SEP  P  P
Sbjct  1743  PAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEP  1791


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 42/94 (45%), Positives = 46/94 (49%), Gaps = 0/94 (0%)
 Frame = +1

Query  202   PNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLK  381
             P  P   D P   SEPT P  P   + PA  +EPT P      D PA  SEPT P  P+ 
Sbjct  1680  PVEPTTPDKPTQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPIT  1739

Query  382   YDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              D PA  SEPT P  P   D PA  +EPT P  P
Sbjct  1740  PDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEP  1773


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 31/63 (49%), Gaps = 6/63 (10%)
 Frame = +1

Query  298   EPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPN  477
             EPT P      D P   SEPT P  P   D PA  +EPT P  P   D PA  SEPT P 
Sbjct  1682  EPTTP------DKPTQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPE  1735

Query  478   HPL  486
              P+
Sbjct  1736  EPI  1738



>ref|WP_021314972.1| hypothetical protein, partial [Lactobacillus gasseri]
 gb|EQB84156.1| hypothetical protein M497_01245, partial [Lactobacillus gasseri 
2016]
Length=343

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 54/112 (48%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P   D PA  +EPT P  P   D PA  SEPT P  P+  + PA  SEPT P      
Sbjct  113  EEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTP  172

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            D PA  +EPT P  P   D PA  SEP  P  P   D PA  SEPT P  P 
Sbjct  173  DKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEPT  224


 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P   D PA  SEPT P  P   D PA  +EPT P  P   + PA  SEPT P   +  D
Sbjct  96   EPTTPDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPD  155

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             PA  SEPT P  P   D PA  +EPT P  P   D PA  SEP  P  P 
Sbjct  156  KPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEPT  206


 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 55/119 (46%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
            ARP        P   D PA  SEPT P  P+  D PA  SEPT P  P   + PA  +EP
Sbjct  122  ARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDKPARPTEP  181

Query  304  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNH  480
            T P      D PA  SEP  P  P   D PA  SEPT P  P   D P   SEPT P  
Sbjct  182  TKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEPTTPDKPTQPSEPTKPEE  240



>ref|WP_002460604.1| hypothetical protein [Staphylococcus lugdunensis]
 gb|EFU83717.1| serine-aspartate repeat-containing protein F [Staphylococcus 
lugdunensis M23590]
Length=2202

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 54/109 (50%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P K + P   SEP  PN P K   P   SEP  P+ P K   P   +EP+ P+   K   
Sbjct  2003  PNKPNEPGKPSEPGKPNEPNKPSEPGKPSEPGKPSEPNKPSEPGKPNEPSKPSEPNKPSE  2062

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             P+  SEP  P+ P K + P+  SEP  PS P K   P   SEP+ P+ P
Sbjct  2063  PSKPSEPNKPSEPGKPNEPSKPSEPNKPSEPSKPSEPNKPSEPSKPSEP  2111


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 45/113 (40%), Positives = 54/113 (48%), Gaps = 1/113 (1%)
 Frame = +1

Query  145   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  324
             PN  P K   P   +EP  P+ P K   P   SEP  P+ P K   P+  SEP  P+   
Sbjct  2006  PNE-PGKPSEPGKPNEPNKPSEPGKPSEPGKPSEPNKPSEPGKPNEPSKPSEPNKPSEPS  2064

Query  325   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             K   P   SEP  PN P K   P   SEP+ PS P K   P+  SEP+ P+ P
Sbjct  2065  KPSEPNKPSEPGKPNEPSKPSEPNKPSEPSKPSEPNKPSEPSKPSEPSKPSEP  2117


 Score = 82.0 bits (201),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 45/117 (38%), Positives = 58/117 (50%), Gaps = 1/117 (1%)
 Frame = +1

Query  145   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  324
             PN  P K   P   SEP  P+ P K   P   +EP+ P+ P K   P+  SEP  P+   
Sbjct  2018  PNE-PNKPSEPGKPSEPGKPSEPNKPSEPGKPNEPSKPSEPNKPSEPSKPSEPNKPSEPG  2076

Query  325   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  495
             K + P+  SEP  P+ P K   P   SEP+ PS P K   P   SEP+ PN  ++ S
Sbjct  2077  KPNEPSKPSEPNKPSEPSKPSEPNKPSEPSKPSEPSKPSEPNKPSEPSKPNKSVHTS  2133


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 53/109 (49%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P K + P   SEP  P+ P K   P   SEP  PN P K   P   SEP+ P+   K   
Sbjct  2015  PGKPNEPNKPSEPGKPSEPGKPSEPNKPSEPGKPNEPSKPSEPNKPSEPSKPSEPNKPSE  2074

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             P   +EP+ P+ P K   P+  SEP  PS P K   P+  SEP  P+ P
Sbjct  2075  PGKPNEPSKPSEPNKPSEPSKPSEPNKPSEPSKPSEPSKPSEPNKPSEP  2123


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 38/98 (39%), Positives = 47/98 (48%), Gaps = 0/98 (0%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             EP  PN P K   P   +EP  P+ P K   P   SEP  P+   K + P+  SEP  P+
Sbjct  2002  EPNKPNEPGKPSEPGKPNEPNKPSEPGKPSEPGKPSEPNKPSEPGKPNEPSKPSEPNKPS  2061

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P K   P   SEP  P+ P K   P   SEP+ P+ P
Sbjct  2062  EPSKPSEPNKPSEPGKPNEPSKPSEPNKPSEPSKPSEP  2099



>ref|WP_037540934.1| hypothetical protein [Staphylococcus lugdunensis]
 gb|EVI50319.1| hypothetical protein T979_01412 [Staphylococcus lugdunensis UCIM6116]
Length=2202

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 46/116 (40%), Positives = 56/116 (48%), Gaps = 2/116 (2%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P K + P   SEP  PN P K   P   SEP  P+ P K   P   SEP  P+   K + 
Sbjct  2003  PNKPNEPGKPSEPGKPNEPNKPSEPGKPSEPGKPSEPGKPSEPGKPSEPGKPSEPGKPNE  2062

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
             P   SEP  P+ P K   P+  SEP  PS P K + P+  SEP  P+ P  G P +
Sbjct  2063  PNKPSEPGKPSEPSKPSEPSKPSEPNKPSEPGKPNEPSKPSEPNKPSEP--GKPSE  2116


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 46/117 (39%), Positives = 56/117 (48%), Gaps = 1/117 (1%)
 Frame = +1

Query  145   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  324
             PN  P K   P   SEP  P+ P K   P   SEP  P+ P K   P   SEP  P+   
Sbjct  2018  PNE-PNKPSEPGKPSEPGKPSEPGKPSEPGKPSEPGKPSEPGKPNEPNKPSEPGKPSEPS  2076

Query  325   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  495
             K   P+  SEP  P+ P K + P+  SEP  PS P K   P+  SEP  PN  ++ S
Sbjct  2077  KPSEPSKPSEPNKPSEPGKPNEPSKPSEPNKPSEPGKPSEPSKPSEPGKPNKSVHTS  2133


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 43/116 (37%), Positives = 56/116 (48%), Gaps = 2/116 (2%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P K + P   SEP  P+ P K   P   SEP  P+ P K   P   +EP  P+   K   
Sbjct  2015  PGKPNEPNKPSEPGKPSEPGKPSEPGKPSEPGKPSEPGKPSEPGKPNEPNKPSEPGKPSE  2074

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
             P+  SEP+ P+ P K   P   +EP+ PS P K   P   SEP+ P+ P  G P +
Sbjct  2075  PSKPSEPSKPSEPNKPSEPGKPNEPSKPSEPNKPSEPGKPSEPSKPSEP--GKPNK  2128


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 41/98 (42%), Positives = 45/98 (46%), Gaps = 0/98 (0%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             EP  PN P K   P   +EP  P+ P K   P   SEP  P+   K   P   SEP  PN
Sbjct  2002  EPNKPNEPGKPSEPGKPNEPNKPSEPGKPSEPGKPSEPGKPSEPGKPSEPGKPSEPGKPN  2061

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P K   P   SEP+ PS P K   P   SEP  PN P
Sbjct  2062  EPNKPSEPGKPSEPSKPSEPSKPSEPNKPSEPGKPNEP  2099


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 44/113 (39%), Positives = 51/113 (45%), Gaps = 1/113 (1%)
 Frame = +1

Query  145   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  324
             PN  P K   P   +EP  P+ P K   P   SEP  P+ P K   P   SEP  PN   
Sbjct  2006  PNE-PGKPSEPGKPNEPNKPSEPGKPSEPGKPSEPGKPSEPGKPSEPGKPSEPGKPNEPN  2064

Query  325   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             K   P   SEP+ P+ P K   P   SEP  P+ P K   P   SEP  P+ P
Sbjct  2065  KPSEPGKPSEPSKPSEPSKPSEPNKPSEPGKPNEPSKPSEPNKPSEPGKPSEP  2117



>ref|WP_002492503.1| hypothetical protein [Staphylococcus lugdunensis]
 gb|EHS04472.1| putative serine-aspartate repeat protein F [Staphylococcus lugdunensis 
VCU139]
Length=2190

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 44/116 (38%), Positives = 56/116 (48%), Gaps = 2/116 (2%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P K + P   SEP  PN P K   P   SEP  P+ P K   P   +EP  P+   K   
Sbjct  2003  PNKPNEPGKPSEPGKPNEPNKPSEPGKPSEPGKPSEPGKPSEPGKPNEPNKPSEPGKPSE  2062

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
             P+  SEP+ P+ P K   P   +EP+ PS P K   P   SEP+ P+ P  G P +
Sbjct  2063  PSKPSEPSKPSEPNKPSEPGKPNEPSKPSEPNKPSEPGKPSEPSKPSEP--GKPNK  2116


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 45/117 (38%), Positives = 56/117 (48%), Gaps = 1/117 (1%)
 Frame = +1

Query  145   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  324
             PN  P K   P   +EP  P+ P K   P   SEP  P+ P K   P   SEP  P+   
Sbjct  2006  PNE-PGKPSEPGKPNEPNKPSEPGKPSEPGKPSEPGKPSEPGKPNEPNKPSEPGKPSEPS  2064

Query  325   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  495
             K   P+  SEP  P+ P K + P+  SEP  PS P K   P+  SEP  PN  ++ S
Sbjct  2065  KPSEPSKPSEPNKPSEPGKPNEPSKPSEPNKPSEPGKPSEPSKPSEPGKPNKSVHTS  2121


 Score = 77.0 bits (188),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 51/105 (49%), Gaps = 2/105 (2%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             EP  PN P K   P   +EP  P+ P K   P   SEP  P+   K + P   SEP  P+
Sbjct  2002  EPNKPNEPGKPSEPGKPNEPNKPSEPGKPSEPGKPSEPGKPSEPGKPNEPNKPSEPGKPS  2061

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
              P K   P+  SEP  PS P K + P+  SEP  P+ P  G P +
Sbjct  2062  EPSKPSEPSKPSEPNKPSEPGKPNEPSKPSEPNKPSEP--GKPSE  2104



>ref|WP_037555315.1| hypothetical protein [Staphylococcus lugdunensis]
 gb|KAK56509.1| putative serine-aspartate repeat protein F [Staphylococcus lugdunensis 
VCU148]
Length=2147

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 44/116 (38%), Positives = 56/116 (48%), Gaps = 2/116 (2%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P K + P   SEP  PN P K   P   SEP  P+ P K   P   +EP  P+   K   
Sbjct  1960  PNKPNEPGKPSEPGKPNEPNKPSEPGKPSEPGKPSEPGKPSEPGKPNEPNKPSEPGKPSE  2019

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
             P+  SEP+ P+ P K   P   +EP+ PS P K   P   SEP+ P+ P  G P +
Sbjct  2020  PSKPSEPSKPSEPNKPSEPGKPNEPSKPSEPNKPSEPGKPSEPSKPSEP--GKPNK  2073


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 45/117 (38%), Positives = 56/117 (48%), Gaps = 1/117 (1%)
 Frame = +1

Query  145   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  324
             PN  P K   P   +EP  P+ P K   P   SEP  P+ P K   P   SEP  P+   
Sbjct  1963  PNE-PGKPSEPGKPNEPNKPSEPGKPSEPGKPSEPGKPSEPGKPNEPNKPSEPGKPSEPS  2021

Query  325   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  495
             K   P+  SEP  P+ P K + P+  SEP  PS P K   P+  SEP  PN  ++ S
Sbjct  2022  KPSEPSKPSEPNKPSEPGKPNEPSKPSEPNKPSEPGKPSEPSKPSEPGKPNKSVHTS  2078


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 51/105 (49%), Gaps = 2/105 (2%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             EP  PN P K   P   +EP  P+ P K   P   SEP  P+   K + P   SEP  P+
Sbjct  1959  EPNKPNEPGKPSEPGKPNEPNKPSEPGKPSEPGKPSEPGKPSEPGKPNEPNKPSEPGKPS  2018

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
              P K   P+  SEP  PS P K + P+  SEP  P+ P  G P +
Sbjct  2019  EPSKPSEPSKPSEPNKPSEPGKPNEPSKPSEPNKPSEP--GKPSE  2061



>ref|WP_037545809.1| hypothetical protein [Staphylococcus lugdunensis]
 gb|KAK55372.1| putative serine-aspartate repeat protein F [Staphylococcus lugdunensis 
VCU150]
Length=2167

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 50/109 (46%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P K + P   +EP  P+ P K   P   SEP  PN P K   P   SEP  P+   K + 
Sbjct  1971  PNKPNEPGKPNEPGKPSEPTKPSEPNKPSEPGKPNEPNKPSEPGKPSEPNKPSEPGKPNE  2030

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             P   SEP  P+ P K   P   SEP  PS P K   P   SEP  P+ P
Sbjct  2031  PNKPSEPNKPSEPGKPSEPGKPSEPNKPSEPGKPSEPGKPSEPNKPSEP  2079


 Score = 80.1 bits (196),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 48/120 (40%), Positives = 55/120 (46%), Gaps = 3/120 (3%)
 Frame = +1

Query  145   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  324
             PN  P K + P   SEPT P+ P K   P   +EP  P+ P K   P   SEP  PN   
Sbjct  1974  PNE-PGKPNEPGKPSEPTKPSEPNKPSEPGKPNEPNKPSEPGKPSEPNKPSEPGKPNEPN  2032

Query  325   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
             K   P   SEP  P+ P K   P   SEP  PS P K   P   SEP  P+ P  G P +
Sbjct  2033  KPSEPNKPSEPGKPSEPGKPSEPNKPSEPGKPSEPGKPSEPNKPSEPNKPSEP--GKPSK  2090


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 43/105 (41%), Positives = 49/105 (47%), Gaps = 2/105 (2%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             EP  PN P K + P   SEPT P+ P K   P   +EP  P+   K   P   SEP  PN
Sbjct  1970  EPNKPNEPGKPNEPGKPSEPTKPSEPNKPSEPGKPNEPNKPSEPGKPSEPNKPSEPGKPN  2029

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
              P K   P   SEP  PS P K   P   SEP  P+ P  G P +
Sbjct  2030  EPNKPSEPNKPSEPGKPSEPGKPSEPNKPSEPGKPSEP--GKPSE  2072


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 44/113 (39%), Positives = 51/113 (45%), Gaps = 1/113 (1%)
 Frame = +1

Query  145   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  324
             PN  P K   P   SEP  P+ P K + P   SEP  P+ P K   P   +EP  P+   
Sbjct  1980  PNE-PGKPSEPTKPSEPNKPSEPGKPNEPNKPSEPGKPSEPNKPSEPGKPNEPNKPSEPN  2038

Query  325   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             K   P   SEP  P+ P K   P   SEP  PS P K   P   SEP  P+ P
Sbjct  2039  KPSEPGKPSEPGKPSEPNKPSEPGKPSEPGKPSEPNKPSEPNKPSEPGKPSKP  2091


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 42/108 (39%), Positives = 46/108 (43%), Gaps = 0/108 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P K   P   SEP  PN P K   P   SEP  P+ P K   P   SEP  P+   K   
Sbjct  1989  PTKPSEPNKPSEPGKPNEPNKPSEPGKPSEPNKPSEPGKPNEPNKPSEPNKPSEPGKPSE  2048

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNH  480
             P   SEP  P+ P K   P   SEP  PS P K   P   S+P    H
Sbjct  2049  PGKPSEPNKPSEPGKPSEPGKPSEPNKPSEPNKPSEPGKPSKPNKSVH  2096


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 35/94 (37%), Positives = 41/94 (44%), Gaps = 1/94 (1%)
 Frame = +1

Query  145   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  324
             PN  P K   P   SEP  P+ P K + P   SEP  P+ P K   P   SEP  P+   
Sbjct  2004  PNE-PNKPSEPGKPSEPNKPSEPGKPNEPNKPSEPNKPSEPGKPSEPGKPSEPNKPSEPG  2062

Query  325   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSH  426
             K   P   SEP  P+ P K   P   S+P    H
Sbjct  2063  KPSEPGKPSEPNKPSEPNKPSEPGKPSKPNKSVH  2096



>ref|WP_042802751.1| hypothetical protein [Mannheimia haemolytica]
 gb|EXI62308.1| hypothetical protein AK33_06225 [Mannheimia haemolytica serotype 
A1/A6 str. PKL10]
Length=2028

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/127 (28%), Positives = 56/127 (44%), Gaps = 2/127 (2%)
 Frame = +1

Query  124  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
            A+P   +    P + + P    +P  P  P + + P    +P  P  P++ E P    +P
Sbjct  171  AQPEQPVQPEQPTQPEQPTQPEQPIQPEQPTQPEKPTQPEQPAQPEQPIQPEQPTQPEQP  230

Query  304  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            T P    + + PA   +PT P  P + + P    +PT P  P + + PA   +PT P  P
Sbjct  231  TQPEQPAQPEKPAQPEQPTQPEQPTQPEQPTRPEQPTQPEQPTQPEKPAQPEQPTQPEQP  290

Query  484  LNGSPEQ  504
                PEQ
Sbjct  291  TQ--PEQ  295


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 0/110 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P + + P    +P  P  P++ + P    +PT P  P + E PA   +PT P    + +
Sbjct  199  QPTQPEKPTQPEQPAQPEQPIQPEQPTQPEQPTQPEQPAQPEKPAQPEQPTQPEQPTQPE  258

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             P    +PT P  P + + PA   +PT P  P + + P    +PT P  P
Sbjct  259  QPTRPEQPTQPEQPTQPEKPAQPEQPTQPEQPTQPEQPTQPEQPTQPEQP  308


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 35/127 (28%), Positives = 56/127 (44%), Gaps = 2/127 (2%)
 Frame = +1

Query  124  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
            A+P   +    P + + P    +P  P  P++ + P    +PT P  P++ E P    +P
Sbjct  147  AQPEQPIQPEQPTQPEQPTQPEQPAQPEQPVQPEQPTQPEQPTQPEQPIQPEQPTQPEKP  206

Query  304  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            T P    + + P    +PT P  P + + PA   +P  P  P + + P    +PT P  P
Sbjct  207  TQPEQPAQPEQPIQPEQPTQPEQPTQPEQPAQPEKPAQPEQPTQPEQPTQPEQPTRPEQP  266

Query  484  LNGSPEQ  504
                PEQ
Sbjct  267  TQ--PEQ  271


 Score = 77.4 bits (189),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 35/127 (28%), Positives = 54/127 (43%), Gaps = 2/127 (2%)
 Frame = +1

Query  124  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
            A+P        P++ + P    +PT P  P + + P    +PT P  P + E P    +P
Sbjct  141  AQPEKTAQPEQPIQPEQPTQPEQPTQPEQPAQPEQPVQPEQPTQPEQPTQPEQPIQPEQP  200

Query  304  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            T P    + + PA   +P  P  P + + P    +P  P  P + + P    +PT P  P
Sbjct  201  TQPEKPTQPEQPAQPEQPIQPEQPTQPEQPTQPEQPAQPEKPAQPEQPTQPEQPTQPEQP  260

Query  484  LNGSPEQ  504
                PEQ
Sbjct  261  TR--PEQ  265


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 51/121 (42%), Gaps = 4/121 (3%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P + + PA   +P  P  P + + P    +P  P  P + E P    +P  P   ++ +
Sbjct  163  QPTQPEQPAQPEQPVQPEQPTQPEQPTQPEQPIQPEQPTQPEKPTQPEQPAQPEQPIQPE  222

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN----GSPE  501
             P    +PT P  P + + PA   +PT P  P + + P    +PT P  P        PE
Sbjct  223  QPTQPEQPTQPEQPAQPEKPAQPEQPTQPEQPTQPEQPTRPEQPTQPEQPTQPEKPAQPE  282

Query  502  Q  504
            Q
Sbjct  283  Q  283


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/117 (28%), Positives = 51/117 (44%), Gaps = 2/117 (2%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P++ + P    +PT P  P + + P    +PT P  P + E PA   +P  P    + +
Sbjct  193  QPIQPEQPTQPEKPTQPEQPAQPEQPIQPEQPTQPEQPTQPEQPAQPEKPAQPEQPTQPE  252

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
             P    +PT P  P + + P    +P  P  P + + P    +PT P  P    PEQ
Sbjct  253  QPTQPEQPTRPEQPTQPEQPTQPEKPAQPEQPTQPEQPTQPEQPTQPEQPTQ--PEQ  307


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 33/117 (28%), Positives = 50/117 (43%), Gaps = 2/117 (2%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P + + P    +PT P  P + + PA   +P  P  P + E P    +P  P    + +
Sbjct  187  QPTQPEQPIQPEQPTQPEKPTQPEQPAQPEQPIQPEQPTQPEQPTQPEQPAQPEKPAQPE  246

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
             P    +PT P  P + + P    +PT P  P + + P    +PT P  P    PEQ
Sbjct  247  QPTQPEQPTQPEQPTRPEQPTQPEQPTQPEKPAQPEQPTQPEQPTQPEQPTQ--PEQ  301


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/109 (28%), Positives = 47/109 (43%), Gaps = 0/109 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P + + PA   +P  P  P + + P    +P  P  P + E P    +PT P    + + 
Sbjct  206  PTQPEQPAQPEQPIQPEQPTQPEQPTQPEQPAQPEKPAQPEQPTQPEQPTQPEQPTRPEQ  265

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            P    +PT P  P + + P    +PT P  P + + P    +PT P  P
Sbjct  266  PTQPEQPTQPEKPAQPEQPTQPEQPTQPEQPTQPEQPTQPEQPTQPEKP  314


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/99 (30%), Positives = 47/99 (47%), Gaps = 0/99 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P++ + P    +PT P  P + + PA   +PT P  P + E P    +PT P    + +
Sbjct  217  QPIQPEQPTQPEQPTQPEQPAQPEKPAQPEQPTQPEQPTQPEQPTRPEQPTQPEQPTQPE  276

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPA  450
             PA   +PT P  P + + P    +PT P  P + + PA
Sbjct  277  KPAQPEQPTQPEQPTQPEQPTQPEQPTQPEQPTQPEKPA  315


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 31/112 (28%), Positives = 48/112 (43%), Gaps = 2/112 (2%)
 Frame = +1

Query  169  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
            +S A   +   P  P++ + P    +PT P  P + E P    +PT P    + + P   
Sbjct  138  NSSAQPEKTAQPEQPIQPEQPTQPEQPTQPEQPAQPEQPVQPEQPTQPEQPTQPEQPIQP  197

Query  349  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
             +PT P  P + + PA   +P  P  P + + P    +P  P  P    PEQ
Sbjct  198  EQPTQPEKPTQPEQPAQPEQPIQPEQPTQPEQPTQPEQPAQPEKP--AQPEQ  247



>ref|WP_001083120.1| alpha-L-fucosidase [Streptococcus oralis]
 gb|EIC76503.1| alpha-L-fucosidase [Streptococcus oralis SK610]
Length=2028

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 56/109 (51%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + PA   +P  P +P++ + PA   +P  P  P + E PA   +PT P    + + 
Sbjct  1699  PAQPEKPAQPEQPAEPENPVQPEKPAQPEKPAEPEKPAQPEKPAQPEKPTQPETPAQPEK  1758

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             PA   +PT P +P++ + PA   +PT P +P++ + PA    P  P  P
Sbjct  1759  PAQPEQPTQPENPVQPEKPAQPEQPTQPENPVQPEKPAQPETPAQPEKP  1807


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 37/127 (29%), Positives = 64/127 (50%), Gaps = 2/127 (2%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P   +    P + ++P    +P  P  P + + PA   +P  P +P++ E PA   +P
Sbjct  1670  AQPENPVQPEKPAQPETPVQPEKPAEPEKPAQPEKPAQPEQPAEPENPVQPEKPAQPEKP  1729

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + + PA   +PT P  P + + PA   +PT P +P++ + PA   +PT P +P
Sbjct  1730  AEPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEQPTQPENPVQPEKPAQPEQPTQPENP  1789

Query  484   LNGSPEQ  504
             +   PE+
Sbjct  1790  VQ--PEK  1794


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 58/120 (48%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P       +P++ + PA   +P  P  P + + PA   +PT P  P + E PA   +P
Sbjct  1706  AQPEQPAEPENPVQPEKPAQPEKPAEPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEQP  1765

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             T P   ++ + PA   +PT P +P++ + PA    P  P  P + ++P    +P  P  P
Sbjct  1766  TQPENPVQPEKPAQPEQPTQPENPVQPEKPAQPETPAQPEKPAQPETPTQPEKPVQPEKP  1825


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/128 (30%), Positives = 62/128 (48%), Gaps = 7/128 (5%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + + PA   +PT P +P++ + PA   +PT P +P++ E PA    P
Sbjct  1742  AQPEKPTQPETPAQPEKPAQPEQPTQPENPVQPEKPAQPEQPTQPENPVQPEKPAQPETP  1801

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P      + PA    PT P  P++ + P     PT P +P++ + PA    P  P  P
Sbjct  1802  AQP------EKPAQPETPTQPEKPVQPEKPTEPENPTQPENPVQPEKPAQPETPAQPEKP  1855

Query  484   L-NGSPEQ  504
             + + SPE+
Sbjct  1856  ITSSSPEE  1863


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + + PA   +PT P  P + + PA   +PT P +P++ E PA   +P
Sbjct  1724  AQPEKPAEPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEQPTQPENPVQPEKPAQPEQP  1783

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             T P   ++ + PA    P  P  P + ++P    +P  P  P + ++P     P  P  P
Sbjct  1784  TQPENPVQPEKPAQPETPAQPEKPAQPETPTQPEKPVQPEKPTEPENPTQPENPVQPEKP  1843



>gb|EFJ68906.1| LPXTG-motif cell wall anchor domain protein [Lactobacillus gasseri 
JV-V03]
Length=1059

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 46/117 (39%), Positives = 48/117 (41%), Gaps = 1/117 (1%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P   D P   S+PT P  P     P   SEPT P  P     P   SEPT P        
Sbjct  831  PTTPDKPTQPSKPTKPEEPTTPGKPVQPSEPTKPEEPTTPAKPVQPSEPTKPEEPTTPGK  890

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP-LNGSPEQ  504
            P   SEPT P  P     P   SEPT P  P     PA  SEPT P  P + G P Q
Sbjct  891  PVQPSEPTKPEEPTTPGKPVQPSEPTKPEEPTTPGKPAQPSEPTKPEEPIIPGKPAQ  947


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 43/106 (41%), Positives = 44/106 (42%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P     P   SEPT P  P     P   SEPT P  P     P   SEPT P        
Sbjct  849  PTTPGKPVQPSEPTKPEEPTTPAKPVQPSEPTKPEEPTTPGKPVQPSEPTKPEEPTTPGK  908

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
            P   SEPT P  P     PA  SEPT P  P+    PA  SEPT P
Sbjct  909  PVQPSEPTKPEEPTTPGKPAQPSEPTKPEEPIIPGKPAQPSEPTKP  954


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 35/102 (34%), Positives = 45/102 (44%), Gaps = 0/102 (0%)
 Frame = +1

Query  190  EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
            EPT P+ P +   P    EPT P  P++   P    EPT P   ++   P    EPT P 
Sbjct  830  EPTTPDKPTQPSKPTKPEEPTTPGKPVQPSEPTKPEEPTTPAKPVQPSEPTKPEEPTTPG  889

Query  370  HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  495
             P++   P    EPT P  P++   P    EPT P  P   S
Sbjct  890  KPVQPSEPTKPEEPTTPGKPVQPSEPTKPEEPTTPGKPAQPS  931


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 34/88 (39%), Positives = 36/88 (41%), Gaps = 7/88 (8%)
 Frame = +1

Query  244  EPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPS  423
            EPT P+ P +   P    EPT P        P   SEPT P  P     P   SEPT P 
Sbjct  830  EPTTPDKPTQPSKPTKPEEPTTPG------KPVQPSEPTKPEEPTTPAKPVQPSEPTKPE  883

Query  424  HPLKYDSPAMLSEPTMPNHPLN-GSPEQ  504
             P     P   SEPT P  P   G P Q
Sbjct  884  EPTTPGKPVQPSEPTKPEEPTTPGKPVQ  911



>ref|WP_001083124.1| alpha-L-fucosidase [Streptococcus sp. GMD5S]
Length=2093

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 38/127 (30%), Positives = 59/127 (46%), Gaps = 2/127 (2%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P++ ++P    +P  P +P++ + PA   +PT P  P + E PA   +P
Sbjct  1795  AQPEKPAEPEKPVQPENPTQPEKPAQPENPVQPEKPAQPEKPTQPETPAQPEKPAQPEQP  1854

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             T P    + + PA   +PT P  P + + PA    P  P  P + + PA    PT P  P
Sbjct  1855  TQPETPAQPEKPAQPEKPTQPETPAQPEKPAQPETPAQPEKPAQPEKPAQPENPTQPETP  1914

Query  484   LNGSPEQ  504
                 PE+
Sbjct  1915  --AQPEK  1919


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 56/113 (50%), Gaps = 6/113 (5%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             +P++ + PA   +PT P  P + + PA   +PT P  P + E PA   +PT P      +
Sbjct  1823  NPVQPEKPAQPEKPTQPETPAQPEKPAQPEQPTQPETPAQPEKPAQPEKPTQP------E  1876

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNG  492
             +PA   +P  P  P + + PA   +P  P +P + ++PA   +P   + P  G
Sbjct  1877  TPAQPEKPAQPETPAQPEKPAQPEKPAQPENPTQPETPAQPEKPITSSSPEEG  1929


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/105 (28%), Positives = 47/105 (45%), Gaps = 2/105 (2%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             E   P  P + + P     PT P  P + E+P    +P  P    + ++PA   +P  P 
Sbjct  1793  EAAQPEKPAEPEKPVQPENPTQPEKPAQPENPVQPEKPAQPEKPTQPETPAQPEKPAQPE  1852

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
              P + ++PA   +P  P  P + ++PA   +P  P  P    PE+
Sbjct  1853  QPTQPETPAQPEKPAQPEKPTQPETPAQPEKPAQPETP--AQPEK  1895


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 46/110 (42%), Gaps = 0/110 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + + PA   +PT P  P + + PA   +PT P  P + E PA    P
Sbjct  1831  AQPEKPTQPETPAQPEKPAQPEQPTQPETPAQPEKPAQPEKPTQPETPAQPEKPAQPETP  1890

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAM  453
               P    + + PA    PT P  P + + P   S P      L +  P++
Sbjct  1891  AQPEKPAQPEKPAQPENPTQPETPAQPEKPITSSSPEEGVKDLVFTLPSL  1940



>ref|WP_001083116.1| alpha-L-fucosidase [Streptococcus sp. GMD3S]
Length=2111

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/117 (29%), Positives = 60/117 (51%), Gaps = 1/117 (1%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + P    +PT P +P++ + PA   +P  P  P + E+PA   +P  P    + ++
Sbjct  1830  PAQPEKPVQPEKPTQPENPVQPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEKPTQPET  1889

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL-NGSPEQ  504
             PA   +PT P +P++ ++PA   +P  P  P + + P     P  P  P+ + SPE+
Sbjct  1890  PAQPEKPTQPENPVQPETPAQPEKPAQPEKPAQPEKPTQPENPAQPEKPITSSSPEE  1946


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/116 (28%), Positives = 59/116 (51%), Gaps = 2/116 (2%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + ++P    +P  P  P + + P    +PT P +P++ E PA   +P  P    + ++
Sbjct  1812  PTQPENPVQPEKPAQPEKPAQPEKPVQPEKPTQPENPVQPEKPAQPEKPAQPEKPTQPET  1871

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
             PA   +P  P  P + ++PA   +PT P +P++ ++PA   +P  P  P    PE+
Sbjct  1872  PAQPEKPAQPEKPTQPETPAQPEKPTQPENPVQPETPAQPEKPAQPEKP--AQPEK  1925


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P       +P++ + P    +P  P  P + ++P    +P  P  P + E P    +P
Sbjct  1783  AQPEKPAQPENPVQPEKPTQPEKPAQPEKPTQPENPVQPEKPAQPEKPAQPEKPVQPEKP  1842

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             T P   ++ + PA   +P  P  P + ++PA   +P  P  P + ++PA   +PT P +P
Sbjct  1843  TQPENPVQPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEKPTQPETPAQPEKPTQPENP  1902

Query  484   L  486
             +
Sbjct  1903  V  1903


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 36/127 (28%), Positives = 57/127 (45%), Gaps = 2/127 (2%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P   +    P + + PA   +PT P +P++ + PA   +P  P  P++ E P     P
Sbjct  1789  AQPENPVQPEKPTQPEKPAQPEKPTQPENPVQPEKPAQPEKPAQPEKPVQPEKPTQPENP  1848

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + + PA   +PT P  P + + PA   +PT P  P + + P     P  P  P
Sbjct  1849  VQPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEKPTQPETPAQPEKPTQPENPVQPETP  1908

Query  484   LNGSPEQ  504
                 PE+
Sbjct  1909  --AQPEK  1913


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/98 (29%), Positives = 48/98 (49%), Gaps = 0/98 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             +P++ + PA   +P  P  P + ++PA   +P  P  P + E+PA   +PT P   ++ +
Sbjct  1847  NPVQPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEKPTQPETPAQPEKPTQPENPVQPE  1906

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSP  447
             +PA   +P  P  P + + P     P  P  P+   SP
Sbjct  1907  TPAQPEKPAQPEKPAQPEKPTQPENPAQPEKPITSSSP  1944


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 28/104 (27%), Positives = 45/104 (43%), Gaps = 6/104 (6%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPA------MLS  351
             E   P  P + ++P    +PT P  P + E P     P  P    + + PA         
Sbjct  1781  EAAQPEKPAQPENPVQPEKPTQPEKPAQPEKPTQPENPVQPEKPAQPEKPAQPEKPVQPE  1840

Query  352   EPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             +PT P +P++ + PA   +P  P  P + ++PA   +P  P  P
Sbjct  1841  KPTQPENPVQPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEKP  1884


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 51/110 (46%), Gaps = 6/110 (5%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + ++PA   +P  P  P + ++PA   +PT P +P++ E+PA   +P
Sbjct  1855  AQPEKPAQPEKPTQPETPAQPEKPAQPEKPTQPETPAQPEKPTQPENPVQPETPAQPEKP  1914

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAM  453
               P      + PA   +PT P +P + + P   S P      L +  P +
Sbjct  1915  AQP------EKPAQPEKPTQPENPAQPEKPITSSSPEEGVKDLVFTLPNL  1958



>ref|WP_001083117.1| alpha-L-fucosidase [Streptococcus oralis]
 gb|EIC78239.1| alpha-L-fucosidase [Streptococcus oralis SK100]
Length=2034

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 37/127 (29%), Positives = 59/127 (46%), Gaps = 2/127 (2%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + ++PA   +PT P  P + + P     P  P  P + E PA   +P
Sbjct  1676  AQPEKPAQPEKPTQPETPAQPEKPTQPETPAQPEKPTQPENPVQPEKPAQPEKPAQPEQP  1735

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             T P   ++ + PA   +P  P  P + + PA    P  P  P++ + PA   +PT P +P
Sbjct  1736  TQPENPVQPEKPAQPEKPAQPEKPAQPEQPAQPETPAQPEKPVQPEKPAQPEKPTQPENP  1795

Query  484   LNGSPEQ  504
             +   PE+
Sbjct  1796  VQ--PEK  1800


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 34/116 (29%), Positives = 56/116 (48%), Gaps = 2/116 (2%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + PA   +PT P +P++ + PA   +P  P  P + E PA    P  P   ++ + 
Sbjct  1723  PAQPEKPAQPEQPTQPENPVQPEKPAQPEKPAQPEKPAQPEQPAQPETPAQPEKPVQPEK  1782

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
             PA   +PT P +P++ + PA   +P  P  P + + P    +P  P  P    PE+
Sbjct  1783  PAQPEKPTQPENPVQPEKPAQPEKPAQPEKPAQPEKPTQPEKPAQPEKP--AQPEK  1836


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 36/127 (28%), Positives = 58/127 (46%), Gaps = 2/127 (2%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + + P     P  P  P + + PA   +PT P +P++ E PA   +P
Sbjct  1694  AQPEKPTQPETPAQPEKPTQPENPVQPEKPAQPEKPAQPEQPTQPENPVQPEKPAQPEKP  1753

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + + PA    P  P  P++ + PA   +PT P +P++ + PA   +P  P  P
Sbjct  1754  AQPEKPAQPEQPAQPETPAQPEKPVQPEKPAQPEKPTQPENPVQPEKPAQPEKPAQPEKP  1813

Query  484   LNGSPEQ  504
                 PE+
Sbjct  1814  --AQPEK  1818


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 38/128 (30%), Positives = 59/128 (46%), Gaps = 7/128 (5%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + + PA    P  P  P++ + PA   +PT P +P++ E PA   +P
Sbjct  1748  AQPEKPAQPEKPAQPEQPAQPETPAQPEKPVQPEKPAQPEKPTQPENPVQPEKPAQPEKP  1807

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P      + PA   +PT P  P + + PA   +PT P  P + + P     P  P  P
Sbjct  1808  AQP------EKPAQPEKPTQPEKPAQPEKPAQPEKPTQPEKPAQPEKPTQPETPAQPEKP  1861

Query  484   L-NGSPEQ  504
             + + SPE+
Sbjct  1862  ITSSSPEE  1869


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 37/127 (29%), Positives = 58/127 (46%), Gaps = 8/127 (6%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P       +P++ + PA   +P  P  P + + PA    P  P  P++ E PA   +P
Sbjct  1730  AQPEQPTQPENPVQPEKPAQPEKPAQPEKPAQPEQPAQPETPAQPEKPVQPEKPAQPEKP  1789

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             T P      ++P    +P  P  P + + PA   +PT P  P + + PA   +PT P  P
Sbjct  1790  TQP------ENPVQPEKPAQPEKPAQPEKPAQPEKPTQPEKPAQPEKPAQPEKPTQPEKP  1843

Query  484   LNGSPEQ  504
                 PE+
Sbjct  1844  --AQPEK  1848


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 33/112 (29%), Positives = 52/112 (46%), Gaps = 2/112 (2%)
 Frame = +1

Query  169   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
             + PA   +P  P  P + ++PA   +PT P  P + E P     P  P    + + PA  
Sbjct  1673  EKPAQPEKPAQPEKPTQPETPAQPEKPTQPETPAQPEKPTQPENPVQPEKPAQPEKPAQP  1732

Query  349   SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
              +PT P +P++ + PA   +P  P  P + + PA    P  P  P+   PE+
Sbjct  1733  EQPTQPENPVQPEKPAQPEKPAQPEKPAQPEQPAQPETPAQPEKPVQ--PEK  1782


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/116 (28%), Positives = 51/116 (44%), Gaps = 2/116 (2%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + PA   +P  P  P + ++PA   +P  P  P + E P     P  P    + + 
Sbjct  1747  PAQPEKPAQPEKPAQPEQPAQPETPAQPEKPVQPEKPAQPEKPTQPENPVQPEKPAQPEK  1806

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
             PA   +P  P  P + + PA   +P  P  P + + PA   +PT P  P    PE+
Sbjct  1807  PAQPEKPAQPEKPTQPEKPAQPEKPAQPEKPTQPEKPAQPEKPTQPETP--AQPEK  1860


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 47/105 (45%), Gaps = 8/105 (8%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             E   P  P + + PA   +PT P      E+PA   +PT P    + + P     P  P 
Sbjct  1668  EAAQPEKPAQPEKPAQPEKPTQP------ETPAQPEKPTQPETPAQPEKPTQPENPVQPE  1721

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
              P + + PA   +PT P +P++ + PA   +P  P  P    PEQ
Sbjct  1722  KPAQPEKPAQPEQPTQPENPVQPEKPAQPEKPAQPEKP--AQPEQ  1764


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 31/116 (27%), Positives = 51/116 (44%), Gaps = 6/116 (5%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHP------LKYESP  285
             A+P T      P++ + PA   +PT P +P++ + PA   +P  P  P       + E P
Sbjct  1766  AQPETPAQPEKPVQPEKPAQPEKPTQPENPVQPEKPAQPEKPAQPEKPAQPEKPTQPEKP  1825

Query  286   AMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAM  453
             A   +P  P    + + PA   +PT P  P + + P   S P      L +  P++
Sbjct  1826  AQPEKPAQPEKPTQPEKPAQPEKPTQPETPAQPEKPITSSSPEEGVKDLVFTLPSL  1881



>emb|CCB52766.1| putative LPXTG cell wall-anchored protein (pseudogene) [Staphylococcus 
lugdunensis N920143]
Length=1619

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 41/108 (38%), Positives = 49/108 (45%), Gaps = 12/108 (11%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P K + P   SEP  PN P K   P+  SEP  P+ P K   P   SEP  PN       
Sbjct  1454  PNKPNEPGKPSEPGKPNEPNKPSEPSKPSEPNKPSEPSKPSEPGKPSEPNKPN-------  1506

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNH  480
                  EP+ P+ P K + P+  SEPT PS P K   P   S+P    H
Sbjct  1507  -----EPSKPSEPNKPNEPSKPSEPTKPSEPNKPSEPGKPSKPNKSVH  1549


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/98 (39%), Positives = 45/98 (46%), Gaps = 6/98 (6%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             EP  PN P K   P   +EP  P+ P K   P   SEP+ P+       P   SEP  PN
Sbjct  1453  EPNKPNEPGKPSEPGKPNEPNKPSEPSKPSEPNKPSEPSKPS------EPGKPSEPNKPN  1506

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P K   P   +EP+ PS P K   P   SEP  P+ P
Sbjct  1507  EPSKPSEPNKPNEPSKPSEPTKPSEPNKPSEPGKPSKP  1544


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 38/84 (45%), Gaps = 6/84 (7%)
 Frame = +1

Query  244   EPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPS  423
             EP  PN P K   P   +EP  P+       P+  SEP  P+ P K   P   SEP  P+
Sbjct  1453  EPNKPNEPGKPSEPGKPNEPNKPS------EPSKPSEPNKPSEPSKPSEPGKPSEPNKPN  1506

Query  424   HPLKYDSPAMLSEPTMPNHPLNGS  495
              P K   P   +EP+ P+ P   S
Sbjct  1507  EPSKPSEPNKPNEPSKPSEPTKPS  1530


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 35/94 (37%), Positives = 43/94 (46%), Gaps = 13/94 (14%)
 Frame = +1

Query  145   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  324
             PN  P K   P+  SEP  P+ P K   P   SEP  PN P         S+P+ PN   
Sbjct  1469  PNE-PNKPSEPSKPSEPNKPSEPSKPSEPGKPSEPNKPNEP---------SKPSEPN---  1515

Query  325   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSH  426
             K + P+  SEPT P+ P K   P   S+P    H
Sbjct  1516  KPNEPSKPSEPTKPSEPNKPSEPGKPSKPNKSVH  1549



>dbj|BAA77828.1| trappin [Hippopotamus amphibius]
Length=180

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 50/112 (45%), Gaps = 6/112 (5%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            DP KG + + G D + G+   KG   + G D + G+   KG   + G D + G+   K  
Sbjct  24   DPVKGQYPVKGQDPVKGQDPVKGQYPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVK--  81

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  159
                G D + G    KG   + G D + G+   KG + + G D + G+   K
Sbjct  82   ----GQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQYPVKGQDPVKGQDPVK  129


 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 45/102 (44%), Gaps = 0/102 (0%)
 Frame = -1

Query  464  GSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**FGIVGSDSIA  285
            G D + G+   KG   + G D + G+   KG + + G D + G+   K    + G D + 
Sbjct  16   GQDPVKGQDPVKGQYPVKGQDPVKGQDPVKGQYPVKGQDPVKGQDPVKGQDPVKGQDPVK  75

Query  284  GDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  159
            G    KG   + G D + G+   KG   + G D + G+   K
Sbjct  76   GQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQYPVK  117


 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 43/96 (45%), Gaps = 0/96 (0%)
 Frame = -1

Query  446  GESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**FGIVGSDSIAGDSYFK  267
            G+   KG +   G D + G+   KG + + G D + G+   K  + + G D + G    K
Sbjct  4    GQGTKKGNVLFKGQDPVKGQDPVKGQYPVKGQDPVKGQDPVKGQYPVKGQDPVKGQDPVK  63

Query  266  G*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  159
            G   + G D + G+   KG   + G D + G+   K
Sbjct  64   GQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVK  99



>ref|WP_015431801.1| hypothetical protein [Bibersteinia trehalosi]
 gb|AGH37662.1| hypothetical protein WQG_3820 [Bibersteinia trehalosi USDA-ARS-USMARC-192]
Length=2013

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 35/103 (34%), Positives = 45/103 (44%), Gaps = 0/103 (0%)
 Frame = +1

Query  175  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  354
            P   SEP  P+ P +   P   SEP  P+ P +   P   SEP  P+   +   P   SE
Sbjct  83   PEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSE  142

Query  355  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            P  P+ P +   P   SEP  PS P +   P   +EP  P  P
Sbjct  143  PEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPTEPEQPTEP  185


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 37/115 (32%), Positives = 49/115 (43%), Gaps = 3/115 (3%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P +   P   SEP  P+ P +   P   SEP  P+ P +   P   SEP  P+   +   
Sbjct  83   PEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSE  142

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPE  501
            P   SEP  P+ P +   P   SEP  PS P   + P    +PT P   +N   E
Sbjct  143  PEQPSEPEQPSEPEQPSEPEQPSEPEQPSEP---EQPTEPEQPTEPQLTINAITE  194


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 38/106 (36%), Positives = 47/106 (44%), Gaps = 7/106 (7%)
 Frame = +1

Query  190  EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
            EP  P+ P +   P   SEP  P+ P +   P   SEP  P+       P   SEP  P+
Sbjct  70   EPEQPSEPEQPVEPEQPSEPEQPSEPEQPSEPEQPSEPEQPS------EPEQPSEPEQPS  123

Query  370  HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS-PEQ  504
             P +   P   SEP  PS P +   P   SEP  P+ P   S PEQ
Sbjct  124  EPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQ  169



>ref|WP_042902012.1| alpha-L-fucosidase [Streptococcus oralis]
 gb|KEQ51034.1| hypothetical protein SK143_0192 [Streptococcus oralis]
Length=2087

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 36/128 (28%), Positives = 60/128 (47%), Gaps = 1/128 (1%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + ++PA   +P  P  P++ + PA   +P  P  P + E+P    +P
Sbjct  1795  AQPEKPAQPEKPTQPETPAQPEKPAQPEKPVQPEKPAQPEQPAQPETPAQPENPVQPEKP  1854

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P   ++ + PA    P  P  P + + PA   +P  P  P + + PA   +PT P  P
Sbjct  1855  AEPEKPVQPEKPAQPETPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPEKP  1914

Query  484   L-NGSPEQ  504
             + + SPE+
Sbjct  1915  ITSSSPEE  1922


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/116 (29%), Positives = 53/116 (46%), Gaps = 2/116 (2%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + PA   +PT P  P + + PA   +P  P  P + E PA    P  P   ++ + 
Sbjct  1794  PAQPEKPAQPEKPTQPETPAQPEKPAQPEKPVQPEKPAQPEQPAQPETPAQPENPVQPEK  1853

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
             PA   +P  P  P + ++PA   +P  P  P + + PA   +P  P  P    PE+
Sbjct  1854  PAEPEKPVQPEKPAQPETPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKP--AQPEK  1907


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 32/116 (28%), Positives = 53/116 (46%), Gaps = 2/116 (2%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + PA   +P  P  P + ++PA   +P  P  P++ E PA   +P  P    + ++
Sbjct  1788  PAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEKPVQPEKPAQPEQPAQPETPAQPEN  1847

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
             P    +P  P  P++ + PA    P  P  P + + PA   +P  P  P    PE+
Sbjct  1848  PVQPEKPAEPEKPVQPEKPAQPETPAQPEKPAQPEKPAQPEKPAQPEKP--AQPEK  1901


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 32/112 (29%), Positives = 51/112 (46%), Gaps = 2/112 (2%)
 Frame = +1

Query  169   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
             + P    +P  P  P + + PA   +PT P  P + E PA   +P  P    + + PA  
Sbjct  1780  EKPTQPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEKPVQPEKPAQPEQPAQP  1839

Query  349   SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
               P  P +P++ + PA   +P  P  P + ++PA   +P  P  P    PE+
Sbjct  1840  ETPAQPENPVQPEKPAEPEKPVQPEKPAQPETPAQPEKPAQPEKP--AQPEK  1889


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/116 (26%), Positives = 47/116 (41%), Gaps = 2/116 (2%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + PA   +P  P  P + + P     P  P  P + E P    +P  P    + ++
Sbjct  1782  PTQPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEKPVQPEKPAQPEQPAQPET  1841

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
             PA    P  P  P + + P    +P  P  P + + PA   +P  P  P    PE+
Sbjct  1842  PAQPENPVQPEKPAEPEKPVQPEKPAQPETPAQPEKPAQPEKPAQPEKP--AQPEK  1895



>ref|WP_039156450.1| adhesin [Lactobacillus gasseri]
 gb|AJC07861.1| adhesin [Lactobacillus gasseri 130918]
Length=1065

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 58/110 (53%), Gaps = 3/110 (3%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
            +P K   P+   +P  P  P K D P+  ++PT P  P K + P+  ++PT P    K D
Sbjct  820  NPDKPSKPSKPDKPDKPETPNKPDKPSEPTKPTKPETPNKPDKPSEPTKPTKPETPNKPD  879

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             P+  ++PT P  P K D P+  S+PT P  P K D P   S+PT PN P
Sbjct  880  KPSEPTKPTKPETPNKPDKPSEPSKPTKPETPNKPDKP---SQPTKPNKP  926


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 38/103 (37%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P K D P+  ++PT P  P K D P+  ++PT P  P K + P+  ++PT P    K D 
Sbjct  839  PNKPDKPSEPTKPTKPETPNKPDKPSEPTKPTKPETPNKPDKPSEPTKPTKPETPNKPDK  898

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  465
            P+  S+PT P  P K D P+  ++P  P  P K D     S+P
Sbjct  899  PSEPSKPTKPETPNKPDKPSQPTKPNKPEVPNKSDKSNESSKP  941


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 34/104 (33%), Positives = 51/104 (49%), Gaps = 0/104 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P K D P+  ++PT P  P K D P+  ++PT P  P K + P+  S+PT P    K D 
Sbjct  857  PNKPDKPSEPTKPTKPETPNKPDKPSEPTKPTKPETPNKPDKPSEPSKPTKPETPNKPDK  916

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPT  468
            P+  ++P  P  P K D     S+P   S     +S  ++ + T
Sbjct  917  PSQPTKPNKPEVPNKSDKSNESSKPDKTSDVKPTESVKLIHQTT  960



>ref|WP_001083121.1| alpha-L-fucosidase [Streptococcus oralis]
 gb|EGL90722.1| alpha-L-fucosidase [Streptococcus oralis SK255]
Length=1962

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 34/116 (29%), Positives = 54/116 (47%), Gaps = 2/116 (2%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + PA   +P  P  P + ++P    +P  P  P + E PA   +P  P    + + 
Sbjct  1675  PAESEKPAQPEKPAQPEKPAQPETPVQPEKPVQPEKPAEPEKPAQPEKPAQPEKPAQPEK  1734

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
             PA   +PT P  P + + PA   +PT P  P + ++PA   +P  P  P    PE+
Sbjct  1735  PAQPEKPTQPETPAQPEKPAQPEKPTQPEKPAQPETPAQPEKPAEPEKP--AQPEK  1788


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/116 (28%), Positives = 51/116 (44%), Gaps = 2/116 (2%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + PA   +P  P  P + + PA    P  P  P++ E PA   +P  P    + + 
Sbjct  1669  PAQPEKPAESEKPAQPEKPAQPEKPAQPETPVQPEKPVQPEKPAEPEKPAQPEKPAQPEK  1728

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
             PA   +P  P  P + ++PA   +P  P  P + + PA    P  P  P    PE+
Sbjct  1729  PAQPEKPAQPEKPTQPETPAQPEKPAQPEKPTQPEKPAQPETPAQPEKP--AEPEK  1782


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/98 (31%), Positives = 45/98 (46%), Gaps = 0/98 (0%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             EP  P  P + + PA   +P  P  P + E+P    +P  P    + + PA   +P  P 
Sbjct  1668  EPAQPEKPAESEKPAQPEKPAQPEKPAQPETPVQPEKPVQPEKPAEPEKPAQPEKPAQPE  1727

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P + + PA   +PT P  P + + PA   +PT P  P
Sbjct  1728  KPAQPEKPAQPEKPTQPETPAQPEKPAQPEKPTQPEKP  1765


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 31/112 (28%), Positives = 49/112 (44%), Gaps = 0/112 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + PA    P  P  P++ + PA   +P  P  P + E PA   +P  P    + ++
Sbjct  1687  PAQPEKPAQPETPVQPEKPVQPEKPAEPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPET  1746

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNG  492
             PA   +P  P  P + + PA    P  P  P + + PA   +P   + P  G
Sbjct  1747  PAQPEKPAQPEKPTQPEKPAQPETPAQPEKPAEPEKPAQPEKPITSSSPEEG  1798


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 32/114 (28%), Positives = 51/114 (45%), Gaps = 0/114 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + ++P    +P  P  P + + PA   +P  P  P + E PA   +P
Sbjct  1682  AQPEKPAQPEKPAQPETPVQPEKPVQPEKPAEPEKPAQPEKPAQPEKPAQPEKPAQPEKP  1741

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  465
             T P    + + PA   +PT P  P + ++PA   +P  P  P + + P   S P
Sbjct  1742  TQPETPAQPEKPAQPEKPTQPEKPAQPETPAQPEKPAEPEKPAQPEKPITSSSP  1795


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 45/99 (45%), Gaps = 0/99 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + PA   +P  P  P + + PA   +PT P  P + E PA   +PT P    + ++
Sbjct  1711  PAEPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEKPTQPEKPAQPET  1770

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAM  453
             PA   +P  P  P + + P   S P      L +  P++
Sbjct  1771  PAQPEKPAEPEKPAQPEKPITSSSPEEGVKDLVFTLPSL  1809



>ref|WP_001083118.1| alpha-L-fucosidase [Streptococcus oralis]
 gb|EIC79947.1| alpha-L-fucosidase [Streptococcus oralis SK10]
Length=1989

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 57/120 (48%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P   +    P + + PA   +P  P  P++ + PA   +PT P  P++ E+P    +P
Sbjct  1685  AQPEKPVQPEKPAQPEKPAQPEKPAQPETPVQPEKPAQPEKPTQPEKPVQPETPTQPEKP  1744

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + ++PA   +P  P  P++ + P    +P  P  P + ++PA   +P  P  P
Sbjct  1745  AQPEKPAQPETPAQPEKPAEPEKPVQPEKPVQPEKPAQPEKPAQPETPAQPEQPAEPEKP  1804


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 33/120 (28%), Positives = 56/120 (47%), Gaps = 4/120 (3%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + ++PA   +P  P  P + + PA   +P  P  P++ E PA   +PT P   ++ ++
Sbjct  1678  PAQPENPAQPEKPVQPEKPAQPEKPAQPEKPAQPETPVQPEKPAQPEKPTQPEKPVQPET  1737

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN----GSPEQ  504
             P    +P  P  P + ++PA   +P  P  P++ + P    +P  P  P        PEQ
Sbjct  1738  PTQPEKPAQPEKPAQPETPAQPEKPAEPEKPVQPEKPVQPEKPAQPEKPAQPETPAQPEQ  1797


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/112 (27%), Positives = 54/112 (48%), Gaps = 0/112 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P++ + PA   +PT P  P++ ++P    +P  P  P + E+PA   +P  P   ++ + 
Sbjct  1714  PVQPEKPAQPEKPTQPEKPVQPETPTQPEKPAQPEKPAQPETPAQPEKPAEPEKPVQPEK  1773

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNG  492
             P    +P  P  P + ++PA   +P  P  P + + PA   +P   + P  G
Sbjct  1774  PVQPEKPAQPEKPAQPETPAQPEQPAEPEKPTQPEKPAQPEKPITSSSPEEG  1825


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 33/127 (26%), Positives = 51/127 (40%), Gaps = 2/127 (2%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P++ + PA   +P  P  P + ++P    +P  P  P + E P     P
Sbjct  1679  AQPENPAQPEKPVQPEKPAQPEKPAQPEKPAQPETPVQPEKPAQPEKPTQPEKPVQPETP  1738

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             T P    + + PA    P  P  P + + P    +P  P  P + + PA    P  P  P
Sbjct  1739  TQPEKPAQPEKPAQPETPAQPEKPAEPEKPVQPEKPVQPEKPAQPEKPAQPETPAQPEQP  1798

Query  484   LNGSPEQ  504
                 PE+
Sbjct  1799  --AEPEK  1803


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 33/128 (26%), Positives = 52/128 (41%), Gaps = 1/128 (1%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + ++P    +P  P  P + + P     PT P  P + E PA    P
Sbjct  1697  AQPEKPAQPEKPAQPETPVQPEKPAQPEKPTQPEKPVQPETPTQPEKPAQPEKPAQPETP  1756

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + + P    +P  P  P + + PA    P  P  P + + P    +P  P  P
Sbjct  1757  AQPEKPAEPEKPVQPEKPVQPEKPAQPEKPAQPETPAQPEQPAEPEKPTQPEKPAQPEKP  1816

Query  484   L-NGSPEQ  504
             + + SPE+
Sbjct  1817  ITSSSPEE  1824


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/105 (29%), Positives = 51/105 (49%), Gaps = 2/105 (2%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             E   P  P + ++PA   +P  P  P + E PA   +P  P   ++ + PA   +PT P 
Sbjct  1671  EAAQPEKPAQPENPAQPEKPVQPEKPAQPEKPAQPEKPAQPETPVQPEKPAQPEKPTQPE  1730

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
              P++ ++P    +P  P  P + ++PA   +P  P  P+   PE+
Sbjct  1731  KPVQPETPTQPEKPAQPEKPAQPETPAQPEKPAEPEKPVQ--PEK  1773


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 30/112 (27%), Positives = 46/112 (41%), Gaps = 2/112 (2%)
 Frame = +1

Query  169   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
             + PA    P  P  P++ + PA   +P  P  P + E+P    +P  P    + + P   
Sbjct  1676  EKPAQPENPAQPEKPVQPEKPAQPEKPAQPEKPAQPETPVQPEKPAQPEKPTQPEKPVQP  1735

Query  349   SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
               PT P  P + + PA    P  P  P + + P    +P  P  P    PE+
Sbjct  1736  ETPTQPEKPAQPEKPAQPETPAQPEKPAEPEKPVQPEKPVQPEKP--AQPEK  1785


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 44/99 (44%), Gaps = 0/99 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + PA   +P  P  P + + PA   +P  P  P++ E PA   +P  P    + + 
Sbjct  1738  PTQPEKPAQPEKPAQPETPAQPEKPAEPEKPVQPEKPVQPEKPAQPEKPAQPETPAQPEQ  1797

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAM  453
             PA   +PT P  P + + P   S P      L +  P++
Sbjct  1798  PAEPEKPTQPEKPAQPEKPITSSSPEEGVKDLVFTLPSL  1836



>ref|WP_001083119.1| alpha-L-fucosidase [Streptococcus oralis]
 gb|EFE57508.1| Gram-positive signal peptide protein, YSIRK family [Streptococcus 
oralis ATCC 35037]
Length=2031

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P T      P + + PA   +P  P  P + ++PA   +P  P  P + E PA   +P
Sbjct  1733  AQPETPAQPEKPAQPEKPAQPEKPAQPETPAQPETPAQPEKPAQPEKPAQPEKPAQPEKP  1792

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + + PA   +P  P  P + + PA   +PT P  P + ++PA   +P  P  P
Sbjct  1793  AQPEKPAETEKPAQPEKPAQPETPAQPEKPAQPEKPTQPEKPAQPETPAQPEKPAEPEKP  1852


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 51/109 (47%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + ++PA   +P  P  P + + PA   +P  P  P++ E PA   +PT P    + ++
Sbjct  1678  PAQPENPAQPEKPVQPEKPAQPEKPAQPEKPAQPETPVQPEKPAQPEKPTQPEKPAQPET  1737

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             PA   +P  P  P + + PA    P  P  P + + PA   +P  P  P
Sbjct  1738  PAQPEKPAQPEKPAQPEKPAQPETPAQPETPAQPEKPAQPEKPAQPEKP  1786


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 55/120 (46%), Gaps = 6/120 (5%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P   +    P + + PA   +P  P  P++ + PA   +PT P  P + E+PA   +P
Sbjct  1685  AQPEKPVQPEKPAQPEKPAQPEKPAQPETPVQPEKPAQPEKPTQPEKPAQPETPAQPEKP  1744

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P      + PA   +P  P  P + ++PA   +P  P  P + + PA   +P  P  P
Sbjct  1745  AQP------EKPAQPEKPAQPETPAQPETPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKP  1798


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 50/109 (46%), Gaps = 6/109 (6%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P++ + PA   +PT P  P + ++PA   +P  P  P + E PA    P  P      ++
Sbjct  1714  PVQPEKPAQPEKPTQPEKPAQPETPAQPEKPAQPEKPAQPEKPAQPETPAQP------ET  1767

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             PA   +P  P  P + + PA   +P  P  P + + PA   +P  P  P
Sbjct  1768  PAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAETEKPAQPEKPAQPETP  1816


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/123 (27%), Positives = 52/123 (42%), Gaps = 0/123 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + ++PA    P  P  P + + PA   +P  P  P + E PA   +P
Sbjct  1745  AQPEKPAQPEKPAQPETPAQPETPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAETEKP  1804

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + ++PA   +P  P  P + + PA    P  P  P + + PA   +P   + P
Sbjct  1805  AQPEKPAQPETPAQPEKPAQPEKPTQPEKPAQPETPAQPEKPAEPEKPAQPEKPITSSSP  1864

Query  484   LNG  492
               G
Sbjct  1865  EEG  1867


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 51/120 (43%), Gaps = 6/120 (5%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + ++PA   +P  P  P + + PA    P  P  P + E PA   +P
Sbjct  1721  AQPEKPTQPEKPAQPETPAQPEKPAQPEKPAQPEKPAQPETPAQPETPAQPEKPAQPEKP  1780

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P      + PA   +P  P  P + + PA   +P  P  P + + PA   +PT P  P
Sbjct  1781  AQP------EKPAQPEKPAQPEKPAETEKPAQPEKPAQPETPAQPEKPAQPEKPTQPEKP  1834


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 30/109 (28%), Positives = 46/109 (42%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + PA    P  P  P + + P    +P  P  P + E PA   +P  P    + ++
Sbjct  1702  PAQPEKPAQPETPVQPEKPAQPEKPTQPEKPAQPETPAQPEKPAQPEKPAQPEKPAQPET  1761

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             PA    P  P  P + + PA   +P  P  P + + PA   +P  P  P
Sbjct  1762  PAQPETPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAETEKPAQPEKP  1810


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/120 (26%), Positives = 49/120 (41%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P       +P + + P    +P  P  P + + PA    P  P  P + E P    +P
Sbjct  1673  AQPEKPAQPENPAQPEKPVQPEKPAQPEKPAQPEKPAQPETPVQPEKPAQPEKPTQPEKP  1732

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + + PA   +P  P  P + ++PA    P  P  P + + PA   +P  P  P
Sbjct  1733  AQPETPAQPEKPAQPEKPAQPEKPAQPETPAQPETPAQPEKPAQPEKPAQPEKPAQPEKP  1792


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 29/98 (30%), Positives = 45/98 (46%), Gaps = 0/98 (0%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             E   P  P + ++PA   +P  P  P + E PA   +P  P   ++ + PA   +PT P 
Sbjct  1671  EAAQPEKPAQPENPAQPEKPVQPEKPAQPEKPAQPEKPAQPETPVQPEKPAQPEKPTQPE  1730

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P + ++PA   +P  P  P + + PA    P  P  P
Sbjct  1731  KPAQPETPAQPEKPAQPEKPAQPEKPAQPETPAQPETP  1768


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 47/110 (43%), Gaps = 0/110 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + + PA   +P  P  P + + PA   +P  P  P + E PA   +P
Sbjct  1769  AQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAETEKPAQPEKPAQPETPAQPEKPAQPEKP  1828

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAM  453
             T P    + ++PA   +P  P  P + + P   S P      L +  P++
Sbjct  1829  TQPEKPAQPETPAQPEKPAEPEKPAQPEKPITSSSPEEGVKDLVFTLPSL  1878



>ref|WP_032847157.1| hypothetical protein [Mannheimia granulomatis]
Length=2035

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 36/134 (27%), Positives = 53/134 (40%), Gaps = 20/134 (15%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLK------------------YES  282
            P + + PA   +P  P  P + + PA   +PT P  P +                   E 
Sbjct  182  PAQPEKPAQPEQPAQPAQPSQPEKPAQPEKPTQPEQPTQPEQPTQPAQPAQPAQPAQPEK  241

Query  283  PAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  462
            PA   +P  P    + + PA   +PT P  P + + P    +PT P  P + + P    +
Sbjct  242  PAQPEQPAQPEQPAQPEKPAQPEQPTQPEQPTQPEQPTQPEQPTQPEQPTQPEKPTQPEQ  301

Query  463  PTMPNHPLNGSPEQ  504
            PT P  P    PEQ
Sbjct  302  PTQPEKP--AQPEQ  313


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 42/93 (45%), Gaps = 0/93 (0%)
 Frame = +1

Query  169  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
            + PA   +P  P  P + + PA   +PT P  P + E P    +PT P    + + P   
Sbjct  240  EKPAQPEQPAQPEQPAQPEKPAQPEQPTQPEQPTQPEQPTQPEQPTQPEQPTQPEKPTQP  299

Query  349  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSP  447
             +PT P  P + + PA   +P  P  P K D P
Sbjct  300  EQPTQPEKPAQPEQPAQPKQPAQPEQPPKEDEP  332


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 36/134 (27%), Positives = 53/134 (40%), Gaps = 20/134 (15%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P + + PA   +P  P  P + + P    +PT P  P + E PA   +P  P    + + 
Sbjct  146  PTQPEKPAQPEQPAQPEQPTQPEQPTQPEQPTQPEKPAQPEKPAQPEQPAQPAQPSQPEK  205

Query  337  PAMLSEPTMPNHPLK------------------YDSPAMLSEPTMPSHPLKYDSPAMLSE  462
            PA   +PT P  P +                   + PA   +P  P  P + + PA   +
Sbjct  206  PAQPEKPTQPEQPTQPEQPTQPAQPAQPAQPAQPEKPAQPEQPAQPEQPAQPEKPAQPEQ  265

Query  463  PTMPNHPLNGSPEQ  504
            PT P  P    PEQ
Sbjct  266  PTQPEQPTQ--PEQ  277


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 36/143 (25%), Positives = 56/143 (39%), Gaps = 16/143 (11%)
 Frame = +1

Query  124  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
            A+P        P + + P    +P  P  P + + PA  ++P+ P  P + E P    +P
Sbjct  159  AQPEQPTQPEQPTQPEQPTQPEKPAQPEKPAQPEQPAQPAQPSQPEKPAQPEKPTQPEQP  218

Query  304  TMPNYHLKY------------DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSP  447
            T P    +             + PA   +P  P  P + + PA   +PT P  P + + P
Sbjct  219  TQPEQPTQPAQPAQPAQPAQPEKPAQPEQPAQPEQPAQPEKPAQPEQPTQPEQPTQPEQP  278

Query  448  AMLSEPTMPNHPLN----GSPEQ  504
                +PT P  P        PEQ
Sbjct  279  TQPEQPTQPEQPTQPEKPTQPEQ  301


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 35/138 (25%), Positives = 53/138 (38%), Gaps = 18/138 (13%)
 Frame = +1

Query  124  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLK------------------YDSPAMLSEP  249
            A+P        P + + PA   +PT P  P +                   + PA   +P
Sbjct  189  AQPEQPAQPAQPSQPEKPAQPEKPTQPEQPTQPEQPTQPAQPAQPAQPAQPEKPAQPEQP  248

Query  250  TMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHP  429
              P  P + E PA   +PT P    + + P    +PT P  P + + P    +PT P  P
Sbjct  249  AQPEQPAQPEKPAQPEQPTQPEQPTQPEQPTQPEQPTQPEQPTQPEKPTQPEQPTQPEKP  308

Query  430  LKYDSPAMLSEPTMPNHP  483
             + + PA   +P  P  P
Sbjct  309  AQPEQPAQPKQPAQPEQP  326


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 33/130 (25%), Positives = 51/130 (39%), Gaps = 20/130 (15%)
 Frame = +1

Query  169  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
            +S     +PT P  P + + PA   +PT P  P + E P    +P  P    + + PA  
Sbjct  138  NSSTQPEKPTQPEKPAQPEQPAQPEQPTQPEQPTQPEQPTQPEKPAQPEKPAQPEQPAQP  197

Query  349  SEPTMPNHPLKYDSPAMLSEPTMP------------------SHPLKYDSPAMLSEPTMP  474
            ++P+ P  P + + P    +PT P                    P + + PA   +P  P
Sbjct  198  AQPSQPEKPAQPEKPTQPEQPTQPEQPTQPAQPAQPAQPAQPEKPAQPEQPAQPEQPAQP  257

Query  475  NHPLNGSPEQ  504
              P    PEQ
Sbjct  258  EKP--AQPEQ  265



>ref|WP_001083127.1| alpha-L-fucosidase [Streptococcus oralis]
 emb|CBZ00014.1| cell wall surface anchor family protein [Streptococcus oralis 
Uo5]
Length=2064

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 34/119 (29%), Positives = 56/119 (47%), Gaps = 0/119 (0%)
 Frame = +1

Query  127   RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  306
             +P T      P + ++PA   +PT P  P + + PA   +P  P +P + E PA    P 
Sbjct  1767  QPETPAQPEKPTQPETPAQPEKPTQPEKPAEPEKPAQPEKPVQPENPTQPEQPAQPETPA  1826

Query  307   MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P+  ++ + PA   +P  P  P++ ++PA   +P  P  P + + PA    P  P  P
Sbjct  1827  QPDNPVQPEKPAEPEKPAQPEKPVQPETPAQPEKPVQPETPAQPEKPAQPETPAQPEKP  1885


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/109 (28%), Positives = 53/109 (49%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + ++P     P  P  P + ++PA   +PT P  P + E PA   +P  P    + + 
Sbjct  1759  PAQPETPTQPETPAQPEKPTQPETPAQPEKPTQPEKPAEPEKPAQPEKPVQPENPTQPEQ  1818

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             PA    P  P++P++ + PA   +P  P  P++ ++PA   +P  P  P
Sbjct  1819  PAQPETPAQPDNPVQPEKPAEPEKPAQPEKPVQPETPAQPEKPVQPETP  1867


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + ++PA   +P  P  P + + PA   +PT P +P++ E PA    PT P    + + 
Sbjct  1717  PTQPETPAQPEKPAQPEKPAQPEKPAQPEKPTQPENPVQPEKPAQPETPTQPETPAQPEK  1776

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             P     P  P  P + + PA   +P  P  P++ ++P    +P  P  P
Sbjct  1777  PTQPETPAQPEKPTQPEKPAEPEKPAQPEKPVQPENPTQPEQPAQPETP  1825


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/109 (28%), Positives = 50/109 (46%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + P     PT P +P++ + P    +P  P  P + E+PA   +P  P    + + 
Sbjct  1681  PAEPEKPVQPENPTQPENPVQPEKPGQPEKPAQPEKPTQPETPAQPEKPAQPEKPAQPEK  1740

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             PA   +PT P +P++ + PA    PT P  P + + P     P  P  P
Sbjct  1741  PAQPEKPTQPENPVQPEKPAQPETPTQPETPAQPEKPTQPETPAQPEKP  1789


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 54/121 (45%), Gaps = 4/121 (3%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             +P++ + P    +P  P  P + ++PA   +P  P  P + E PA   +PT P   ++ +
Sbjct  1698  NPVQPEKPGQPEKPAQPEKPTQPETPAQPEKPAQPEKPAQPEKPAQPEKPTQPENPVQPE  1757

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN----GSPE  501
              PA    PT P  P + + P     P  P  P + + PA   +P  P  P+       PE
Sbjct  1758  KPAQPETPTQPETPAQPEKPTQPETPAQPEKPTQPEKPAEPEKPAQPEKPVQPENPTQPE  1817

Query  502   Q  504
             Q
Sbjct  1818  Q  1818


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 36/127 (28%), Positives = 59/127 (46%), Gaps = 6/127 (5%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPT------MPNHPLKYESP  285
             A+P        P + + PA   +PT P +P++ + PA    PT       P  P + E+P
Sbjct  1724  AQPEKPAQPEKPAQPEKPAQPEKPTQPENPVQPEKPAQPETPTQPETPAQPEKPTQPETP  1783

Query  286   AMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  465
             A   +PT P    + + PA   +P  P +P + + PA    P  P +P++ + PA   +P
Sbjct  1784  AQPEKPTQPEKPAEPEKPAQPEKPVQPENPTQPEQPAQPETPAQPDNPVQPEKPAEPEKP  1843

Query  466   TMPNHPL  486
               P  P+
Sbjct  1844  AQPEKPV  1850


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 51/120 (43%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + ++P    +P  P  P + ++PA   +PT P  P + E P    +P
Sbjct  1736  AQPEKPAQPEKPTQPENPVQPEKPAQPETPTQPETPAQPEKPTQPETPAQPEKPTQPEKP  1795

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + + P     PT P  P + ++PA    P  P  P + + PA   +P  P  P
Sbjct  1796  AEPEKPAQPEKPVQPENPTQPEQPAQPETPAQPDNPVQPEKPAEPEKPAQPEKPVQPETP  1855


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 29/98 (30%), Positives = 46/98 (47%), Gaps = 0/98 (0%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             E   P  P + + P     PT P +P++ E P    +P  P    + ++PA   +P  P 
Sbjct  1674  EAAQPEKPAEPEKPVQPENPTQPENPVQPEKPGQPEKPAQPEKPTQPETPAQPEKPAQPE  1733

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P + + PA   +PT P +P++ + PA    PT P  P
Sbjct  1734  KPAQPEKPAQPEKPTQPENPVQPEKPAQPETPTQPETP  1771


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 31/114 (27%), Positives = 52/114 (46%), Gaps = 0/114 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + + PA   +P  P +P + + PA    P  P++P++ E PA   +P
Sbjct  1784  AQPEKPTQPEKPAEPEKPAQPEKPVQPENPTQPEQPAQPETPAQPDNPVQPEKPAEPEKP  1843

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  465
               P   ++ ++PA   +P  P  P + + PA    P  P  P + + P   S P
Sbjct  1844  AQPEKPVQPETPAQPEKPVQPETPAQPEKPAQPETPAQPEKPAQPEKPITSSSP  1897


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 37/81 (46%), Gaps = 0/81 (0%)
 Frame = +1

Query  244   EPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPS  423
             E   P  P + E P     PT P   ++ + P    +P  P  P + ++PA   +P  P 
Sbjct  1674  EAAQPEKPAEPEKPVQPENPTQPENPVQPEKPGQPEKPAQPEKPTQPETPAQPEKPAQPE  1733

Query  424   HPLKYDSPAMLSEPTMPNHPL  486
              P + + PA   +PT P +P+
Sbjct  1734  KPAQPEKPAQPEKPTQPENPV  1754



>gb|AAQ92320.1| elafin [Ovis aries]
Length=262

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 49/112 (44%), Gaps = 0/112 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            DP KG   + G D + G+   KG   + G D + G+   KG   + G D + G+   K  
Sbjct  76   DPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQ  135

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  159
              + G D + G    KG   + G D + G+   KG   + G D + G+   K
Sbjct  136  DPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDLVKGQDPVKGQDPVKGQGPVK  187


 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 49/112 (44%), Gaps = 0/112 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            DP KG   + G D + G+   KG   + G D + G+   KG   + G D + G+   K  
Sbjct  94   DPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQ  153

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  159
              + G D + G    KG   + G D + G+   KG   + G D + G+   K
Sbjct  154  DPVKGQDPVKGQDLVKGQDPVKGQDPVKGQGPVKGQDPVKGQDPVKGQDPVK  205


 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 49/112 (44%), Gaps = 0/112 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            DP KG   + G D + G+   KG   + G D + G+   KG   + G D + G+   K  
Sbjct  64   DPVKGQDPVEGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQ  123

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  159
              + G D + G    KG   + G D + G+   KG   + G D + G+   K
Sbjct  124  DPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDLVKGQDPVK  175


 Score = 65.5 bits (158),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 49/112 (44%), Gaps = 0/112 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            +P KG   + G D + G+   KG   + G D + G+   KG   + G D + G+   K  
Sbjct  58   NPVKGQDPVKGQDPVEGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQ  117

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  159
              + G D + G    KG   + G D + G+   KG   + G D + G+   K
Sbjct  118  DPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDLVK  169


 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 49/112 (44%), Gaps = 0/112 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            DP KG   + G D + G+   KG   + G D + G+   KG   + G D + G+   K  
Sbjct  88   DPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQ  147

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  159
              + G D + G    KG   + G D + G+   KG   + G D + G+   K
Sbjct  148  DPVKGQDPVKGQDPVKGQDLVKGQDPVKGQDPVKGQGPVKGQDPVKGQDPVK  199


 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 49/112 (44%), Gaps = 0/112 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            DP +G   + G D + G+   KG   + G D + G+   KG   + G D + G+   K  
Sbjct  70   DPVEGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQ  129

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  159
              + G D + G    KG   + G D + G+   KG   + G D + G+   K
Sbjct  130  DPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDLVKGQDPVKGQDPVK  181


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 48/112 (43%), Gaps = 0/112 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            DP KG   + G D + G+   KG   + G D + G+   KG   + G D + G+   K  
Sbjct  106  DPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQ  165

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  159
              + G D + G    KG   + G D + G+   KG   + G D + G    K
Sbjct  166  DLVKGQDPVKGQDPVKGQGPVKGQDPVKGQDPVKGQDPVKGQDRVRGPLLTK  217



>ref|WP_042749347.1| cell wall anchor protein [Lactobacillus gasseri]
Length=1077

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 53/105 (50%), Gaps = 0/105 (0%)
 Frame = +1

Query  169  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
            D PA  +EPT P  P   D PA  SEPT P  P+  + PA  SEPT P      D PA  
Sbjct  853  DKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDKPARP  912

Query  349  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            +EPT P  P   D PA  SEP  P  P   D PA  SEPT P  P
Sbjct  913  TEPTKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEP  957


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 52/105 (50%), Gaps = 0/105 (0%)
 Frame = +1

Query  169  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
            D P   SEPT P  P   D PA  +EPT P  P   + PA  SEPT P   +  D PA  
Sbjct  835  DKPTQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQP  894

Query  349  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            SEPT P  P   D PA  +EPT P  P   D PA  SEP  P  P
Sbjct  895  SEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEP  939


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 55/117 (47%), Gaps = 0/117 (0%)
 Frame = +1

Query  124  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
            ARP        P   D PA  SEPT P  P+  D PA  SEPT P  P   + PA  +EP
Sbjct  856  ARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDKPARPTEP  915

Query  304  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
            T P      D PA  SEP  P  P   D PA  SEPT P  P   D P   SEPT P
Sbjct  916  TKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEPTTPDKPTQPSEPTKP  972


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 48/98 (49%), Gaps = 6/98 (6%)
 Frame = +1

Query  190  EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
            EPT P+ P +   P    EPT P+ P +   P    EPT P      D PA  SEPT P 
Sbjct  830  EPTTPDKPTQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTP------DKPAQPSEPTKPE  883

Query  370  HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             P+  D PA  SEPT P  P   D PA  +EPT P  P
Sbjct  884  EPITPDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEP  921



>ref|WP_035423195.1| cell wall anchor protein, partial [Lactobacillus gasseri]
Length=665

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 52/105 (50%), Gaps = 0/105 (0%)
 Frame = +1

Query  169  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
            D P   SEPT P  P   D PA  +EPT P  P   + PA  SEPT P   +  D PA  
Sbjct  561  DKPTQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQP  620

Query  349  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            SEPT P  P   D PA  +EPT P  P   D PA  SEP  P  P
Sbjct  621  SEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEP  665


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 48/98 (49%), Gaps = 6/98 (6%)
 Frame = +1

Query  190  EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
            EPT P+ P +   P    EPT P+ P +   P    EPT P      D PA  SEPT P 
Sbjct  556  EPTTPDKPTQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTP------DKPAQPSEPTKPE  609

Query  370  HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             P+  D PA  SEPT P  P   D PA  +EPT P  P
Sbjct  610  EPITPDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEP  647



>ref|WP_001083110.1| MULTISPECIES: alpha-L-fucosidase [Streptococcus]
 gb|EJO20845.1| alpha-L-fucosidase [Streptococcus sp. BS35b]
 gb|ETS90425.1| alpha-L-fucosidase [Streptococcus sp. BS29a]
Length=1998

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 35/128 (27%), Positives = 59/128 (46%), Gaps = 1/128 (1%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P   +    P + + PA   +P  P  P++ + PA   +PT P  P + E P    +P
Sbjct  1706  AQPEKPIQPEKPDQPEKPAQPEKPAQPEKPVQPEKPAQPEKPTNPEKPAQPEKPVQPEKP  1765

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + + P    +PT P  P + + P    +P  P +P + ++PA    P  P  P
Sbjct  1766  DQPEKPAQPEKPVQPEKPTQPETPAQPEKPDQPEKPAQPDNPTQPETPAQPETPAQPEKP  1825

Query  484   L-NGSPEQ  504
             + + SPE+
Sbjct  1826  ITSSSPEE  1833


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 55/125 (44%), Gaps = 2/125 (2%)
 Frame = +1

Query  130   PITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTM  309
             P T +    P + + P    +P  P  P++ + PA   +P  P  P + E PA   +P  
Sbjct  1672  PETPVQPEKPTQPEKPVQPEKPAQPEKPVQPEKPAQPEKPIQPEKPDQPEKPAQPEKPAQ  1731

Query  310   PNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
             P   ++ + PA   +PT P  P + + P    +P  P  P + + P    +PT P  P  
Sbjct  1732  PEKPVQPEKPAQPEKPTNPEKPAQPEKPVQPEKPDQPEKPAQPEKPVQPEKPTQPETP--  1789

Query  490   GSPEQ  504
               PE+
Sbjct  1790  AQPEK  1794


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/109 (28%), Positives = 51/109 (47%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P++ + PA   +P  P  P + + PA   +P  P  P++ E PA   +PT P    + + 
Sbjct  1699  PVQPEKPAQPEKPIQPEKPDQPEKPAQPEKPAQPEKPVQPEKPAQPEKPTNPEKPAQPEK  1758

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             P    +P  P  P + + P    +PT P  P + + P    +P  P++P
Sbjct  1759  PVQPEKPDQPEKPAQPEKPVQPEKPTQPETPAQPEKPDQPEKPAQPDNP  1807


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/112 (26%), Positives = 48/112 (43%), Gaps = 0/112 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + PA   +P  P  P + + P    +P  P  P++ E P    +P  P   ++ + 
Sbjct  1723  PAQPEKPAQPEKPVQPEKPAQPEKPTNPEKPAQPEKPVQPEKPDQPEKPAQPEKPVQPEK  1782

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNG  492
             P     P  P  P + + PA    PT P  P + ++PA   +P   + P  G
Sbjct  1783  PTQPETPAQPEKPDQPEKPAQPDNPTQPETPAQPETPAQPEKPITSSSPEEG  1834



>ref|WP_035425140.1| cell wall anchor protein [Lactobacillus gasseri]
Length=1203

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 53/105 (50%), Gaps = 0/105 (0%)
 Frame = +1

Query  169   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
             D PA  +EPT P  P   D PA  SEPT P  P+  + PA  SEPT P      D PA  
Sbjct  979   DKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDKPARP  1038

Query  349   SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             +EPT P  P   D PA  SEP  P  P   D PA  SEPT P  P
Sbjct  1039  TEPTKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEP  1083


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 52/105 (50%), Gaps = 0/105 (0%)
 Frame = +1

Query  169   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
             D P   SEPT P  P   D PA  +EPT P  P   + PA  SEPT P   +  D PA  
Sbjct  961   DKPTQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQP  1020

Query  349   SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             SEPT P  P   D PA  +EPT P  P   D PA  SEP  P  P
Sbjct  1021  SEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEP  1065


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  169   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
             D PA  SEPT P  P+  D PA  SEPT P  P   + PA  +EPT P      D PA  
Sbjct  997   DKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQP  1056

Query  349   SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
             SEP  P  P   D PA  SEPT P  P   D P   SEPT P
Sbjct  1057  SEPIKPEEPTTPDKPAQPSEPTEPKEPTTPDKPTQPSEPTKP  1098


 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 48/98 (49%), Gaps = 6/98 (6%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             EPT P+ P +   P    EPT P+ P +   P    EPT P      D PA  SEPT P 
Sbjct  956   EPTTPDKPTQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTP------DKPAQPSEPTKPE  1009

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P+  D PA  SEPT P  P   D PA  +EPT P  P
Sbjct  1010  EPITPDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEP  1047



>ref|WP_001083125.1| alpha-L-fucosidase [Streptococcus oralis]
 gb|EID24691.1| alpha-L-fucosidase [Streptococcus oralis SK1074]
Length=1992

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 35/128 (27%), Positives = 59/128 (46%), Gaps = 1/128 (1%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P   +    P + + PA   +P  P  P++ + PA   +PT P  P + E P    +P
Sbjct  1700  AQPEKPIQPEKPDQPEKPAQPEKPAQPEKPVQPEKPAQPEKPTNPEKPAQPEKPVQPEKP  1759

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + + P    +PT P  P + + P    +P  P +P + ++PA    P  P  P
Sbjct  1760  DQPEKPAQPEKPVQPEKPTQPETPAQPEKPDQPEKPAQPDNPTQPETPAQPETPAQPEKP  1819

Query  484   L-NGSPEQ  504
             + + SPE+
Sbjct  1820  ITSSSPEE  1827


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/109 (28%), Positives = 51/109 (47%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P++ + PA   +P  P  P + + PA   +P  P  P++ E PA   +PT P    + + 
Sbjct  1693  PVQPEKPAQPEKPIQPEKPDQPEKPAQPEKPAQPEKPVQPEKPAQPEKPTNPEKPAQPEK  1752

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             P    +P  P  P + + P    +PT P  P + + P    +P  P++P
Sbjct  1753  PVQPEKPDQPEKPAQPEKPVQPEKPTQPETPAQPEKPDQPEKPAQPDNP  1801


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 32/116 (28%), Positives = 52/116 (45%), Gaps = 2/116 (2%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + P    +P  P  P++ + PA   +P  P  P + E PA   +P  P   ++ + 
Sbjct  1675  PAQPEKPVQPEKPAQPEKPVQPEKPAQPEKPIQPEKPDQPEKPAQPEKPAQPEKPVQPEK  1734

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
             PA   +PT P  P + + P    +P  P  P + + P    +PT P  P    PE+
Sbjct  1735  PAQPEKPTNPEKPAQPEKPVQPEKPDQPEKPAQPEKPVQPEKPTQPETP--AQPEK  1788


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/112 (26%), Positives = 48/112 (43%), Gaps = 0/112 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + PA   +P  P  P + + P    +P  P  P++ E P    +P  P   ++ + 
Sbjct  1717  PAQPEKPAQPEKPVQPEKPAQPEKPTNPEKPAQPEKPVQPEKPDQPEKPAQPEKPVQPEK  1776

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNG  492
             P     P  P  P + + PA    PT P  P + ++PA   +P   + P  G
Sbjct  1777  PTQPETPAQPEKPDQPEKPAQPDNPTQPETPAQPETPAQPEKPITSSSPEEG  1828


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/105 (26%), Positives = 44/105 (42%), Gaps = 0/105 (0%)
 Frame = +1

Query  169   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
             ++PA   +P  P  P + + P    +P  P  P++ E P    +P  P    + + P   
Sbjct  1673  ETPAQPEKPVQPEKPAQPEKPVQPEKPAQPEKPIQPEKPDQPEKPAQPEKPAQPEKPVQP  1732

Query  349   SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              +P  P  P   + PA   +P  P  P + + PA   +P  P  P
Sbjct  1733  EKPAQPEKPTNPEKPAQPEKPVQPEKPDQPEKPAQPEKPVQPEKP  1777



>ref|WP_035430318.1| cell wall anchor protein, partial [Lactobacillus gasseri]
Length=233

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 45/111 (41%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P   D P   S+PT P  P     P   SEPT P  P     P   SEPT P       
Sbjct  4    EPTTPDKPTQPSKPTKPEEPTTPGKPVQPSEPTKPEEPTTPAKPVQPSEPTKPEEPTTPG  63

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P   SEPT P  P     P   SEPT P  P     PA  SEPT P  P+
Sbjct  64   KPVQPSEPTKPEEPTTPGKPVQPSEPTKPEEPTTPGKPAQPSEPTKPEEPI  114


 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 44/110 (40%), Gaps = 0/110 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P     P   SEPT P  P     P   SEPT P  P     P   SEPT P      
Sbjct  21   EEPTTPGKPVQPSEPTKPEEPTTPAKPVQPSEPTKPEEPTTPGKPVQPSEPTKPEEPTTP  80

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNH  480
              P   SEPT P  P     PA  SEPT P  P+    PA  SEPT P  
Sbjct  81   GKPVQPSEPTKPEEPTTPGKPAQPSEPTKPEEPIIPGKPAQPSEPTKPEE  130



>ref|WP_042768039.1| alpha-L-fucosidase [Streptococcus sp. DBCMS]
Length=2025

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P++ + P     P  P  P + ++PA   +P  P  P + E+P     P
Sbjct  1727  AQPEKPAEPEKPVQPEKPTQPETPAQPEKPTQPETPAQPEKPAEPEKPAQPENPTQPENP  1786

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             T P   ++ + PA   +P  P  P + + PA   +PT P  P + + PA   +PT P  P
Sbjct  1787  TQPEKPVQPEKPAQPEKPAQPETPAQPEQPAEPEKPTQPEKPAQPEKPAQPEKPTQPETP  1846


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/109 (28%), Positives = 48/109 (44%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + PA   +P  P  P + + PA   +P  P  P + E+PA   +P  P    + + 
Sbjct  1678  PAQPEKPAQPEKPAQPEQPAQPEQPAQPEQPAQPEQPAQPETPAQPEKPAQPEKPAEPEK  1737

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             P    +PT P  P + + P     P  P  P + + PA    PT P +P
Sbjct  1738  PVQPEKPTQPETPAQPEKPTQPETPAQPEKPAEPEKPAQPENPTQPENP  1786


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 55/120 (46%), Gaps = 6/120 (5%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P T      P + + PA   +P  P  P + ++PA   +PT P  P + E PA   +P
Sbjct  1715  AQPETPAQPEKPAQPEKPAEPEKPVQPEKPTQPETPAQPEKPTQPETPAQPEKPAEPEKP  1774

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P      ++P     PT P  P++ + PA   +P  P  P + + PA   +PT P  P
Sbjct  1775  AQP------ENPTQPENPTQPEKPVQPEKPAQPEKPAQPETPAQPEQPAEPEKPTQPEKP  1828


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 33/120 (28%), Positives = 53/120 (44%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + + PA   +P  P  P + + PA    P  P  P + E PA   +P
Sbjct  1679  AQPEKPAQPEKPAQPEQPAQPEQPAQPEQPAQPEQPAQPETPAQPEKPAQPEKPAEPEKP  1738

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + ++PA   +PT P  P + + PA   +P  P +P + ++P    +P  P  P
Sbjct  1739  VQPEKPTQPETPAQPEKPTQPETPAQPEKPAEPEKPAQPENPTQPENPTQPEKPVQPEKP  1798


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 33/120 (28%), Positives = 52/120 (43%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + + PA    P  P  P + + PA   +P  P  P + E+PA   +P
Sbjct  1697  AQPEQPAQPEQPAQPEQPAQPETPAQPEKPAQPEKPAEPEKPVQPEKPTQPETPAQPEKP  1756

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             T P    + + PA   +P  P +P + ++P    +P  P  P + + PA    P  P  P
Sbjct  1757  TQPETPAQPEKPAEPEKPAQPENPTQPENPTQPEKPVQPEKPAQPEKPAQPETPAQPEQP  1816


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 35/131 (27%), Positives = 53/131 (40%), Gaps = 4/131 (3%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + + PA   +P  P  P + ++PA   +P  P  P + E P    +P
Sbjct  1685  AQPEKPAQPEQPAQPEQPAQPEQPAQPEQPAQPETPAQPEKPAQPEKPAEPEKPVQPEKP  1744

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             T P    + + P     P  P  P + + PA    PT P +P + + P    +P  P  P
Sbjct  1745  TQPETPAQPEKPTQPETPAQPEKPAEPEKPAQPENPTQPENPTQPEKPVQPEKPAQPEKP  1804

Query  484   LN----GSPEQ  504
                     PEQ
Sbjct  1805  AQPETPAQPEQ  1815


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 34/128 (27%), Positives = 56/128 (44%), Gaps = 1/128 (1%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A P   +    P + ++PA   +PT P  P + + PA   +P  P +P + E+P    +P
Sbjct  1733  AEPEKPVQPEKPTQPETPAQPEKPTQPETPAQPEKPAEPEKPAQPENPTQPENPTQPEKP  1792

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + + PA    P  P  P + + P    +P  P  P + + P     P  P  P
Sbjct  1793  VQPEKPAQPEKPAQPETPAQPEQPAEPEKPTQPEKPAQPEKPAQPEKPTQPETPAQPEKP  1852

Query  484   L-NGSPEQ  504
             + + SPE+
Sbjct  1853  ITSSSPEE  1860


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 31/105 (30%), Positives = 48/105 (46%), Gaps = 0/105 (0%)
 Frame = +1

Query  169   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
             + PA   +P  P  P + + PA   +P  P  P + E PA    P  P    + + PA  
Sbjct  1676  EKPAQPEKPAQPEKPAQPEQPAQPEQPAQPEQPAQPEQPAQPETPAQPEKPAQPEKPAEP  1735

Query  349   SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              +P  P  P + ++PA   +PT P  P + + PA   +P  P +P
Sbjct  1736  EKPVQPEKPTQPETPAQPEKPTQPETPAQPEKPAEPEKPAQPENP  1780


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 52/121 (43%), Gaps = 0/121 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + + PA   +P  P  P + + PA   +P  P  P + E PA   +P
Sbjct  1673  AQPEKPAQPEKPAQPEKPAQPEQPAQPEQPAQPEQPAQPEQPAQPETPAQPEKPAQPEKP  1732

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P   ++ + P     P  P  P + ++PA   +P  P  P + ++P     PT P  P
Sbjct  1733  AEPEKPVQPEKPTQPETPAQPEKPTQPETPAQPEKPAEPEKPAQPENPTQPENPTQPEKP  1792

Query  484   L  486
             +
Sbjct  1793  V  1793


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 51/120 (43%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + ++PA   +P  P  P + + P    +PT P  P + E P     P
Sbjct  1703  AQPEQPAQPEQPAQPETPAQPEKPAQPEKPAEPEKPVQPEKPTQPETPAQPEKPTQPETP  1762

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + + PA    PT P +P + + P    +P  P  P + ++PA   +P  P  P
Sbjct  1763  AQPEKPAEPEKPAQPENPTQPENPTQPEKPVQPEKPAQPEKPAQPETPAQPEQPAEPEKP  1822


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 49/120 (41%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + + P    +PT P  P + + P     P  P  P + E PA    P
Sbjct  1721  AQPEKPAQPEKPAEPEKPVQPEKPTQPETPAQPEKPTQPETPAQPEKPAEPEKPAQPENP  1780

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             T P    + + P    +P  P  P + ++PA   +P  P  P + + PA   +P  P  P
Sbjct  1781  TQPENPTQPEKPVQPEKPAQPEKPAQPETPAQPEQPAEPEKPTQPEKPAQPEKPAQPEKP  1840


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/112 (27%), Positives = 49/112 (44%), Gaps = 0/112 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + P     P  P  P + + PA    PT P +P + E P    +P  P    + ++
Sbjct  1750  PAQPEKPTQPETPAQPEKPAEPEKPAQPENPTQPENPTQPEKPVQPEKPAQPEKPAQPET  1809

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNG  492
             PA   +P  P  P + + PA   +P  P  P + ++PA   +P   + P  G
Sbjct  1810  PAQPEQPAEPEKPTQPEKPAQPEKPAQPEKPTQPETPAQPEKPITSSSPEEG  1861


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/98 (28%), Positives = 41/98 (42%), Gaps = 0/98 (0%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             E   P  P + + PA   +P  P  P + E PA   +P  P    + ++PA   +P  P 
Sbjct  1671  EAAQPEKPAQPEKPAQPEKPAQPEQPAQPEQPAQPEQPAQPEQPAQPETPAQPEKPAQPE  1730

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P + + P    +PT P  P + + P     P  P  P
Sbjct  1731  KPAEPEKPVQPEKPTQPETPAQPEKPTQPETPAQPEKP  1768


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 48/110 (44%), Gaps = 0/110 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + ++P     PT P  P++ + PA   +P  P  P + E PA   +P
Sbjct  1763  AQPEKPAEPEKPAQPENPTQPENPTQPEKPVQPEKPAQPEKPAQPETPAQPEQPAEPEKP  1822

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAM  453
             T P    + + PA   +PT P  P + + P   S P      L +  P++
Sbjct  1823  TQPEKPAQPEKPAQPEKPTQPETPAQPEKPITSSSPEEGVKDLVFTLPSL  1872



>ref|WP_035426675.1| cell wall anchor protein [Lactobacillus gasseri]
Length=1203

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 53/105 (50%), Gaps = 0/105 (0%)
 Frame = +1

Query  169   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
             D PA  SEPT P  P   D PA  +EPT P  P   + PA  SEPT P   +  D PA  
Sbjct  961   DKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQP  1020

Query  349   SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             SEPT P  P   D PA  +EPT P  P   D PA  SEP  P  P
Sbjct  1021  SEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEP  1065


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 53/105 (50%), Gaps = 0/105 (0%)
 Frame = +1

Query  169   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
             D PA  +EPT P  P   D PA  SEPT P  P+  + PA  SEPT P      D PA  
Sbjct  979   DKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDKPARP  1038

Query  349   SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             +EPT P  P   D PA  SEP  P  P   D PA  SEPT P  P
Sbjct  1039  TEPTKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEP  1083


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  169   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
             D PA  SEPT P  P+  D PA  SEPT P  P   + PA  +EPT P      D PA  
Sbjct  997   DKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQP  1056

Query  349   SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
             SEP  P  P   D PA  SEPT P  P   D P   SEPT P
Sbjct  1057  SEPIKPEEPTTPDKPAQPSEPTEPKEPTTPDKPTQPSEPTKP  1098


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 49/98 (50%), Gaps = 6/98 (6%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             EPT P      D PA  SEPT P  P   + PA  +EPT P      D PA  SEPT P 
Sbjct  956   EPTTP------DKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPE  1009

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P+  D PA  SEPT P  P   D PA  +EPT P  P
Sbjct  1010  EPITPDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEP  1047



>ref|WP_041807453.1| cell wall anchor protein [Lactobacillus gasseri]
Length=1203

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 53/105 (50%), Gaps = 0/105 (0%)
 Frame = +1

Query  169   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
             D PA  SEPT P  P   D PA  +EPT P  P   + PA  SEPT P   +  D PA  
Sbjct  961   DKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQP  1020

Query  349   SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             SEPT P  P   D PA  +EPT P  P   D PA  SEP  P  P
Sbjct  1021  SEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEP  1065


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 53/105 (50%), Gaps = 0/105 (0%)
 Frame = +1

Query  169   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
             D PA  +EPT P  P   D PA  SEPT P  P+  + PA  SEPT P      D PA  
Sbjct  979   DKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDKPARP  1038

Query  349   SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             +EPT P  P   D PA  SEP  P  P   D PA  SEPT P  P
Sbjct  1039  TEPTKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEP  1083


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  169   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
             D PA  SEPT P  P+  D PA  SEPT P  P   + PA  +EPT P      D PA  
Sbjct  997   DKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQP  1056

Query  349   SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
             SEP  P  P   D PA  SEPT P  P   D P   SEPT P
Sbjct  1057  SEPIKPEEPTTPDKPAQPSEPTEPKEPTTPDKPTQPSEPTKP  1098


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 49/98 (50%), Gaps = 6/98 (6%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             EPT P      D PA  SEPT P  P   + PA  +EPT P      D PA  SEPT P 
Sbjct  956   EPTTP------DKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPE  1009

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P+  D PA  SEPT P  P   D PA  +EPT P  P
Sbjct  1010  EPITPDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEP  1047



>ref|WP_003646770.1| cell wall anchor protein [Lactobacillus gasseri]
 gb|EFQ45682.1| putative phage head-tail adaptor [Lactobacillus gasseri MV-22]
Length=1205

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 53/105 (50%), Gaps = 0/105 (0%)
 Frame = +1

Query  169   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
             D PA  SEPT P  P   D PA  +EPT P  P   + PA  SEPT P   +  D PA  
Sbjct  961   DKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQP  1020

Query  349   SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             SEPT P  P   D PA  +EPT P  P   D PA  SEP  P  P
Sbjct  1021  SEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEP  1065


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 53/105 (50%), Gaps = 0/105 (0%)
 Frame = +1

Query  169   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
             D PA  +EPT P  P   D PA  SEPT P  P+  + PA  SEPT P      D PA  
Sbjct  979   DKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDKPARP  1038

Query  349   SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             +EPT P  P   D PA  SEP  P  P   D PA  SEPT P  P
Sbjct  1039  TEPTKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEP  1083


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  169   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
             D PA  SEPT P  P+  D PA  SEPT P  P   + PA  +EPT P      D PA  
Sbjct  997   DKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQP  1056

Query  349   SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
             SEP  P  P   D PA  SEPT P  P   D P   SEPT P
Sbjct  1057  SEPIKPEEPTTPDKPAQPSEPTEPKEPTTPDKPTQPSEPTKP  1098


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 49/98 (50%), Gaps = 6/98 (6%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             EPT P      D PA  SEPT P  P   + PA  +EPT P      D PA  SEPT P 
Sbjct  956   EPTTP------DKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPE  1009

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P+  D PA  SEPT P  P   D PA  +EPT P  P
Sbjct  1010  EPITPDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEP  1047



>ref|XP_007932588.1| hypothetical protein MYCFIDRAFT_45664 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME76825.1| hypothetical protein MYCFIDRAFT_45664 [Pseudocercospora fijiensis 
CIRAD86]
Length=157

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 48/112 (43%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              PL    P ML    M +  L  D   ML +  + + PL    P ML  P + +  L  
Sbjct  3    DGPLVLQGPLMLDGSIMLDGSLVVDGSLMLDDRLILDEPLILNGPLMLDGPLVLDGSLTL  62

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            D   +L EP M N PL  D P +L    M    L  D P ML+ P M + PL
Sbjct  63   DDRLILDEPLMLNGPLMLDWPLVLDGSLMLDDRLTLDEPLMLNSPLMLDGPL  114


 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 50/112 (45%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              PL  + P ML  P + +  L  D   +L EP M N PL  + P +L    M +  L  
Sbjct  39   DEPLILNGPLMLDGPLVLDGSLTLDDRLILDEPLMLNGPLMLDWPLVLDGSLMLDDRLTL  98

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            D P ML+ P M + PL  D   ML +P MP   L  D   M     MP+  L
Sbjct  99   DEPLMLNSPLMLDGPLVLDGSLMLDDPLMPDGSLMPDGSLMPDGSLMPDGSL  150


 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 50/112 (45%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
               L  D   ML +  + + PL  + P ML  P + +  L  +   +L EP M N  L  
Sbjct  21   DGSLVVDGSLMLDDRLILDEPLILNGPLMLDGPLVLDGSLTLDDRLILDEPLMLNGPLML  80

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            D P +L    M +  L  D P ML+ P M   PL  D   ML +P MP+  L
Sbjct  81   DWPLVLDGSLMLDDRLTLDEPLMLNSPLMLDGPLVLDGSLMLDDPLMPDGSL  132


 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 50/118 (42%), Gaps = 6/118 (5%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              PL  D   ML    + +  L  D   +L EP + N PL  + P +L      +  L  
Sbjct  9    QGPLMLDGSIMLDGSLVVDGSLMLDDRLILDEPLILNGPLMLDGPLVLDGSLTLDDRLIL  68

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLS------EPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            D P ML+ P M + PL  D   ML       EP M + PL  D P +L    M + PL
Sbjct  69   DEPLMLNGPLMLDWPLVLDGSLMLDDRLTLDEPLMLNSPLMLDGPLVLDGSLMLDDPL  126


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 44/108 (41%), Gaps = 6/108 (6%)
 Frame = +1

Query  181  MLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPT  360
            ML  P +   PL  D   ML    + +  L  +   +L EP + N  L  D P +L    
Sbjct  1    MLDGPLVLQGPLMLDGSIMLDGSLVVDGSLMLDDRLILDEPLILNGPLMLDGPLVLDGSL  60

Query  361  MPNHPLKYDSPAMLSEPTMPSHPLKYDSPAM------LSEPTMPNHPL  486
              +  L  D P ML+ P M   PL  D   M      L EP M N PL
Sbjct  61   TLDDRLILDEPLMLNGPLMLDWPLVLDGSLMLDDRLTLDEPLMLNSPL  108



>ref|WP_003144797.1| gram-positive signal peptide, ysirk family [Gemella haemolysans]
 gb|EER68201.1| Gram-positive signal peptide protein, YSIRK family [Gemella haemolysans 
ATCC 10379]
Length=3204

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/114 (27%), Positives = 62/114 (54%), Gaps = 1/114 (1%)
 Frame = +1

Query  145   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  324
             PN  P++ + P   ++P  PN P++ + P   ++P  PN P++   P   ++P  PN  +
Sbjct  3045  PNK-PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPMEPTKPVEPNKPVEPNKPV  3103

Query  325   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + + P   ++P  PN P++ + P   ++P  P+ P++ + P   ++P  PN P+
Sbjct  3104  EPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPV  3157


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/114 (27%), Positives = 62/114 (54%), Gaps = 1/114 (1%)
 Frame = +1

Query  145   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  324
             PN  P++ + P   ++P  PN P++ + P   ++P  PN P++   P   ++P  PN  +
Sbjct  2997  PNK-PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPV  3055

Query  325   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + + P   ++P  PN P++ + P   ++P  P+ P++ + P   ++P  PN P+
Sbjct  3056  EPNKPVEPNKPVEPNKPVEPNKPVEPNKPMEPTKPVEPNKPVEPNKPVEPNKPV  3109


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/114 (27%), Positives = 62/114 (54%), Gaps = 1/114 (1%)
 Frame = +1

Query  145   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  324
             PN  P++ + P   ++P  PN P++ + P   ++P  PN P++   P   ++P  PN  +
Sbjct  3003  PNK-PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPV  3061

Query  325   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + + P   ++P  PN P++ + P   ++P  P+ P++ + P   ++P  PN P+
Sbjct  3062  EPNKPVEPNKPVEPNKPVEPNKPMEPTKPVEPNKPVEPNKPVEPNKPVEPNKPV  3115


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/114 (27%), Positives = 62/114 (54%), Gaps = 1/114 (1%)
 Frame = +1

Query  145   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  324
             PN  P++ + P   ++P  PN P++ + P   ++P  PN P++   P   ++P  PN  +
Sbjct  3021  PNK-PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPV  3079

Query  325   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + + P   ++P  PN P++ + P   ++P  P+ P++ + P   ++P  PN P+
Sbjct  3080  EPNKPMEPTKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPV  3133


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/114 (27%), Positives = 62/114 (54%), Gaps = 1/114 (1%)
 Frame = +1

Query  145   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  324
             PN  P++ + P   ++P  PN P++ + P   ++P  PN P++   P   ++P  PN  +
Sbjct  3039  PNK-PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPMEPTKPVEPNKPV  3097

Query  325   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + + P   ++P  PN P++ + P   ++P  P+ P++ + P   ++P  PN P+
Sbjct  3098  EPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPV  3151


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/114 (27%), Positives = 61/114 (54%), Gaps = 1/114 (1%)
 Frame = +1

Query  145   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  324
             PN  P++ + P   ++P  PN P++ + P   ++P  PN P++   P   ++P  PN  +
Sbjct  2991  PNK-PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPV  3049

Query  325   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + + P   ++P  PN P++ + P   ++P  P+ P++   P   ++P  PN P+
Sbjct  3050  EPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPMEPTKPVEPNKPVEPNKPV  3103


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/114 (27%), Positives = 61/114 (54%), Gaps = 1/114 (1%)
 Frame = +1

Query  145   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  324
             PN  P++ + P   ++P  PN P++ + P   ++P  PN P++   P   ++P  PN  +
Sbjct  3009  PNK-PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPV  3067

Query  325   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + + P   ++P  PN P++   P   ++P  P+ P++ + P   ++P  PN P+
Sbjct  3068  EPNKPVEPNKPVEPNKPMEPTKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPV  3121


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/114 (27%), Positives = 61/114 (54%), Gaps = 1/114 (1%)
 Frame = +1

Query  145   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  324
             PN  P++ + P   ++P  PN P++ + P   ++P  PN P++   P   ++P  PN  +
Sbjct  3027  PNK-PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPM  3085

Query  325   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             +   P   ++P  PN P++ + P   ++P  P+ P++ + P   ++P  PN P+
Sbjct  3086  EPTKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPV  3139


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 61/114 (54%), Gaps = 1/114 (1%)
 Frame = +1

Query  145   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  324
             PN  P++ + P   ++P  PN P++ + P   ++P  PN P++   P   ++P  PN  +
Sbjct  3015  PNK-PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPV  3073

Query  325   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + + P   ++P  P  P++ + P   ++P  P+ P++ + P   ++P  PN P+
Sbjct  3074  EPNKPVEPNKPMEPTKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPV  3127


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 61/114 (54%), Gaps = 1/114 (1%)
 Frame = +1

Query  145   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  324
             PN  P++ + P   ++P  PN P++ + P   ++P  PN P++   P   ++P  P   +
Sbjct  3033  PNK-PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPMEPTKPV  3091

Query  325   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + + P   ++P  PN P++ + P   ++P  P+ P++ + P   ++P  PN P+
Sbjct  3092  EPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPV  3145


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 61/114 (54%), Gaps = 1/114 (1%)
 Frame = +1

Query  145   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  324
             PN  P++ + P   ++P  PN P++ + P   ++P  P  P++   P   ++P  PN  +
Sbjct  3051  PNK-PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPMEPTKPVEPNKPVEPNKPVEPNKPV  3109

Query  325   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + + P   ++P  PN P++ + P   ++P  P+ P++ + P   ++P  PN P+
Sbjct  3110  EPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPV  3163


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 60/114 (53%), Gaps = 1/114 (1%)
 Frame = +1

Query  145   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  324
             PN  P++ + P   ++P  PN P++ + P   ++P  PN P++   P   ++P  PN  +
Sbjct  3057  PNK-PVEPNKPVEPNKPVEPNKPVEPNKPMEPTKPVEPNKPVEPNKPVEPNKPVEPNKPV  3115

Query  325   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + + P   ++P  PN P++ + P   ++P  P+ P++ + P   ++P  P   L
Sbjct  3116  EPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPTKRL  3169


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 30/106 (28%), Positives = 49/106 (46%), Gaps = 6/106 (6%)
 Frame = +1

Query  127   RPITMMPNHHPLKYDSPAMLSEPTMP---NHPLKYDSPAMLSEPTMPNHPLKYESPAMLS  297
             +P+       P K   P    EPT P   N P++ + P   ++P  PN P++   P   +
Sbjct  3065  KPVEPNKPVEPNKPVEPNKPMEPTKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPN  3124

Query  298   EPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLK  435
             +P  PN  ++ + P   ++P  PN P++ + P    EP  P  P K
Sbjct  3125  KPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPV---EPNKPVEPTK  3167



>ref|WP_025267364.1| hypothetical protein [Bibersteinia trehalosi]
 gb|AHG82529.1| hypothetical protein F542_18140 [Bibersteinia trehalosi USDA-ARS-USMARC-188]
 gb|AHG84863.1| hypothetical protein F543_20020 [Bibersteinia trehalosi USDA-ARS-USMARC-189]
Length=2364

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 35/103 (34%), Positives = 45/103 (44%), Gaps = 0/103 (0%)
 Frame = +1

Query  175  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  354
            P   SEP  P+ P +   P   SEP  P+ P +   P   SEP  P+   +   P   SE
Sbjct  434  PEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSE  493

Query  355  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            P  P+ P +   P   SEP  PS P +   P   +EP  P  P
Sbjct  494  PEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPTEPEQPTEP  536


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 37/115 (32%), Positives = 49/115 (43%), Gaps = 3/115 (3%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P +   P   SEP  P+ P +   P   SEP  P+ P +   P   SEP  P+   +   
Sbjct  434  PEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSE  493

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPE  501
            P   SEP  P+ P +   P   SEP  PS P   + P    +PT P   +N   E
Sbjct  494  PEQPSEPEQPSEPEQPSEPEQPSEPEQPSEP---EQPTEPEQPTEPQLTINAITE  545


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 38/106 (36%), Positives = 47/106 (44%), Gaps = 7/106 (7%)
 Frame = +1

Query  190  EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
            EP  P+ P +   P   SEP  P+ P +   P   SEP  P+       P   SEP  P+
Sbjct  421  EPEQPSEPEQPVEPEQPSEPEQPSEPEQPSEPEQPSEPEQPS------EPEQPSEPEQPS  474

Query  370  HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS-PEQ  504
             P +   P   SEP  PS P +   P   SEP  P+ P   S PEQ
Sbjct  475  EPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQ  520


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/106 (27%), Positives = 46/106 (43%), Gaps = 6/106 (6%)
 Frame = +1

Query  166  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAM  345
            YD P    +P+ P  P   + P    +PT P  P + E P    +P+ P      + P  
Sbjct  176  YDQPIEPEQPSEPEQPTAPEQPTAPEQPTAPEQPTEPEQPTAPEQPSEP------EQPTE  229

Query  346  LSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              +P  P  P + + P+   +PT P  P + + P+   +PT P  P
Sbjct  230  PEQPVEPEQPSEPEQPSEPEQPTEPEQPSEPEQPSEPEQPTEPEQP  275


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 37/133 (28%), Positives = 56/133 (42%), Gaps = 16/133 (12%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLS------------  297
             P++ + P+   +P+ P  P + + P+   +P+ P  P + E P +              
Sbjct  232  QPVEPEQPSEPEQPSEPEQPTEPEQPSEPEQPSEPEQPTEPEQPTVPEQPPEPEQPSEPE  291

Query  298  ---EPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPT  468
               EP  P+   +  +P   SEP  P  P +   P   SEP  PS P +   P   SEP 
Sbjct  292  QPIEPEQPSEPERPTAPEQPSEPEQPTEPEQPVEPEQPSEPEQPSEPEQPSEPEQPSEPE  351

Query  469  MPNHPLNGS-PEQ  504
             P+ P   S PEQ
Sbjct  352  QPSEPEQPSEPEQ  364


 Score = 58.2 bits (139),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 35/133 (26%), Positives = 57/133 (43%), Gaps = 16/133 (12%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P   + P+   +PT P  P++ + P+   +P+ P  P + E P+   +P+ P    + +
Sbjct  214  QPTAPEQPSEPEQPTEPEQPVEPEQPSEPEQPSEPEQPTEPEQPSEPEQPSEPEQPTEPE  273

Query  334  SPAMLS---------------EPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPT  468
             P +                 EP  P+ P +  +P   SEP  P+ P +   P   SEP 
Sbjct  274  QPTVPEQPPEPEQPSEPEQPIEPEQPSEPERPTAPEQPSEPEQPTEPEQPVEPEQPSEPE  333

Query  469  MPNHPLNGS-PEQ  504
             P+ P   S PEQ
Sbjct  334  QPSEPEQPSEPEQ  346


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 34/133 (26%), Positives = 54/133 (41%), Gaps = 16/133 (12%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P   + P    +PT P  P   + P+   +PT P  P++ E P+   +P+ P    + +
Sbjct  196  QPTAPEQPTAPEQPTEPEQPTAPEQPSEPEQPTEPEQPVEPEQPSEPEQPSEPEQPTEPE  255

Query  334  SPAMLSEPTMPNHPLKYDSPAMLS---------------EPTMPSHPLKYDSPAMLSEPT  468
             P+   +P+ P  P + + P +                 EP  PS P +  +P   SEP 
Sbjct  256  QPSEPEQPSEPEQPTEPEQPTVPEQPPEPEQPSEPEQPIEPEQPSEPERPTAPEQPSEPE  315

Query  469  MPNHPLNG-SPEQ  504
             P  P     PEQ
Sbjct  316  QPTEPEQPVEPEQ  328


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 33/135 (24%), Positives = 52/135 (39%), Gaps = 20/135 (15%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P + + P    +PT P  P   + P    +PT P  P + E P    +P  P    + +
Sbjct  184  QPSEPEQPTAPEQPTAPEQPTAPEQPTEPEQPTAPEQPSEPEQPTEPEQPVEPEQPSEPE  243

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHP------------------LKYDSPAMLS  459
             P+   +PT P  P + + P+   +PT P  P                  ++ + P+   
Sbjct  244  QPSEPEQPTEPEQPSEPEQPSEPEQPTEPEQPTVPEQPPEPEQPSEPEQPIEPEQPSEPE  303

Query  460  EPTMPNHPLNGSPEQ  504
             PT P  P    PEQ
Sbjct  304  RPTAPEQP--SEPEQ  316



>ref|WP_001083113.1| alpha-L-fucosidase [Streptococcus mitis]
 gb|EGU68650.1| Gram-positive signal peptide protein, YSIRK family [Streptococcus 
mitis bv. 2 str. SK95]
Length=2132

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A P       +P + + PA   +P  P  P + + PA   +P  P  P + E PA   +P
Sbjct  1696  AEPEKPAQPENPTQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKP  1755

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             T P    + + PA   +P  P +P + ++PA   +P  P +P + + PA    P  P  P
Sbjct  1756  TQPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKP  1815


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 34/119 (29%), Positives = 49/119 (41%), Gaps = 0/119 (0%)
 Frame = +1

Query  127   RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  306
             +P T      P + + PA    PT P  P + + PA   +P  P  P + E PA   +P 
Sbjct  1685  QPETPAQPEQPAEPEKPAQPENPTQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPA  1744

Query  307   MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P    + + P     P  P  P + + PA    P  P +P + + PA    PT P  P
Sbjct  1745  QPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENPTQPEKP  1803


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 33/120 (28%), Positives = 57/120 (48%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P       +P + + PA    PT P  P + ++PA   +P  P  P++ E+P    +P
Sbjct  1774  AQPENPAQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKP  1833

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P   ++ + PA   +P  P  P + + PA   +P  P  P   + PA+  +P +P +P
Sbjct  1834  AEPEKPVQPEKPAEPEKPAEPEKPTQPEKPAQPEKPAQPEKPAVPEKPAVPEKPAVPENP  1893


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 33/119 (28%), Positives = 54/119 (45%), Gaps = 0/119 (0%)
 Frame = +1

Query  127   RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  306
             +P T      P + + PA    P  P +P + + PA    PT P  P + E+PA   +P 
Sbjct  1757  QPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKPA  1816

Query  307   MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P   ++ ++P    +P  P  P++ + PA   +P  P  P + + PA   +P  P  P
Sbjct  1817  EPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKPAEPEKPTQPEKPAQPEKPAQPEKP  1875


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 51/109 (47%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + P    +PT P  P + + PA   +P  P +P + E PA   +P  P    + + 
Sbjct  1671  PAEPEKPVQPEKPTQPETPAQPEQPAEPEKPAQPENPTQPEKPAQPEKPAQPEKPAQPEK  1730

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             PA   +P  P  P + + PA   +PT P  P + + PA   +P  P +P
Sbjct  1731  PAQPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENP  1779


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 34/117 (29%), Positives = 56/117 (48%), Gaps = 1/117 (1%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + P    +P  P  P + + PA+  +P +P  P   E+PA    P  P      + 
Sbjct  1851  PAEPEKPTQPEKPAQPEKPAQPEKPAVPEKPAVPEKPAVPENPAHPENPAHPENPAHPEK  1910

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL-NGSPEQ  504
             PA+  +P  P  P + + PA L +P  P  P + + PA   +P +P  P+ + SPE+
Sbjct  1911  PAVPEKPAEPEKPAEPEKPAELEKPAQPEKPAQPEKPAQPEKPAVPEKPITSSSPEE  1967


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 51/121 (42%), Gaps = 0/121 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + + PA   +P  P  P + + PA   +P  P  P + E P     P
Sbjct  1702  AQPENPTQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPETP  1761

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + + PA    P  P +P + + PA    PT P  P + ++PA   +P  P  P
Sbjct  1762  AQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKPAEPEKP  1821

Query  484   L  486
             +
Sbjct  1822  V  1822


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 53/120 (44%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A P   +    P + ++PA   +P  P  P + ++P    +P  P  P + E PA   +P
Sbjct  1672  AEPEKPVQPEKPTQPETPAQPEQPAEPEKPAQPENPTQPEKPAQPEKPAQPEKPAQPEKP  1731

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + + PA   +P  P  P + ++PA   +P  P  P + ++PA    P  P  P
Sbjct  1732  AQPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKP  1791


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 33/120 (28%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + ++PA    P  P  P + ++P    +P  P  P + E PA   +P
Sbjct  1762  AQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKPAEPEKP  1821

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P   ++ + PA   +P  P  P + + PA   +PT P  P + + PA   +P +P  P
Sbjct  1822  VQPETPVQPEKPAEPEKPVQPEKPAEPEKPAEPEKPTQPEKPAQPEKPAQPEKPAVPEKP  1881


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 33/120 (28%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + ++PA   +P  P  P + ++PA    P  P  P + E+P    +P
Sbjct  1744  AQPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENPTQPEKP  1803

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + + PA   +P  P  P++ + PA   +P  P  P + + PA   +PT P  P
Sbjct  1804  AQPETPAQPEKPAEPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKPAEPEKPTQPEKP  1863


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 33/120 (28%), Positives = 51/120 (43%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + + PA   +P  P  P + + PA   +PT P  P + E PA   +P
Sbjct  1714  AQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAEPEKP  1773

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + ++PA   +P  P +P + + PA    P  P  P + + P     P  P  P
Sbjct  1774  AQPENPAQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKP  1833


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 52/109 (48%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + PA   +P  P  P++ + PA   +P  P  P + E PA   +PT P    + + 
Sbjct  1809  PAQPEKPAEPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKPAEPEKPTQPEKPAQPEK  1868

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             PA   +P +P  P   + PA+   P  P +P   ++PA   +P +P  P
Sbjct  1869  PAQPEKPAVPEKPAVPEKPAVPENPAHPENPAHPENPAHPEKPAVPEKP  1917


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 48/120 (40%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P++ + P     P  P  P + + PA    PT P  P + E PA   +P
Sbjct  1666  AQPEKPAEPEKPVQPEKPTQPETPAQPEQPAEPEKPAQPENPTQPEKPAQPEKPAQPEKP  1725

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + + PA   +P  P  P + + P     P  P  P + + PA    P  P +P
Sbjct  1726  AQPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENPAQPENP  1785


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 51/121 (42%), Gaps = 0/121 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + + PA   +P  P  P + + P     P  P  P + E PA    P
Sbjct  1720  AQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENP  1779

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + + PA    PT P  P + ++PA   +P  P  P++ ++P    +P  P  P
Sbjct  1780  AQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKPAEPEKP  1839

Query  484   L  486
             +
Sbjct  1840  V  1840


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 52/120 (43%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + + P     P  P  P + + PA    P  P +P + E PA    P
Sbjct  1738  AQPEKPAQPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENP  1797

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             T P    + ++PA   +P  P  P++ ++P    +P  P  P++ + PA   +P  P  P
Sbjct  1798  TQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKPAEPEKP  1857


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 33/120 (28%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + ++P    +P  P  P + + PA   +P  P  P++ E PA   +P
Sbjct  1780  AQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKPAEPEKP  1839

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + + PA   +PT P  P + + PA   +P +P  P   + PA+   P  P +P
Sbjct  1840  VQPEKPAEPEKPAEPEKPTQPEKPAQPEKPAQPEKPAVPEKPAVPEKPAVPENPAHPENP  1899


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 53/120 (44%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + + PA   +P  P  P + ++PA   +P  P  P + E+PA    P
Sbjct  1726  AQPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENPAQPENP  1785

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + ++P    +P  P  P + + PA   +P  P  P++ + PA   +P  P  P
Sbjct  1786  AQPEKPAQPENPTQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKPAEPEKPVQPEKP  1845


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + ++PA   +P  P  P++ ++P    +P  P  P++ E PA   +P
Sbjct  1792  AQPENPTQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKP  1851

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + + PA   +P  P  P   + PA+  +P +P +P   ++PA    P  P  P
Sbjct  1852  AEPEKPTQPEKPAQPEKPAQPEKPAVPEKPAVPEKPAVPENPAHPENPAHPENPAHPEKP  1911


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 31/120 (26%), Positives = 52/120 (43%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + ++P    +P  P  P + + PA   +P  P  P + E PA   +P
Sbjct  1690  AQPEQPAEPEKPAQPENPTQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKP  1749

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + ++PA   +P  P  P + ++PA    P  P  P + ++P    +P  P  P
Sbjct  1750  AQPEKPTQPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENPTQPEKPAQPETP  1809


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/119 (27%), Positives = 53/119 (45%), Gaps = 0/119 (0%)
 Frame = +1

Query  127   RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  306
             +P T +    P + + P    +P  P  P + + P    +P  P  P + E PA+  +P 
Sbjct  1823  QPETPVQPEKPAEPEKPVQPEKPAEPEKPAEPEKPTQPEKPAQPEKPAQPEKPAVPEKPA  1882

Query  307   MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             +P      ++PA    P  P +P   + PA+  +P  P  P + + PA L +P  P  P
Sbjct  1883  VPEKPAVPENPAHPENPAHPENPAHPEKPAVPEKPAEPEKPAEPEKPAELEKPAQPEKP  1941


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 50/120 (42%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + + PA   +PT P  P + + PA   +P  P +P + E+PA   +P
Sbjct  1732  AQPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKP  1791

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + + PA    P  P  P + + P     P  P  P + + P    +P  P  P
Sbjct  1792  AQPENPTQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKP  1851


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 53/120 (44%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P++ ++P    +P  P  P++ + PA   +P  P  P + E PA   +P
Sbjct  1810  AQPEKPAEPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKPAEPEKPTQPEKPAQPEKP  1869

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P      + PA+  +P +P +P   ++PA    P  P  P   + PA   +P  P  P
Sbjct  1870  AQPEKPAVPEKPAVPEKPAVPENPAHPENPAHPENPAHPEKPAVPEKPAEPEKPAEPEKP  1929


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 31/120 (26%), Positives = 50/120 (42%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P T      P + + P     P  P  P + + P    +P  P  P + E P    +P
Sbjct  1804  AQPETPAQPEKPAEPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKPAEPEKPTQPEKP  1863

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + + PA+  +P +P  P   ++PA    P  P +P   + PA+  +P  P  P
Sbjct  1864  AQPEKPAQPEKPAVPEKPAVPEKPAVPENPAHPENPAHPENPAHPEKPAVPEKPAEPEKP  1923


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/98 (30%), Positives = 43/98 (44%), Gaps = 0/98 (0%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             E   P  P + + P    +PT P  P + E PA   +P  P    + + PA   +P  P 
Sbjct  1664  EAAQPEKPAEPEKPVQPEKPTQPETPAQPEQPAEPEKPAQPENPTQPEKPAQPEKPAQPE  1723

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P + + PA   +P  P  P + + PA   +PT P  P
Sbjct  1724  KPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPETP  1761


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 31/108 (29%), Positives = 47/108 (44%), Gaps = 6/108 (6%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P   + PA+  +P +P +P   ++PA    P  P  P   E PA   +P
Sbjct  1864  AQPEKPAQPEKPAVPEKPAVPEKPAVPENPAHPENPAHPENPAHPEKPAVPEKPAEPEKP  1923

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSP  447
               P      + PA L +P  P  P + + PA   +P +P  P+   SP
Sbjct  1924  AEP------EKPAELEKPAQPEKPAQPEKPAQPEKPAVPEKPITSSSP  1965



>ref|WP_001083112.1| hypothetical protein, partial [Streptococcus oralis]
 gb|EJP21625.1| alpha-L-fucosidase, partial [Streptococcus oralis SK304]
Length=1883

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 31/109 (28%), Positives = 50/109 (46%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + PA   +P  P  P + + PA    P  P  P++ E PA   +P  P    + + 
Sbjct  1768  PAEPEKPAQPEKPAQPEKPAQPEKPAQPETPVQPEKPVQPEKPAEPEKPAEPEKPAQPEK  1827

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             PA   +P  P  P + ++PA   +P  P  P + ++PA   +P  P  P
Sbjct  1828  PAQPEKPAQPEKPTQPETPAQPEQPAQPEKPAQPETPAQPEKPAQPEKP  1876


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 50/110 (45%), Gaps = 0/110 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + PA   +P  P  P + ++P    +P  P  P + E PA   +P  P    + + 
Sbjct  1774  PAQPEKPAQPEKPAQPEKPAQPETPVQPEKPVQPEKPAEPEKPAEPEKPAQPEKPAQPEK  1833

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             PA   +PT P  P + + PA   +P  P  P + + PA   +P  P  P+
Sbjct  1834  PAQPEKPTQPETPAQPEQPAQPEKPAQPETPAQPEKPAQPEKPAQPETPV  1883


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/98 (28%), Positives = 43/98 (44%), Gaps = 0/98 (0%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             EP  P  P + + PA   +P  P  P + E+P    +P  P    + + PA   +P  P 
Sbjct  1671  EPAQPEKPAESEKPAQPEKPAQPEKPAQPETPVQPEKPVQPEKPAEPEKPAQPEKPAQPE  1730

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P + + PA   +P  P  P + ++P    +P  P  P
Sbjct  1731  KPAQPEKPAQPEKPAQPEKPAQPETPVQPEKPVQPEKP  1768


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 29/108 (27%), Positives = 49/108 (45%), Gaps = 0/108 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + + PA    P  P  P++ + PA   +P  P  P + E PA   +P
Sbjct  1775  AQPEKPAQPEKPAQPEKPAQPETPVQPEKPVQPEKPAEPEKPAEPEKPAQPEKPAQPEKP  1834

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSP  447
               P    + ++PA   +P  P  P + ++PA   +P  P  P + ++P
Sbjct  1835  AQPEKPTQPETPAQPEQPAQPEKPAQPETPAQPEKPAQPEKPAQPETP  1882



>ref|WP_040443091.1| hypothetical protein, partial [Facklamia ignava]
Length=148

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 44/117 (38%), Gaps = 6/117 (5%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P   D P    +P MP+ P   D P    EP  P+ P   + P M  EP  P+     
Sbjct  26   DEPGTPDEPDTPDKPGMPDEPGTPDEPGTPDEPGTPDEPGTPDKPGMPDEPGTPDEQGTP  85

Query  331  DSPAMLSEP------TMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            D P    EP        P+ P   D P    EP  P  P   D P    EP MP+ P
Sbjct  86   DEPGTPDEPGTPDESGTPDEPGTPDEPGTPDEPGTPDEPGTPDEPGTPDEPGMPDEP  142


 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 46/118 (39%), Gaps = 2/118 (2%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P   D P    EP  P+ P   D P    +P MP+ P   + P    EP  P+     
Sbjct  8    DEPGTPDEPGTPDEPGTPDEPGTPDEPDTPDKPGMPDEPGTPDEPGTPDEPGTPDEPGTP  67

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
            D P M  EP  P+     D P    EP  P      D P    EP  P+ P  G+P++
Sbjct  68   DKPGMPDEPGTPDEQGTPDEPGTPDEPGTPDESGTPDEPGTPDEPGTPDEP--GTPDE  123


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 45/118 (38%), Gaps = 2/118 (2%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P   D P    EP  P+ P   D P    EP  P+ P   + P    +P MP+     
Sbjct  20   DEPGTPDEPGTPDEPDTPDKPGMPDEPGTPDEPGTPDEPGTPDEPGTPDKPGMPDEPGTP  79

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
            D      EP  P+ P   D      EP  P  P   D P    EP  P+ P  G+P++
Sbjct  80   DEQGTPDEPGTPDEPGTPDESGTPDEPGTPDEPGTPDEPGTPDEPGTPDEP--GTPDE  135


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 45/111 (41%), Gaps = 8/111 (7%)
 Frame = +1

Query  172  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLS  351
             P +  EP  P+ P   D P    EP  P+ P   + P M  EP  P      D P    
Sbjct  3    DPEIRDEPGTPDEPGTPDEPGTPDEPGTPDEPDTPDKPGMPDEPGTP------DEPGTPD  56

Query  352  EPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
            EP  P+ P   D P M  EP  P      D P    EP  P+   +G+P++
Sbjct  57   EPGTPDEPGTPDKPGMPDEPGTPDEQGTPDEPGTPDEPGTPDE--SGTPDE  105


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 44/113 (39%), Gaps = 2/113 (2%)
 Frame = +1

Query  166  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAM  345
             D P    EP  P+ P   D P    EP  P+ P   + P    EP  P+     D P  
Sbjct  7    RDEPGTPDEPGTPDEPGTPDEPGTPDEPDTPDKPGMPDEPGTPDEPGTPDEPGTPDEPGT  66

Query  346  LSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
              +P MP+ P   D      EP  P  P   D      EP  P+ P  G+P++
Sbjct  67   PDKPGMPDEPGTPDEQGTPDEPGTPDEPGTPDESGTPDEPGTPDEP--GTPDE  117



>ref|WP_038804553.1| alpha-L-fucosidase [Streptococcus dentisani]
Length=2117

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 51/120 (43%), Gaps = 0/120 (0%)
 Frame = +1

Query  127   RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  306
             +P T      P + + PA    PT P  P + + PA   +P  P  P + E P     P 
Sbjct  1685  QPETPAQPEQPAEPEKPAQPENPTQPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPETPA  1744

Query  307   MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P    + + PA    P  P +P + + PA    PT P  P + ++PA   +P  P  P+
Sbjct  1745  QPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKPAEPEKPV  1804


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 53/109 (49%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + P    +PT P  P + + PA   +P  P +P + E PA   +P  P    + + 
Sbjct  1671  PAEPEKPVQPEKPTQPETPAQPEQPAEPEKPAQPENPTQPEKPAQPEKPAQPEKPAQPEK  1730

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             PA   +PT P  P + + PA   +P  P +P + ++PA   +P  P +P
Sbjct  1731  PAQPEKPTQPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENP  1779


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/120 (28%), Positives = 48/120 (40%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P++ + P     P  P  P + + PA    PT P  P + E PA   +P
Sbjct  1666  AQPEKPAEPEKPVQPEKPTQPETPAQPEQPAEPEKPAQPENPTQPEKPAQPEKPAQPEKP  1725

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + + P     P  P  P + + PA    P  P +P + + PA    PT P  P
Sbjct  1726  AQPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENPTQPEKP  1785


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 33/120 (28%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + ++PA   +P  P  P + ++PA    P  P  P + E+P    +P
Sbjct  1726  AQPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENPTQPEKP  1785

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + + PA   +P  P  P++ + PA   +P  P  P + + PA  +EP  P  P
Sbjct  1786  AQPETPAQPEKPAEPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKPAEPAEPEKPTQP  1845


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 33/119 (28%), Positives = 54/119 (45%), Gaps = 0/119 (0%)
 Frame = +1

Query  127   RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  306
             +P T      P + + PA    P  P +P + + PA    PT P  P + E+PA   +P 
Sbjct  1739  QPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKPA  1798

Query  307   MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P   ++ ++P    +P  P  P++ + PA   +P  P+ P K   P   ++P  P  P
Sbjct  1799  EPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKPAEPAEPEKPTQPEKPAQPEKPAQP  1857


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 34/119 (29%), Positives = 53/119 (45%), Gaps = 0/119 (0%)
 Frame = +1

Query  127   RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  306
             +P+       P K   PA   +PT P  P + + PA   +P +P  P   E PA+   P 
Sbjct  1820  KPVQPEKPAEPEKPAEPAEPEKPTQPEKPAQPEKPAQPEKPAVPEKPAVPEKPAVPENPA  1879

Query  307   MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P      ++PA   +P +P  P + + PA   +P +P  P + + PA   +P  P  P
Sbjct  1880  HPENPAHPENPAHPEKPAVPEKPAEPEKPAEPEKPAVPEKPAQPEKPAQPEKPAQPEKP  1938


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 33/120 (28%), Positives = 51/120 (43%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A P       +P + + PA   +P  P  P + + PA   +PT P  P + E PA   +P
Sbjct  1696  AEPEKPAQPENPTQPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAEPEKP  1755

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + ++PA   +P  P +P + + PA    P  P  P + + P     P  P  P
Sbjct  1756  AQPENPAQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKP  1815


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 33/117 (28%), Positives = 56/117 (48%), Gaps = 1/117 (1%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + P    +P  P  P + + PA+  +P +P  P   E+PA    P  P      + 
Sbjct  1836  PAEPEKPTQPEKPAQPEKPAQPEKPAVPEKPAVPEKPAVPENPAHPENPAHPENPAHPEK  1895

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL-NGSPEQ  504
             PA+  +P  P  P + + PA+  +P  P  P + + PA   +P +P  P+ + SPE+
Sbjct  1896  PAVPEKPAEPEKPAEPEKPAVPEKPAQPEKPAQPEKPAQPEKPAVPEKPITSSSPEE  1952


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 51/121 (42%), Gaps = 0/121 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + + PA   +P  P  P + + P     P  P  P + E PA    P
Sbjct  1702  AQPENPTQPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENP  1761

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + + PA    PT P  P + ++PA   +P  P  P++ ++P    +P  P  P
Sbjct  1762  AQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKPAEPEKP  1821

Query  484   L  486
             +
Sbjct  1822  V  1822


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 31/120 (26%), Positives = 53/120 (44%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A P   +    P + ++PA   +P  P  P + ++P    +P  P  P + E PA   +P
Sbjct  1672  AEPEKPVQPEKPTQPETPAQPEQPAEPEKPAQPENPTQPEKPAQPEKPAQPEKPAQPEKP  1731

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + ++PA   +P  P  P + ++PA    P  P  P + ++P    +P  P  P
Sbjct  1732  AQPEKPTQPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENPTQPEKPAQPETP  1791


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 52/120 (43%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + + P     P  P  P + + PA    P  P +P + E PA    P
Sbjct  1720  AQPEKPAQPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENP  1779

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             T P    + ++PA   +P  P  P++ ++P    +P  P  P++ + PA   +P  P  P
Sbjct  1780  TQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKPAEPAEP  1839


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 34/123 (28%), Positives = 58/123 (47%), Gaps = 3/123 (2%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P       +P + + PA    PT P  P + ++PA   +P  P  P++ E+P    +P
Sbjct  1756  AQPENPAQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKP  1815

Query  304   TMPNYHLKYDSPA---MLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
               P   ++ + PA     +EP  P  P + + PA   +P  P  P   + PA+  +P +P
Sbjct  1816  AEPEKPVQPEKPAEPEKPAEPAEPEKPTQPEKPAQPEKPAQPEKPAVPEKPAVPEKPAVP  1875

Query  475   NHP  483
              +P
Sbjct  1876  ENP  1878


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 50/120 (42%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + + PA   +PT P  P + + PA   +P  P +P + E+PA   +P
Sbjct  1714  AQPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKP  1773

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + + PA    P  P  P + + P     P  P  P + + P    +P  P  P
Sbjct  1774  AQPENPTQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKP  1833


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 33/120 (28%), Positives = 53/120 (44%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P + ++PA    P  P  P + ++P    +P  P  P + E PA   +P
Sbjct  1744  AQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKPAEPEKP  1803

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P   ++ + PA   +P  P  P + + PA  +EP  P+ P K   P   ++P  P  P
Sbjct  1804  VQPETPVQPEKPAEPEKPVQPEKPAEPEKPAEPAEPEKPTQPEKPAQPEKPAQPEKPAVP  1863


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 57/123 (46%), Gaps = 3/123 (2%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEP---TMPNHPLKYESPAML  294
             A P   +    P++ + PA   +P  P  P + + PA  +EP   T P  P + E PA  
Sbjct  1798  AEPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKPAEPAEPEKPTQPEKPAQPEKPAQP  1857

Query  295   SEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
              +P +P      + PA+   P  P +P   ++PA   +P +P  P + + PA   +P +P
Sbjct  1858  EKPAVPEKPAVPEKPAVPENPAHPENPAHPENPAHPEKPAVPEKPAEPEKPAEPEKPAVP  1917

Query  475   NHP  483
               P
Sbjct  1918  EKP  1920


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 32/118 (27%), Positives = 51/118 (43%), Gaps = 0/118 (0%)
 Frame = +1

Query  130   PITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTM  309
             P+       P K   P   +EP  P  P + + P    +P  P  P + E PA+  +P +
Sbjct  1809  PVQPEKPAEPEKPVQPEKPAEPEKPAEPAEPEKPTQPEKPAQPEKPAQPEKPAVPEKPAV  1868

Query  310   PNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             P      ++PA    P  P +P   + PA+  +P  P  P + + PA+  +P  P  P
Sbjct  1869  PEKPAVPENPAHPENPAHPENPAHPEKPAVPEKPAEPEKPAEPEKPAVPEKPAQPEKP  1926


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 33/123 (27%), Positives = 56/123 (46%), Gaps = 3/123 (2%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPA---ML  294
             A+P        P + ++PA   +P  P  P++ ++P    +P  P  P++ E PA     
Sbjct  1774  AQPENPTQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKP  1833

Query  295   SEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
             +EP  P    + + PA   +P  P  P   + PA+  +P +P +P   ++PA    P  P
Sbjct  1834  AEPAEPEKPTQPEKPAQPEKPAQPEKPAVPEKPAVPEKPAVPENPAHPENPAHPENPAHP  1893

Query  475   NHP  483
               P
Sbjct  1894  EKP  1896


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/98 (30%), Positives = 44/98 (45%), Gaps = 0/98 (0%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             E   P  P + + P    +PT P  P + E PA   +P  P    + + PA   +P  P 
Sbjct  1664  EAAQPEKPAEPEKPVQPEKPTQPETPAQPEQPAEPEKPAQPENPTQPEKPAQPEKPAQPE  1723

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P + + PA   +PT P  P + + PA   +P  P +P
Sbjct  1724  KPAQPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENP  1761


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 32/112 (29%), Positives = 53/112 (47%), Gaps = 3/112 (3%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLS---EPTMPNYHLK  327
             P + + PA   +P  P  P++ + PA   +P  P  P + E PA  +   +PT P    +
Sbjct  1791  PAQPEKPAEPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKPAEPAEPEKPTQPEKPAQ  1850

Query  328   YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              + PA   +P +P  P   + PA+   P  P +P   ++PA   +P +P  P
Sbjct  1851  PEKPAQPEKPAVPEKPAVPEKPAVPENPAHPENPAHPENPAHPEKPAVPEKP  1902


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 33/120 (28%), Positives = 50/120 (42%), Gaps = 3/120 (3%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A P       +P + ++PA   +P  P +P + + PA    P  P  P + E P     P
Sbjct  1750  AEPEKPAQPENPAQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKPAEPEKPVQPETP  1809

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    + + P    +P  P  P K   PA   +PT P  P + + PA   +P +P  P
Sbjct  1810  VQPEKPAEPEKPV---QPEKPAEPEKPAEPAEPEKPTQPEKPAQPEKPAQPEKPAVPEKP  1866


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 30/108 (28%), Positives = 47/108 (44%), Gaps = 6/108 (6%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P   + PA+  +P +P +P   ++PA    P  P  P   E PA   +P
Sbjct  1849  AQPEKPAQPEKPAVPEKPAVPEKPAVPENPAHPENPAHPENPAHPEKPAVPEKPAEPEKP  1908

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSP  447
               P      + PA+  +P  P  P + + PA   +P +P  P+   SP
Sbjct  1909  AEP------EKPAVPEKPAQPEKPAQPEKPAQPEKPAVPEKPITSSSP  1950



>ref|WP_036967957.1| ribonuclease [Pseudoalteromonas lipolytica]
 gb|EWH06976.1| ribonuclease [Pseudoalteromonas lipolytica SCSIO 04301]
Length=1047

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/106 (28%), Positives = 42/106 (40%), Gaps = 0/106 (0%)
 Frame = +1

Query  169  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
            D P    EP     P+K + P    EP     P+K E P    EP      ++ + P + 
Sbjct  861  DEPVKAEEPVQAEEPVKTEEPVQADEPVKAEEPVKAEEPVQSEEPVQAEEPVQAEEPVIT  920

Query  349  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             EP   + P+K + P    EP     P+K D P    EP     P+
Sbjct  921  EEPVKADEPVKAEEPVQAEEPVKAEEPVKADEPVKAEEPVKAEEPV  966


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/103 (28%), Positives = 43/103 (42%), Gaps = 0/103 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P++ + P    EP   + P+K + P    EP     P++ E P    EP +    +K D 
Sbjct  869  PVQAEEPVKTEEPVQADEPVKAEEPVKAEEPVQSEEPVQAEEPVQAEEPVITEEPVKADE  928

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  465
            P    EP     P+K + P    EP     P+K + P    EP
Sbjct  929  PVKAEEPVQAEEPVKAEEPVKADEPVKAEEPVKAEEPVKADEP  971


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/111 (26%), Positives = 44/111 (40%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P++    A   EP     P++ + P    EP   + P+K E P    EP      ++ +
Sbjct  850  QPVEAPESANTDEPVKAEEPVQAEEPVKTEEPVQADEPVKAEEPVKAEEPVQSEEPVQAE  909

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P    EP +   P+K D P    EP     P+K + P    EP     P+
Sbjct  910  EPVQAEEPVITEEPVKADEPVKAEEPVQAEEPVKAEEPVKADEPVKAEEPV  960


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 26/103 (25%), Positives = 37/103 (36%), Gaps = 0/103 (0%)
 Frame = +1

Query  178  AMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEP  357
            A   +P         D P    EP     P+K E P    EP      +K + P    EP
Sbjct  846  AQTEQPVEAPESANTDEPVKAEEPVQAEEPVKTEEPVQADEPVKAEEPVKAEEPVQSEEP  905

Query  358  TMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
                 P++ + P +  EP     P+K + P    EP     P+
Sbjct  906  VQAEEPVQAEEPVITEEPVKADEPVKAEEPVQAEEPVKAEEPV  948


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 36/92 (39%), Gaps = 0/92 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P++ D P    EP     P++ + P    EP     P+  E P    EP      ++ + 
Sbjct  881  PVQADEPVKAEEPVKAEEPVQSEEPVQAEEPVQAEEPVITEEPVKADEPVKAEEPVQAEE  940

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPL  432
            P    EP   + P+K + P    EP     P+
Sbjct  941  PVKAEEPVKADEPVKAEEPVKAEEPVKADEPV  972



>ref|XP_003647604.1| hypothetical protein Ecym_6415 [Eremothecium cymbalariae DBVPG#7215]
 gb|AET40787.1| hypothetical protein Ecym_6415 [Eremothecium cymbalariae DBVPG#7215]
Length=1208

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -2

Query  460  PIALPENHTSKDDLASSAPIALPENHTLKDDLASSAPIALPENHTSNDNLASSAPIALQE  281
            P+A P+  T K++L    P+A P+  T K++L    P+A P+  T  + L    P+A  +
Sbjct  646  PVATPKKDTPKEELKEVTPVAAPKKDTPKEELKEVTPVATPKKDTPKEELKEVTPVATPK  705

Query  280  IHTLKDDLASSAPIALPENHTLKDDLASSAPIA  182
              T K++L    P+A P+  T K++L    P+A
Sbjct  706  KDTPKEELKEVTPVATPKKDTPKEELKEVTPVA  738


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 46/88 (52%), Gaps = 0/88 (0%)
 Frame = -2

Query  484  KDDLASSAPIALPENHTSKDDLASSAPIALPENHTLKDDLASSAPIALPENHTSNDNLAS  305
            K++L    P+A P+  T K++L    P+A P+  T K++L    P+A P+  T  + L  
Sbjct  656  KEELKEVTPVAAPKKDTPKEELKEVTPVATPKKDTPKEELKEVTPVATPKKDTPKEELKE  715

Query  304  SAPIALQEIHTLKDDLASSAPIALPENH  221
              P+A  +  T K++L    P+A P+  
Sbjct  716  VTPVATPKKDTPKEELKEVTPVATPKKE  743


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 58/126 (46%), Gaps = 4/126 (3%)
 Frame = -2

Query  532  TPFHHAINFTAPVIRLKDDLASSAPIALPENHTSKDDLASS-APIALPENHTLKDDLASS  356
            TP         PV+  + +   + P   P+  T K++      P+A P+  T K++L   
Sbjct  606  TPVATPKKEVTPVVTPRKE---ATPEFTPKQDTPKEEPKKEVTPVATPKKDTPKEELKEV  662

Query  355  APIALPENHTSNDNLASSAPIALQEIHTLKDDLASSAPIALPENHTLKDDLASSAPIALQ  176
             P+A P+  T  + L    P+A  +  T K++L    P+A P+  T K++L    P+A  
Sbjct  663  TPVAAPKKDTPKEELKEVTPVATPKKDTPKEELKEVTPVATPKKDTPKEELKEVTPVATP  722

Query  175  ENHTLK  158
            +  T K
Sbjct  723  KKDTPK  728



>gb|KFY54418.1| hypothetical protein V496_07262 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
Length=1797

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 47/111 (42%), Gaps = 12/111 (11%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPL------KYESPAMLSEPTMP  312
               P K + P ++  P     P+K ++PA + EPT  + P       K E PA + EPT  
Sbjct  1503  EEPTKVEEPVVVEAPAAVEEPIKVEAPAAVEEPTKVDEPAAAEESTKVEEPAAVEEPT--  1560

Query  313   NYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  465
                 K D PA   E T    P      A + EP     P K + PA + EP
Sbjct  1561  ----KVDEPAATEESTKVEEPAAVVESAKVEEPVTVEEPTKVEEPATVEEP  1607


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/109 (28%), Positives = 44/109 (40%), Gaps = 0/109 (0%)
 Frame = +1

Query  163   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPA  342
             K +  A + EPT    P+  ++PA + EP     P   E P  + EP       K + PA
Sbjct  1495  KVEEAAAVEEPTKVEEPVVVEAPAAVEEPIKVEAPAAVEEPTKVDEPAAAEESTKVEEPA  1554

Query  343   MLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
              + EPT  + P   +    + EP       K + P  + EPT    P  
Sbjct  1555  AVEEPTKVDEPAATEESTKVEEPAAVVESAKVEEPVTVEEPTKVEEPAT  1603



>ref|WP_013355917.1| cell surface protein precursor [Lactobacillus plantarum]
 gb|ADN99729.1| cell surface protein precursor [Lactobacillus plantarum subsp. 
plantarum ST-III]
Length=1365

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 27/105 (26%), Positives = 47/105 (45%), Gaps = 0/105 (0%)
 Frame = +1

Query  160   LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSP  339
             +K + P    +P+ P  P + + P+   EP  P  P + E P    +P+ P      + P
Sbjct  1155  IKPEEPGQPEQPSQPEEPGQPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQP  1214

Query  340   AMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
             +   EP  P  P + + P    +P+ P  P + + P  L +P+ P
Sbjct  1215  SQPEEPGHPEQPSQPEEPGQHEQPSQPEEPGQSEKPGELQKPSQP  1259


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/94 (26%), Positives = 40/94 (43%), Gaps = 0/94 (0%)
 Frame = +1

Query  202   PNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLK  381
             P  P + + P+   EP  P  P + E P    +P+ P      + P+   EP  P  P +
Sbjct  1157  PEEPGQPEQPSQPEEPGQPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQ  1216

Query  382   YDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              + P    +P+ P  P +++ P+   EP     P
Sbjct  1217  PEEPGHPEQPSQPEEPGQHEQPSQPEEPGQSEKP  1250


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 24/96 (25%), Positives = 40/96 (42%), Gaps = 0/96 (0%)
 Frame = +1

Query  196   TMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHP  375
             T     +K + P    +P+ P  P + E P+   EP  P    + + P    +P+ P  P
Sbjct  1149  TYKKSAIKPEEPGQPEQPSQPEEPGQPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEP  1208

Query  376   LKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
                + P+   EP  P  P + + P    +P+ P  P
Sbjct  1209  GHPEQPSQPEEPGHPEQPSQPEEPGQHEQPSQPEEP  1244


 Score = 52.0 bits (123),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 23/89 (26%), Positives = 40/89 (45%), Gaps = 0/89 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + P+   EP  P  P + + P    +P+ P  P   E P+   EP  P    + + 
Sbjct  1172  PGQPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEE  1231

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPS  423
             P    +P+ P  P + + P  L +P+ P+
Sbjct  1232  PGQHEQPSQPEEPGQSEKPGELQKPSQPA  1260



>gb|KFY75885.1| hypothetical protein V498_09857 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=1797

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 47/111 (42%), Gaps = 12/111 (11%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPL------KYESPAMLSEPTMP  312
               P K + P ++  P     P+K ++PA + EPT  + P       K E PA + EPT  
Sbjct  1503  EEPTKVEEPVVVEAPAAVEEPIKVEAPAAVEEPTKVDEPAAAEESTKVEEPAAVEEPT--  1560

Query  313   NYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  465
                 K D PA   E T    P      A + EP     P K + PA + EP
Sbjct  1561  ----KVDEPAATEESTKVEEPAAVVESAKVEEPVTVEEPTKVEEPATVEEP  1607


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/109 (28%), Positives = 44/109 (40%), Gaps = 0/109 (0%)
 Frame = +1

Query  163   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPA  342
             K +  A + EPT    P+  ++PA + EP     P   E P  + EP       K + PA
Sbjct  1495  KVEEAAAVEEPTKVEEPVVVEAPAAVEEPIKVEAPAAVEEPTKVDEPAAAEESTKVEEPA  1554

Query  343   MLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
              + EPT  + P   +    + EP       K + P  + EPT    P  
Sbjct  1555  AVEEPTKVDEPAATEESTKVEEPAAVVESAKVEEPVTVEEPTKVEEPAT  1603



>ref|WP_013746171.1| phospholipase/lecithinase/hemolysin [Gallibacterium anatis]
 gb|AEC17397.1| Phospholipase/lecithinase/hemolysin [Gallibacterium anatis UMN179]
Length=1722

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 24/112 (21%), Positives = 58/112 (52%), Gaps = 0/112 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P + + P+  + PA+ ++P + N P     P + ++P      +  
Sbjct  1146  NQPVAETQPVVANQPVVEDQPVVANQPAVETQPVVANQPAIETQPVVANQPVAETQPVVA  1205

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + P + ++P + N P+  D P + ++P   + P+  + PA+ ++P + N P+
Sbjct  1206  NQPVVETQPVVANQPVVEDQPVVANQPAAKTQPVVANQPAVETQPVVANQPV  1257


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/110 (23%), Positives = 57/110 (52%), Gaps = 6/110 (5%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA+ ++P + N P+    P + ++P + + P+    PA+ ++P + N      
Sbjct  1129  QPVVANQPAVETQPVVANQPVAETQPVVANQPVVEDQPVVANQPAVETQPVVAN------  1182

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              PA+ ++P + N P+    P + ++P + + P+  + P +  +P + N P
Sbjct  1183  QPAIETQPVVANQPVAETQPVVANQPVVETQPVVANQPVVEDQPVVANQP  1232


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/111 (23%), Positives = 57/111 (51%), Gaps = 6/111 (5%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA+ ++P + N P+    P + ++P     P+    PA+ ++P + N      
Sbjct  1093  QPVVANQPAVETQPVVANQPVAETQPMVANQPVAEVQPVVANQPAVETQPVVAN------  1146

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P   ++P + N P+  D P + ++P + + P+  + PA+ ++P + N P+
Sbjct  1147  QPVAETQPVVANQPVVEDQPVVANQPAVETQPVVANQPAIETQPVVANQPV  1197


 Score = 58.2 bits (139),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 26/116 (22%), Positives = 59/116 (51%), Gaps = 6/116 (5%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLK------YDSPAMLSEPTMPNHPLKYESPAMLSEPTMPN  315
              P+  + PA+ ++P + N P+        + PA+ ++P + N P+    P + ++P    
Sbjct  1069  QPVVANQPAIETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPMVANQPVAEV  1128

Query  316   YHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               +  + PA+ ++P + N P+    P + ++P +   P+  + PA+ ++P + N P
Sbjct  1129  QPVVANQPAVETQPVVANQPVAETQPVVANQPVVEDQPVVANQPAVETQPVVANQP  1184


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/112 (21%), Positives = 57/112 (51%), Gaps = 0/112 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P + +  +  
Sbjct  1110  NQPVAETQPMVANQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPVVEDQPVVA  1169

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + PA+ ++P + N P     P + ++P   + P+  + P + ++P + N P+
Sbjct  1170  NQPAVETQPVVANQPAIETQPVVANQPVAETQPVVANQPVVETQPVVANQPV  1221


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 55/112 (49%), Gaps = 0/112 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+  D P + ++P +   P+  + PA+ ++P + N P+    P + ++P +    +  
Sbjct  1158  NQPVVEDQPVVANQPAVETQPVVANQPAIETQPVVANQPVAETQPVVANQPVVETQPVVA  1217

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + P +  +P + N P     P + ++P + + P+  + P +  +P +   P+
Sbjct  1218  NQPVVEDQPVVANQPAAKTQPVVANQPAVETQPVVANQPVVEDQPEVATQPV  1269


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 6/111 (5%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA+ ++P + N P+    P + ++P +   P+    P    +P + N      
Sbjct  1045  QPVVANQPAIETQPVVANQPVAETQPVVANQPAIETQPVVTNQPVAEVQPVVAN------  1098

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              PA+ ++P + N P+    P + ++P     P+  + PA+ ++P + N P+
Sbjct  1099  QPAVETQPVVANQPVAETQPMVANQPVAEVQPVVANQPAVETQPVVANQPV  1149


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/106 (22%), Positives = 53/106 (50%), Gaps = 0/106 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA+ ++P + N P     P + ++P     P+    P + ++P + N  +  D
Sbjct  1165  QPVVANQPAVETQPVVANQPAIETQPVVANQPVAETQPVVANQPVVETQPVVANQPVVED  1224

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  471
              P + ++P     P+  + PA+ ++P + + P+  D P + ++P +
Sbjct  1225  QPVVANQPAAKTQPVVANQPAVETQPVVANQPVVEDQPEVATQPVV  1270


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P   ++P + N P+    P + ++P +   P+    P   ++P + N  +  D
Sbjct  1105  QPVVANQPVAETQPMVANQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPVVED  1164

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P +   P+  + PA+ ++P + + P+    P + ++P +   P+
Sbjct  1165  QPVVANQPAVETQPVVANQPAIETQPVVANQPVAETQPVVANQPVVETQPV  1215


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/115 (21%), Positives = 53/115 (46%), Gaps = 0/115 (0%)
 Frame = +1

Query  142   MPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYH  321
             M  + P+    P + ++P     P+  + PA  ++P + N P     P + ++P +    
Sbjct  999   MVANQPVVETQPVVANQPVAETQPVVANQPAAETQPEVANQPAAEVQPVVANQPAIETQP  1058

Query  322   LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             +  + P   ++P + N P     P + ++P     P+  + PA+ ++P + N P+
Sbjct  1059  VVANQPVAETQPVVANQPAIETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPV  1113


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/111 (22%), Positives = 53/111 (48%), Gaps = 6/111 (5%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA  ++P + N P     P + ++P +   P+    P   ++P + N      
Sbjct  1021  QPVVANQPAAETQPEVANQPAAEVQPVVANQPAIETQPVVANQPVAETQPVVAN------  1074

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              PA+ ++P + N P+    P + ++P + + P+  + P   ++P + N P+
Sbjct  1075  QPAIETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPMVANQPV  1125


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P   ++P + N P     P + ++P     P+    PA+ ++P + N  +   
Sbjct  1057  QPVVANQPVAETQPVVANQPAIETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAET  1116

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P     P+  + PA+ ++P + + P+    P + ++P + + P+
Sbjct  1117  QPMVANQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPVVEDQPV  1167


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 49/111 (44%), Gaps = 0/111 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P     P + ++P     P+  + PA+ ++P + N P+    P + ++P +    +  
Sbjct  1026  NQPAAETQPEVANQPAAEVQPVVANQPAIETQPVVANQPVAETQPVVANQPAIETQPVVT  1085

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             + P    +P + N P     P + ++P   + P+  + P    +P + N P
Sbjct  1086  NQPVAEVQPVVANQPAVETQPVVANQPVAETQPMVANQPVAEVQPVVANQP  1136



>gb|AHA42334.1| neurofilament triplet H1 protein [Andrias davidianus ranavirus]
Length=195

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 42/114 (37%), Gaps = 0/114 (0%)
 Frame = +1

Query  148  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  327
               P+K  SP     P   + P+K  SP   S P     P+K  SP     P   +  +K
Sbjct  71   KRSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVK  130

Query  328  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
              SP   S P     P+K  SP     P   S P+K  SP   S P     P  
Sbjct  131  RKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPAK  184


 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 41/105 (39%), Gaps = 0/105 (0%)
 Frame = +1

Query  148  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  327
               P+K  SP     P   + P+K  SP   S P     P+K  SP     P   +  +K
Sbjct  83   RKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVK  142

Query  328  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  462
              SP   S P     P+K  SP     P   S P+K  SPA   +
Sbjct  143  RKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPAKRRQ  187


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 44/116 (38%), Gaps = 6/116 (5%)
 Frame = +1

Query  148  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  327
            N  P    SP   S P     P+K  SP     P   + P+K +SP   S P      +K
Sbjct  65   NRKPPVKRSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSP------VK  118

Query  328  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  495
              SP   S P     P+K  SP     P   S P+K  SP   S P     P+  S
Sbjct  119  RKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKS  174



>ref|WP_042907582.1| hypothetical protein, partial [Gallibacterium anatis]
 gb|KGQ49214.1| hypothetical protein IO46_11125, partial [Gallibacterium anatis]
Length=610

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/111 (23%), Positives = 57/111 (51%), Gaps = 6/111 (5%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + P   ++P + N P+  D P + ++P +   P+    PA+ ++P + N      
Sbjct  41   QPVVANQPVAETQPVVANQPVVEDQPVVANQPAVETQPVVANQPAIETQPVVAN------  94

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P + ++P + N P+  D P + ++P   + P+  + PA+ ++P + N P+
Sbjct  95   QPVVETQPVVANQPVVEDQPVVANQPAAKTQPVVANQPAVETQPVVANQPV  145


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/110 (24%), Positives = 57/110 (52%), Gaps = 6/110 (5%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + PA+ ++P + N P+    P + ++P + + P+    PA+ ++P + N      
Sbjct  29   QPVVANQPAVETQPVVANQPVAETQPVVANQPVVEDQPVVANQPAVETQPVVAN------  82

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             PA+ ++P + N P+    P + ++P +   P+  + PA  ++P + N P
Sbjct  83   QPAIETQPVVANQPVVETQPVVANQPVVEDQPVVANQPAAKTQPVVANQP  132


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 56/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
            + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P + +  +  
Sbjct  10   NQPVAETQPMVANQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPVVEDQPVVA  69

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            + PA+ ++P + N P     P + ++P + + P+  + P +  +P + N P
Sbjct  70   NQPAVETQPVVANQPAIETQPVVANQPVVETQPVVANQPVVEDQPVVANQP  120


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + P   ++P + N P+    P + ++P +   P+    P   ++P + N  +  D
Sbjct  5    QPVVANQPVAETQPMVANQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPVVED  64

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P + ++P +   P+  + PA+ ++P + + P+    P + ++P + + P+
Sbjct  65   QPVVANQPAVETQPVVANQPAIETQPVVANQPVVETQPVVANQPVVEDQPV  115


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/106 (21%), Positives = 52/106 (49%), Gaps = 0/106 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + P +  +P + N P     P + ++P +   P+    P + ++P + N  +  D
Sbjct  53   QPVVANQPVVEDQPVVANQPAVETQPVVANQPAIETQPVVANQPVVETQPVVANQPVVED  112

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  471
             P + ++P     P+  + PA+ ++P + + P+  D P + ++P +
Sbjct  113  QPVVANQPAAKTQPVVANQPAVETQPVVANQPVVEDQPEVATQPVV  158


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 53/103 (51%), Gaps = 6/103 (6%)
 Frame = +1

Query  178  AMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEP  357
            A+ ++P + N P+    P + ++P     P+    PA+ ++P + N       P   ++P
Sbjct  1    AVETQPVVANQPVAETQPMVANQPVAEVQPVVANQPAVETQPVVAN------QPVAETQP  54

Query  358  TMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + N P+  D P + ++P + + P+  + PA+ ++P + N P+
Sbjct  55   VVANQPVVEDQPVVANQPAVETQPVVANQPAIETQPVVANQPV  97



>ref|WP_039155889.1| hypothetical protein, partial [Gallibacterium anatis]
 gb|KGQ59493.1| hypothetical protein IO45_06335, partial [Gallibacterium anatis]
Length=612

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/111 (23%), Positives = 57/111 (51%), Gaps = 6/111 (5%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + P   ++P + N P+  D P + ++P +   P+    PA+ ++P + N      
Sbjct  43   QPVVANQPVAETQPVVANQPVVEDQPVVANQPAVETQPVVANQPAIETQPVVAN------  96

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P + ++P + N P+  D P + ++P   + P+  + PA+ ++P + N P+
Sbjct  97   QPVVETQPVVANQPVVEDQPVVANQPAAKTQPVVANQPAVETQPVVANQPV  147


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/110 (24%), Positives = 57/110 (52%), Gaps = 6/110 (5%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + PA+ ++P + N P+    P + ++P + + P+    PA+ ++P + N      
Sbjct  31   QPVVANQPAVETQPVVANQPVAETQPVVANQPVVEDQPVVANQPAVETQPVVAN------  84

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             PA+ ++P + N P+    P + ++P +   P+  + PA  ++P + N P
Sbjct  85   QPAIETQPVVANQPVVETQPVVANQPVVEDQPVVANQPAAKTQPVVANQP  134


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/104 (24%), Positives = 54/104 (52%), Gaps = 6/104 (6%)
 Frame = +1

Query  175  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  354
            PA+ ++P + N P+    P + ++P     P+    PA+ ++P + N       P   ++
Sbjct  2    PAVETQPVVANQPVAETQPMVANQPVAEVQPVVANQPAVETQPVVAN------QPVAETQ  55

Query  355  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P + N P+  D P + ++P + + P+  + PA+ ++P + N P+
Sbjct  56   PVVANQPVVEDQPVVANQPAVETQPVVANQPAIETQPVVANQPV  99


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 56/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
            + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P + +  +  
Sbjct  12   NQPVAETQPMVANQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPVVEDQPVVA  71

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            + PA+ ++P + N P     P + ++P + + P+  + P +  +P + N P
Sbjct  72   NQPAVETQPVVANQPAIETQPVVANQPVVETQPVVANQPVVEDQPVVANQP  122


 Score = 55.5 bits (132),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + P   ++P + N P+    P + ++P +   P+    P   ++P + N  +  D
Sbjct  7    QPVVANQPVAETQPMVANQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPVVED  66

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P + ++P +   P+  + PA+ ++P + + P+    P + ++P + + P+
Sbjct  67   QPVVANQPAVETQPVVANQPAIETQPVVANQPVVETQPVVANQPVVEDQPV  117


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/106 (21%), Positives = 52/106 (49%), Gaps = 0/106 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + P +  +P + N P     P + ++P +   P+    P + ++P + N  +  D
Sbjct  55   QPVVANQPVVEDQPVVANQPAVETQPVVANQPAIETQPVVANQPVVETQPVVANQPVVED  114

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  471
             P + ++P     P+  + PA+ ++P + + P+  D P + ++P +
Sbjct  115  QPVVANQPAAKTQPVVANQPAVETQPVVANQPVVEDQPEVATQPVV  160



>ref|WP_010389626.1| ribonuclease [Pseudoalteromonas undina]
 gb|ERG62061.1| RNase E [Pseudoalteromonas undina NCIMB 2128]
Length=1077

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/108 (28%), Positives = 42/108 (39%), Gaps = 0/108 (0%)
 Frame = +1

Query  163  KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPA  342
            K + P   +EP     P+K + P    EP     P+K E P    EP      +K + P 
Sbjct  852  KTEEPVKTAEPVKTEEPVKTEEPVKTEEPVKAEEPVKAEEPVKAEEPVKAEEPVKTEEPV  911

Query  343  MLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
               EP     P+K + P    EP     P+K + P    EP     P+
Sbjct  912  KTEEPVKTEEPVKTEEPVKAEEPVKTEEPVKTEEPVKTEEPVQTEEPV  959


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/103 (29%), Positives = 40/103 (39%), Gaps = 0/103 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+K   P    EP     P+K + P    EP     P+K E P    EP      +K + 
Sbjct  856  PVKTAEPVKTEEPVKTEEPVKTEEPVKAEEPVKAEEPVKAEEPVKAEEPVKTEEPVKTEE  915

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  465
            P    EP     P+K + P    EP     P+K + P    EP
Sbjct  916  PVKTEEPVKTEEPVKAEEPVKTEEPVKTEEPVKTEEPVQTEEP  958


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/103 (28%), Positives = 39/103 (38%), Gaps = 0/103 (0%)
 Frame = +1

Query  178  AMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEP  357
            A   EP     P+K + P    EP     P+K E P    EP      +K + P    EP
Sbjct  851  AKTEEPVKTAEPVKTEEPVKTEEPVKTEEPVKAEEPVKAEEPVKAEEPVKAEEPVKTEEP  910

Query  358  TMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
                 P+K + P    EP     P+K + P    EP     P+
Sbjct  911  VKTEEPVKTEEPVKTEEPVKAEEPVKTEEPVKTEEPVKTEEPV  953


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 28/102 (27%), Positives = 39/102 (38%), Gaps = 0/102 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+K + P    EP     P+K + P    EP     P+K E P    EP      +K + 
Sbjct  868  PVKTEEPVKTEEPVKAEEPVKAEEPVKAEEPVKAEEPVKTEEPVKTEEPVKTEEPVKTEE  927

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  462
            P    EP     P+K + P    EP     P+K +      E
Sbjct  928  PVKAEEPVKTEEPVKTEEPVKTEEPVQTEEPVKTEEQVQTEE  969


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 27/102 (26%), Positives = 41/102 (40%), Gaps = 0/102 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+K + P    EP     P+K + P    EP     P+K E P    EP      +K + 
Sbjct  874  PVKTEEPVKAEEPVKAEEPVKAEEPVKAEEPVKTEEPVKTEEPVKTEEPVKTEEPVKAEE  933

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  462
            P    EP     P+K + P    EP      ++ +  A+ +E
Sbjct  934  PVKTEEPVKTEEPVKTEEPVQTEEPVKTEEQVQTEEVAIEAE  975


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/111 (24%), Positives = 41/111 (37%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
            H    D+   + +  +     K + P   +EP     P+K E P    EP      +K +
Sbjct  831  HKTAVDASDAVEQNIVEEELAKTEEPVKTAEPVKTEEPVKTEEPVKTEEPVKAEEPVKAE  890

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P    EP     P+K + P    EP     P+K + P    EP     P+
Sbjct  891  EPVKAEEPVKAEEPVKTEEPVKTEEPVKTEEPVKTEEPVKAEEPVKTEEPV  941



>ref|WP_039090727.1| hypothetical protein, partial [Gallibacterium anatis]
 gb|KGQ30229.1| hypothetical protein JP34_11875, partial [Gallibacterium anatis]
Length=1027

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/114 (22%), Positives = 57/114 (50%), Gaps = 0/114 (0%)
 Frame = +1

Query  142   MPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYH  321
             M  + P     P + ++P +   P+  + PA+ ++P + N P     P + ++P +    
Sbjct  889   MVANQPAAEAQPVVANQPAVETQPVVANQPAIETQPEVANQPAAEVQPVVANQPAVETQP  948

Query  322   LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             +  + PA+ ++P + N P+    P + ++P + + P   + PA+ ++P + N P
Sbjct  949   VVANQPAVETQPVVTNQPVVETQPVVANQPVVEAQPEVANQPAVETQPVVANQP  1002


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/106 (22%), Positives = 54/106 (51%), Gaps = 6/106 (6%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA+ ++P + N P     P + ++P +   P+    PA+ ++P + N      
Sbjct  911   QPVVANQPAIETQPEVANQPAAEVQPVVANQPAVETQPVVANQPAVETQPVVTN------  964

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  471
              P + ++P + N P+    P + ++P + + P+  + PA+ ++P +
Sbjct  965   QPVVETQPVVANQPVVEAQPEVANQPAVETQPVVANQPAVEAQPVV  1010


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 28/122 (23%), Positives = 55/122 (45%), Gaps = 7/122 (6%)
 Frame = +1

Query  154  HPLKYDSP-----AMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNY  318
             P+  D P     A+ + PT   H +  + PA  ++P + N P     P + ++P +   
Sbjct  865  QPVTEDQPVVEDSAVDTAPT-ETHNMVANQPAAEAQPVVANQPAVETQPVVANQPAIETQ  923

Query  319  HLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP-LNGS  495
                + PA   +P + N P     P + ++P + + P+  + P + ++P + N P +   
Sbjct  924  PEVANQPAAEVQPVVANQPAVETQPVVANQPAVETQPVVTNQPVVETQPVVANQPVVEAQ  983

Query  496  PE  501
            PE
Sbjct  984  PE  985



>gb|KGN58216.1| hypothetical protein Csa_3G593190 [Cucumis sativus]
Length=334

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/112 (26%), Positives = 36/112 (32%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P   D P     PT  + P   D P     PT  + P   + P     PT  +     
Sbjct  185  DGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAA  244

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            D P     PT  + P   D P     PT    P   D P     PT  + P+
Sbjct  245  DGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPV  296


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/112 (26%), Positives = 35/112 (31%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P   D P     PT  + P   D P     PT  + P   + P     PT  +     
Sbjct  149  DGPAAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAA  208

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            D P     PT  + P   D P     PT    P   D P     PT  + P 
Sbjct  209  DGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPT  260


 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/112 (26%), Positives = 35/112 (31%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P   D P     PT  + P   D P     PT  + P   + P     PT  +     
Sbjct  155  DGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAA  214

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            D P     PT  + P   D P     PT    P   D P     PT  + P 
Sbjct  215  DGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPT  266


 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/112 (26%), Positives = 35/112 (31%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P   D P     PT  + P   D P     PT  + P   + P     PT  +     
Sbjct  161  DGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAA  220

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            D P     PT  + P   D P     PT    P   D P     PT  + P 
Sbjct  221  DGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPT  272


 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/112 (26%), Positives = 35/112 (31%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P   D P     PT  + P   D P     PT  + P   + P     PT  +     
Sbjct  167  DGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAA  226

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            D P     PT  + P   D P     PT    P   D P     PT  + P 
Sbjct  227  DGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPT  278


 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/112 (26%), Positives = 35/112 (31%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P   D P     PT  + P   D P     PT  + P   + P     PT  +     
Sbjct  173  DGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAA  232

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            D P     PT  + P   D P     PT    P   D P     PT  + P 
Sbjct  233  DGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPT  284


 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/112 (26%), Positives = 35/112 (31%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P   D P     PT  + P   D P     PT  + P   + P     PT  +     
Sbjct  179  DGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAA  238

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            D P     PT  + P   D P     PT    P   D P     PT  + P 
Sbjct  239  DGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPT  290


 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 35/107 (33%), Gaps = 0/107 (0%)
 Frame = +1

Query  166  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAM  345
             D PA    PT  + P   D P     PT  + P   + P     PT  +     D P  
Sbjct  148  ADGPAAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTA  207

Query  346  LSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
               PT  + P   D P     PT    P   D P     PT  + P 
Sbjct  208  ADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPT  254


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 34/100 (34%), Gaps = 0/100 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P   D P     PT  + P   D P     PT  + P   + P     PT  +     
Sbjct  203  DGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAA  262

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPA  450
            D P     PT  + P   D P     PT    P+  DSPA
Sbjct  263  DGPTAADGPTAADGPTAADGPTAADGPTAADGPVAADSPA  302


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/113 (25%), Positives = 35/113 (31%), Gaps = 0/113 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P   D P     PT  + P   D P     PT  + P   + P     PT  +     
Sbjct  191  DGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAA  250

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
            D P     PT  + P   D P     PT    P   D P     P   + P +
Sbjct  251  DGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPTAADGPVAADSPAD  303



>ref|WP_028835972.1| ribonuclease [Pseudoalteromonas sp. 23_GOM-1509m]
Length=1084

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/108 (28%), Positives = 41/108 (38%), Gaps = 0/108 (0%)
 Frame = +1

Query  163  KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPA  342
            K + P    EP     P+K + P    EP     P+K E P    EP      +K + P 
Sbjct  859  KVEEPVKAEEPVKAEEPVKTEEPVKTDEPVKTVEPVKAEEPVQAEEPVKAEELVKTEEPV  918

Query  343  MLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
               EP     P+K + P    EP     P+K + P    EP     P+
Sbjct  919  KAEEPVKAEEPVKAEEPVQAEEPVQTEEPVKAEEPVKAEEPVKAEEPV  966


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 27/102 (26%), Positives = 39/102 (38%), Gaps = 0/102 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+K + P    EP   + P+K   P    EP     P+K E      EP      +K + 
Sbjct  869  PVKAEEPVKTEEPVKTDEPVKTVEPVKAEEPVQAEEPVKAEELVKTEEPVKAEEPVKAEE  928

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  462
            P    EP     P++ + P    EP     P+K + P    E
Sbjct  929  PVKAEEPVQAEEPVQTEEPVKAEEPVKAEEPVKAEEPVKAEE  970



>gb|EGV03550.1| alpha-L-fucosidase [Streptococcus infantis SK970]
Length=2417

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/103 (29%), Positives = 46/103 (45%), Gaps = 6/103 (6%)
 Frame = +1

Query  175   PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  354
             P+   EP  P  P K + P+   +P+ P  P + E PA   +P+ P      + PA   +
Sbjct  1896  PSKPEEPAKPEDPSKPEDPSKPEDPSKPEDPARPEDPARPEDPSKP------EDPARPED  1949

Query  355   PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             P+ P  P +   P+   +P  P  P K + PA    P+ P  P
Sbjct  1950  PSKPEDPARPKDPSKPEDPARPEDPSKPEDPARPEYPSKPEDP  1992


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/88 (31%), Positives = 40/88 (45%), Gaps = 0/88 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P K + P+   +P+ P  P K + PA   +P  P  P K E PA   +P+ P    +   
Sbjct  1902  PAKPEDPSKPEDPSKPEDPSKPEDPARPEDPARPEDPSKPEDPARPEDPSKPEDPARPKD  1961

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMP  420
             P+   +P  P  P K + PA    P+ P
Sbjct  1962  PSKPEDPARPEDPSKPEDPARPEYPSKP  1989


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/91 (27%), Positives = 41/91 (45%), Gaps = 0/91 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P        P K + P+   +P  P  P + + P+   +P  P  P K E PA   +P
Sbjct  1903  AKPEDPSKPEDPSKPEDPSKPEDPARPEDPARPEDPSKPEDPARPEDPSKPEDPARPKDP  1962

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPA  396
             + P    + + P+   +P  P +P K + PA
Sbjct  1963  SKPEDPARPEDPSKPEDPARPEYPSKPEDPA  1993



>gb|AGV20596.1| neurofilament triplet H1-like protein [Andrias davidianus ranavirus]
Length=169

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 41/105 (39%), Gaps = 0/105 (0%)
 Frame = +1

Query  148  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  327
               P+K  SP     P   + P+K  SP   S P     P+K  SP     P   +  +K
Sbjct  57   KRSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVK  116

Query  328  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  462
              SP   S P     P+K  SP     P   S P+K  SPA   +
Sbjct  117  RKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPAKRRQ  161


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 42/114 (37%), Gaps = 6/114 (5%)
 Frame = +1

Query  148  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  327
            N  P    SP   S P     P+K  SP     P   + P+K +SP   S P      +K
Sbjct  51   NRKPPVKRSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSP------VK  104

Query  328  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
              SP   S P     P+K  SP     P   S P+K  SP   S P     P  
Sbjct  105  RKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPAK  158



>ref|WP_016359640.1| hypothetical protein [Gemella sanguinis]
 gb|EPC06416.1| hypothetical protein HMPREF0433_01840 [Gemella sanguinis M325]
Length=1900

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 37/117 (32%), Positives = 55/117 (47%), Gaps = 4/117 (3%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + PA   +P+ P  P + + PA   +P  P  P + E PA   +P  P    + + 
Sbjct  1732  PAEPEKPAEPEKPSEPEKPTEPEKPAEPEKPVEPEKPAEPEKPAEPEKPVDPEKPAEPEK  1791

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS-PEQ  504
             PA   +PT P  P + + P   +EP  P+ P K   P   SEP  P+ P   S PE+
Sbjct  1792  PAEPEKPTEPEKPAEPEKP---TEPEKPAEPEKPSKPEKPSEPEKPSEPEKPSEPEK  1845


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 37/109 (34%), Positives = 47/109 (43%), Gaps = 3/109 (3%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + PA   +P  P  P + + PA   +P  P  P + E PA   +PT P    K   
Sbjct  1750  PTEPEKPAEPEKPVEPEKPAEPEKPAEPEKPVDPEKPAEPEKPAEPEKPTEPE---KPAE  1806

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             P   +EP  P  P K   P   SEP  PS P K   P   +EP  P  P
Sbjct  1807  PEKPTEPEKPAEPEKPSKPEKPSEPEKPSEPEKPSEPEKPAEPEKPVEP  1855


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 57/121 (47%), Gaps = 2/121 (2%)
 Frame = +1

Query  142   MPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYH  321
             M    P + + P+   +P+ P  P++ + PA   +PT P  P++ E P    +P  P   
Sbjct  1667  MEPEKPAEPEKPSEPEKPSEPEKPVEPEKPAEPEKPTEPEKPVEPEKPTEPEKPAEPEKP  1726

Query  322   LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPE  501
              + + PA   +P  P  P + + P    +P  P  P++ + PA   +P  P  P++  PE
Sbjct  1727  AEPEKPAEPEKPAEPEKPSEPEKPTEPEKPAEPEKPVEPEKPAEPEKPAEPEKPVD--PE  1784

Query  502   Q  504
             +
Sbjct  1785  K  1785


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 35/127 (28%), Positives = 57/127 (45%), Gaps = 2/127 (2%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A P   +    P + + PA   +P  P  P + + PA   +PT P  P + E P    +P
Sbjct  1757  AEPEKPVEPEKPAEPEKPAEPEKPVDPEKPAEPEKPAEPEKPTEPEKPAEPEKPTEPEKP  1816

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P    K + P+   +P+ P  P + + PA   +P  P  P++ + PA   +P  P  P
Sbjct  1817  AEPEKPSKPEKPSEPEKPSEPEKPSEPEKPAEPEKPVEPEKPVEPEKPAEPEKPVEPEKP  1876

Query  484   LNGSPEQ  504
             +   PE+
Sbjct  1877  V--EPEK  1881


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 30/109 (28%), Positives = 50/109 (46%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P++ + PA   +PT P  P++ + P    +P  P  P + E PA   +P  P    + + 
Sbjct  1690  PVEPEKPAEPEKPTEPEKPVEPEKPTEPEKPAEPEKPAEPEKPAEPEKPAEPEKPSEPEK  1749

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             P    +P  P  P++ + PA   +P  P  P+  + PA   +P  P  P
Sbjct  1750  PTEPEKPAEPEKPVEPEKPAEPEKPAEPEKPVDPEKPAEPEKPAEPEKP  1798


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 38/109 (35%), Positives = 43/109 (39%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P K   P   +EP  P  P K   P   +EP  P  P K   P   +EP  P    K   
Sbjct  1741  PEKPSEPEKPTEPEKPAEPEKPVEPEKPAEPEKPAEPEKPVDPEKPAEPEKPAEPEKPTE  1800

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             P   +EP  P  P K   P   S+P  PS P K   P   SEP  P  P
Sbjct  1801  PEKPAEPEKPTEPEKPAEPEKPSKPEKPSEPEKPSEPEKPSEPEKPAEP  1849


 Score = 58.2 bits (139),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 29/111 (26%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P+  + PA   +P  P  P + + PA   +PT P  P + E P+   +P+ P    + + 
Sbjct  1780  PVDPEKPAEPEKPAEPEKPTEPEKPAEPEKPTEPEKPAEPEKPSKPEKPSEPEKPSEPEK  1839

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
             P+   +P  P  P++ + P    +P  P  P++ + P    +P  P + LN
Sbjct  1840  PSEPEKPAEPEKPVEPEKPVEPEKPAEPEKPVEPEKPVEPEKPVEPENQLN  1890


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 39/117 (33%), Positives = 48/117 (41%), Gaps = 1/117 (1%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P K   P   +EP  P  P K   P   +EP  P  P K   P   +EP  P    K   
Sbjct  1723  PEKPAEPEKPAEPEKPAEPEKPSEPEKPTEPEKPAEPEKPVEPEKPAEPEKPAEPEKPVD  1782

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS-PEQ  504
             P   +EP  P  P K   P   +EP  P+ P K   P   S+P  P+ P   S PE+
Sbjct  1783  PEKPAEPEKPAEPEKPTEPEKPAEPEKPTEPEKPAEPEKPSKPEKPSEPEKPSEPEK  1839


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 34/116 (29%), Positives = 52/116 (45%), Gaps = 8/116 (7%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + P    +PT P  P + + PA   +P  P  P + E P+   +PT P      + 
Sbjct  1702  PTEPEKPVEPEKPTEPEKPAEPEKPAEPEKPAEPEKPAEPEKPSEPEKPTEP------EK  1755

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
             PA   +P  P  P + + PA   +P  P  P + + PA   +PT P  P    PE+
Sbjct  1756  PAEPEKPVEPEKPAEPEKPAEPEKPVDPEKPAEPEKPAEPEKPTEPEKP--AEPEK  1809


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 49/127 (39%), Gaps = 1/127 (1%)
 Frame = +1

Query  127   RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  306
             +P+       P K   P   +EP  P  P K   P   SEP  P  P K   P    EP 
Sbjct  1707  KPVEPEKPTEPEKPAEPEKPAEPEKPAEPEKPAEPEKPSEPEKPTEPEKPAEPEKPVEPE  1766

Query  307   MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P    K   P    +P  P  P K   P   +EP  P+ P K   P   +EP  P+ P 
Sbjct  1767  KPAEPEKPAEPEKPVDPEKPAEPEKPAEPEKPTEPEKPAEPEKPTEPEKPAEPEKPSKPE  1826

Query  487   NGS-PEQ  504
               S PE+
Sbjct  1827  KPSEPEK  1833


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 43/109 (39%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P K   P   +EP  P  P K   P   +EP  P  P K   P   +EP  P    K   
Sbjct  1705  PEKPVEPEKPTEPEKPAEPEKPAEPEKPAEPEKPAEPEKPSEPEKPTEPEKPAEPEKPVE  1764

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             P   +EP  P  P K   P   +EP  P+ P K   P   +EP  P  P
Sbjct  1765  PEKPAEPEKPAEPEKPVDPEKPAEPEKPAEPEKPTEPEKPAEPEKPTEP  1813


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 43/109 (39%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P K   P   +EP  P  P K   P   +EP  P  P K   P   +EP  P+   K   
Sbjct  1693  PEKPAEPEKPTEPEKPVEPEKPTEPEKPAEPEKPAEPEKPAEPEKPAEPEKPSEPEKPTE  1752

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             P   +EP  P  P K   P   +EP  P  P K   P   +EP  P  P
Sbjct  1753  PEKPAEPEKPVEPEKPAEPEKPAEPEKPVDPEKPAEPEKPAEPEKPTEP  1801


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 31/115 (27%), Positives = 52/115 (45%), Gaps = 6/115 (5%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNH------PLKYESPAMLSEPTMPNY  318
             P + + PA   +P  P  P + + P+   +PT P        P++ E PA   +P  P  
Sbjct  1720  PAEPEKPAEPEKPAEPEKPAEPEKPSEPEKPTEPEKPAEPEKPVEPEKPAEPEKPAEPEK  1779

Query  319   HLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              +  + PA   +P  P  P + + PA   +PT P  P + + P+   +P+ P  P
Sbjct  1780  PVDPEKPAEPEKPAEPEKPTEPEKPAEPEKPTEPEKPAEPEKPSKPEKPSEPEKP  1834


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 30/116 (26%), Positives = 49/116 (42%), Gaps = 2/116 (2%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + P    +P  P  P + + P    +PT P  P + E PA   +P  P    + + 
Sbjct  1684  PSEPEKPVEPEKPAEPEKPTEPEKPVEPEKPTEPEKPAEPEKPAEPEKPAEPEKPAEPEK  1743

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
             P+   +PT P  P + + P    +P  P  P + + P    +P  P  P    PE+
Sbjct  1744  PSEPEKPTEPEKPAEPEKPVEPEKPAEPEKPAEPEKPVDPEKPAEPEKP--AEPEK  1797



>gb|AFR22934.1| cell surface protein precursor [Lactobacillus helveticus R0052]
Length=980

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 31/103 (30%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + PA  ++P  PN P + + PA  ++P  PN P +   PA  ++P  PN   + + 
Sbjct  817  PVNPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNK  876

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  465
            PA  ++P  PN P + + PA  ++P  P+ P K ++    + P
Sbjct  877  PAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAKLNNLGKSTNP  919


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/99 (33%), Positives = 51/99 (52%), Gaps = 6/99 (6%)
 Frame = +1

Query  187  SEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMP  366
            S P  PN P + + PA  ++P  PN P +   PA  ++P  PN       PA  ++P  P
Sbjct  815  SIPVNPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPN------KPAEPNKPAEP  868

Query  367  NHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            N P + + PA  ++P  P+ P + + PA  ++P  PN P
Sbjct  869  NKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKP  907


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 31/103 (30%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  175  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  354
            P   ++P  PN P + + PA  ++P  PN P +   PA  ++P  PN   + + PA  ++
Sbjct  817  PVNPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNK  876

Query  355  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            P  PN P + + PA  ++P  P+ P + + PA L+      +P
Sbjct  877  PAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAKLNNLGKSTNP  919


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P + + PA  ++P  PN P + + PA  ++P  PN P +   PA  ++P  PN   + + 
Sbjct  829  PAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNK  888

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLK  435
            PA  ++P  PN P + + PA L+     ++P K
Sbjct  889  PAEPNKPAEPNKPAEPNKPAKLNNLGKSTNPGK  921


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 47/96 (49%), Gaps = 0/96 (0%)
 Frame = +1

Query  124  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
            A P      + P + + PA  ++P  PN P + + PA  ++P  PN P +   PA  ++P
Sbjct  824  AEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKP  883

Query  304  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEP  411
              PN   + + PA  ++P  PN P K ++    + P
Sbjct  884  AEPNKPAEPNKPAEPNKPAEPNKPAKLNNLGKSTNP  919



>ref|WP_018379564.1| hypothetical protein [Streptococcus thoraltensis]
Length=1523

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 35/110 (32%), Positives = 50/110 (45%), Gaps = 3/110 (3%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             +P   D P    +P+ P+ P   D P   + P  PN P K  +P   S P  P+   K +
Sbjct  1370  NPSTPDKPNTPGKPSTPDKPNTPDKP---NTPDKPNTPDKPNTPDKPSTPDKPSTPDKPN  1426

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             +P   + P  PN P K  +P   + P  P+ P K ++P   S P  PN P
Sbjct  1427  TPDKPNTPDKPNTPDKPSTPDKPNTPDKPNTPDKPNTPGKPSTPDKPNTP  1476


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 38/122 (31%), Positives = 54/122 (44%), Gaps = 2/122 (2%)
 Frame = +1

Query  202   PNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLK  381
             P+ P K ++P   S P  PN P K  +P   + P  PN   K  +P   S P  PN P K
Sbjct  1371  PSTPDKPNTPGKPSTPDKPNTPDKPNTPDKPNTPDKPNTPDKPSTPDKPSTPDKPNTPDK  1430

Query  382   YDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ*SLWHGETVFNNKLSKAIS  561
              ++P   + P  PS P K ++P   + P  PN P  G P      +      N +S+   
Sbjct  1431  PNTPDKPNTPDKPSTPDKPNTPDKPNTPDKPNTP--GKPSTPDKPNTPDKLENSISQEKQ  1488

Query  562   IP  567
             +P
Sbjct  1489  LP  1490


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 33/100 (33%), Positives = 48/100 (48%), Gaps = 0/100 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P K  +P   + P  PN P K ++P   + P  P+ P K  +P   + P  PN   K ++
Sbjct  1380  PGKPSTPDKPNTPDKPNTPDKPNTPDKPNTPDKPSTPDKPSTPDKPNTPDKPNTPDKPNT  1439

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAML  456
             P   S P  PN P K ++P   + P  PS P K ++P  L
Sbjct  1440  PDKPSTPDKPNTPDKPNTPDKPNTPGKPSTPDKPNTPDKL  1479


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 35/116 (30%), Positives = 54/116 (47%), Gaps = 1/116 (1%)
 Frame = +1

Query  127   RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  306
             +P T      P K ++P   + P  PN P K ++P   S P  P+ P K  +P   + P 
Sbjct  1376  KPNTPGKPSTPDKPNTPDKPNTPDKPNTPDKPNTPDKPSTPDKPSTPDKPNTPDKPNTPD  1435

Query  307   MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
              PN   K  +P   + P  PN P K ++P   S P  P+ P K ++ ++  E  +P
Sbjct  1436  KPNTPDKPSTPDKPNTPDKPNTPDKPNTPGKPSTPDKPNTPDKLEN-SISQEKQLP  1490



>gb|KGQ47133.1| hypothetical protein IO46_13420, partial [Gallibacterium anatis]
Length=1095

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/117 (23%), Positives = 57/117 (49%), Gaps = 1/117 (1%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA+ ++P + N P+    P + ++P     P+    PA  ++P + N  +   
Sbjct  913   QPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVET  972

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP-LNGSPE  501
              P + ++P + N P+    P + ++P     P+  + PA+ ++P + N P +   PE
Sbjct  973   QPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPE  1029


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/111 (22%), Positives = 57/111 (51%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA  ++P + N P+    P + ++P + N P+    P + ++P      +  +
Sbjct  949   QPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVAN  1008

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              PA+ ++P + N P+    P + ++P + + P+  + P + ++P + N P+
Sbjct  1009  QPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPV  1059


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/111 (23%), Positives = 53/111 (48%), Gaps = 6/111 (5%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  D P + ++P +   P+  D P + ++P +   P+    P    +P + N      
Sbjct  865  QPVTEDQPVVETQPEVATQPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVAN------  918

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             PA+ ++P + N P+    P + ++P   + P+  + PA  ++P + N P+
Sbjct  919  QPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPV  969


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P + ++P +   P+  + P + ++P + N P     P + ++P +    +  +
Sbjct  961   QPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVAN  1020

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P + N P     P + ++P + + P+  + P + ++P + N P+
Sbjct  1021  QPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPV  1071


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/111 (22%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA  ++P + N P     P + ++P +   P     P + ++P +    +  +
Sbjct  937   QPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVAN  996

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              PA   +P + N P     P + ++P + + P   + PA+ ++P + N P+
Sbjct  997   QPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPV  1047


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 50/104 (48%), Gaps = 0/104 (0%)
 Frame = +1

Query  175  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  354
            P +  +P + N P+    P + ++P     P+    PA+ ++P + N  +    P + ++
Sbjct  884  PVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQ  943

Query  355  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P     P+  + PA  ++P + + P+    P + ++P + N P+
Sbjct  944  PAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPV  987


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/120 (18%), Positives = 57/120 (48%), Gaps = 3/120 (3%)
 Frame = +1

Query  127  RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  306
            +P+T      P+    P + ++P + + P+  + P + ++P + N P+    P + ++P 
Sbjct  865  QPVT---EDQPVVETQPEVATQPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPA  921

Query  307  MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            +    +  + P   ++P + N P     P + ++P   + P+  + P + ++P +   P+
Sbjct  922  VETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPV  981


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 56/112 (50%), Gaps = 0/112 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P +    +  
Sbjct  984   NQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVA  1043

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + P + ++P + N P+    P + ++P + + P+  +  A  ++P + N P+
Sbjct  1044  NQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQLAAETQPVVANQPV  1095


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/110 (19%), Positives = 51/110 (46%), Gaps = 0/110 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P   ++P + N P     P + ++P     P+    P + ++P +    +  +
Sbjct  925   QPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVAN  984

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P + ++P + N P     P + ++P + + P+  + P + ++P + N P
Sbjct  985   QPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQP  1034


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 53/112 (47%), Gaps = 0/112 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P      +  
Sbjct  894   NQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVA  953

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + PA  ++P + N P+    P + ++P + + P+    P + ++P     P+
Sbjct  954   NQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPV  1005


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 49/111 (44%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  D P + ++P +   P+  + P    +P + N P     P + ++P      +  +
Sbjct  883  QPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVAN  942

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             PA  ++P + N P     P + ++P + + P     P + ++P +   P+
Sbjct  943  QPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPV  993


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/109 (20%), Positives = 53/109 (49%), Gaps = 6/109 (6%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P + ++P + N P     P + ++P +   P+    P + ++P + N      
Sbjct  979   QPVVANQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVAN------  1032

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNH  480
              PA+ ++P + N P+    P + ++P + + P+  + P + ++P + N 
Sbjct  1033  QPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQ  1081



>ref|XP_808638.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gb|EAN86787.1| hypothetical protein, conserved [Trypanosoma cruzi]
Length=469

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  4    DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  63

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  64   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  114


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  10   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  69

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  70   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  120


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  16   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  75

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  76   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  126


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  22   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  81

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  82   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  132


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  28   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  87

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  88   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  138


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  34   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  93

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  94   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  144


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  40   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  99

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  100  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  150


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  46   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  105

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  106  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  156


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  52   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  111

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  112  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  162


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  58   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  117

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  118  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  168


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  64   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  123

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  124  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  174


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  70   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  129

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  130  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  180


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  76   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  135

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  136  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  186


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  82   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  141

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  142  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  192


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  88   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  147

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  148  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  198


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  94   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  153

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  154  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  204


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  100  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  159

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  160  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  210


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  106  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  165

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  166  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  216


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  112  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  171

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  172  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  222


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  118  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  177

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  178  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  228


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  124  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  183

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  184  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  234


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  130  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  189

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  190  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  240


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  136  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  195

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  196  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  246


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  142  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  201

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  202  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  252


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  148  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  207

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  208  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  258


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  154  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  213

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  214  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  264


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  160  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  219

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  220  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  270


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  166  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  225

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  226  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  276


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  172  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  231

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  232  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  282


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  178  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  237

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  238  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  288


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  184  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  243

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  244  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  294


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  190  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  249

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  250  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  300


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/109 (23%), Positives = 54/109 (50%), Gaps = 0/109 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  196  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  255

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGES  168
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+ 
Sbjct  256  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDD  304


 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = -1

Query  494  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  315
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  202  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  261

Query  314  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              ++G D++ GD    G   ++G D++ G+    G   ++G D++  E   
Sbjct  262  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNVHSEMRM  312


 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/102 (23%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = -1

Query  467  VGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**FGIVGSDSI  288
            +G D++ G+    G   ++G D++ G+    G   ++G D++ G+        ++G D++
Sbjct  1    MGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  60

Query  287  AGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
             GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  61   MGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  102



>ref|WP_042907803.1| hypothetical protein, partial [Gallibacterium anatis]
Length=229

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + PA+ ++P + N P+    P + ++P     P+    PA  ++P + N  +   
Sbjct  66   QPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVET  125

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P + ++P + N P+    P + ++P     P+  + PA+ ++P + N P+
Sbjct  126  QPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPV  176


 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/111 (22%), Positives = 57/111 (51%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + PA  ++P + N P+    P + ++P + N P+    P + ++P      +  +
Sbjct  102  QPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVAN  161

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             PA+ ++P + N P+    P + ++P + + P+  + P + ++P + N P+
Sbjct  162  QPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPV  212


 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 53/111 (48%), Gaps = 6/111 (5%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  D P + ++P +   P+  D P + ++P +   P+    P    +P + N      
Sbjct  18   QPVTEDQPVVETQPEVATQPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQ-----  72

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             PA+ ++P + N P+    P + ++P   + P+  + PA  ++P + N P+
Sbjct  73   -PAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPV  122


 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/111 (19%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + P + ++P +   P+  + P + ++P + N P     P + ++P +    +  +
Sbjct  114  QPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVAN  173

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P + ++P + N P     P + ++P + + P+  + P + ++P + N P+
Sbjct  174  QPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPV  224


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/111 (22%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + PA  ++P + N P     P + ++P +   P     P + ++P +    +  +
Sbjct  90   QPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVAN  149

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             PA   +P + N P     P + ++P + + P   + PA+ ++P + N P+
Sbjct  150  QPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPV  200


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/126 (20%), Positives = 60/126 (48%), Gaps = 9/126 (7%)
 Frame = +1

Query  127  RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLK------YESPA  288
            +P+T      P+    P + ++P + + P+  + P + ++P + N P+          PA
Sbjct  18   QPVT---EDQPVVETQPEVATQPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPA  74

Query  289  MLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPT  468
            + ++P + N  +    P + ++P     P+  + PA  ++P + + P+    P + ++P 
Sbjct  75   VETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPV  134

Query  469  MPNHPL  486
            + N P+
Sbjct  135  VANQPV  140


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/112 (20%), Positives = 53/112 (47%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
            + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P      +  
Sbjct  47   NQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVA  106

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            + PA  ++P + N P+    P + ++P + + P+    P + ++P     P+
Sbjct  107  NQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPV  158


 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/110 (19%), Positives = 51/110 (46%), Gaps = 0/110 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + P   ++P + N P     P + ++P     P+    P + ++P +    +  +
Sbjct  78   QPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVAN  137

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             P + ++P + N P     P + ++P + + P+  + P + ++P + N P
Sbjct  138  QPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQP  187



>ref|WP_039153091.1| hypothetical protein [Gallibacterium anatis]
 gb|KGQ69327.1| hypothetical protein IO47_00165 [Gallibacterium anatis]
Length=1775

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/111 (23%), Positives = 56/111 (50%), Gaps = 6/111 (5%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA+ ++    N P   D P + ++P +   P+    PA+ ++P + N      
Sbjct  1205  QPVAANQPAVETQAVAANQPAVEDQPVVANQPAVETQPVVANQPAIETQPVVAN------  1258

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P + N P+  D P + ++P   + P+  + PA+ ++P + N P+
Sbjct  1259  QPVVETQPVVANQPVVEDQPVVANQPAAKTQPVVANQPAVETQPVVANQPV  1309


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/110 (22%), Positives = 56/110 (51%), Gaps = 0/110 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA+ ++P + N P+    P + ++P + N P+    P + ++P +    +  +
Sbjct  971   QPVVANQPAVETQPMVANQPVAEAQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVAN  1030

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              PA  ++P + N P     P + ++P + + P+  + P + ++P + N P
Sbjct  1031  QPAAETQPEVANQPAAEVQPVVANQPVVEAQPVVANQPVVEAQPEVANQP  1080


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/110 (23%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P   + PA+ ++P + N P     P + ++P     P+    PA+ ++P + N  +   
Sbjct  935   QPEVANQPAVETQPVIANQPAAETQPEVANQPAAEVQPVVANQPAVETQPMVANQPVAEA  994

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P + ++P + N P+    P + ++P + + P+  + PA  ++P + N P
Sbjct  995   QPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPAAETQPEVANQP  1044


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/115 (21%), Positives = 56/115 (49%), Gaps = 0/115 (0%)
 Frame = +1

Query  142   MPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYH  321
             M  + P   D P + ++P + + P+  + PA  ++P + N P+    P + ++P +    
Sbjct  889   MVANQPAVEDQPVVETQPVVEDQPVVANQPAAEAQPVVTNQPVAEVQPEVANQPAVETQP  948

Query  322   LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             +  + PA  ++P + N P     P + ++P + + P+  + P   ++P +   P+
Sbjct  949   VIANQPAAETQPEVANQPAAEVQPVVANQPAVETQPMVANQPVAEAQPVVETQPV  1003


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 24/112 (21%), Positives = 54/112 (48%), Gaps = 0/112 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P     P + ++P +   P+  + PA   +P + N P+    P + ++P      +  
Sbjct  1150  NQPAVETQPVVANQPVVETQPVIANQPAAEVQPVVANQPVVETQPVIANQPAAEVQPVAA  1209

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + PA+ ++    N P   D P + ++P + + P+  + PA+ ++P + N P+
Sbjct  1210  NQPAVETQAVAANQPAVEDQPVVANQPAVETQPVVANQPAIETQPVVANQPV  1261


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P     P+  + PA+ ++    N P   + P + ++P +    +  
Sbjct  1186  NQPVVETQPVIANQPAAEVQPVAANQPAVETQAVAANQPAVEDQPVVANQPAVETQPVVA  1245

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             + PA+ ++P + N P+    P + ++P +   P+  + PA  ++P + N P
Sbjct  1246  NQPAIETQPVVANQPVVETQPVVANQPVVEDQPVVANQPAAKTQPVVANQP  1296


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 22/101 (22%), Positives = 51/101 (50%), Gaps = 0/101 (0%)
 Frame = +1

Query  169   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
             + PA+  +P + N P     P + ++P +   P+    P + ++P + N  +  D P + 
Sbjct  1222  NQPAVEDQPVVANQPAVETQPVVANQPAIETQPVVANQPVVETQPVVANQPVVEDQPVVA  1281

Query  349   SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  471
             ++P     P+  + PA+ ++P + + P+  D P + ++P +
Sbjct  1282  NQPAAKTQPVVANQPAVETQPVVANQPVVEDQPEVATQPVV  1322


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 53/112 (47%), Gaps = 0/112 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P     P+  + P + ++P + N P     P   ++P +    +  
Sbjct  1162  NQPVVETQPVIANQPAAEVQPVVANQPVVETQPVIANQPAAEVQPVAANQPAVETQAVAA  1221

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + PA+  +P + N P     P + ++P + + P+  + P + ++P + N P+
Sbjct  1222  NQPAVEDQPVVANQPAVETQPVVANQPAIETQPVVANQPVVETQPVVANQPV  1273


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/115 (23%), Positives = 55/115 (48%), Gaps = 6/115 (5%)
 Frame = +1

Query  142   MPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYH  321
             M  + P+    P + ++P + N P+    P + ++P +   P+    PA  ++P + N  
Sbjct  985   MVANQPVAEAQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPAAETQPEVAN--  1042

Query  322   LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
                  PA   +P + N P+    P + ++P + + P   + PA+ ++P + N P+
Sbjct  1043  ----QPAAEVQPVVANQPVVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPV  1093


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 55/112 (49%), Gaps = 0/112 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P +   P+  + PA  ++P + N P     P + ++P +    +  
Sbjct  1006  NQPVAEVQPVVANQPAVETQPVVANQPAAETQPEVANQPAAEVQPVVANQPVVEAQPVVA  1065

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + P + ++P + N P     P + ++P + + P+  + P + ++P + N P+
Sbjct  1066  NQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPV  1117


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA   +P + N P+    P + ++P     P+    PA+ ++    N     D
Sbjct  1169  QPVIANQPAAEVQPVVANQPVVETQPVIANQPAAEVQPVAANQPAVETQAVAANQPAVED  1228

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P +   P+  + PA+ ++P + + P+    P + ++P + + P+
Sbjct  1229  QPVVANQPAVETQPVVANQPAIETQPVVANQPVVETQPVVANQPVVEDQPV  1279


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+    P + ++P     P+  + PA+ ++P + N P     P + ++P      +  +
Sbjct  995   QPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPAAETQPEVANQPAAEVQPVVAN  1054

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P + N P+    P + ++P + + P+  + P + ++P + N P+
Sbjct  1055  QPVVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPV  1105


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P +   P+  + P + ++P + N P+    P + ++P +    +  
Sbjct  1066  NQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVA  1125

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             +  A  ++P + N P+    P + ++P + + P+  + P + ++P + N P
Sbjct  1126  NQLAAETQPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVIANQP  1176


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/117 (21%), Positives = 56/117 (48%), Gaps = 6/117 (5%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLK------YDSPAMLSEPTMPNHPLKYESPAMLSEPTMPN  315
              P+  + PA  ++P + N P+        + PA+ ++P + N P     P + ++P    
Sbjct  911   QPVVANQPAAEAQPVVTNQPVAEVQPEVANQPAVETQPVIANQPAAETQPEVANQPAAEV  970

Query  316   YHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
               +  + PA+ ++P + N P+    P + ++P + + P+    P + ++P +   P+
Sbjct  971   QPVVANQPAVETQPMVANQPVAEAQPVVETQPVVTNQPVAEVQPVVANQPAVETQPV  1027


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 53/112 (47%), Gaps = 0/112 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P     P + ++P     P+  + PA+ ++P + N P+    P + ++P + N  +  
Sbjct  952   NQPAAETQPEVANQPAAEVQPVVANQPAVETQPMVANQPVAEAQPVVETQPVVTNQPVAE  1011

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
               P + ++P +   P+  + PA  ++P + + P     P + ++P +   P+
Sbjct  1012  VQPVVANQPAVETQPVVANQPAAETQPEVANQPAAEVQPVVANQPVVEAQPV  1063


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 50/111 (45%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P + ++P + N P     P   ++P +    +    PA+  +P + N      
Sbjct  1181  QPVVANQPVVETQPVIANQPAAEVQPVAANQPAVETQAVAANQPAVEDQPVVANQPAVET  1240

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P +   P+  + P + ++P + + P+  D P + ++P     P+
Sbjct  1241  QPVVANQPAIETQPVVANQPVVETQPVVANQPVVEDQPVVANQPAAKTQPV  1291


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 55/112 (49%), Gaps = 0/112 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P +   P   + PA+ ++P + N P+    P + ++P +    +  
Sbjct  1054  NQPVVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVA  1113

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + P + ++P + N       P + ++P + + P   + PA+ ++P + N P+
Sbjct  1114  NQPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQPAVETQPVVANQPV  1165


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/120 (20%), Positives = 56/120 (47%), Gaps = 3/120 (3%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P+     + P+    P + ++P +   P+  +  A  ++P + N P+    P + ++P
Sbjct  1096  AQPVV---TNQPVVEAQPVVANQPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQP  1152

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              +    +  + P + ++P + N P     P + ++P + + P+  + PA   +P   N P
Sbjct  1153  AVETQPVVANQPVVETQPVIANQPAAEVQPVVANQPVVETQPVIANQPAAEVQPVAANQP  1212


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/109 (21%), Positives = 53/109 (49%), Gaps = 6/109 (6%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA  ++P + N P     P + ++P +   P+    P + ++P + N      
Sbjct  1025  QPVVANQPAAETQPEVANQPAAEVQPVVANQPVVEAQPVVANQPVVEAQPEVAN------  1078

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNH  480
              PA+ ++P + N P+    P + ++P + + P+  + P + ++P + N 
Sbjct  1079  QPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQ  1127


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 48/111 (43%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA  ++P + N P     P + ++P +   P+    P   ++P +    +  +
Sbjct  947   QPVIANQPAAETQPEVANQPAAEVQPVVANQPAVETQPMVANQPVAEAQPVVETQPVVTN  1006

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P    +P + N P     P + ++P   + P   + PA   +P + N P+
Sbjct  1007  QPVAEVQPVVANQPAVETQPVVANQPAAETQPEVANQPAAEVQPVVANQPV  1057


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P   + PA+ ++P + N P+    P + ++P +   P+    P + ++P + N      
Sbjct  1073  QPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQLAAET  1132

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P +   P   + PA+ ++P + + P+    P + ++P     P+
Sbjct  1133  QPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVIANQPAAEVQPV  1183


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 50/111 (45%), Gaps = 0/111 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P +   P+  + P + ++P + N P     P + ++P +    +  
Sbjct  1138  NQPVVETQPEVANQPAVETQPVVANQPVVETQPVIANQPAAEVQPVVANQPVVETQPVIA  1197

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             + PA   +P   N P         ++P +   P+  + PA+ ++P + N P
Sbjct  1198  NQPAAEVQPVAANQPAVETQAVAANQPAVEDQPVVANQPAVETQPVVANQP  1248


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/112 (19%), Positives = 54/112 (48%), Gaps = 0/112 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P     P + ++P     P+  + P + ++P + N P+    P + ++P +    +  
Sbjct  1030  NQPAAETQPEVANQPAAEVQPVVANQPVVEAQPVVANQPVVEAQPEVANQPAVETQPVVA  1089

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + P + ++P + N P+    P + ++P + + P+  +  A  ++P + N P+
Sbjct  1090  NQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQLAAETQPVVANQPV  1141


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 50/111 (45%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P + ++P + N P     P + ++P +   P+    PA   +P + N  +   
Sbjct  1133  QPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVIANQPAAEVQPVVANQPVVET  1192

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P     P+  + PA+ ++    + P   D P + ++P +   P+
Sbjct  1193  QPVIANQPAAEVQPVAANQPAVETQAVAANQPAVEDQPVVANQPAVETQPV  1243


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P +   P+  + P + ++P + N       P + ++P +       
Sbjct  1090  NQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQLAAETQPVVANQPVVETQPEVA  1149

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             + PA+ ++P + N P+    P + ++P     P+  + P + ++P + N P
Sbjct  1150  NQPAVETQPVVANQPVVETQPVIANQPAAEVQPVVANQPVVETQPVIANQP  1200


 Score = 49.3 bits (116),  Expect = 0.001, Method: Composition-based stats.
 Identities = 21/112 (19%), Positives = 52/112 (46%), Gaps = 0/112 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P     P + ++P +   P+  + P + ++P + N P+    P + ++       +  
Sbjct  1078  NQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQLAAETQPVVA  1137

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + P + ++P + N P     P + ++P + + P+  + PA   +P + N P+
Sbjct  1138  NQPVVETQPEVANQPAVETQPVVANQPVVETQPVIANQPAAEVQPVVANQPV  1189



>ref|WP_033587337.1| hypothetical protein, partial [Streptococcus sp. GMD3S]
Length=335

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 53/113 (47%), Gaps = 0/113 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P++ ++P    +P  P +P++ + PA   +PT P  P + E PA   +PT P    + 
Sbjct  105  EKPVQPENPTQPEKPAQPENPVQPEKPAQPEKPTQPETPAQPEKPAQPEQPTQPETPAQP  164

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
            + PA   +PT P  P + + PA    P  P  P + + PA    PT P  P  
Sbjct  165  EKPAQPEKPTQPETPAQPEKPAQPETPAQPEKPAQPEKPAQPENPTQPETPAQ  217


 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 56/114 (49%), Gaps = 6/114 (5%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             +P++ + PA   +PT P  P + + PA   +PT P  P + E PA   +PT P      
Sbjct  123  ENPVQPEKPAQPEKPTQPETPAQPEKPAQPEQPTQPETPAQPEKPAQPEKPTQP------  176

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNG  492
            ++PA   +P  P  P + + PA   +P  P +P + ++PA   +P   + P  G
Sbjct  177  ETPAQPEKPAQPETPAQPEKPAQPEKPAQPENPTQPETPAQPEKPITSSSPEEG  230



>ref|WP_039083408.1| hypothetical protein [Gallibacterium anatis]
 gb|KGQ34025.1| hypothetical protein JP32_01535 [Gallibacterium anatis]
Length=1651

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/111 (22%), Positives = 56/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P   + PA+ ++P + N P+    P + ++P +   P+    P + ++P + N      
Sbjct  1037  QPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVIANQPTAET  1096

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P + N P+    P + ++P + + P+  + PA+ ++P + N P+
Sbjct  1097  QPVVANQPVVTNQPVAEVQPVVANQPAVETQPVVANQPAVETQPVVANQPV  1147


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/109 (21%), Positives = 54/109 (50%), Gaps = 0/109 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA+ ++P + N P+    P + ++P     P+    PA  ++P + N  +   
Sbjct  911   QPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVET  970

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNH  480
              P + ++P + N P+    P + ++P + + P+  + P + ++P + N 
Sbjct  971   QPEVATQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQ  1019


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/110 (21%), Positives = 53/110 (48%), Gaps = 0/110 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P + ++P + N P     P + ++P +   P+    PA+ ++P +    +   
Sbjct  1025  QPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVVET  1084

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P + ++PT    P+  + P + ++P     P+  + PA+ ++P + N P
Sbjct  1085  QPVIANQPTAETQPVVANQPVVTNQPVAEVQPVVANQPAVETQPVVANQP  1134


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA  ++P + N P+    P + ++P + N P+    P + ++P +    +  +
Sbjct  947   QPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVTNQPVVEAQPVVAN  1006

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P + N       P + ++P + + P   + PA+ ++P + N P+
Sbjct  1007  QPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQPAVETQPVVANQPV  1057


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P + ++P + N P     P + ++P +   P+    P   ++P + N  +  +
Sbjct  1049  QPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVIANQPTAETQPVVANQPVVTN  1108

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P    +P + N P     P + ++P + + P+  + P + ++P + N P+
Sbjct  1109  QPVAEVQPVVANQPAVETQPVVANQPAVETQPVVANQPVVETQPVVTNQPV  1159


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+    P + ++P + N P     P + ++P + N P+    P + ++P +    +  +
Sbjct  1073  QPVVATQPVVETQPVIANQPTAETQPVVANQPVVTNQPVAEVQPVVANQPAVETQPVVAN  1132

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              PA+ ++P + N P+    P + ++P + + P     P + ++P     P+
Sbjct  1133  QPAVETQPVVANQPVVETQPVVTNQPVVETQPEVATQPVVANQPVAKTQPI  1183


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA+ ++P +   P+    P + ++PT    P+    P + ++P      +  +
Sbjct  1061  QPVVANQPAVETQPVVATQPVVETQPVIANQPTAETQPVVANQPVVTNQPVAEVQPVVAN  1120

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              PA+ ++P + N P     P + ++P + + P+  + P + ++P +   P+
Sbjct  1121  QPAVETQPVVANQPAVETQPVVANQPVVETQPVVTNQPVVETQPEVATQPV  1171


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+    P + ++PT    P+  + P + ++P     P+    PA+ ++P + N      
Sbjct  1079  QPVVETQPVIANQPTAETQPVVANQPVVTNQPVAEVQPVVANQPAVETQPVVANQPAVET  1138

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P +   P+  + P + ++P + + P+  + P   ++P + N P+
Sbjct  1139  QPVVANQPVVETQPVVTNQPVVETQPEVATQPVVANQPVAKTQPIVANQPV  1189


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/115 (20%), Positives = 55/115 (48%), Gaps = 0/115 (0%)
 Frame = +1

Query  142   MPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYH  321
             M  + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P      
Sbjct  889   MVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQP  948

Query  322   LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             +  + PA  ++P + N P+    P + ++P + + P+    P + ++P +   P+
Sbjct  949   VVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVTNQPVVEAQPV  1003


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/110 (19%), Positives = 55/110 (50%), Gaps = 0/110 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P + ++P +   P+  + P + ++P + N P+    P + ++P +    +  +
Sbjct  959   QPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVAN  1018

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               A  ++P + N P+    P + ++P + + P+  + P + ++P + N P
Sbjct  1019  QLAAETQPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQP  1068


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 58/121 (48%), Gaps = 3/121 (2%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P+     + P+    P + ++P +   P+  +  A  ++P + N P+    P + ++P
Sbjct  988   AQPVV---TNQPVVEAQPVVANQPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQP  1044

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              +    +  + P + ++P + N P     P + ++P + + P+  + P   ++P + N P
Sbjct  1045  AVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVIANQPTAETQPVVANQP  1104

Query  484   L  486
             +
Sbjct  1105  V  1105


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/112 (21%), Positives = 54/112 (48%), Gaps = 6/112 (5%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P     P+  + PA  ++P + N P+    P + ++P + N     
Sbjct  928   NQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVAN-----  982

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
               P + ++P + N P+    P + ++P + + P+  +  A  ++P + N P+
Sbjct  983   -QPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQLAAETQPVVANQPV  1033


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/104 (19%), Positives = 50/104 (48%), Gaps = 0/104 (0%)
 Frame = +1

Query  175   PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  354
             P + ++P +   P   + PA+ ++P + N P+    P + ++P +    +    P + ++
Sbjct  1026  PVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQ  1085

Query  355   PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P + N P     P + ++P + + P+    P + ++P +   P+
Sbjct  1086  PVIANQPTAETQPVVANQPVVTNQPVAEVQPVVANQPAVETQPV  1129


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P +   P+  + P + ++P + N       P + ++P +       
Sbjct  982   NQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQLAAETQPVVANQPVVETQPEVA  1041

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             + PA+ ++P + N P+    P + ++P + + P+    P + ++P + N P
Sbjct  1042  NQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVIANQP  1092


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/110 (19%), Positives = 51/110 (46%), Gaps = 0/110 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA  ++P + N P     P + ++P +   P     P + ++P +    +  +
Sbjct  935   QPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVTN  994

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P + ++P + N P+    P + ++    + P+  + P + ++P + N P
Sbjct  995   QPVVEAQPVVANQPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQP  1044


 Score = 49.3 bits (116),  Expect = 0.001, Method: Composition-based stats.
 Identities = 22/117 (19%), Positives = 55/117 (47%), Gaps = 6/117 (5%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNH------PLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPN  315
              P+  + P + ++P + N       P+  + P + ++P + N P     P + ++P +  
Sbjct  1001  QPVVANQPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQPAVETQPVVANQPVVET  1060

Query  316   YHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
               +  + PA+ ++P +   P+    P + ++PT  + P+  + P + ++P     P+
Sbjct  1061  QPVVANQPAVETQPVVATQPVVETQPVIANQPTAETQPVVANQPVVTNQPVAEVQPV  1117


 Score = 49.3 bits (116),  Expect = 0.001, Method: Composition-based stats.
 Identities = 21/105 (20%), Positives = 50/105 (48%), Gaps = 6/105 (6%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P     P + ++P + N P+    P + ++P +   P+    PA+ ++P + N     
Sbjct  1090  NQPTAETQPVVANQPVVTNQPVAEVQPVVANQPAVETQPVVANQPAVETQPVVAN-----  1144

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  465
               P + ++P + N P+    P + ++P + + P+    P + ++P
Sbjct  1145  -QPVVETQPVVTNQPVVETQPEVATQPVVANQPVAKTQPIVANQP  1188



>ref|XP_011196264.1| PREDICTED: probable serine/threonine-protein kinase kinX [Bactrocera 
cucurbitae]
Length=258

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 53/119 (45%), Gaps = 13/119 (11%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P++ D PA + EP+    P   + P+ + EP     P K E PA   EP+      K +
Sbjct  119  KPVQGDEPAKVEEPSKVEQPADSEEPSKVEEPAKVEEPSKVEQPADSEEPS------KVE  172

Query  334  SPAM-------LSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
             PA         ++P   + P K + P+ + +P     PLK + PA + EPT    P +
Sbjct  173  QPAQDDDLLLLDAKPAQGDEPAKVEEPSKVEQPADSEEPLKVEQPAKVEEPTKVEQPAD  231


 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 50/120 (42%), Gaps = 7/120 (6%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAML-------SEPTM  309
              P K + PA   EP+    P K + P+ + +P     P K E PA         ++P  
Sbjct  130  EEPSKVEQPADSEEPSKVEEPAKVEEPSKVEQPADSEEPSKVEQPAQDDDLLLLDAKPAQ  189

Query  310  PNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
             +   K + P+ + +P     PLK + PA + EPT    P   + P+ + +P     P  
Sbjct  190  GDEPAKVEEPSKVEQPADSEEPLKVEQPAKVEEPTKVEQPADSEEPSKVEQPAQAEQPAE  249



>ref|WP_000300357.1| hypothetical protein, partial [Streptococcus sp. GMD4S]
 gb|EKA08096.1| cell wall surface anchor family protein, partial [Streptococcus 
sp. GMD4S]
Length=459

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/115 (28%), Positives = 56/115 (49%), Gaps = 0/115 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P + + P    +PT P +P++ + PA   +P  P  P + E+PA   +P  P    + 
Sbjct  176  EKPAQPEKPVQPEKPTQPENPVQPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEKPTQP  235

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  495
            ++PA   +PT P +P++ ++PA   +P  P  P + + P     P  P  P+  S
Sbjct  236  ETPAQPEKPTQPENPVQPETPAQPEKPAQPEKPAQPEKPTQPENPAQPEKPITSS  290


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 56/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P + ++P    +P  P  P + + P    +PT P +P++ E PA   +P  P    + 
Sbjct  158  EKPTQPENPVQPEKPAQPEKPAQPEKPVQPEKPTQPENPVQPEKPAQPEKPAQPEKPTQP  217

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            ++PA   +P  P  P + ++PA   +PT P +P++ ++PA   +P  P  P
Sbjct  218  ETPAQPEKPAQPEKPTQPETPAQPEKPTQPENPVQPETPAQPEKPAQPEKP  268


 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/113 (27%), Positives = 55/113 (49%), Gaps = 0/113 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             +P++ + P    +P  P  P + ++P    +P  P  P + E P    +PT P   ++ 
Sbjct  140  ENPVQPEKPTQPEKPAQPEKPTQPENPVQPEKPAQPEKPAQPEKPVQPEKPTQPENPVQP  199

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
            + PA   +P  P  P + ++PA   +P  P  P + ++PA   +PT P +P+ 
Sbjct  200  EKPAQPEKPAQPEKPTQPETPAQPEKPAQPEKPTQPETPAQPEKPTQPENPVQ  252


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 48/99 (48%), Gaps = 0/99 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             +P++ + PA   +P  P  P + ++PA   +P  P  P + E+PA   +PT P   ++ 
Sbjct  194  ENPVQPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEKPTQPETPAQPEKPTQPENPVQP  253

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSP  447
            ++PA   +P  P  P + + P     P  P  P+   SP
Sbjct  254  ETPAQPEKPAQPEKPAQPEKPTQPENPAQPEKPITSSSP  292



>ref|WP_039081894.1| hypothetical protein [Gallibacterium anatis]
 gb|KGQ37876.1| hypothetical protein JP35_08810 [Gallibacterium anatis]
Length=1612

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/111 (23%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA+ ++P + N P+    P + ++P     P+    PA  ++P + N  +   
Sbjct  922   QPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVET  981

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P + N P+    P + ++P     P+  + PA+ ++P + N P+
Sbjct  982   QPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPV  1032


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/111 (23%), Positives = 53/111 (48%), Gaps = 6/111 (5%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  D P + ++P +   P+  D P + ++P +   P+    P    +P + N      
Sbjct  874  QPVTEDQPVVETQPEVATQPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVAN------  927

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             PA+ ++P + N P+    P + ++P   + P+  + PA  ++P + N P+
Sbjct  928  QPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPV  978


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/109 (21%), Positives = 55/109 (50%), Gaps = 0/109 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA  ++P + N P+    P + ++P + N P+    P + ++P      +  +
Sbjct  958   QPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVAN  1017

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNH  480
              PA+ ++P + N P+    P + ++P + + P+  + P + ++P + N 
Sbjct  1018  QPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPVVETQPVVANQ  1066


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  +  A  ++P + N P+    P + ++P +   P+    P + ++P + N      
Sbjct  1060  QPVVANQLAAETQPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQPAVET  1119

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P +   P+  D P + ++P   + P+  + PA+ ++P + N P+
Sbjct  1120  QPVVATQPVVETQPVVEDQPVVANQPAAKTQPVVANQPAVETQPVVANQPV  1170


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P + ++P + N P     P + ++P +   P+    PA+ ++P +    +   
Sbjct  1072  QPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVVET  1131

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P +  +P + N P     P + ++P + + P+  + P + ++P + N P+
Sbjct  1132  QPVVEDQPVVANQPAAKTQPVVANQPAVETQPVVANQPVVETQPVVTNQPV  1182


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P   + PA+ ++P + N P+    P + ++P +   P+    P + ++P + +  +  +
Sbjct  1084  QPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVVEDQPVVAN  1143

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              PA  ++P + N P     P + ++P + + P+  + P + ++P +   P+
Sbjct  1144  QPAAKTQPVVANQPAVETQPVVANQPVVETQPVVTNQPVVETQPEVATQPV  1194


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA+ ++P + N P+    P + ++P +   P+    P + ++P + N      
Sbjct  1012  QPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPVVETQPVVANQLAAET  1071

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P +   P   + PA+ ++P + + P+    P + ++P +   P+
Sbjct  1072  QPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPV  1122


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P +   P+  + P + ++P + N P     P + ++P +    +  
Sbjct  1077  NQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVVE  1136

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             D P + ++P     P+  + PA+ ++P + + P+    P + ++P +   P
Sbjct  1137  DQPVVANQPAAKTQPVVANQPAVETQPVVANQPVVETQPVVTNQPVVETQP  1187


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/111 (22%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA  ++P + N P     P + ++P +   P     P + ++P +    +  +
Sbjct  946   QPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVAN  1005

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              PA   +P + N P     P + ++P + + P   + PA+ ++P + N P+
Sbjct  1006  QPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPV  1056


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P + ++P + N P     P + ++P +   P+  + P + ++P      +  +
Sbjct  1096  QPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVVEDQPVVANQPAAKTQPVVAN  1155

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              PA+ ++P + N P+    P + ++P + + P     P + ++P +   P+
Sbjct  1156  QPAVETQPVVANQPVVETQPVVTNQPVVETQPEVATQPVVETQPEVATQPV  1206


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 50/104 (48%), Gaps = 0/104 (0%)
 Frame = +1

Query  175  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  354
            P +  +P + N P+    P + ++P     P+    PA+ ++P + N  +    P + ++
Sbjct  893  PVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQ  952

Query  355  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P     P+  + PA  ++P + + P+    P + ++P + N P+
Sbjct  953  PAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPV  996


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 20/111 (18%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+    P + ++P + + P+  + P + ++P + N P+    P + ++P +    +  +
Sbjct  880  QPVVETQPEVATQPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVAN  939

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P   ++P + N P     P + ++P   + P+  + P + ++P +   P+
Sbjct  940  QPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPV  990


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/110 (19%), Positives = 51/110 (46%), Gaps = 0/110 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P   ++P + N P     P + ++P     P+    P + ++P +    +  +
Sbjct  934   QPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVAN  993

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P + ++P + N P     P + ++P + + P+  + P + ++P + N P
Sbjct  994   QPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQP  1043


 Score = 52.0 bits (123),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 55/112 (49%), Gaps = 0/112 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P +    +  
Sbjct  993   NQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVA  1052

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + P + ++P + N       P + ++P + + P   + PA+ ++P + N P+
Sbjct  1053  NQPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQPAVETQPVVANQPV  1104


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 53/112 (47%), Gaps = 0/112 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P      +  
Sbjct  903   NQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVA  962

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + PA  ++P + N P+    P + ++P + + P+    P + ++P     P+
Sbjct  963   NQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPV  1014


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 49/111 (44%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  D P + ++P +   P+  + P    +P + N P     P + ++P      +  +
Sbjct  892   QPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVAN  951

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              PA  ++P + N P     P + ++P + + P     P + ++P +   P+
Sbjct  952   QPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPV  1002


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/117 (21%), Positives = 54/117 (46%), Gaps = 6/117 (5%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSP------AMLSEPTMPNHPLKYESPAMLSEPTMPN  315
              P   + PA+ ++P + N P+    P      A  ++P + N P+    P + ++P +  
Sbjct  1036  QPEVANQPAVETQPVVANQPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQPAVET  1095

Query  316   YHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
               +  + P + ++P + N P     P + ++P + + P+  D P + ++P     P+
Sbjct  1096  QPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVVEDQPVVANQPAAKTQPV  1152


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P + ++P +   P+  + P + ++P + N P     P + ++P +    +  +
Sbjct  970   QPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVAN  1029

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P + N P     P + ++P + + P+  +  A  ++P + N P+
Sbjct  1030  QPVVEAQPEVANQPAVETQPVVANQPVVETQPVVANQLAAETQPVVANQPV  1080


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/116 (22%), Positives = 53/116 (46%), Gaps = 6/116 (5%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA   +P + N P     P + ++P +   P     PA+ ++P + N  +   
Sbjct  1000  QPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPVVET  1059

Query  334   SP------AMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P      A  ++P + N P+    P + ++P + + P+  + P + ++P + N P
Sbjct  1060  QPVVANQLAAETQPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQP  1115


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 20/112 (18%), Positives = 54/112 (48%), Gaps = 0/112 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P +   P+  + P + ++P + N       P + ++P +       
Sbjct  1029  NQPVVEAQPEVANQPAVETQPVVANQPVVETQPVVANQLAAETQPVVANQPVVETQPEVA  1088

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + PA+ ++P + N P+    P + ++P + + P+    P + ++P + + P+
Sbjct  1089  NQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVVEDQPV  1140



>ref|WP_011328491.1| ribonuclease [Pseudoalteromonas haloplanktis]
 emb|CAI86888.1| RNase E: endoribonuclease for rRNA processing and mRNA degradation; 
member of the degradosome; involved in the production 
of deoxyribonucleotides via the formation of NDPs [Pseudoalteromonas 
haloplanktis TAC125]
Length=1071

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 50/110 (45%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P++ + PA +  P +   P K ++P    EP     P+  E PA +  P +     K ++
Sbjct  865  PVQTEEPAKVETPVVTEEPAKVETPVAAEEPAKVETPVAAEEPAKVEAPVVTEEPAKVET  924

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P +  EP     P+  + PA +  P +   P K ++P +  EPT    P+
Sbjct  925  PLVTEEPAKVEAPVVTEEPAKVETPVVTEEPAKVEAPVVTEEPTKVETPV  974


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 31/120 (26%), Positives = 52/120 (43%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+  T +    P K ++P    EP     P+  + PA +  P +   P K E+P +  EP
Sbjct  884   AKVETPVAAEEPAKVETPVAAEEPAKVEAPVVTEEPAKVETPLVTEEPAKVEAPVVTEEP  943

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
                   +  + PA +  P +   P K ++P +  EPT    P+  + PA +  P +   P
Sbjct  944   AKVETPVVTEEPAKVEAPVVTEEPTKVETPVVTEEPTKVEAPVVTEEPAKVETPVVTAAP  1003


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 53/121 (44%), Gaps = 6/121 (5%)
 Frame = +1

Query  124  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
            A+  T +    P K ++P    EP     P+  + PA +  P +   P K E+P +  EP
Sbjct  872  AKVETPVVTEEPAKVETPVAAEEPAKVETPVAAEEPAKVEAPVVTEEPAKVETPLVTEEP  931

Query  304  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
                   K ++P +  EP     P+  + PA +  P +   P K ++P +  EPT    P
Sbjct  932  A------KVEAPVVTEEPAKVETPVVTEEPAKVEAPVVTEEPTKVETPVVTEEPTKVEAP  985

Query  484  L  486
            +
Sbjct  986  V  986


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 28/110 (25%), Positives = 47/110 (43%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + PA +  P     P K ++P +  EP     PL  E PA +  P +     K ++
Sbjct  889  PVAAEEPAKVETPVAAEEPAKVEAPVVTEEPAKVETPLVTEEPAKVEAPVVTEEPAKVET  948

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P +  EP     P+  + P  +  P +   P K ++P +  EP     P+
Sbjct  949  PVVTEEPAKVEAPVVTEEPTKVETPVVTEEPTKVEAPVVTEEPAKVETPV  998


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 32/124 (26%), Positives = 54/124 (44%), Gaps = 6/124 (5%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+  T +    P K ++P +  EP     PL  + PA +  P +   P K E+P +  EP
Sbjct  896   AKVETPVAAEEPAKVEAPVVTEEPAKVETPLVTEEPAKVEAPVVTEEPAKVETPVVTEEP  955

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
                    K ++P +  EPT    P+  + P  +  P +   P K ++P + + P +    
Sbjct  956   A------KVEAPVVTEEPTKVETPVVTEEPTKVEAPVVTEEPAKVETPVVTAAPHVKTAI  1009

Query  484   LNGS  495
               GS
Sbjct  1010  AQGS  1013


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/101 (27%), Positives = 43/101 (43%), Gaps = 0/101 (0%)
 Frame = +1

Query  184  LSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTM  363
            + EP     P K ++P +  EP     P+  E PA +  P       K ++P +  EP  
Sbjct  862  VEEPVQTEEPAKVETPVVTEEPAKVETPVAAEEPAKVETPVAAEEPAKVEAPVVTEEPAK  921

Query  364  PNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
               PL  + PA +  P +   P K ++P +  EP     P+
Sbjct  922  VETPLVTEEPAKVEAPVVTEEPAKVETPVVTEEPAKVEAPV  962


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/104 (24%), Positives = 49/104 (47%), Gaps = 0/104 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P K ++P +  EP     P+  + PA +  P +   P K E+P +  EPT     +  + 
Sbjct  919   PAKVETPLVTEEPAKVEAPVVTEEPAKVETPVVTEEPAKVEAPVVTEEPTKVETPVVTEE  978

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPT  468
             P  +  P +   P K ++P + + P + +   +  + A +++PT
Sbjct  979   PTKVEAPVVTEEPAKVETPVVTAAPHVKTAIAQGSASAPMAQPT  1022



>ref|WP_039163635.1| hypothetical protein [Gallibacterium anatis]
 gb|KGQ61741.1| hypothetical protein IO48_06935 [Gallibacterium anatis 4895]
Length=1527

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/121 (21%), Positives = 60/121 (50%), Gaps = 3/121 (2%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P+     + P+    P + ++P + + P+  + PA+  +P + N P+    P + ++P
Sbjct  891   AQPVVA---NQPVVETQPVVANQPVVEDQPVVANQPAVEDQPVVANQPVVETQPVVANQP  947

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
                   +  + PA  ++P + N P     P + ++P + + P+  + P + ++P + N P
Sbjct  948   VAETQPVVANQPAAETQPEVANQPAAEVQPVVANQPVVETQPVVANQPVVEAQPEVANQP  1007

Query  484   L  486
             +
Sbjct  1008  V  1008


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/112 (21%), Positives = 55/112 (49%), Gaps = 0/112 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+  D P + ++P + + P+  + P + ++P + N P+    P + ++P         
Sbjct  909   NQPVVEDQPVVANQPAVEDQPVVANQPVVETQPVVANQPVAETQPVVANQPAAETQPEVA  968

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + PA   +P + N P+    P + ++P + + P   + P + ++P + N P+
Sbjct  969   NQPAAEVQPVVANQPVVETQPVVANQPVVEAQPEVANQPVVETQPVVTNQPV  1020


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/112 (21%), Positives = 54/112 (48%), Gaps = 0/112 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P     P+  + PA  ++P + N P     P + ++P +    +  
Sbjct  933   NQPVVETQPVVANQPVAETQPVVANQPAAETQPEVANQPAAEVQPVVANQPVVETQPVVA  992

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + P + ++P + N P+    P + ++P     P+  + PA+ ++P + N P+
Sbjct  993   NQPVVEAQPEVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPV  1044


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/106 (23%), Positives = 52/106 (49%), Gaps = 6/106 (6%)
 Frame = +1

Query  169  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
            + PA+ ++P + N P+    P + ++P + + P+    PA+  +P + N       P + 
Sbjct  885  NQPAVEAQPVVANQPVVETQPVVANQPVVEDQPVVANQPAVEDQPVVAN------QPVVE  938

Query  349  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            ++P + N P+    P + ++P   + P   + PA   +P + N P+
Sbjct  939  TQPVVANQPVAETQPVVANQPAAETQPEVANQPAAEVQPVVANQPV  984


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 51/111 (46%), Gaps = 0/111 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P   D P + ++P +   P+  + P   ++P + N P     P + ++P      +  
Sbjct  921   NQPAVEDQPVVANQPVVETQPVVANQPVAETQPVVANQPAAETQPEVANQPAAEVQPVVA  980

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             + P + ++P + N P+    P + ++P + + P+  + P    +P + N P
Sbjct  981   NQPVVETQPVVANQPVVEAQPEVANQPVVETQPVVTNQPVAEVQPVVANQP  1031


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 53/111 (48%), Gaps = 6/111 (5%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA  ++P + N P     P + ++P +   P+    P + ++P + N      
Sbjct  952   QPVVANQPAAETQPEVANQPAAEVQPVVANQPVVETQPVVANQPVVEAQPEVAN------  1005

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P + N P+    P + ++P + + P+  + P   ++P + N P+
Sbjct  1006  QPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPV  1056


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/112 (19%), Positives = 50/112 (45%), Gaps = 0/112 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P     P + ++P     P+  + P + ++P + N P+    P + ++P +    +  
Sbjct  957   NQPAAETQPEVANQPAAEVQPVVANQPVVETQPVVANQPVVEAQPEVANQPVVETQPVVT  1016

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + P    +P + N P     P + ++P   + P+  + P +  +P + N P+
Sbjct  1017  NQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPVVEDQPVVANQPI  1068


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/105 (19%), Positives = 51/105 (49%), Gaps = 0/105 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P     P + ++P +   P+  + P + ++P + N P+    P + ++P      +  
Sbjct  969   NQPAAEVQPVVANQPVVETQPVVANQPVVEAQPEVANQPVVETQPVVTNQPVAEVQPVVA  1028

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  465
             + PA+ ++P + N P+    P + ++P +   P+  + P + ++P
Sbjct  1029  NQPAVETQPVVANQPVAETQPVVANQPVVEDQPVVANQPIVEAQP  1073



>ref|WP_039157809.1| hypothetical protein [Gallibacterium anatis]
 gb|KGQ66824.1| hypothetical protein IO49_03030 [Gallibacterium anatis]
Length=1800

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/111 (23%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA+ ++P + N P+    P + ++P     P+    PA  ++P + N  +   
Sbjct  913   QPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVET  972

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P + N P+    P + ++P     P+  + PA+ ++P + N P+
Sbjct  973   QPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPV  1023


 Score = 58.2 bits (139),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/111 (22%), Positives = 57/111 (51%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA  ++P + N P+    P + ++P + N P+    P + ++P      +  +
Sbjct  949   QPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVAN  1008

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              PA+ ++P + N P+    P + ++P + + P+  + P + ++P + N P+
Sbjct  1009  QPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPV  1059


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/111 (23%), Positives = 53/111 (48%), Gaps = 6/111 (5%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  D P + ++P +   P+  D P + ++P +   P+    P    +P + N      
Sbjct  865  QPVTEDQPVVETQPEVATQPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVAN------  918

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             PA+ ++P + N P+    P + ++P   + P+  + PA  ++P + N P+
Sbjct  919  QPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPV  969


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/110 (21%), Positives = 52/110 (47%), Gaps = 0/110 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P + ++P + N P     P + ++P +   P+    PA+ ++P +    +   
Sbjct  1087  QPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVAET  1146

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              PA+ ++P + N P+    P + ++P     P+  + P   ++P + N P
Sbjct  1147  QPAVEAQPVVANQPVVETQPVVTNQPVAEVQPVVANQPVTEAQPVVSNQP  1196


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P + ++P +   P+  + P + ++P + N P     P + ++P +    +  +
Sbjct  961   QPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVAN  1020

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P + N P     P + ++P + + P+  + P + ++P + N P+
Sbjct  1021  QPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPV  1071


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/111 (22%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA  ++P + N P     P + ++P +   P     P + ++P +    +  +
Sbjct  937   QPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVAN  996

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              PA   +P + N P     P + ++P + + P   + PA+ ++P + N P+
Sbjct  997   QPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPV  1047


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P + ++P + N P+    P + ++      P+    P + ++P + N      
Sbjct  1051  QPVVTNQPVVEAQPVVANQPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQPAVET  1110

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P +   P+  + PA+ ++P + + P+    PA+ ++P + N P+
Sbjct  1111  QPVVANQPVVETQPVVANQPAVETQPVVATQPVAETQPAVEAQPVVANQPV  1161


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/106 (20%), Positives = 52/106 (49%), Gaps = 0/106 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P + ++P + N P+    P + ++P     P+    PA+ ++P +    +   
Sbjct  1153  QPVVANQPVVETQPVVTNQPVAEVQPVVANQPVTEAQPVVSNQPAVEAQPVVEKQAVTEA  1212

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  471
              P ++++P     P+  D P + ++P   + P+  + PA+ ++P +
Sbjct  1213  QPVVVNQPVAETQPIVKDQPVVANQPVTEAQPVVSNQPAVEAQPVV  1258


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 50/104 (48%), Gaps = 0/104 (0%)
 Frame = +1

Query  175  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  354
            P +  +P + N P+    P + ++P     P+    PA+ ++P + N  +    P + ++
Sbjct  884  PVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQ  943

Query  355  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P     P+  + PA  ++P + + P+    P + ++P + N P+
Sbjct  944  PAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPV  987


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 20/111 (18%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+    P + ++P + + P+  + P + ++P + N P+    P + ++P +    +  +
Sbjct  871  QPVVETQPEVATQPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVAN  930

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P   ++P + N P     P + ++P   + P+  + P + ++P +   P+
Sbjct  931  QPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPV  981


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 56/112 (50%), Gaps = 0/112 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P +    +  
Sbjct  984   NQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVA  1043

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + P + ++P + N P+    P + ++P + + P+  +  A  ++P + N P+
Sbjct  1044  NQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQLAAETQPVVANQPV  1095


 Score = 52.0 bits (123),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P +   P+  + P + ++P + N P+    P + ++P +    +  
Sbjct  1020  NQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVA  1079

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             +  A  ++P + N P+    P + ++P + + P+  + P + ++P + N P
Sbjct  1080  NQLAAETQPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQP  1130


 Score = 52.0 bits (123),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P   + PA+ ++P + N P+    P + ++P +   P+    P + ++P + N      
Sbjct  1027  QPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQLAAET  1086

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P +   P   + PA+ ++P + + P+    P + ++P +   P+
Sbjct  1087  QPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPV  1137


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/110 (19%), Positives = 51/110 (46%), Gaps = 0/110 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P   ++P + N P     P + ++P     P+    P + ++P +    +  +
Sbjct  925   QPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVAN  984

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P + ++P + N P     P + ++P + + P+  + P + ++P + N P
Sbjct  985   QPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQP  1034


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 53/112 (47%), Gaps = 0/112 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P      +  
Sbjct  894   NQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVA  953

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + PA  ++P + N P+    P + ++P + + P+    P + ++P     P+
Sbjct  954   NQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPV  1005


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/117 (21%), Positives = 58/117 (50%), Gaps = 6/117 (5%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPL------KYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPN  315
              P+  + PA+ ++P + N P+        + PA+ ++P + N P+    P + ++P +  
Sbjct  1003  QPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEA  1062

Query  316   YHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
               +  + P + ++P + N       P + ++P + + P   + PA+ ++P + N P+
Sbjct  1063  QPVVANQPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQPAVETQPVVANQPV  1119


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 49/111 (44%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  D P + ++P +   P+  + P    +P + N P     P + ++P      +  +
Sbjct  883  QPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVAN  942

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             PA  ++P + N P     P + ++P + + P     P + ++P +   P+
Sbjct  943  QPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPV  993


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/106 (20%), Positives = 52/106 (49%), Gaps = 0/106 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P   + PA+ ++P + N P+    P + ++P +   P+    P   ++P +    +  +
Sbjct  1099  QPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVAETQPAVEAQPVVAN  1158

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  471
              P + ++P + N P+    P + ++P   + P+  + PA+ ++P +
Sbjct  1159  QPVVETQPVVTNQPVAEVQPVVANQPVTEAQPVVSNQPAVEAQPVV  1204


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/109 (20%), Positives = 53/109 (49%), Gaps = 6/109 (6%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P + ++P + N P     P + ++P +   P+    P + ++P + N      
Sbjct  979   QPVVANQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVAN------  1032

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNH  480
              PA+ ++P + N P+    P + ++P + + P+  + P + ++P + N 
Sbjct  1033  QPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQ  1081


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 56/121 (46%), Gaps = 3/121 (2%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P+ +   + P+    P +  +P + N P+    P + ++P +   P+  +     ++P
Sbjct  1212  AQPVVV---NQPVAETQPIVKDQPVVANQPVTEAQPVVSNQPAVEAQPVVEKQAVTEAQP  1268

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              + N  +    P + ++P     P+    P + ++P     P+  + PA+ ++P + N P
Sbjct  1269  VVVNQPVAETQPVVETKPVAETQPVAETQPVVTNQPVAEVQPVVANQPAVETQPMVANQP  1328

Query  484   L  486
             +
Sbjct  1329  V  1329


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 51/111 (46%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA+ ++P +   P+    PA+ ++P + N P+    P + ++P      +  +
Sbjct  1123  QPVVANQPAVETQPVVATQPVAETQPAVEAQPVVANQPVVETQPVVTNQPVAEVQPVVAN  1182

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P   ++P + N P     P +  +    + P+  + P   ++P + + P+
Sbjct  1183  QPVTEAQPVVSNQPAVEAQPVVEKQAVTEAQPVVVNQPVAETQPIVKDQPV  1233


 Score = 49.3 bits (116),  Expect = 0.001, Method: Composition-based stats.
 Identities = 20/111 (18%), Positives = 51/111 (46%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+    P   ++P +   P+  + P + ++P + N P+    P + ++P      +  +
Sbjct  1135  QPVVATQPVAETQPAVEAQPVVANQPVVETQPVVTNQPVAEVQPVVANQPVTEAQPVVSN  1194

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              PA+ ++P +    +    P ++++P   + P+  D P + ++P     P+
Sbjct  1195  QPAVEAQPVVEKQAVTEAQPVVVNQPVAETQPIVKDQPVVANQPVTEAQPV  1245



>ref|WP_021461970.1| hypothetical protein [Gallibacterium anatis]
 gb|ERF78007.1| hypothetical protein N561_08640 [Gallibacterium anatis 12656/12]
Length=1800

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/111 (23%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA+ ++P + N P+    P + ++P     P+    PA  ++P + N  +   
Sbjct  913   QPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVET  972

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P + N P+    P + ++P     P+  + PA+ ++P + N P+
Sbjct  973   QPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPV  1023


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/111 (22%), Positives = 57/111 (51%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA  ++P + N P+    P + ++P + N P+    P + ++P      +  +
Sbjct  949   QPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVAN  1008

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              PA+ ++P + N P+    P + ++P + + P+  + P + ++P + N P+
Sbjct  1009  QPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPV  1059


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/111 (23%), Positives = 53/111 (48%), Gaps = 6/111 (5%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  D P + ++P +   P+  D P + ++P +   P+    P    +P + N      
Sbjct  865  QPVTEDQPVVETQPEVATQPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVAN------  918

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             PA+ ++P + N P+    P + ++P   + P+  + PA  ++P + N P+
Sbjct  919  QPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPV  969


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/110 (21%), Positives = 52/110 (47%), Gaps = 0/110 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P + ++P + N P     P + ++P +   P+    PA+ ++P +    +   
Sbjct  1087  QPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVAET  1146

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              PA+ ++P + N P+    P + ++P     P+  + P   ++P + N P
Sbjct  1147  QPAVEAQPVVANQPVVETQPVVTNQPVAEVQPVVANQPVTEAQPVVSNQP  1196


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P + ++P +   P+  + P + ++P + N P     P + ++P +    +  +
Sbjct  961   QPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVAN  1020

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P + N P     P + ++P + + P+  + P + ++P + N P+
Sbjct  1021  QPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPV  1071


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/111 (22%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA  ++P + N P     P + ++P +   P     P + ++P +    +  +
Sbjct  937   QPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVAN  996

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              PA   +P + N P     P + ++P + + P   + PA+ ++P + N P+
Sbjct  997   QPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPV  1047


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P + ++P + N P+    P + ++      P+    P + ++P + N      
Sbjct  1051  QPVVTNQPVVEAQPVVANQPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQPAVET  1110

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P +   P+  + PA+ ++P + + P+    PA+ ++P + N P+
Sbjct  1111  QPVVANQPVVETQPVVANQPAVETQPVVATQPVAETQPAVEAQPVVANQPV  1161


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/106 (20%), Positives = 52/106 (49%), Gaps = 0/106 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P + ++P + N P+    P + ++P     P+    PA+ ++P +    +   
Sbjct  1153  QPVVANQPVVETQPVVTNQPVAEVQPVVANQPVTEAQPVVSNQPAVEAQPVVEKQAVTEA  1212

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  471
              P ++++P     P+  D P + ++P   + P+  + PA+ ++P +
Sbjct  1213  QPVVVNQPVAETQPIVKDQPVVANQPVTEAQPVVSNQPAVEAQPVV  1258


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 50/104 (48%), Gaps = 0/104 (0%)
 Frame = +1

Query  175  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  354
            P +  +P + N P+    P + ++P     P+    PA+ ++P + N  +    P + ++
Sbjct  884  PVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQ  943

Query  355  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P     P+  + PA  ++P + + P+    P + ++P + N P+
Sbjct  944  PAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPV  987


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 20/111 (18%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+    P + ++P + + P+  + P + ++P + N P+    P + ++P +    +  +
Sbjct  871  QPVVETQPEVATQPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVAN  930

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P   ++P + N P     P + ++P   + P+  + P + ++P +   P+
Sbjct  931  QPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPV  981


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 56/112 (50%), Gaps = 0/112 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P +    +  
Sbjct  984   NQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVA  1043

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + P + ++P + N P+    P + ++P + + P+  +  A  ++P + N P+
Sbjct  1044  NQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQLAAETQPVVANQPV  1095


 Score = 52.0 bits (123),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P +   P+  + P + ++P + N P+    P + ++P +    +  
Sbjct  1020  NQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVA  1079

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             +  A  ++P + N P+    P + ++P + + P+  + P + ++P + N P
Sbjct  1080  NQLAAETQPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQP  1130


 Score = 52.0 bits (123),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P   + PA+ ++P + N P+    P + ++P +   P+    P + ++P + N      
Sbjct  1027  QPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQLAAET  1086

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P +   P   + PA+ ++P + + P+    P + ++P +   P+
Sbjct  1087  QPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPV  1137


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/110 (19%), Positives = 51/110 (46%), Gaps = 0/110 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P   ++P + N P     P + ++P     P+    P + ++P +    +  +
Sbjct  925   QPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVAN  984

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P + ++P + N P     P + ++P + + P+  + P + ++P + N P
Sbjct  985   QPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQP  1034


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 53/112 (47%), Gaps = 0/112 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P      +  
Sbjct  894   NQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVA  953

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + PA  ++P + N P+    P + ++P + + P+    P + ++P     P+
Sbjct  954   NQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPV  1005


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/117 (21%), Positives = 58/117 (50%), Gaps = 6/117 (5%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPL------KYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPN  315
              P+  + PA+ ++P + N P+        + PA+ ++P + N P+    P + ++P +  
Sbjct  1003  QPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEA  1062

Query  316   YHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
               +  + P + ++P + N       P + ++P + + P   + PA+ ++P + N P+
Sbjct  1063  QPVVANQPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQPAVETQPVVANQPV  1119


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 49/111 (44%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  D P + ++P +   P+  + P    +P + N P     P + ++P      +  +
Sbjct  883  QPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVAN  942

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             PA  ++P + N P     P + ++P + + P     P + ++P +   P+
Sbjct  943  QPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPV  993


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/106 (20%), Positives = 52/106 (49%), Gaps = 0/106 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P   + PA+ ++P + N P+    P + ++P +   P+    P   ++P +    +  +
Sbjct  1099  QPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVAETQPAVEAQPVVAN  1158

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  471
              P + ++P + N P+    P + ++P   + P+  + PA+ ++P +
Sbjct  1159  QPVVETQPVVTNQPVAEVQPVVANQPVTEAQPVVSNQPAVEAQPVV  1204


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/109 (20%), Positives = 53/109 (49%), Gaps = 6/109 (6%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P + ++P + N P     P + ++P +   P+    P + ++P + N      
Sbjct  979   QPVVANQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVAN------  1032

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNH  480
              PA+ ++P + N P+    P + ++P + + P+  + P + ++P + N 
Sbjct  1033  QPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQ  1081


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 56/121 (46%), Gaps = 3/121 (2%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P+ +   + P+    P +  +P + N P+    P + ++P +   P+  +     ++P
Sbjct  1212  AQPVVV---NQPVAETQPIVKDQPVVANQPVTEAQPVVSNQPAVEAQPVVEKQAVTEAQP  1268

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              + N  +    P + ++P     P+    P + ++P     P+  + PA+ ++P + N P
Sbjct  1269  VVVNQPVAETQPVVETKPVAETQPVAETQPVVTNQPVAEVQPVVANQPAVETQPMVANQP  1328

Query  484   L  486
             +
Sbjct  1329  V  1329


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 51/111 (46%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA+ ++P +   P+    PA+ ++P + N P+    P + ++P      +  +
Sbjct  1123  QPVVANQPAVETQPVVATQPVAETQPAVEAQPVVANQPVVETQPVVTNQPVAEVQPVVAN  1182

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P   ++P + N P     P +  +    + P+  + P   ++P + + P+
Sbjct  1183  QPVTEAQPVVSNQPAVEAQPVVEKQAVTEAQPVVVNQPVAETQPIVKDQPV  1233


 Score = 49.3 bits (116),  Expect = 0.001, Method: Composition-based stats.
 Identities = 20/111 (18%), Positives = 51/111 (46%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+    P   ++P +   P+  + P + ++P + N P+    P + ++P      +  +
Sbjct  1135  QPVVATQPVAETQPAVEAQPVVANQPVVETQPVVTNQPVAEVQPVVANQPVTEAQPVVSN  1194

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              PA+ ++P +    +    P ++++P   + P+  D P + ++P     P+
Sbjct  1195  QPAVEAQPVVEKQAVTEAQPVVVNQPVAETQPIVKDQPVVANQPVTEAQPV  1245



>ref|WP_039156382.1| hypothetical protein, partial [Gallibacterium anatis]
 gb|KGQ57531.1| hypothetical protein IO45_11020, partial [Gallibacterium anatis]
Length=1049

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/111 (23%), Positives = 53/111 (48%), Gaps = 6/111 (5%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  D P + ++P +   P+  D P + ++P +   P+    P    +P + N      
Sbjct  865  QPVTEDQPVVETQPEVATQPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVAN------  918

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             PA+ ++P + N P+    P + ++P   + P+  + PA  ++P + N P+
Sbjct  919  QPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPV  969


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/118 (22%), Positives = 57/118 (48%), Gaps = 1/118 (1%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P      +  
Sbjct  894   NQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVA  953

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP-LNGSPE  501
             + PA  ++P + N P+    P + ++P     P+  + PA+ ++P + N P +   PE
Sbjct  954   NQPAAEAQPVVTNQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPE  1011


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/112 (21%), Positives = 56/112 (50%), Gaps = 0/112 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P     P+  + PA  ++P + N P+    P + ++P      +  
Sbjct  930   NQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVEAQPVVANQPAAEVQPVVA  989

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + PA+ ++P + N P+    P + ++P + + P+  + P + ++P + N P+
Sbjct  990   NQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPV  1041


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/110 (22%), Positives = 50/110 (45%), Gaps = 0/110 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  D P + ++P +   P+  + P    +P + N P     P + ++P      +  +
Sbjct  883  QPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVAN  942

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             PA  ++P + N P     P + ++P + + P+  + PA   +P + N P
Sbjct  943  QPAAEAQPVVANQPAAEAQPVVTNQPVVEAQPVVANQPAAEVQPVVANQP  992


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/119 (19%), Positives = 57/119 (48%), Gaps = 3/119 (3%)
 Frame = +1

Query  127  RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  306
            +P+T      P+    P + ++P + + P+  + P + ++P + N P+    P + ++P 
Sbjct  865  QPVT---EDQPVVETQPEVATQPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPA  921

Query  307  MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            +    +  + P   ++P + N P     P + ++P   + P+  + P + ++P + N P
Sbjct  922  VETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVEAQPVVANQP  980


 Score = 55.5 bits (132),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 24/110 (22%), Positives = 53/110 (48%), Gaps = 6/110 (5%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA+ ++P + N P+    P + ++P     P+    PA  ++P + N      
Sbjct  913   QPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTN------  966

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P + ++P + N P     P + ++P + + P+  + P + ++P + N P
Sbjct  967   QPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQP  1016



>ref|WP_009013731.1| TolA domain protein [Streptococcus sp. C300]
 gb|EFX56219.1| LPXTG-motif cell wall anchor domain protein [Streptococcus sp. 
C300]
Length=558

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 58/122 (48%), Gaps = 4/122 (3%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P++ + PA   +PT P  P++ ++P    +P  P  P + E+PA   +P  P   ++ 
Sbjct  173  ETPVQPEKPAQSEKPTQPEKPVQPETPTQPEKPAQPEKPAQPETPAQPEKPAEPEKPVQP  232

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN----GSP  498
            + P    +P  P  P + ++PA   +P  P  P++ + PA   +P  P  P+       P
Sbjct  233  EKPVQPEKPAQPEKPAQPETPAQPEQPAQPETPVQPEKPAQPEKPAQPEKPVQPEKPAQP  292

Query  499  EQ  504
            EQ
Sbjct  293  EQ  294


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 56/122 (46%), Gaps = 0/122 (0%)
 Frame = +1

Query  124  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
            A+P T +    P + + PA   +P  P  P + + PA    P  P +P++ E PA   +P
Sbjct  260  AQPETPVQPEKPAQPEKPAQPEKPVQPEKPAQPEQPAQPETPAQPENPVQPEKPAEPEKP  319

Query  304  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P    + ++PA   +P  P  P + + PA   +P  P  P + + PA   +PT P  P
Sbjct  320  AQPEKPAQPETPAQPEKPAQPETPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPEKP  379

Query  484  LN  489
              
Sbjct  380  AQ  381


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/113 (27%), Positives = 54/113 (48%), Gaps = 0/113 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P + + PA   +P  P  P++ + PA   +PT P  P++ E+P    +P  P    + 
Sbjct  155  EKPAQPEKPAQPEKPAQPETPVQPEKPAQSEKPTQPEKPVQPETPTQPEKPAQPEKPAQP  214

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
            ++PA   +P  P  P++ + P    +P  P  P + ++PA   +P  P  P+ 
Sbjct  215  ETPAQPEKPAEPEKPVQPEKPVQPEKPAQPEKPAQPETPAQPEQPAQPETPVQ  267


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 56/122 (46%), Gaps = 4/122 (3%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P + ++PA   +P  P  P + + PA   +P  P  P++ E PA   +PT P   ++ 
Sbjct  137  EKPAQPENPAQPEKPVQPEKPAQPEKPAQPEKPAQPETPVQPEKPAQSEKPTQPEKPVQP  196

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN----GSP  498
            ++P    +P  P  P + ++PA   +P  P  P++ + P    +P  P  P        P
Sbjct  197  ETPTQPEKPAQPEKPAQPETPAQPEKPAEPEKPVQPEKPVQPEKPAQPEKPAQPETPAQP  256

Query  499  EQ  504
            EQ
Sbjct  257  EQ  258


 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/113 (26%), Positives = 53/113 (47%), Gaps = 0/113 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P++ ++P    +P  P  P + ++PA   +P  P  P++ E P    +P  P    + 
Sbjct  191  EKPVQPETPTQPEKPAQPEKPAQPETPAQPEKPAEPEKPVQPEKPVQPEKPAQPEKPAQP  250

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
            ++PA   +P  P  P++ + PA   +P  P  P++ + PA   +P  P  P  
Sbjct  251  ETPAQPEQPAQPETPVQPEKPAQPEKPAQPEKPVQPEKPAQPEQPAQPETPAQ  303


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/113 (27%), Positives = 51/113 (45%), Gaps = 0/113 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P + ++PA   +P  P  P++ + PA   +P  P  P++ E PA   +P  P    + 
Sbjct  245  EKPAQPETPAQPEQPAQPETPVQPEKPAQPEKPAQPEKPVQPEKPAQPEQPAQPETPAQP  304

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
            ++P    +P  P  P + + PA    P  P  P + ++PA   +P  P  P  
Sbjct  305  ENPVQPEKPAEPEKPAQPEKPAQPETPAQPEKPAQPETPAQPEKPAQPEKPAQ  357


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/113 (26%), Positives = 52/113 (46%), Gaps = 0/113 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P + ++PA   +P  P  P++ + P    +P  P  P + E+PA   +P  P   ++ 
Sbjct  209  EKPAQPETPAQPEKPAEPEKPVQPEKPVQPEKPAQPEKPAQPETPAQPEQPAQPETPVQP  268

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
            + PA   +P  P  P++ + PA   +P  P  P + ++P    +P  P  P  
Sbjct  269  EKPAQPEKPAQPEKPVQPEKPAQPEQPAQPETPAQPENPVQPEKPAEPEKPAQ  321


 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/113 (26%), Positives = 50/113 (44%), Gaps = 0/113 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P++ + P    +P  P  P + ++PA   +P  P  P++ E PA   +P  P   ++ 
Sbjct  227  EKPVQPEKPVQPEKPAQPEKPAQPETPAQPEQPAQPETPVQPEKPAQPEKPAQPEKPVQP  286

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
            + PA   +P  P  P + ++P    +P  P  P + + PA    P  P  P  
Sbjct  287  EKPAQPEQPAQPETPAQPENPVQPEKPAEPEKPAQPEKPAQPETPAQPEKPAQ  339


 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 48/100 (48%), Gaps = 0/100 (0%)
 Frame = +1

Query  190  EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
            E   P  P + ++PA   +P  P  P + E PA   +P  P   ++ + PA   +PT P 
Sbjct  132  EAAQPEKPAQPENPAQPEKPVQPEKPAQPEKPAQPEKPAQPETPVQPEKPAQSEKPTQPE  191

Query  370  HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
             P++ ++P    +P  P  P + ++PA   +P  P  P+ 
Sbjct  192  KPVQPETPTQPEKPAQPEKPAQPETPAQPEKPAEPEKPVQ  231


 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 47/115 (41%), Gaps = 0/115 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P + + P    +P  P  P + ++PA    P  P  P + E PA   +P  P    + 
Sbjct  275  EKPAQPEKPVQPEKPAQPEQPAQPETPAQPENPVQPEKPAEPEKPAQPEKPAQPETPAQP  334

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  495
            + PA    P  P  P + + PA   +P  P  P + + P    +P  P  P+  S
Sbjct  335  EKPAQPETPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPEKPAQPEKPITSS  389


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 48/113 (42%), Gaps = 0/113 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P + + PA    P  P  P + + PA   +P  P  P + E PA    P  P   ++ 
Sbjct  251  ETPAQPEQPAQPETPVQPEKPAQPEKPAQPEKPVQPEKPAQPEQPAQPETPAQPENPVQP  310

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
            + PA   +P  P  P + ++PA   +P  P  P + + PA   +P  P  P  
Sbjct  311  EKPAEPEKPAQPEKPAQPETPAQPEKPAQPETPAQPEKPAQPEKPAQPEKPAQ  363


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 50/114 (44%), Gaps = 0/114 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P++ + PA   +P  P  P + ++P    +P  P  P + E PA    P  P    + 
Sbjct  281  EKPVQPEKPAQPEQPAQPETPAQPENPVQPEKPAEPEKPAQPEKPAQPETPAQPEKPAQP  340

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNG  492
            ++PA   +P  P  P + + PA   +P  P  P + + PA   +P   + P  G
Sbjct  341  ETPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPEKPAQPEKPITSSSPEEG  394


 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 49/122 (40%), Gaps = 0/122 (0%)
 Frame = +1

Query  124  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
            A+P T      P + + P    +P  P  P + + PA    P  P  P + E+P    +P
Sbjct  212  AQPETPAQPEKPAEPEKPVQPEKPVQPEKPAQPEKPAQPETPAQPEQPAQPETPVQPEKP  271

Query  304  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P    + + P    +P  P  P + ++PA    P  P  P + + PA   +P  P  P
Sbjct  272  AQPEKPAQPEKPVQPEKPAQPEQPAQPETPAQPENPVQPEKPAEPEKPAQPEKPAQPETP  331

Query  484  LN  489
              
Sbjct  332  AQ  333



>gb|EAR66038.1| cell wall-anchored protein [Bacillus sp. NRRL B-14911]
Length=200

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 56/107 (52%), Gaps = 6/107 (6%)
 Frame = -2

Query  460  PIALPENHTSK------DDLASSAPIALPENHTLKDDLASSAPIALPENHTSNDNLASSA  299
            P+AL      K      + LA  A +AL E+  L+  LA  A +AL E+    ++LA  A
Sbjct  29   PLALKAQLARKESKVLRESLALKAQLALKESKVLRGPLALKAQLALKESKVLRESLALKA  88

Query  298  PIALQEIHTLKDDLASSAPIALPENHTLKDDLASSAPIALQENHTLK  158
             +A +E   L++ LA  A +A  E+  L++ LA  A +A +E+  L+
Sbjct  89   QLARKESKVLREKLALKAQLARKESKVLRESLALKAQLARKESKVLR  135



>ref|WP_039490054.1| MULTISPECIES: ribonuclease [Pseudoalteromonas]
 gb|KHM46559.1| ribonuclease [Pseudoalteromonas flavipulchra NCIMB 2033 = ATCC 
BAA-314]
 gb|KID34166.1| ribonuclease [Pseudoalteromonas distincta]
Length=1073

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 44/110 (40%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+K   PA +  P     P K ++P    EP     P+  E PA +  P       K ++
Sbjct  865  PVKAKEPAKVETPVATEEPTKVEAPVATEEPAKAETPVATEEPAKVETPVATEEPAKVET  924

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P    EP     P+  + PA +  P     P K ++PA   EP     P+
Sbjct  925  PVATEEPAKVETPVATEEPAKVETPVATEEPAKVETPAATEEPAKAETPV  974


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 46/120 (38%), Gaps = 0/120 (0%)
 Frame = +1

Query  124  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
            A+  T +    P K ++P    EP     P+  + PA +  P     P K E+P    EP
Sbjct  872  AKVETPVATEEPTKVEAPVATEEPAKAETPVATEEPAKVETPVATEEPAKVETPVATEEP  931

Query  304  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
                  +  + PA +  P     P K ++PA   EP     P+  + P  +  P     P
Sbjct  932  AKVETPVATEEPAKVETPVATEEPAKVETPAATEEPAKAETPVATEEPTKVETPVATEEP  991


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 27/98 (28%), Positives = 40/98 (41%), Gaps = 0/98 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P K ++P    EP     P+  + PA +  P     P K E+P    EP      +  + 
Sbjct  895  PAKAETPVATEEPAKVETPVATEEPAKVETPVATEEPAKVETPVATEEPAKVETPVATEE  954

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPA  450
            PA +  P     P K ++P    EPT    P+  + PA
Sbjct  955  PAKVETPAATEEPAKAETPVATEEPTKVETPVATEEPA  992


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 38/100 (38%), Gaps = 0/100 (0%)
 Frame = +1

Query  184  LSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTM  363
            + EP     P K ++P    EPT    P+  E PA    P       K ++P    EP  
Sbjct  862  VEEPVKAKEPAKVETPVATEEPTKVEAPVATEEPAKAETPVATEEPAKVETPVATEEPAK  921

Query  364  PNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P+  + PA +  P     P K ++P    EP     P
Sbjct  922  VETPVATEEPAKVETPVATEEPAKVETPVATEEPAKVETP  961



>gb|KDA98464.1| cell wall anchor protein [Lactobacillus gasseri K7]
Length=1737

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 34/95 (36%), Positives = 40/95 (42%), Gaps = 6/95 (6%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             EPT P+ P +   P    EPT P  P++   P    EPT P        PA  SEPT P 
Sbjct  1562  EPTTPDKPTQPSKPTKPEEPTTPGKPVQPSEPTKPEEPTTPG------KPAQPSEPTKPE  1615

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
              P     PA  SEPT P      + P   +E   P
Sbjct  1616  EPTTPGKPAQPSEPTKPKEQTIPNKPNQSNETESP  1650


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 32/91 (35%), Positives = 36/91 (40%), Gaps = 12/91 (13%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P   D P   S+PT P  P     P   SEPT P  P     PA  SEPT P        
Sbjct  1563  PTTPDKPTQPSKPTKPEEPTTPGKPVQPSEPTKPEEPTTPGKPAQPSEPTKP--------  1614

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHP  429
                  EPT P  P +   P    E T+P+ P
Sbjct  1615  ----EEPTTPGKPAQPSEPTKPKEQTIPNKP  1641


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/84 (31%), Positives = 34/84 (40%), Gaps = 0/84 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P+       P +   P    EPT P  P++   P    EPT P  P +   P    EP
Sbjct  1558  AKPVEPTTPDKPTQPSKPTKPEEPTTPGKPVQPSEPTKPEEPTTPGKPAQPSEPTKPEEP  1617

Query  304   TMPNYHLKYDSPAMLSEPTMPNHP  375
             T P    +   P    E T+PN P
Sbjct  1618  TTPGKPAQPSEPTKPKEQTIPNKP  1641



>gb|AGL65247.2| Cell surface protein [Lactobacillus plantarum subsp. plantarum 
P-8]
Length=1377

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 29/112 (26%), Positives = 48/112 (43%), Gaps = 2/112 (2%)
 Frame = +1

Query  145   PNH--HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNY  318
             P H   P + + P    +P+ P  P   + P+   EP  P  P + E P    +P+ P  
Sbjct  1160  PGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEE  1219

Query  319   HLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
                 + P+   EP  P  P + + P    +P+ P  P + + P  L +P+ P
Sbjct  1220  PGHPEQPSQPEEPGHPEQPSQPEEPGQHEQPSQPEEPGQSEKPGELQKPSQP  1271


 Score = 58.2 bits (139),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 28/109 (26%), Positives = 46/109 (42%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + P+   EP  P  P + + P    +P+ P  P   E P+   EP  P    + + 
Sbjct  1136  PGQPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEE  1195

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             P    +P+ P  P   + P+   EP  P  P + + P    +P+ P  P
Sbjct  1196  PGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEP  1244


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 31/115 (27%), Positives = 49/115 (43%), Gaps = 8/115 (7%)
 Frame = +1

Query  160   LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSP  339
             +K + P    +P+ P  P   + P+   EP  P  P + E P    +P+ P      + P
Sbjct  1131  IKPEEPGQPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQP------EEP  1184

Query  340   AMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
                 +P+ P  P   + P+   EP  P  P + + P    +P+ P  P  G PEQ
Sbjct  1185  GHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEP--GHPEQ  1237


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 46/110 (42%), Gaps = 3/110 (3%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             HP   + P+   EP  P  P + + P    +P+ P  P   E P+   EP  P    + +
Sbjct  1150  HP---EQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPE  1206

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P    +P+ P  P   + P+   EP  P  P + + P    +P+ P  P
Sbjct  1207  EPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGQHEQPSQPEEP  1256


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/115 (25%), Positives = 48/115 (42%), Gaps = 2/115 (2%)
 Frame = +1

Query  145   PNH--HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNY  318
             P H   P + + P    +P+ P  P   + P+   EP  P  P + E P    +P+ P  
Sbjct  1148  PGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEE  1207

Query  319   HLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
                 + P+   EP  P  P + + P    +P+ P  P +++ P+   EP     P
Sbjct  1208  PGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGQHEQPSQPEEPGQSEKP  1262


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 28/103 (27%), Positives = 43/103 (42%), Gaps = 2/103 (2%)
 Frame = +1

Query  196   TMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHP  375
             T     +K + P    +P+ P  P   E P+   EP  P    + + P    +P+ P  P
Sbjct  1125  TYKKSAIKPEEPGQPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEP  1184

Query  376   LKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
                + P+   EP  P  P + + P    +P+ P  P  G PEQ
Sbjct  1185  GHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEP--GHPEQ  1225


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/108 (24%), Positives = 46/108 (43%), Gaps = 3/108 (3%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             HP   + P+   EP  P  P + + P    +P+ P  P   E P+   EP  P    + +
Sbjct  1174  HP---EQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPE  1230

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPN  477
              P    +P+ P  P +++ P+   EP     P +   P+  ++   P+
Sbjct  1231  EPGHPEQPSQPEEPGQHEQPSQPEEPGQSEKPGELQKPSQPADSEQPD  1278



>ref|XP_006659167.1| PREDICTED: uncharacterized protein LOC102702307 [Oryza brachyantha]
Length=331

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 56/124 (45%), Gaps = 3/124 (2%)
 Frame = +1

Query  124  ARPITMMPNHHP---LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAML  294
            A+P+     H P   +    P  L+ P   N P   + P M S+PT  N PL+   P  L
Sbjct  201  AQPMKTTTIHRPNSTITVTKPIGLNRPLQSNKPTGLNRPLMSSKPTGLNRPLQSNKPTGL  260

Query  295  SEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
            + P   N     + P   ++PT  N PL+ + P  L+ P M S P   + P   ++PT  
Sbjct  261  NRPLQSNKPTGLNRPLQSNKPTGLNRPLQSNKPTGLNRPLMSSKPTGLNRPMQSNKPTGQ  320

Query  475  NHPL  486
            N PL
Sbjct  321  NRPL  324


 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 53/119 (45%), Gaps = 0/119 (0%)
 Frame = +1

Query  127  RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  306
            RP + +    P+  + P   ++PT  N PL    P  L+ P   N P     P   ++PT
Sbjct  211  RPNSTITVTKPIGLNRPLQSNKPTGLNRPLMSSKPTGLNRPLQSNKPTGLNRPLQSNKPT  270

Query  307  MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              N  L+ + P  L+ P   N P   + P M S+PT  + P++ + P   + P   N P
Sbjct  271  GLNRPLQSNKPTGLNRPLQSNKPTGLNRPLMSSKPTGLNRPMQSNKPTGQNRPLQSNRP  329



>ref|WP_021032005.1| RNase E [Pseudoalteromonas arctica]
 gb|ERG11248.1| RNase E [Pseudoalteromonas arctica A 37-1-2]
Length=1082

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 52/120 (43%), Gaps = 0/120 (0%)
 Frame = +1

Query  124  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
            A+  T +    P K ++P +  EP     P+  + PA +  P +   P K E+P +  EP
Sbjct  869  AKVETPVATEEPAKVETPVVTEEPAKVEAPVATEEPAKVETPVVTEEPAKVETPVVTEEP  928

Query  304  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
                  +  + PA +  P +   P K ++P +  EP     P+  + PA +  P +   P
Sbjct  929  AKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEP  988


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 51/120 (43%), Gaps = 0/120 (0%)
 Frame = +1

Query  124  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
            A+  T +    P K ++P    EP     P+  + PA +  P +   P K E+P +  EP
Sbjct  881  AKVETPVVTEEPAKVEAPVATEEPAKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEP  940

Query  304  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
                  +  + PA +  P +   P K ++P +  EP     P+  + PA +  P +   P
Sbjct  941  AKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEP  1000


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 28/110 (25%), Positives = 48/110 (44%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + PA +  P     P K ++P +  EP     P+  E PA +  P +     K ++
Sbjct  886  PVVTEEPAKVEAPVATEEPAKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEPAKVET  945

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P +  EP     P+  + PA +  P +   P K ++P +  EP     P+
Sbjct  946  PVVTEEPAKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEPAKVETPV  995


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 28/109 (26%), Positives = 46/109 (42%), Gaps = 0/109 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P K ++P    EP     P+  + PA +  P     P K E+P +  EP      +  + 
Sbjct  868  PAKVETPVATEEPAKVETPVVTEEPAKVEAPVATEEPAKVETPVVTEEPAKVETPVVTEE  927

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            PA +  P +   P K ++P +  EP     P+  + PA +  P +   P
Sbjct  928  PAKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEP  976


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 46/106 (43%), Gaps = 0/106 (0%)
 Frame = +1

Query  169  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
            + PA +  P     P K ++P +  EP     P+  E PA +  P +     K ++P + 
Sbjct  866  EEPAKVETPVATEEPAKVETPVVTEEPAKVEAPVATEEPAKVETPVVTEEPAKVETPVVT  925

Query  349  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             EP     P+  + PA +  P +   P K ++P +  EP     P+
Sbjct  926  EEPAKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEPAKVETPV  971


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/100 (25%), Positives = 42/100 (42%), Gaps = 0/100 (0%)
 Frame = +1

Query  184  LSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTM  363
            + EP     P+  + PA +  P +   P K E+P    EP      +  + PA +  P +
Sbjct  865  VEEPAKVETPVATEEPAKVETPVVTEEPAKVEAPVATEEPAKVETPVVTEEPAKVETPVV  924

Query  364  PNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P K ++P +  EP     P+  + PA +  P +   P
Sbjct  925  TEEPAKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEP  964


 Score = 48.9 bits (115),  Expect = 0.001, Method: Composition-based stats.
 Identities = 27/109 (25%), Positives = 47/109 (43%), Gaps = 0/109 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+  T +    P K ++P +  EP     P+  + PA +  P +   P K E+P +  EP
Sbjct  905   AKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEP  964

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPA  450
                   +  + PA +  P +   P K ++P +  EP      +K +  A
Sbjct  965   AKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEPAKVEAKVKTEKSA  1013



>gb|EHJ52010.1| agglutinin receptor [Streptococcus macacae NCTC 11558]
Length=1153

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 33/109 (30%), Positives = 50/109 (46%), Gaps = 3/109 (3%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            PLK  +P   +EP  P  P +  +P   +EP  P  P + E+P   +EP  P    + ++
Sbjct  636  PLKPVAPTAPTEPVAPTAPTEPVAPTAPTEPVAPTAPTEPEAPTAPTEPVAPTAPTEPEA  695

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            P   +EP  P  P +  +P   +EP  P  PL   +P    +P  P  P
Sbjct  696  PTAPTEPVAPTAPTEPVAPTAPTEPVAPIEPL---APERAVDPEPPVAP  741


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 30/98 (31%), Positives = 49/98 (50%), Gaps = 2/98 (2%)
 Frame = +1

Query  211  PLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDS  390
            PLK  +P   +EP  P  P +  +P   +EP  P    + ++P   +EP  P  P + ++
Sbjct  636  PLKPVAPTAPTEPVAPTAPTEPVAPTAPTEPVAPTAPTEPEAPTAPTEPVAPTAPTEPEA  695

Query  391  PAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
            P   +EP  P+ P +  +P   +EP  P  PL  +PE+
Sbjct  696  PTAPTEPVAPTAPTEPVAPTAPTEPVAPIEPL--APER  731



>ref|WP_001083114.1| alpha-L-fucosidase [Streptococcus oralis]
 gb|EFU64233.1| Gram-positive signal peptide protein, YSIRK family [Streptococcus 
oralis ATCC 49296]
Length=2041

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/101 (28%), Positives = 44/101 (44%), Gaps = 6/101 (6%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             E   P  P + ++PA   +P  P  P + E+PA    P  P      + PA   +P  P 
Sbjct  1671  EAAQPEKPARPETPAQPEKPAQPEKPAQPETPAQPETPAQP------EQPAQPEKPAQPE  1724

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNG  492
              P + ++PA   +P  P  P + + PA   +P   + P  G
Sbjct  1725  TPAQPETPAQPEQPAQPEQPAQPEKPAQPEKPITSSSPEEG  1765


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/90 (29%), Positives = 40/90 (44%), Gaps = 0/90 (0%)
 Frame = +1

Query  178   AMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEP  357
             A   +P  P  P + + PA   +P  P  P + E+PA   +P  P    + ++PA    P
Sbjct  1673  AQPEKPARPETPAQPEKPAQPEKPAQPETPAQPETPAQPEQPAQPEKPAQPETPAQPETP  1732

Query  358   TMPNHPLKYDSPAMLSEPTMPSHPLKYDSP  447
               P  P + + PA   +P  P  P+   SP
Sbjct  1733  AQPEQPAQPEQPAQPEKPAQPEKPITSSSP  1762


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/91 (29%), Positives = 40/91 (44%), Gaps = 6/91 (7%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + ++PA   +P  P  P + ++PA    P  P  P + E PA    P  P      ++
Sbjct  1678  PARPETPAQPEKPAQPEKPAQPETPAQPETPAQPEQPAQPEKPAQPETPAQP------ET  1731

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHP  429
             PA   +P  P  P + + PA   +P   S P
Sbjct  1732  PAQPEQPAQPEQPAQPEKPAQPEKPITSSSP  1762



>gb|KFY94434.1| hypothetical protein V500_03260 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=1850

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 49/105 (47%), Gaps = 14/105 (13%)
 Frame = +1

Query  163   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPA--MLSEPTMPNYHLKYDS  336
             K++ P ++ EP     P K + PA+  EPT      K E PA  ++ EPT      K + 
Sbjct  1544  KFEEPVVVDEPAAVEEPTKVEEPAVAEEPT------KVEEPAADVVEEPT------KVEE  1591

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  471
             PA ++EP     P   + P  + EPT    P K + P  + EPT 
Sbjct  1592  PAAVAEPIKAAEPAVVEEPTKVEEPTKVEEPTKVEEPVAVEEPTA  1636



>ref|WP_024593398.1| ribonuclease [Pseudoalteromonas haloplanktis]
Length=1070

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/109 (26%), Positives = 47/109 (43%), Gaps = 0/109 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P K ++P +  EP     P+  + PA +  P     P K E+P +  EP      +  + 
Sbjct  868  PAKVETPVVTEEPAKVEAPVATEEPAKVETPVATEEPAKVETPVVTEEPAKVEAPVATEE  927

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            PA +  P +   P K ++P +  EP     P+  + PA +  P +   P
Sbjct  928  PAKVETPVVTEEPTKVEAPVVTEEPAKVEAPVVTEEPAKVETPVVTEEP  976


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 47/110 (43%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + PA +  P     P K ++P    EP     P+  E PA +  P       K ++
Sbjct  874  PVVTEEPAKVEAPVATEEPAKVETPVATEEPAKVETPVVTEEPAKVEAPVATEEPAKVET  933

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P +  EPT    P+  + PA +  P +   P K ++P +  EP     P+
Sbjct  934  PVVTEEPTKVEAPVVTEEPAKVEAPVVTEEPAKVETPVVTEEPAKVETPV  983


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 27/103 (26%), Positives = 46/103 (45%), Gaps = 0/103 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + PA +  P     P K ++P +  EP     P+  E PA +  P +     K ++
Sbjct  886  PVATEEPAKVETPVATEEPAKVETPVVTEEPAKVEAPVATEEPAKVETPVVTEEPTKVEA  945

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  465
            P +  EP     P+  + PA +  P +   P K ++P +  EP
Sbjct  946  PVVTEEPAKVEAPVVTEEPAKVETPVVTEEPAKVETPVVTEEP  988


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/100 (26%), Positives = 41/100 (41%), Gaps = 0/100 (0%)
 Frame = +1

Query  184  LSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTM  363
            + EP     P+  + PA +  P     P K E+P    EP      +  + PA +  P  
Sbjct  865  VEEPAKVETPVVTEEPAKVEAPVATEEPAKVETPVATEEPAKVETPVVTEEPAKVEAPVA  924

Query  364  PNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               P K ++P +  EPT    P+  + PA +  P +   P
Sbjct  925  TEEPAKVETPVVTEEPTKVEAPVVTEEPAKVEAPVVTEEP  964


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 27/109 (25%), Positives = 47/109 (43%), Gaps = 0/109 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+  T +    P K ++P +  EP     P+  + PA +  P +   P K E+P +  EP
Sbjct  893   AKVETPVATEEPAKVETPVVTEEPAKVEAPVATEEPAKVETPVVTEEPTKVEAPVVTEEP  952

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPA  450
                   +  + PA +  P +   P K ++P +  EP      +K +  A
Sbjct  953   AKVEAPVVTEEPAKVETPVVTEEPAKVETPVVTEEPAKVEAKVKTEKSA  1001


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 40/92 (43%), Gaps = 0/92 (0%)
 Frame = +1

Query  211  PLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDS  390
            P K ++P +  EP     P+  E PA +  P       K ++P +  EP     P+  + 
Sbjct  868  PAKVETPVVTEEPAKVEAPVATEEPAKVETPVATEEPAKVETPVVTEEPAKVEAPVATEE  927

Query  391  PAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            PA +  P +   P K ++P +  EP     P+
Sbjct  928  PAKVETPVVTEEPTKVEAPVVTEEPAKVEAPV  959



>ref|WP_039145306.1| hypothetical protein, partial [Gallibacterium anatis]
 gb|KGQ41732.1| hypothetical protein JP30_03940, partial [Gallibacterium anatis 
IPDH697-78]
Length=660

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/110 (22%), Positives = 55/110 (50%), Gaps = 0/110 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + P + ++P + N P     P + ++P +   P+    PA  ++P + N  +  +
Sbjct  7    QPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVIANQPAAETQPVVANQPVVTN  66

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             PA+ ++P + N P+    P + ++P + + P+    P + ++P + N P
Sbjct  67   QPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVIANQP  116


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/112 (21%), Positives = 57/112 (51%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
            + P+  + PA+ ++P + N P+    P + ++P +   P+    P + ++P + N     
Sbjct  60   NQPVVTNQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVIANQPAAE  119

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P + N P+    P + ++P + + P+  + P + ++P + N P+
Sbjct  120  TQPVVANQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVVETQPVVTNQPV  171


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + PA  ++P + N P+  + PA+ ++P + N P+    P + ++P +    +   
Sbjct  43   QPVIANQPAAETQPVVANQPVVTNQPAVETQPVVANQPVVETQPVVANQPAVETQPVVAT  102

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P + ++P + N P     P + ++P + + P+    P + ++P +   P+
Sbjct  103  QPVVETQPVIANQPAAETQPVVANQPVVTNQPVAEVQPVVANQPAVETQPV  153


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/112 (21%), Positives = 54/112 (48%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
            + P     P + ++P +   P+  + PA  ++P + N P+    PA+ ++P + N  +  
Sbjct  24   NQPAVETQPVVATQPVVETQPVIANQPAAETQPVVANQPVVTNQPAVETQPVVANQPVVE  83

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P +   P+    P + ++P + + P     P + ++P + N P+
Sbjct  84   TQPVVANQPAVETQPVVATQPVVETQPVIANQPAAETQPVVANQPVVTNQPV  135


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 52/104 (50%), Gaps = 0/104 (0%)
 Frame = +1

Query  175  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  354
            PA+ ++P + N P+    P + ++P +   P+    P + ++P + N       P + ++
Sbjct  2    PAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVIANQPAAETQPVVANQ  61

Query  355  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P + N P     P + ++P + + P+  + PA+ ++P +   P+
Sbjct  62   PVVTNQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPV  105


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 51/111 (46%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + P + ++P + N P     P + ++P +   P+    PA  ++P + N  +  +
Sbjct  73   QPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVIANQPAAETQPVVANQPVVTN  132

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P    +P + N P     P + ++P + + P+  + P    +P + N P+
Sbjct  133  QPVAEVQPVVANQPAVETQPVVANQPVVETQPVVTNQPVAEVQPVVANQPV  183


 Score = 52.4 bits (124),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+    P + ++P + N P     P + ++P + N P+    P + ++P +    +  +
Sbjct  97   QPVVATQPVVETQPVIANQPAAETQPVVANQPVVTNQPVAEVQPVVANQPAVETQPVVAN  156

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P + ++P + N P+    P + ++P + + P+    P   ++P + + P+
Sbjct  157  QPVVETQPVVTNQPVAEVQPVVANQPVVETQPVAETQPVAETQPVVEDQPV  207


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + P + ++P +   P+  + P + ++P + N P     P + ++P +    +  +
Sbjct  55   QPVVANQPVVTNQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVIAN  114

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             PA  ++P + N P+  + P    +P + + P     P + ++P +   P+
Sbjct  115  QPAAETQPVVANQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVVETQPV  165


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 51/111 (46%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+    P + ++P + N P     P + ++P + N P     P + ++P +    +  +
Sbjct  31   QPVVATQPVVETQPVIANQPAAETQPVVANQPVVTNQPAVETQPVVANQPVVETQPVVAN  90

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             PA+ ++P +   P+    P + ++P   + P+  + P + ++P     P+
Sbjct  91   QPAVETQPVVATQPVVETQPVIANQPAAETQPVVANQPVVTNQPVAEVQPV  141


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 51/111 (46%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + PA+ ++P +   P+    P + ++P     P+    P + ++P      +  +
Sbjct  85   QPVVANQPAVETQPVVATQPVVETQPVIANQPAAETQPVVANQPVVTNQPVAEVQPVVAN  144

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             PA+ ++P + N P+    P + ++P     P+  + P + ++P     P+
Sbjct  145  QPAVETQPVVANQPVVETQPVVTNQPVAEVQPVVANQPVVETQPVAETQPV  195



>ref|WP_014567818.1| mucin binding protein [Lactobacillus johnsonii]
 gb|AEB93885.1| putative mucin binding protein [Lactobacillus johnsonii DPC 6026]
Length=1534

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 39/121 (32%), Positives = 48/121 (40%), Gaps = 0/121 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A P+       P K   P    +PT P  P+K   P    EPT P  P K   P    EP
Sbjct  1324  AEPVQPTKPVEPTKPVQPTKPVKPTKPVQPIKPVKPTKPVEPTKPVKPTKPVEPTKPVEP  1383

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             T P    K   P    +PT P  P K   P    EPT P  P++   P   ++P  P  P
Sbjct  1384  TKPVEPTKPVEPTKPVQPTKPVEPTKPVQPTKPVEPTKPVEPVQPTKPIEPTKPVQPTKP  1443

Query  484   L  486
             +
Sbjct  1444  V  1444


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 46/120 (38%), Gaps = 0/120 (0%)
 Frame = +1

Query  127   RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  306
             +P+       P K   P    +P  P  P K   P    +PT P  P K   P    EPT
Sbjct  1331  KPVEPTKPVQPTKPVKPTKPVQPIKPVKPTKPVEPTKPVKPTKPVEPTKPVEPTKPVEPT  1390

Query  307   MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P    K   P    EPT P  P K   P    EP  P+ P++   P   ++P  P  P+
Sbjct  1391  KPVEPTKPVQPTKPVEPTKPVQPTKPVEPTKPVEPVQPTKPIEPTKPVQPTKPVEPTKPV  1450



>ref|WP_000300356.1| hypothetical protein, partial [Streptococcus sp. GMD4S]
 gb|EKA08052.1| cell wall surface anchor family protein, partial [Streptococcus 
sp. GMD4S]
Length=441

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P++ ++P    +P  P +P++ + PA   +PT P  P + E PA   +PT P    + 
Sbjct  152  EKPVQPENPTQPEKPAQPENPVQPEKPAQPEKPTQPETPAQPEKPAQPEQPTQPETPAQP  211

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            + PA   +PT P  P + + PA    P  P  P + + PA    PT P  P
Sbjct  212  EKPAQPEKPTQPETPAQPEKPAQPETPAQPEKPAQPEKPAQPENPTQPETP  262


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 56/114 (49%), Gaps = 6/114 (5%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             +P++ + PA   +PT P  P + + PA   +PT P  P + E PA   +PT P      
Sbjct  170  ENPVQPEKPAQPEKPTQPETPAQPEKPAQPEQPTQPETPAQPEKPAQPEKPTQP------  223

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNG  492
            ++PA   +P  P  P + + PA   +P  P +P + ++PA   +P   + P  G
Sbjct  224  ETPAQPEKPAQPETPAQPEKPAQPEKPAQPENPTQPETPAQPEKPITSSSPEEG  277



>gb|EPD62247.1| hypothetical protein HMPREF1211_03881 [Streptomyces sp. HGB0020]
Length=563

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 58/94 (62%), Gaps = 0/94 (0%)
 Frame = +1

Query  190  EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
            +P  P  P   D PA+  +P  P HP K + PA  ++P MP + +K D P+   +P MP+
Sbjct  467  KPAYPEKPAHPDKPALPMKPDYPAHPAKPDYPAHPAKPDMPAHPMKPDMPSHPMKPDMPS  526

Query  370  HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  471
            HP+K D P+   +P MPSHP+K D+P+  S+P+M
Sbjct  527  HPMKPDMPSHPMKPDMPSHPMKPDTPSHPSKPSM  560


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = +1

Query  169  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
            D PA+  +P  P HP K D PA  ++P MP HP+K + P+   +P MP++ +K D P+  
Sbjct  478  DKPALPMKPDYPAHPAKPDYPAHPAKPDMPAHPMKPDMPSHPMKPDMPSHPMKPDMPSHP  537

Query  349  SEPTMPNHPLKYDSPAMLSEPTM  417
             +P MP+HP+K D+P+  S+P+M
Sbjct  538  MKPDMPSHPMKPDTPSHPSKPSM  560


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 63/132 (48%), Gaps = 21/132 (16%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY--  330
            P K + PAM ++P  P +P K   PA  + P  P  P K E PA  ++P  P Y  K   
Sbjct  399  PAKPEKPAMPAKPVKPAYPEKPAMPAKPAYPEKPAMPAKPEKPAYPAKPEKPAYPEKPAA  458

Query  331  -------------------DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAM  453
                               D PA+  +P  P HP K D PA  ++P MP+HP+K D P+ 
Sbjct  459  PAYPAHPVKPAYPEKPAHPDKPALPMKPDYPAHPAKPDYPAHPAKPDMPAHPMKPDMPSH  518

Query  454  LSEPTMPNHPLN  489
              +P MP+HP+ 
Sbjct  519  PMKPDMPSHPMK  530


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 62/119 (52%), Gaps = 12/119 (10%)
 Frame = +1

Query  169  DSPAMLSEPTMPNHPLKYDSPA------------MLSEPTMPNHPLKYESPAMLSEPTMP  312
            + PAM ++P  P +P K + PA               +P  P  P   + PA+  +P  P
Sbjct  430  EKPAMPAKPEKPAYPAKPEKPAYPEKPAAPAYPAHPVKPAYPEKPAHPDKPALPMKPDYP  489

Query  313  NYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
             +  K D PA  ++P MP HP+K D P+   +P MPSHP+K D P+   +P MP+HP+ 
Sbjct  490  AHPAKPDYPAHPAKPDMPAHPMKPDMPSHPMKPDMPSHPMKPDMPSHPMKPDMPSHPMK  548


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 61/132 (46%), Gaps = 21/132 (16%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPA----------------  288
            P K   PA   +P MP  P   + PAM ++P  P +P K E PA                
Sbjct  408  PAKPVKPAYPEKPAMPAKPAYPEKPAMPAKPEKPAYPAKPEKPAYPEKPAAPAYPAHPVK  467

Query  289  -----MLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAM  453
                   + P  P   +K D PA  ++P  P HP K D PA   +P MPSHP+K D P+ 
Sbjct  468  PAYPEKPAHPDKPALPMKPDYPAHPAKPDYPAHPAKPDMPAHPMKPDMPSHPMKPDMPSH  527

Query  454  LSEPTMPNHPLN  489
              +P MP+HP+ 
Sbjct  528  PMKPDMPSHPMK  539



>ref|WP_004897948.1| mucin binding protein [Lactobacillus johnsonii]
 gb|EGP12982.1| internalin, putative [Lactobacillus johnsonii pf01]
Length=1534

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 39/121 (32%), Positives = 48/121 (40%), Gaps = 0/121 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A P+       P K   P    +PT P  P+K   P    EPT P  P K   P    EP
Sbjct  1324  AEPVQPTKPVEPTKPVQPTKPVKPTKPVQPIKPVKPTKPVEPTKPVKPTKPVEPTKPVEP  1383

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             T P    K   P    +PT P  P K   P    EPT P  P++   P   ++P  P  P
Sbjct  1384  TKPVEPTKPVEPTKPVQPTKPVEPTKPVQPTKPVEPTKPVEPVQPTKPIEPTKPVQPTKP  1443

Query  484   L  486
             +
Sbjct  1444  V  1444


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 46/120 (38%), Gaps = 0/120 (0%)
 Frame = +1

Query  127   RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  306
             +P+       P K   P    +P  P  P K   P    +PT P  P K   P    EPT
Sbjct  1331  KPVEPTKPVQPTKPVKPTKPVQPIKPVKPTKPVEPTKPVKPTKPVEPTKPVEPTKPVEPT  1390

Query  307   MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P    K   P    EPT P  P K   P    EP  P+ P++   P   ++P  P  P+
Sbjct  1391  KPVEPTKPVQPTKPVEPTKPVQPTKPVEPTKPVEPVQPTKPIEPTKPVQPTKPVEPTKPV  1450



>ref|WP_039085890.1| hypothetical protein, partial [Gallibacterium anatis]
 gb|KGQ45061.1| hypothetical protein JP28_02600, partial [Gallibacterium anatis]
Length=832

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/111 (23%), Positives = 57/111 (51%), Gaps = 6/111 (5%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + P   ++P + N P+  D P + ++P +   P+    PA+ ++P + N      
Sbjct  263  QPVVANQPVAETQPVVANQPVVEDQPVVANQPAVETQPVVANQPAIETQPVVAN------  316

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P + ++P + N P+  D P + ++P   + P+  + PA+ ++P + N P+
Sbjct  317  QPVVETQPVVANQPVVEDQPVVANQPAAKTQPVVANQPAVETQPVVANQPV  367


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 26/110 (24%), Positives = 57/110 (52%), Gaps = 6/110 (5%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + PA+ ++P + N P+    P + ++P + + P+    PA+ ++P + N      
Sbjct  251  QPVVANQPAVETQPVVANQPVAETQPVVANQPVVEDQPVVANQPAVETQPVVAN------  304

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             PA+ ++P + N P+    P + ++P +   P+  + PA  ++P + N P
Sbjct  305  QPAIETQPVVANQPVVETQPVVANQPVVEDQPVVANQPAAKTQPVVANQP  354


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/112 (21%), Positives = 57/112 (51%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
            + P+    P + ++P +   P+  + P   ++P + N P+    P + ++P +    +  
Sbjct  208  NQPVVETQPEVANQPAVETQPVVANQPVAETQPMVANQPVAEVQPVVANQPAVETQPVVA  267

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            + P   ++P + N P+  D P + ++P + + P+  + PA+ ++P + N P+
Sbjct  268  NQPVAETQPVVANQPVVEDQPVVANQPAVETQPVVANQPAIETQPVVANQPV  319


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 56/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
            + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P + +  +  
Sbjct  232  NQPVAETQPMVANQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPVVEDQPVVA  291

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            + PA+ ++P + N P     P + ++P + + P+  + P +  +P + N P
Sbjct  292  NQPAVETQPVVANQPAIETQPVVANQPVVETQPVVANQPVVEDQPVVANQP  342


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  175  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  354
            P + ++P +   P   + PA+ ++P + N P+    P + ++P      +  + PA+ ++
Sbjct  204  PVVANQPVVETQPEVANQPAVETQPVVANQPVAETQPMVANQPVAEVQPVVANQPAVETQ  263

Query  355  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            P + N P+    P + ++P +   P+  + PA+ ++P + N P
Sbjct  264  PVVANQPVAETQPVVANQPVVEDQPVVANQPAVETQPVVANQP  306


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + P   ++P + N P+    P + ++P +   P+    P   ++P + N  +  D
Sbjct  227  QPVVANQPVAETQPMVANQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPVVED  286

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P + ++P +   P+  + PA+ ++P + + P+    P + ++P + + P+
Sbjct  287  QPVVANQPAVETQPVVANQPAIETQPVVANQPVVETQPVVANQPVVEDQPV  337


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 56/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + PA+ ++P + N P+    P + ++P +   P+    P + ++P + N  +  +
Sbjct  125  QPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVAN  184

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P + ++P + N       P + ++P + + P   + PA+ ++P + N P+
Sbjct  185  QPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQPAVETQPVVANQPV  235


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/110 (20%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + P + ++P + N P+    P + ++P +   P+    P + ++P + N  +   
Sbjct  47   QPVVANQPVVETQPVVTNQPVVETQPVVANQPVVEAQPVVTNQPVVETQPVVTNQPVVET  106

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             P + ++P + N P     P + ++P + + P+  + P + ++P + N P
Sbjct  107  QPEVATQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQP  156


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/106 (21%), Positives = 52/106 (49%), Gaps = 0/106 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + P +  +P + N P     P + ++P +   P+    P + ++P + N  +  D
Sbjct  275  QPVVANQPVVEDQPVVANQPAVETQPVVANQPAIETQPVVANQPVVETQPVVANQPVVED  334

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  471
             P + ++P     P+  + PA+ ++P + + P+  D P + ++P +
Sbjct  335  QPVVANQPAAKTQPVVANQPAVETQPVVANQPVVEDQPEVATQPVV  380


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + P + ++P + N P+  + P + ++P + N       P + ++P +       +
Sbjct  161  QPVVANQPVVEAQPVVTNQPVVANQPVVETQPVVANQLAAETQPVVANQPVVETQPEVAN  220

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             PA+ ++P + N P+    P + ++P     P+  + PA+ ++P + N P+
Sbjct  221  QPAVETQPVVANQPVAETQPMVANQPVAEVQPVVANQPAVETQPVVANQPV  271


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+    PA+ ++P + N P+    P + ++P +   P+    P + ++P + N  +   
Sbjct  35   QPVAETQPAVEAQPVVANQPVVETQPVVTNQPVVETQPVVANQPVVEAQPVVTNQPVVET  94

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P + ++P +   P     P + ++P     P+  + PA+ ++P + N P+
Sbjct  95   QPVVTNQPVVETQPEVATQPVVANQPAAEVQPVVANQPAVEAQPVVANQPV  145


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + P + ++P + N P+    P + ++P +   P+    P + ++P +    +  +
Sbjct  59   QPVVTNQPVVETQPVVANQPVVEAQPVVTNQPVVETQPVVTNQPVVETQPEVATQPVVAN  118

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             PA   +P + N P     P + ++P + + P   + PA+ ++P + N P+
Sbjct  119  QPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPV  169


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/112 (19%), Positives = 54/112 (48%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
            + P+    P + ++P + + P+  + PA+ ++P + N P     P + ++P +    +  
Sbjct  268  NQPVAETQPVVANQPVVEDQPVVANQPAVETQPVVANQPAIETQPVVANQPVVETQPVVA  327

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            + P +  +P + N P     P + ++P + + P+  + P +  +P +   P+
Sbjct  328  NQPVVEDQPVVANQPAAKTQPVVANQPAVETQPVVANQPVVEDQPEVATQPV  379


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + P + ++P + N P+    P + ++P +   P     P + ++P      +  +
Sbjct  71   QPVVANQPVVEAQPVVTNQPVVETQPVVTNQPVVETQPEVATQPVVANQPAAEVQPVVAN  130

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             PA+ ++P + N P+    P + ++P + + P+  + P + ++P + N P+
Sbjct  131  QPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPV  181


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + PA+ ++P +   P+    PA+ ++P + N P+    P + ++P +    +  +
Sbjct  17   QPVVANQPAVETQPVVATQPVAETQPAVEAQPVVANQPVVETQPVVTNQPVVETQPVVAN  76

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P + ++P + N P+    P + ++P + + P     P + ++P     P+
Sbjct  77   QPVVEAQPVVTNQPVVETQPVVTNQPVVETQPEVATQPVVANQPAAEVQPV  127


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + P + ++P + N P+    P + ++P + N P     P + ++P +    +  +
Sbjct  83   QPVVTNQPVVETQPVVTNQPVVETQPEVATQPVVANQPAAEVQPVVANQPAVEAQPVVAN  142

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P + ++P + N P     P + ++P + + P+  + P + ++P +   P+
Sbjct  143  QPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVANQPVVETQPV  193


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 54/104 (52%), Gaps = 6/104 (6%)
 Frame = +1

Query  175  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  354
            P + ++P +   P+  + PA+ ++P +   P+    PA+ ++P + N       P + ++
Sbjct  6    PVVANQPVVETQPVVANQPAVETQPVVATQPVAETQPAVEAQPVVAN------QPVVETQ  59

Query  355  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P + N P+    P + ++P + + P+  + P + ++P + N P+
Sbjct  60   PVVTNQPVVETQPVVANQPVVEAQPVVTNQPVVETQPVVTNQPV  103


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + P + ++P +   P+  +  A  ++P + N P+    P + ++P +    +  +
Sbjct  173  QPVVTNQPVVANQPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQPAVETQPVVAN  232

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P   ++P + N P+    P + ++P + + P+  + P   ++P + N P+
Sbjct  233  QPVAETQPMVANQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPV  283



>ref|WP_025288912.1| hypothetical protein [Bibersteinia trehalosi]
Length=2322

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 39/141 (28%), Positives = 53/141 (38%), Gaps = 25/141 (18%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD-  333
            P +  +P   SEP  P+ P +   P   SEP  P+ P +   P   SEP  P+   +   
Sbjct  194  PEQPTAPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPTT  253

Query  334  -----------------------SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDS  444
                                   +P   SEP  P  P +   P   +EP  P+ P +   
Sbjct  254  PEQPPEPEQPSEPEQPSEPEQPTAPEQPSEPEQPTEPEQPSEPEQPTEPEQPTEPEQPSE  313

Query  445  PAMLSEPTMPNHPLNGS-PEQ  504
            P   SEP  P+ P   S PEQ
Sbjct  314  PEQPSEPEQPSEPEQPSEPEQ  334


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 33/141 (23%), Positives = 53/141 (38%), Gaps = 28/141 (20%)
 Frame = +1

Query  166  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAM  345
            YD P    +P+ P  P + + P    +P+ P  P + E P+   +P+ P    + + P+ 
Sbjct  176  YDQPIEPEQPSEPEQPTEPEQPTAPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSE  235

Query  346  LSEPTMPNHP---------------------------LKYDSPAMLSEPTMPSHPLKYDS  444
              +P+ P  P                            +  +P   SEP  P+ P +   
Sbjct  236  PEQPSEPEQPSEPEQPTTPEQPPEPEQPSEPEQPSEPEQPTAPEQPSEPEQPTEPEQPSE  295

Query  445  PAMLSEPTMPNHPLNGS-PEQ  504
            P   +EP  P  P   S PEQ
Sbjct  296  PEQPTEPEQPTEPEQPSEPEQ  316


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 35/139 (25%), Positives = 48/139 (35%), Gaps = 30/139 (22%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNH------------------------  264
            P +   P   SEP  P+ P +   P   SEP  P+                         
Sbjct  212  PEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPTTPEQPPEPEQPSEPEQPSE  271

Query  265  ------PLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSH  426
                  P +   P   +EP  P+   +   P   +EP  P+ P +   P   SEP  PS 
Sbjct  272  PEQPTAPEQPSEPEQPTEPEQPSEPEQPTEPEQPTEPEQPSEPEQPSEPEQPSEPEQPSE  331

Query  427  PLKYDSPAMLSEPTMPNHP  483
            P +  +P   SEP  P  P
Sbjct  332  PEQPTAPGQPSEPEQPTEP  350


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 41/147 (28%), Positives = 50/147 (34%), Gaps = 31/147 (21%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSE------------  300
            P +   P   SEP  P+ P +   P   SEP  P+ P +   P   SE            
Sbjct  200  PEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPTTPEQPPE  259

Query  301  ------------------PTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSH  426
                              P  P+   +   P   SEP  P  P +   P   SEP  PS 
Sbjct  260  PEQPSEPEQPSEPEQPTAPEQPSEPEQPTEPEQPSEPEQPTEPEQPTEPEQPSEPEQPSE  319

Query  427  PLKYDSPAMLSEPTMPNHPLNGS-PEQ  504
            P +   P   SEP  P  P   S PEQ
Sbjct  320  PEQPSEPEQPSEPEQPTAPGQPSEPEQ  346



>ref|WP_024002328.1| cell surface protein precursor [Lactobacillus plantarum]
 gb|ETF12868.1| cell surface protein precursor [Lactobacillus plantarum 4_3]
Length=1357

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 3/95 (3%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             +P  P HP   + P+   EP  P  P + E P    +P+ P    + + P+   EP  P 
Sbjct  1160  KPEEPGHP---EQPSQPEEPGQPEQPSQPEEPGHPEQPSQPEEPGQPEQPSQPEEPGHPE  1216

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
              P + + P    +P+ P  P + + P  L +P+ P
Sbjct  1217  QPSQPEEPGQHEQPSQPEEPGQSEKPGELQKPSQP  1251


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 24/90 (27%), Positives = 41/90 (46%), Gaps = 3/90 (3%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             HP   + P+   EP  P  P + + P    +P+ P  P + E P+   EP  P    + +
Sbjct  1166  HP---EQPSQPEEPGQPEQPSQPEEPGHPEQPSQPEEPGQPEQPSQPEEPGHPEQPSQPE  1222

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPS  423
              P    +P+ P  P + + P  L +P+ P+
Sbjct  1223  EPGQHEQPSQPEEPGQSEKPGELQKPSQPA  1252


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 24/106 (23%), Positives = 46/106 (43%), Gaps = 6/106 (6%)
 Frame = +1

Query  160   LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSP  339
             +K + P    +P+ P  P + + P+   EP  P  P + E P    +P+ P      + P
Sbjct  1159  IKPEEPGHPEQPSQPEEPGQPEQPSQPEEPGHPEQPSQPEEPGQPEQPSQP------EEP  1212

Query  340   AMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPN  477
                 +P+ P  P +++ P+   EP     P +   P+  ++   P+
Sbjct  1213  GHPEQPSQPEEPGQHEQPSQPEEPGQSEKPGELQKPSQPADSEQPD  1258


 Score = 48.9 bits (115),  Expect = 0.001, Method: Composition-based stats.
 Identities = 24/96 (25%), Positives = 40/96 (42%), Gaps = 6/96 (6%)
 Frame = +1

Query  196   TMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHP  375
             T     +K + P    +P+ P  P + E P+   EP  P      + P+   EP  P  P
Sbjct  1153  TYKKSAIKPEEPGHPEQPSQPEEPGQPEQPSQPEEPGHP------EQPSQPEEPGQPEQP  1206

Query  376   LKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              + + P    +P+ P  P +++ P+   EP     P
Sbjct  1207  SQPEEPGHPEQPSQPEEPGQHEQPSQPEEPGQSEKP  1242



>ref|WP_003642311.1| cell surface protein precursor [Lactobacillus plantarum]
 gb|EFK27998.1| LPXTG-motif cell wall anchor domain protein [Lactobacillus plantarum 
subsp. plantarum ATCC 14917 = JCM 1149 = CGMCC 1.2437]
Length=1357

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 42/95 (44%), Gaps = 6/95 (6%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             EP  P  P + + P    +P+ P  P + E P+   EP  P      + P+   EP  P 
Sbjct  1163  EPGQPEQPSQPEEPGQPEQPSQPEEPGQPEQPSQPEEPGQP------EQPSQPEEPGHPE  1216

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
              P + + P    +P+ P  P + + P  L +P+ P
Sbjct  1217  QPSQPEEPGQPEQPSQPEEPGQSEKPGELQKPSQP  1251


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/89 (26%), Positives = 41/89 (46%), Gaps = 0/89 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + P+   EP  P  P + + P    +P+ P  P + E P+   EP  P    + + 
Sbjct  1164  PGQPEQPSQPEEPGQPEQPSQPEEPGQPEQPSQPEEPGQPEQPSQPEEPGHPEQPSQPEE  1223

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPS  423
             P    +P+ P  P + + P  L +P+ P+
Sbjct  1224  PGQPEQPSQPEEPGQSEKPGELQKPSQPA  1252



>ref|WP_033037822.1| ribonuclease [Pseudoalteromonas sp. S3431]
 gb|KDC55995.1| ribonuclease [Pseudoalteromonas sp. S3431]
Length=1061

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/107 (24%), Positives = 49/107 (46%), Gaps = 0/107 (0%)
 Frame = +1

Query  163  KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPA  342
            K ++P +  +PT    P+  + PA +  P +   P K E+PA+  +P      +  + PA
Sbjct  879  KIEAPVVTEQPTKVEAPVVTEQPAKVEAPAVTEQPAKVEAPAVTEQPAKVEAPVVTEQPA  938

Query  343  MLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             +  P +   P K ++P +  +P     P+  + PA +  P +   P
Sbjct  939  KVEAPVVTEQPAKVEAPVVTEQPAKVEAPVVTEQPAKVEAPVVTEQP  985


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 46/103 (45%), Gaps = 0/103 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +  P +   P K ++PA+  +P     P   E PA +  P +     K ++
Sbjct  883  PVVTEQPTKVEAPVVTEQPAKVEAPAVTEQPAKVEAPAVTEQPAKVEAPVVTEQPAKVEA  942

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  465
            P +  +P     P+  + PA +  P +   P K ++P +  +P
Sbjct  943  PVVTEQPAKVEAPVVTEQPAKVEAPVVTEQPAKVEAPVVTEQP  985


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 46/103 (45%), Gaps = 0/103 (0%)
 Frame = +1

Query  178  AMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEP  357
            A +  P +     K ++P +  +PT    P+  E PA +  P +     K ++PA+  +P
Sbjct  866  AEVEAPVVTEQAAKIEAPVVTEQPTKVEAPVVTEQPAKVEAPAVTEQPAKVEAPAVTEQP  925

Query  358  TMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
                 P+  + PA +  P +   P K ++P +  +P     P+
Sbjct  926  AKVEAPVVTEQPAKVEAPVVTEQPAKVEAPVVTEQPAKVEAPV  968


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 43/95 (45%), Gaps = 0/95 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + PA +  P +   P K ++PA+  +P     P+  E PA +  P +     K ++
Sbjct  895  PVVTEQPAKVEAPAVTEQPAKVEAPAVTEQPAKVEAPVVTEQPAKVEAPVVTEQPAKVEA  954

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYD  441
            P +  +P     P+  + PA +  P +   P K +
Sbjct  955  PVVTEQPAKVEAPVVTEQPAKVEAPVVTEQPAKVE  989



>ref|WP_033032426.1| hypothetical protein, partial [Pseudoalteromonas citrea]
Length=113

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/101 (25%), Positives = 46/101 (46%), Gaps = 0/101 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P+  + PA +  P +   P K ++PA+  +P     P   E PA +  P +     K 
Sbjct  11   EAPVVTEQPAKVEAPVVTEQPAKVEAPAVTEQPAKVEAPAVTEQPAKVEAPVVTEQPAKV  70

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAM  453
            ++PA+  +P     P+  + PA +  P +   P K ++P +
Sbjct  71   EAPAVTEQPAKVEAPVVTEQPAKVEAPVVTEQPAKVEAPVV  111


 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 47/111 (42%), Gaps = 6/111 (5%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + PA +  P +   P K ++P +         P K E+PA+  +P         + 
Sbjct  1    PVVTEQPAKVEAPVVTEQPAKVEAPVVT------EQPAKVEAPAVTEQPAKVEAPAVTEQ  54

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
            PA +  P +   P K ++PA+  +P     P+  + PA +  P +   P  
Sbjct  55   PAKVEAPVVTEQPAKVEAPAVTEQPAKVEAPVVTEQPAKVEAPVVTEQPAK  105



>gb|AHG85653.1| hypothetical protein F544_4210 [Bibersteinia trehalosi USDA-ARS-USMARC-190]
Length=2315

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 39/141 (28%), Positives = 53/141 (38%), Gaps = 25/141 (18%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD-  333
            P +  +P   SEP  P+ P +   P   SEP  P+ P +   P   SEP  P+   +   
Sbjct  187  PEQPTAPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPTT  246

Query  334  -----------------------SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDS  444
                                   +P   SEP  P  P +   P   +EP  P+ P +   
Sbjct  247  PEQPPEPEQPSEPEQPSEPEQPTAPEQPSEPEQPTEPEQPSEPEQPTEPEQPTEPEQPSE  306

Query  445  PAMLSEPTMPNHPLNGS-PEQ  504
            P   SEP  P+ P   S PEQ
Sbjct  307  PEQPSEPEQPSEPEQPSEPEQ  327


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 33/141 (23%), Positives = 53/141 (38%), Gaps = 28/141 (20%)
 Frame = +1

Query  166  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAM  345
            YD P    +P+ P  P + + P    +P+ P  P + E P+   +P+ P    + + P+ 
Sbjct  169  YDQPIEPEQPSEPEQPTEPEQPTAPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSE  228

Query  346  LSEPTMPNHP---------------------------LKYDSPAMLSEPTMPSHPLKYDS  444
              +P+ P  P                            +  +P   SEP  P+ P +   
Sbjct  229  PEQPSEPEQPSEPEQPTTPEQPPEPEQPSEPEQPSEPEQPTAPEQPSEPEQPTEPEQPSE  288

Query  445  PAMLSEPTMPNHPLNGS-PEQ  504
            P   +EP  P  P   S PEQ
Sbjct  289  PEQPTEPEQPTEPEQPSEPEQ  309


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 35/139 (25%), Positives = 48/139 (35%), Gaps = 30/139 (22%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNH------------------------  264
            P +   P   SEP  P+ P +   P   SEP  P+                         
Sbjct  205  PEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPTTPEQPPEPEQPSEPEQPSE  264

Query  265  ------PLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSH  426
                  P +   P   +EP  P+   +   P   +EP  P+ P +   P   SEP  PS 
Sbjct  265  PEQPTAPEQPSEPEQPTEPEQPSEPEQPTEPEQPTEPEQPSEPEQPSEPEQPSEPEQPSE  324

Query  427  PLKYDSPAMLSEPTMPNHP  483
            P +  +P   SEP  P  P
Sbjct  325  PEQPTAPGQPSEPEQPTEP  343


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 41/147 (28%), Positives = 50/147 (34%), Gaps = 31/147 (21%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSE------------  300
            P +   P   SEP  P+ P +   P   SEP  P+ P +   P   SE            
Sbjct  193  PEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPTTPEQPPE  252

Query  301  ------------------PTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSH  426
                              P  P+   +   P   SEP  P  P +   P   SEP  PS 
Sbjct  253  PEQPSEPEQPSEPEQPTAPEQPSEPEQPTEPEQPSEPEQPTEPEQPTEPEQPSEPEQPSE  312

Query  427  PLKYDSPAMLSEPTMPNHPLNGS-PEQ  504
            P +   P   SEP  P  P   S PEQ
Sbjct  313  PEQPSEPEQPSEPEQPTAPGQPSEPEQ  339



>ref|WP_035425692.1| cell wall anchor protein, partial [Lactobacillus gasseri]
Length=1006

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 34/95 (36%), Positives = 40/95 (42%), Gaps = 6/95 (6%)
 Frame = +1

Query  190  EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
            EPT P+ P +   P    EPT P  P++   P    EPT P        PA  SEPT P 
Sbjct  831  EPTTPDKPTQPSKPTKPEEPTTPGKPVQPSEPTKPEEPTTPG------KPAQPSEPTKPE  884

Query  370  HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
             P     PA  SEPT P      + P   +E   P
Sbjct  885  EPTTPGKPAQPSEPTKPKEQTIPNKPNQSNETESP  919


 Score = 52.0 bits (123),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 35/88 (40%), Gaps = 0/88 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P   D P   S+PT P  P     P   SEPT P  P     PA  SEPT P        
Sbjct  832  PTTPDKPTQPSKPTKPEEPTTPGKPVQPSEPTKPEEPTTPGKPAQPSEPTKPEEPTTPGK  891

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMP  420
            PA  SEPT P      + P   +E   P
Sbjct  892  PAQPSEPTKPKEQTIPNKPNQSNETESP  919


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 26/84 (31%), Positives = 34/84 (40%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
            A+P+       P +   P    EPT P  P++   P    EPT P  P +   P    EP
Sbjct  827  AKPVEPTTPDKPTQPSKPTKPEEPTTPGKPVQPSEPTKPEEPTTPGKPAQPSEPTKPEEP  886

Query  304  TMPNYHLKYDSPAMLSEPTMPNHP  375
            T P    +   P    E T+PN P
Sbjct  887  TTPGKPAQPSEPTKPKEQTIPNKP  910



>ref|WP_039167092.1| hypothetical protein [Gallibacterium anatis]
 gb|KGQ47170.1| hypothetical protein JL04_11255 [Gallibacterium anatis]
Length=1782

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/111 (23%), Positives = 53/111 (48%), Gaps = 6/111 (5%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  D P + ++P +   P+  D P + ++P +   P+    P    +P + N      
Sbjct  865  QPVTEDQPVVETQPEVATQPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVAN------  918

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             PA+ ++P + N P+    P + ++P   + P+  + PA  ++P + N P+
Sbjct  919  QPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPV  969


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/112 (21%), Positives = 55/112 (49%), Gaps = 0/112 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P      +  
Sbjct  894   NQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVA  953

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + PA  ++P + N P+    P + ++P     P+  + PA+ ++P + N P+
Sbjct  954   NQPAAEAQPVVTNQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPV  1005


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/112 (21%), Positives = 56/112 (50%), Gaps = 0/112 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P     P+  + PA  ++P + N P+    P + ++P      +  
Sbjct  930   NQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVEAQPVVANQPAAEVQPVVA  989

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + PA+ ++P + N P+    P + ++P + + P+  + P + ++P + N P+
Sbjct  990   NQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPV  1041


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 24/110 (22%), Positives = 50/110 (45%), Gaps = 0/110 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  D P + ++P +   P+  + P    +P + N P     P + ++P      +  +
Sbjct  883  QPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVAN  942

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             PA  ++P + N P     P + ++P + + P+  + PA   +P + N P
Sbjct  943  QPAAEAQPVVANQPAAEAQPVVTNQPVVEAQPVVANQPAAEVQPVVANQP  992


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/110 (21%), Positives = 52/110 (47%), Gaps = 0/110 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P + ++P + N P     P + ++P +   P+    PA+ ++P +    +   
Sbjct  1069  QPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVAET  1128

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              PA+ ++P + N P+    P + ++P     P+  + P   ++P + N P
Sbjct  1129  QPAVEAQPVVANQPVVETQPVVTNQPVAEVQPVVANQPVTEAQPVVSNQP  1178


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/110 (19%), Positives = 53/110 (48%), Gaps = 0/110 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+    P + ++P + + P+  + P + ++P + N P+    P + ++P +    +  +
Sbjct  871  QPVVETQPEVATQPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVAN  930

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             P   ++P + N P     P + ++P   + P+  + P + ++P + N P
Sbjct  931  QPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVEAQPVVANQP  980


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/110 (22%), Positives = 53/110 (48%), Gaps = 6/110 (5%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA+ ++P + N P+    P + ++P     P+    PA  ++P + N      
Sbjct  913   QPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTN------  966

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P + ++P + N P     P + ++P + + P+  + P + ++P + N P
Sbjct  967   QPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQP  1016


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/112 (21%), Positives = 52/112 (46%), Gaps = 0/112 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P     P + ++P     P+  + PA  ++P + N P     P + ++P +    +  
Sbjct  918   NQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVEAQPVVA  977

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             + PA   +P + N P     P + ++P + + P   + PA+ ++P + N P+
Sbjct  978   NQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPV  1029


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P + ++P + N P+    P + ++      P+    P + ++P + N      
Sbjct  1033  QPVVTNQPVVEAQPVVANQPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQPAVET  1092

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P +   P+  + PA+ ++P + + P+    PA+ ++P + N P+
Sbjct  1093  QPVVANQPVVETQPVVANQPAVETQPVVATQPVAETQPAVEAQPVVANQPV  1143


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 24/111 (22%), Positives = 54/111 (49%), Gaps = 6/111 (5%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA  ++P + N P+    P + ++P     P+    PA+ ++P + N      
Sbjct  949   QPVVANQPAAEAQPVVTNQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVAN------  1002

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P + N P     P + ++P + + P+  + P + ++P + N P+
Sbjct  1003  QPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPV  1053


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/106 (20%), Positives = 52/106 (49%), Gaps = 0/106 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P + ++P + N P+    P + ++P     P+    PA+ ++P +    +   
Sbjct  1135  QPVVANQPVVETQPVVTNQPVAEVQPVVANQPVTEAQPVVSNQPAVEAQPVVEKQAVTEA  1194

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  471
              P ++++P     P+  D P + ++P   + P+  + PA+ ++P +
Sbjct  1195  QPVVVNQPVAETQPIVKDQPVVANQPVTEAQPVVSNQPAVEAQPVV  1240


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 24/121 (20%), Positives = 60/121 (50%), Gaps = 3/121 (2%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P+     + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P
Sbjct  960   AQPVV---TNQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQP  1016

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              +    +  + P + ++P + N P+    P + ++P + + P+  +  A  ++P + N P
Sbjct  1017  AVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQLAAETQPVVANQP  1076

Query  484   L  486
             +
Sbjct  1077  V  1077


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  151   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
             + P+    P + ++P +   P+  + P + ++P + N P+    P + ++P +    +  
Sbjct  1002  NQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVA  1061

Query  331   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             +  A  ++P + N P+    P + ++P + + P+  + P + ++P + N P
Sbjct  1062  NQLAAETQPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQP  1112


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P   + PA+ ++P + N P+    P + ++P +   P+    P + ++P + N      
Sbjct  1009  QPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQLAAET  1068

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P +   P   + PA+ ++P + + P+    P + ++P +   P+
Sbjct  1069  QPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPV  1119


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/117 (21%), Positives = 58/117 (50%), Gaps = 6/117 (5%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPL------KYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPN  315
              P+  + PA+ ++P + N P+        + PA+ ++P + N P+    P + ++P +  
Sbjct  985   QPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEA  1044

Query  316   YHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
               +  + P + ++P + N       P + ++P + + P   + PA+ ++P + N P+
Sbjct  1045  QPVVANQPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQPAVETQPVVANQPV  1101


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/106 (20%), Positives = 52/106 (49%), Gaps = 0/106 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P   + PA+ ++P + N P+    P + ++P +   P+    P   ++P +    +  +
Sbjct  1081  QPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVAETQPAVEAQPVVAN  1140

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  471
              P + ++P + N P+    P + ++P   + P+  + PA+ ++P +
Sbjct  1141  QPVVETQPVVTNQPVAEVQPVVANQPVTEAQPVVSNQPAVEAQPVV  1186


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 56/121 (46%), Gaps = 3/121 (2%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A+P+ +   + P+    P +  +P + N P+    P + ++P +   P+  +     ++P
Sbjct  1194  AQPVVV---NQPVAETQPIVKDQPVVANQPVTEAQPVVSNQPAVEAQPVVEKQAVTEAQP  1250

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              + N  +    P + ++P     P+    P + ++P     P+  + PA+ ++P + N P
Sbjct  1251  VVVNQPVAETQPVVETKPVAETQPVAETQPVVTNQPVAEVQPVVANQPAVETQPMVANQP  1310

Query  484   L  486
             +
Sbjct  1311  V  1311


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 51/111 (46%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA+ ++P +   P+    PA+ ++P + N P+    P + ++P      +  +
Sbjct  1105  QPVVANQPAVETQPVVATQPVAETQPAVEAQPVVANQPVVETQPVVTNQPVAEVQPVVAN  1164

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P   ++P + N P     P +  +    + P+  + P   ++P + + P+
Sbjct  1165  QPVTEAQPVVSNQPAVEAQPVVEKQAVTEAQPVVVNQPVAETQPIVKDQPV  1215


 Score = 49.3 bits (116),  Expect = 0.001, Method: Composition-based stats.
 Identities = 20/111 (18%), Positives = 51/111 (46%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+    P   ++P +   P+  + P + ++P + N P+    P + ++P      +  +
Sbjct  1117  QPVVATQPVAETQPAVEAQPVVANQPVVETQPVVTNQPVAEVQPVVANQPVTEAQPVVSN  1176

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              PA+ ++P +    +    P ++++P   + P+  D P + ++P     P+
Sbjct  1177  QPAVEAQPVVEKQAVTEAQPVVVNQPVAETQPIVKDQPVVANQPVTEAQPV  1227



>ref|WP_039946191.1| hypothetical protein, partial [Lactobacillus mucosae]
Length=186

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 54/124 (44%), Gaps = 0/124 (0%)
 Frame = +1

Query  124  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
            A+P T      P K  +PA  +EP  P+ P K   PA  S P  P  P+   +P   +EP
Sbjct  13   AKPSTPAKPTEPAKPSTPAKPTEPAKPSAPTKPTEPAKPSTPNKPTEPVNPSTPEKPTEP  72

Query  304  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P+   K   PA  S P  P  P K  +P   +EP  PS P K   PA  S P  P  P
Sbjct  73   AKPSTSAKPTEPAKPSTPEKPTEPAKPSTPNKPTEPAKPSTPEKPTEPAKPSTPNKPTEP  132

Query  484  LNGS  495
               S
Sbjct  133  ATPS  136


 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 50/114 (44%), Gaps = 0/114 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P K  +PA  +EP  P+ P K   PA  S PT P  P K  +P   +EP  P+   K  
Sbjct  11   EPAKPSTPAKPTEPAKPSTPAKPTEPAKPSAPTKPTEPAKPSTPNKPTEPVNPSTPEKPT  70

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  495
             PA  S    P  P K  +P   +EP  PS P K   PA  S P  P  P   S
Sbjct  71   EPAKPSTSAKPTEPAKPSTPEKPTEPAKPSTPNKPTEPAKPSTPEKPTEPAKPS  124


 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 51/119 (43%), Gaps = 6/119 (5%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLS------EPTMPNY  318
            P K   PA  S PT P  P K  +P   +EP  P+ P K   PA  S      EP  P+ 
Sbjct  30   PAKPTEPAKPSAPTKPTEPAKPSTPNKPTEPVNPSTPEKPTEPAKPSTSAKPTEPAKPST  89

Query  319  HLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  495
              K   PA  S P  P  P K  +P   +EP  PS P K   PA  S P  P  P+  S
Sbjct  90   PEKPTEPAKPSTPNKPTEPAKPSTPEKPTEPAKPSTPNKPTEPATPSTPEKPTEPVTPS  148



>ref|WP_033615607.1| cell wall anchor protein [Lactobacillus plantarum]
Length=1357

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 42/95 (44%), Gaps = 6/95 (6%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             EP  P  P + + P    +P+ P  P + E P+   EP  P      + P+   EP  P 
Sbjct  1163  EPGQPEQPSQPEEPGHPEQPSQPEEPGQPEQPSQPEEPGQP------EQPSQPEEPGHPE  1216

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
              P + + P    +P+ P  P + + P  L +P+ P
Sbjct  1217  QPSQPEEPGQPEQPSQPEEPGQSEKPGELQKPSQP  1251


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/89 (26%), Positives = 41/89 (46%), Gaps = 0/89 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + P+   EP  P  P + + P    +P+ P  P + E P+   EP  P    + + 
Sbjct  1164  PGQPEQPSQPEEPGHPEQPSQPEEPGQPEQPSQPEEPGQPEQPSQPEEPGHPEQPSQPEE  1223

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPS  423
             P    +P+ P  P + + P  L +P+ P+
Sbjct  1224  PGQPEQPSQPEEPGQSEKPGELQKPSQPA  1252



>ref|WP_023599945.1| mucin binding protein [Lactobacillus johnsonii]
 gb|AHA97899.1| mucin binding protein [Lactobacillus johnsonii N6.2]
Length=1579

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 40/119 (34%), Positives = 46/119 (39%), Gaps = 0/119 (0%)
 Frame = +1

Query  127   RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  306
             +P+       P K   P    EPT P  P K   P    +PT P  P+K   P    +PT
Sbjct  1331  KPVQPTKPVEPTKPVQPTKPVEPTKPVQPTKPVEPTKPVQPTKPVEPIKPVKPTKPVQPT  1390

Query  307   MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P   +K   P     PT P  P K   P    EPT P  P K   P    EPT P  P
Sbjct  1391  KPVEPIKPVKPTKPVRPTKPVEPTKPVKPTKPVEPTKPVQPTKPIEPTKPVEPTKPVQP  1449


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 27/110 (25%), Positives = 50/110 (45%), Gaps = 0/110 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P++   P   ++P  P  P++   P   ++P  P  P++   P   ++P  P   +K   
Sbjct  1326  PVQPTKPVQPTKPVEPTKPVQPTKPVEPTKPVQPTKPVEPTKPVQPTKPVEPIKPVKPTK  1385

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P   ++P  P  P+K   P   ++P  P+ P+K   P   ++P  P  P+
Sbjct  1386  PVQPTKPVEPIKPVKPTKPVRPTKPVEPTKPVKPTKPVEPTKPVQPTKPI  1435


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 27/110 (25%), Positives = 50/110 (45%), Gaps = 0/110 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P++   P   ++P  P  P++   P   ++P  P  P+K   P   ++P  P   +K   
Sbjct  1344  PVQPTKPVEPTKPVQPTKPVEPTKPVQPTKPVEPIKPVKPTKPVQPTKPVEPIKPVKPTK  1403

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P   ++P  P  P+K   P   ++P  P+ P++   P   ++P  P  P+
Sbjct  1404  PVRPTKPVEPTKPVKPTKPVEPTKPVQPTKPIEPTKPVEPTKPVQPTKPV  1453


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 40/120 (33%), Positives = 45/120 (38%), Gaps = 0/120 (0%)
 Frame = +1

Query  124   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
             A P+       P K   P    +PT P  P K   P    EPT P  P K   P    +P
Sbjct  1324  AEPVQPTKPVQPTKPVEPTKPVQPTKPVEPTKPVQPTKPVEPTKPVQPTKPVEPIKPVKP  1383

Query  304   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             T P    K   P    +PT P  P K   P    +PT P  P K   P    EPT P  P
Sbjct  1384  TKPVQPTKPVEPIKPVKPTKPVRPTKPVEPTKPVKPTKPVEPTKPVQPTKPIEPTKPVEP  1443


 Score = 52.0 bits (123),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 27/110 (25%), Positives = 49/110 (45%), Gaps = 0/110 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P++   P   ++P  P  P+K   P   ++P  P  P+K   P   ++P  P   +K   
Sbjct  1362  PVEPTKPVQPTKPVEPIKPVKPTKPVQPTKPVEPIKPVKPTKPVRPTKPVEPTKPVKPTK  1421

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P   ++P  P  P++   P   ++P  P+ P++   P    +P  P  P+
Sbjct  1422  PVEPTKPVQPTKPIEPTKPVEPTKPVQPTKPVEPTKPVKSIKPVQPTKPV  1471


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 39/116 (34%), Positives = 44/116 (38%), Gaps = 0/116 (0%)
 Frame = +1

Query  127   RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  306
             +P+       P K   P    EPT P  P K   P    +PT P  P K   P    +PT
Sbjct  1343  KPVQPTKPVEPTKPVQPTKPVEPTKPVQPTKPVEPIKPVKPTKPVQPTKPVEPIKPVKPT  1402

Query  307   MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
              P    K   P    +PT P  P K   P    EPT P  P K   P    EPT P
Sbjct  1403  KPVRPTKPVEPTKPVKPTKPVEPTKPVQPTKPIEPTKPVEPTKPVQPTKPVEPTKP  1458


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/110 (25%), Positives = 48/110 (44%), Gaps = 0/110 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P+K   P   ++P  P  P+K   P   ++P  P  P+K   P   ++P  P   ++   
Sbjct  1380  PVKPTKPVQPTKPVEPIKPVKPTKPVRPTKPVEPTKPVKPTKPVEPTKPVQPTKPIEPTK  1439

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P   ++P  P  P++   P    +P  P+ P+K   P   ++P     P+
Sbjct  1440  PVEPTKPVQPTKPVEPTKPVKSIKPVQPTKPVKPTKPVEPTKPVQTTKPV  1489


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 38/119 (32%), Positives = 43/119 (36%), Gaps = 0/119 (0%)
 Frame = +1

Query  127   RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  306
             +P+       P K   P    +PT P  P K   P    EP  P  P K   P    EP 
Sbjct  1337  KPVEPTKPVQPTKPVEPTKPVQPTKPVEPTKPVQPTKPVEPIKPVKPTKPVQPTKPVEPI  1396

Query  307   MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P    K   P    EPT P  P K   P    +PT P  P K   P    +PT P  P
Sbjct  1397  KPVKPTKPVRPTKPVEPTKPVKPTKPVEPTKPVQPTKPIEPTKPVEPTKPVQPTKPVEP  1455


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 36/129 (28%), Positives = 50/129 (39%), Gaps = 9/129 (7%)
 Frame = +1

Query  127   RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  306
             +P+       P+K   P    +PT P  P+K   P     PT P  P K   P    EPT
Sbjct  1367  KPVQPTKPVEPIKPVKPTKPVQPTKPVEPIKPVKPTKPVRPTKPVEPTKPVKPTKPVEPT  1426

Query  307   MPNYHLKYDSPAMLSEPTM---------PNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLS  459
              P    K   P    EPT          P  P+K   P   ++P  P+ P++   P   +
Sbjct  1427  KPVQPTKPIEPTKPVEPTKPVQPTKPVEPTKPVKSIKPVQPTKPVKPTKPVEPTKPVQTT  1486

Query  460   EPTMPNHPL  486
             +P  P  P+
Sbjct  1487  KPVEPTKPV  1495



>ref|XP_002736705.2| PREDICTED: uncharacterized protein C1orf173-like [Saccoglossus 
kowalevskii]
Length=1336

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 30/118 (25%), Positives = 56/118 (47%), Gaps = 3/118 (3%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P + + P+ + EPT    P K + P+ + EP+    P + E P+ + EP+      + + 
Sbjct  776  PSQDEEPSGVDEPTRVEEPSKVEEPSGVEEPSQVEGPSRVEEPSQVEEPSQDEEPSQDEE  835

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP---LNGSPE  501
            P+   EP+      + + P+ + EPT    P +  +P  + EP +       ++GSPE
Sbjct  836  PSQDEEPSQDEERSRVEEPSGVEEPTRVEEPSQVQTPFQIEEPRLNEEKVSIVSGSPE  893


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 26/112 (23%), Positives = 52/112 (46%), Gaps = 0/112 (0%)
 Frame = +1

Query  148  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  327
            +  P + +  + + EP+    P + + P+ + EPT    P K E P+ + EP+      +
Sbjct  755  DEEPSQDEERSGVEEPSRVEEPSQDEEPSGVDEPTRVEEPSKVEEPSGVEEPSQVEGPSR  814

Query  328  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             + P+ + EP+    P + + P+   EP+      + + P+ + EPT    P
Sbjct  815  VEEPSQVEEPSQDEEPSQDEEPSQDEEPSQDEERSRVEEPSGVEEPTRVEEP  866


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 26/109 (24%), Positives = 50/109 (46%), Gaps = 6/109 (6%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P   + P+ + EP+    P + + P+   EP+        E P+ + EP+      + + 
Sbjct  728  PSGVEEPSQVEEPSRVEEPFQDEEPSQDEEPSQDEERSGVEEPSRVEEPS------QDEE  781

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            P+ + EPT    P K + P+ + EP+    P + + P+ + EP+    P
Sbjct  782  PSGVDEPTRVEEPSKVEEPSGVEEPSQVEGPSRVEEPSQVEEPSQDEEP  830


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/104 (24%), Positives = 49/104 (47%), Gaps = 0/104 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P + + P    EP+    P + +  + + EP+    P + E P+ + EPT      K + 
Sbjct  740  PSRVEEPFQDEEPSQDEEPSQDEERSGVEEPSRVEEPSQDEEPSGVDEPTRVEEPSKVEE  799

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPT  468
            P+ + EP+    P + + P+ + EP+    P + + P+   EP+
Sbjct  800  PSGVEEPSQVEGPSRVEEPSQVEEPSQDEEPSQDEEPSQDEEPS  843


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/109 (22%), Positives = 50/109 (46%), Gaps = 0/109 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P + + P+ + EP     P + + P+   E +    P + E P+   EP+  +   + + 
Sbjct  734  PSQVEEPSRVEEPFQDEEPSQDEEPSQDEERSGVEEPSRVEEPSQDEEPSGVDEPTRVEE  793

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            P+ + EP+    P + + P+ + EP+    P + + P+   EP+    P
Sbjct  794  PSKVEEPSGVEEPSQVEGPSRVEEPSQVEEPSQDEEPSQDEEPSQDEEP  842



>ref|WP_024600481.1| ribonuclease [Pseudoalteromonas haloplanktis]
Length=1056

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 28/109 (26%), Positives = 46/109 (42%), Gaps = 0/109 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P K  +P +  EP     P+  + PA +  P     P K E+P +  EP      +  + 
Sbjct  866  PAKVGAPVVTEEPAKVETPVATEEPAKVETPVATEEPAKVETPVVTEEPAKVEAPVATEE  925

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            PA +  P +   P K ++P +  EP     P+  + PA +  P +   P
Sbjct  926  PAKVETPVVTEEPAKVETPVVTEEPAKVEAPVVTEEPAKVETPVVTEEP  974


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 45/106 (42%), Gaps = 0/106 (0%)
 Frame = +1

Query  169  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
            + PA +  P +   P K ++P    EP     P+  E PA +  P +     K ++P   
Sbjct  864  EEPAKVGAPVVTEEPAKVETPVATEEPAKVETPVATEEPAKVETPVVTEEPAKVEAPVAT  923

Query  349  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             EP     P+  + PA +  P +   P K ++P +  EP     P+
Sbjct  924  EEPAKVETPVVTEEPAKVETPVVTEEPAKVEAPVVTEEPAKVETPV  969



>gb|KFL87002.1| hypothetical protein LpDm1_2602 [Lactobacillus plantarum]
Length=1329

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 42/95 (44%), Gaps = 6/95 (6%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             EP  P  P + + P    +P+ P  P + E P+   EP  P      + P+   EP  P 
Sbjct  1135  EPGQPEQPSQPEEPGHPEQPSQPEEPGQPEQPSQPEEPGQP------EQPSQPEEPGHPE  1188

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
              P + + P    +P+ P  P + + P  L +P+ P
Sbjct  1189  QPSQPEEPGQPEQPSQPEEPGQSEKPGELQKPSQP  1223


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/89 (26%), Positives = 41/89 (46%), Gaps = 0/89 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + P+   EP  P  P + + P    +P+ P  P + E P+   EP  P    + + 
Sbjct  1136  PGQPEQPSQPEEPGHPEQPSQPEEPGQPEQPSQPEEPGQPEQPSQPEEPGHPEQPSQPEE  1195

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPS  423
             P    +P+ P  P + + P  L +P+ P+
Sbjct  1196  PGQPEQPSQPEEPGQSEKPGELQKPSQPA  1224



>ref|WP_024601393.1| ribonuclease [Pseudoalteromonas atlantica]
Length=1064

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 38/100 (38%), Gaps = 0/100 (0%)
 Frame = +1

Query  163  KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPA  342
            K + P    EP     P+K + P    EP     P+K E P    EP      +K + P 
Sbjct  851  KVEEPVKAEEPVKAEEPVKTEEPVKTEEPVKTEEPVKAEEPVKAEEPVQTEEPVKAEEPV  910

Query  343  MLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  462
               EP     P+K + P    EP     P+K + P    E
Sbjct  911  KAEEPVKAEEPVKTEEPVKAEEPVKAEEPVKAEEPVKAEE  950


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 37/93 (40%), Gaps = 0/93 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+K + P    EP     P+K + P    EP     P+K E P    EP      +K + 
Sbjct  855  PVKAEEPVKAEEPVKTEEPVKTEEPVKTEEPVKAEEPVKAEEPVQTEEPVKAEEPVKAEE  914

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLK  435
            P    EP     P+K + P    EP     P+K
Sbjct  915  PVKAEEPVKTEEPVKAEEPVKAEEPVKAEEPVK  947


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 38/96 (40%), Gaps = 0/96 (0%)
 Frame = +1

Query  178  AMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEP  357
            A + EP     P+K + P    EP     P+K E P    EP      ++ + P    EP
Sbjct  850  AKVEEPVKAEEPVKAEEPVKTEEPVKTEEPVKTEEPVKAEEPVKAEEPVQTEEPVKAEEP  909

Query  358  TMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  465
                 P+K + P    EP     P+K + P    EP
Sbjct  910  VKAEEPVKAEEPVKTEEPVKAEEPVKAEEPVKAEEP  945


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/92 (28%), Positives = 36/92 (39%), Gaps = 0/92 (0%)
 Frame = +1

Query  211  PLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDS  390
            P+K + P    EP     P+K E P    EP      +K + P    EP     P+K + 
Sbjct  855  PVKAEEPVKAEEPVKTEEPVKTEEPVKTEEPVKAEEPVKAEEPVQTEEPVKAEEPVKAEE  914

Query  391  PAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P    EP     P+K + P    EP     P+
Sbjct  915  PVKAEEPVKTEEPVKAEEPVKAEEPVKAEEPV  946


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/111 (24%), Positives = 40/111 (36%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
            H    D+   + +  +     K + P    EP     P+K E P    EP      +K +
Sbjct  830  HKTAVDASDAVEQNIVEEELAKVEEPVKAEEPVKAEEPVKTEEPVKTEEPVKTEEPVKAE  889

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P    EP     P+K + P    EP     P+K + P    EP     P+
Sbjct  890  EPVKAEEPVQTEEPVKAEEPVKAEEPVKAEEPVKTEEPVKAEEPVKAEEPV  940


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/102 (25%), Positives = 40/102 (39%), Gaps = 0/102 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+K + P    EP     P+K + P    EP     P++ E P    EP      +K + 
Sbjct  861  PVKAEEPVKTEEPVKTEEPVKTEEPVKAEEPVKAEEPVQTEEPVKAEEPVKAEEPVKAEE  920

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  462
            P    EP     P+K + P    EP      +  +  A+ +E
Sbjct  921  PVKTEEPVKAEEPVKAEEPVKAEEPVKAEESVPAEEVAVEAE  962



>gb|EJP18773.1| LPXTG cell wall anchor domain protein, partial [Streptococcus 
oralis SK304]
Length=346

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 57/122 (47%), Gaps = 0/122 (0%)
 Frame = +1

Query  124  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
            A+P T +    P++ + PA   +P  P  P + + PA   +P  P  P + E+PA   +P
Sbjct  12   AQPETPVQPEKPVQPEKPAEPEKPAEPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEQP  71

Query  304  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P    + ++PA   +P  P  P + ++P    +P  P  P + ++P    +PT P  P
Sbjct  72   AQPEKPAQPETPAQPEKPAQPEKPAQPETPVQPEKPAQPEKPAQPETPVQPEQPTEPETP  131

Query  484  LN  489
              
Sbjct  132  AQ  133


 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 54/118 (46%), Gaps = 2/118 (2%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P + ++P    +P  P  P + + PA   +P  P  P + E PA   +PT P    + 
Sbjct  9    EKPAQPETPVQPEKPVQPEKPAEPEKPAEPEKPAQPEKPAQPEKPAQPEKPTQPETPAQP  68

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
            + PA   +P  P  P + + PA   +P  P  P++ + PA   +P  P  P+   PEQ
Sbjct  69   EQPAQPEKPAQPETPAQPEKPAQPEKPAQPETPVQPEKPAQPEKPAQPETPVQ--PEQ  124


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/113 (27%), Positives = 50/113 (44%), Gaps = 0/113 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P + + PA    P  P  P++ + PA   +P  P  P + E PA   +P  P    + 
Sbjct  3    EKPAQPEKPAQPETPVQPEKPVQPEKPAEPEKPAEPEKPAQPEKPAQPEKPAQPEKPTQP  62

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
            ++PA   +P  P  P + ++PA   +P  P  P + ++P    +P  P  P  
Sbjct  63   ETPAQPEQPAQPEKPAQPETPAQPEKPAQPEKPAQPETPVQPEKPAQPEKPAQ  115


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/113 (26%), Positives = 51/113 (45%), Gaps = 0/113 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P + + PA   +P  P  P + ++PA   +P  P  P + E+PA   +P  P    + 
Sbjct  39   EKPAQPEKPAQPEKPAQPEKPTQPETPAQPEQPAQPEKPAQPETPAQPEKPAQPEKPAQP  98

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
            ++P    +P  P  P + ++P    +PT P  P + ++P    +P  P  P  
Sbjct  99   ETPVQPEKPAQPEKPAQPETPVQPEQPTEPETPAQPETPVQPEKPVQPEKPAQ  151


 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 50/113 (44%), Gaps = 0/113 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P + + PA   +P  P  P + + PA   +PT P  P + E PA   +P  P    + 
Sbjct  27   EKPAEPEKPAEPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEQPAQPEKPAQPETPAQP  86

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
            + PA   +P  P  P++ + PA   +P  P  P++ + P     P  P  P+ 
Sbjct  87   EKPAQPEKPAQPETPVQPEKPAQPEKPAQPETPVQPEQPTEPETPAQPETPVQ  139


 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 51/110 (46%), Gaps = 0/110 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P + ++PA   +P  P  P + ++PA   +P  P  P + E+P    +P  P    + 
Sbjct  57   EKPTQPETPAQPEQPAQPEKPAQPETPAQPEKPAQPEKPAQPETPVQPEKPAQPEKPAQP  116

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNH  480
            ++P    +PT P  P + ++P    +P  P  P + + PA   +P  P +
Sbjct  117  ETPVQPEQPTEPETPAQPETPVQPEKPVQPEKPAQSEKPAETEKPDQPEN  166



>gb|ACF42267.1| neurofilament triplet H1 protein [Soft-shelled turtle iridovirus]
Length=192

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/105 (28%), Positives = 37/105 (35%), Gaps = 0/105 (0%)
 Frame = +1

Query  148  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  327
               P+K  SP     P     P+K  SP     P     P+K +SP     P      +K
Sbjct  80   RKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVK  139

Query  328  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  462
              SP     P     P+K  SP     P     P+K  SPA   +
Sbjct  140  RKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPAKRRQ  184


 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 37/111 (33%), Gaps = 0/111 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+K  SP     P     P+K  SP     P     P+K +SP     P      +K  S
Sbjct  71   PVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKS  130

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
            P     P     P+K  SP     P     P+K  SP     P     P  
Sbjct  131  PVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPAK  181


 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 38/114 (33%), Gaps = 1/114 (1%)
 Frame = +1

Query  148  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  327
               PLK  S    S P     P+K  SP     P     P+K +SP     P      +K
Sbjct  57   KRSPLKKRSQTRTS-PVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVK  115

Query  328  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
              SP     P     P+K  SP     P     P+K  SP     P     P+ 
Sbjct  116  RKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVK  169



>gb|KGK34316.1| hypothetical protein JL09_g6537, partial [Pichia kudriavzevii]
Length=112

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 36/82 (44%), Gaps = 0/82 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P + D P  + EPT  + P   D P  + +PT  + P + + P  + +PT  +     
Sbjct  1    DEPTEVDDPTEVDEPTEVDDPTGVDDPTEVDDPTEVDDPTEVDDPTEVDDPTEVDDTTGV  60

Query  331  DSPAMLSEPTMPNHPLKYDSPA  396
            D P  + EPT  + P   D P 
Sbjct  61   DEPTEVDEPTGVDEPTGVDDPT  82


 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 6/88 (7%)
 Frame = +1

Query  205  NHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKY  384
            + P + D P  + EPT  + P   + P  + +PT      + D P  + +PT  + P + 
Sbjct  1    DEPTEVDDPTEVDEPTEVDDPTGVDDPTEVDDPT------EVDDPTEVDDPTEVDDPTEV  54

Query  385  DSPAMLSEPTMPSHPLKYDSPAMLSEPT  468
            D    + EPT    P   D P  + +PT
Sbjct  55   DDTTGVDEPTEVDEPTGVDEPTGVDDPT  82


 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/82 (27%), Positives = 39/82 (48%), Gaps = 0/82 (0%)
 Frame = +1

Query  169  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
            D P  + +PT  + P + D P  + +PT  + P + + P  + +PT  +   + D    +
Sbjct  1    DEPTEVDDPTEVDEPTEVDDPTGVDDPTEVDDPTEVDDPTEVDDPTEVDDPTEVDDTTGV  60

Query  349  SEPTMPNHPLKYDSPAMLSEPT  414
             EPT  + P   D P  + +PT
Sbjct  61   DEPTEVDEPTGVDEPTGVDDPT  82



>ref|WP_039161440.1| hypothetical protein, partial [Gallibacterium anatis]
 gb|KGQ24862.1| hypothetical protein JP33_07780, partial [Gallibacterium anatis 
CCM5995]
Length=594

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 53/104 (51%), Gaps = 0/104 (0%)
 Frame = +1

Query  175  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  354
            PA+ ++P + N P+    P + ++P +   P+    P + ++P + N       P + ++
Sbjct  2    PAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVIANQPAAETQPVVANQ  61

Query  355  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P + N P+    P + ++P + + P+  + P + ++P + N P+
Sbjct  62   PVVTNQPVAEVQPVVANQPAVETQPVVANQPVVETQPVVTNQPV  105


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 51/111 (46%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + P + ++P + N P     P + ++P +   P+    PA  ++P + N  +  +
Sbjct  7    QPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVIANQPAAETQPVVANQPVVTN  66

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P    +P + N P     P + ++P + + P+  + P    +P + N P+
Sbjct  67   QPVAEVQPVVANQPAVETQPVVANQPVVETQPVVTNQPVAEVQPVVANQPV  117


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+    P + ++P + N P     P + ++P + N P+    P + ++P +    +  +
Sbjct  31   QPVVATQPVVETQPVIANQPAAETQPVVANQPVVTNQPVAEVQPVVANQPAVETQPVVAN  90

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P + ++P + N P+    P + ++P + + P+    P   ++P + + P+
Sbjct  91   QPVVETQPVVTNQPVAEVQPVVANQPVVETQPVAETQPVAETQPVVEDQPV  141


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 51/111 (46%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + PA+ ++P +   P+    P + ++P     P+    P + ++P      +  +
Sbjct  19   QPVVANQPAVETQPVVATQPVVETQPVIANQPAAETQPVVANQPVVTNQPVAEVQPVVAN  78

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             PA+ ++P + N P+    P + ++P     P+  + P + ++P     P+
Sbjct  79   QPAVETQPVVANQPVVETQPVVTNQPVAEVQPVVANQPVVETQPVAETQPV  129



>ref|XP_002940580.2| PREDICTED: uncharacterized protein LOC100379885 [Xenopus (Silurana) 
tropicalis]
Length=8401

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 40/118 (34%), Positives = 58/118 (49%), Gaps = 24/118 (20%)
 Frame = +1

Query  202   PNHPLKYDSPAMLSEPTMP----NHPL----------KYESPAMLSEPTMPNYHLKYDSP  339
             P H  K ++PAM+S+   P    N P           K+  PAM+S+   P    K++ P
Sbjct  1633  PGHGRKLNNPAMVSQEAWPWKKFNDPAMVSQEAWPWKKFNDPAMVSQEAWP--WKKFNDP  1690

Query  340   AMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP----NHPLNGSPE  501
             AM+S+   P    K++ PAM+S+   P    K + PAM+S+   P    NHP  GS E
Sbjct  1691  AMVSQEAWPWK--KFNDPAMVSQEAWPWK--KLNDPAMVSQEVWPWKKLNHPAIGSQE  1744



>ref|WP_034371226.1| cell surface protein [Dermabacter hominis]
Length=1750

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 32/111 (29%), Positives = 44/111 (40%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P + + P    EP  P  P K + P    +P  P  P +   P    EP  P    + +
Sbjct  1605  QPGEPEQPGQPEEPGKPGQPGKPEQPGKPGQPEQPGKPEQPGEPEQPGEPEQPGKPGQPE  1664

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P    +P  P  P K + P    +P  P  P K   PA  S+P+ P  PL
Sbjct  1665  EPGKPEQPGQPEEPGKPEQPGKPEQPGQPEQPAKPADPAHPSKPSKPGLPL  1715


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/109 (27%), Positives = 42/109 (39%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P K + P    +P  P  P K   P    +P  P  P +   P    EP  P    +   
Sbjct  1600  PGKPEQPGEPEQPGQPEEPGKPGQPGKPEQPGKPGQPEQPGKPEQPGEPEQPGEPEQPGK  1659

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             P    EP  P  P + + P    +P  P  P + + PA  ++P  P+ P
Sbjct  1660  PGQPEEPGKPEQPGQPEEPGKPEQPGKPEQPGQPEQPAKPADPAHPSKP  1708


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 39/105 (37%), Gaps = 8/105 (8%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             EP  P  P + + P    EP  P  P K E P    +P  P        P    EP  P 
Sbjct  1599  EPGKPEQPGEPEQPGQPEEPGKPGQPGKPEQPGKPGQPEQPG------KPEQPGEPEQPG  1652

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
              P +   P    EP  P  P + + P    +P  P  P  G PEQ
Sbjct  1653  EPEQPGKPGQPEEPGKPEQPGQPEEPGKPEQPGKPEQP--GQPEQ  1695



>ref|WP_040539980.1| hypothetical protein, partial [Pedobacter arcticus]
Length=326

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = -1

Query  488  FKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**FG  309
             KG  GI G+D   G +  KG  GI G+D   G +  KG  GI G+D   G +  K   G
Sbjct  216  PKGTDGINGNDGATGPAGAKGADGINGNDGATGPAGPKGTDGINGNDGATGPAGPKGTDG  275

Query  308  IVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  159
            I G+D   G +  KG  GI G+D   G +  KG  GI G+D   G +  K
Sbjct  276  INGNDGATGPAGPKGTDGINGNDGATGPAGAKGTDGINGNDGATGPAGPK  325


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 54/109 (50%), Gaps = 0/109 (0%)
 Frame = -1

Query  485  KG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**FGI  306
            KG  GI G+D   G +  KG  GI G+D   G +  KG  GI G+D   G +  K   GI
Sbjct  199  KGIDGINGNDGAIGPAGPKGTDGINGNDGATGPAGAKGADGINGNDGATGPAGPKGTDGI  258

Query  305  VGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  159
             G+D   G +  KG  GI G+D   G +  KG  GI G+D   G +  K
Sbjct  259  NGNDGATGPAGPKGTDGINGNDGATGPAGPKGTDGINGNDGATGPAGAK  307



>ref|WP_007375272.1| ribonuclease E [Pseudoalteromonas sp. Bsw20308]
 gb|EKS14718.1| ribonuclease E [Pseudoalteromonas sp. Bsw20308]
Length=1061

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 25/105 (24%), Positives = 48/105 (46%), Gaps = 0/105 (0%)
 Frame = +1

Query  169  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
            ++P +  +PT    P+  + PA +  P +   P K E+PA+  +P      +  + PA +
Sbjct  881  EAPVVTEQPTKVEAPVVTEQPAKVEAPVVTEQPAKVEAPAVTEQPAKVEAPVVTEQPAKV  940

Query  349  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              P +   P K ++P +  +P     P+  + PA +  P +   P
Sbjct  941  EAPVVTEQPAKVEAPVVTEQPAKVEAPVVTEQPAKVEAPVVTEQP  985


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 43/95 (45%), Gaps = 0/95 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + PA +  P +   P K ++PA+  +P     P+  E PA +  P +     K ++
Sbjct  895  PVVTEQPAKVEAPVVTEQPAKVEAPAVTEQPAKVEAPVVTEQPAKVEAPVVTEQPAKVEA  954

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYD  441
            P +  +P     P+  + PA +  P +   P K +
Sbjct  955  PVVTEQPAKVEAPVVTEQPAKVEAPVVTEQPAKVE  989


 Score = 48.9 bits (115),  Expect = 0.001, Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 46/103 (45%), Gaps = 0/103 (0%)
 Frame = +1

Query  178  AMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEP  357
            A +  P +     + ++P +  +PT    P+  E PA +  P +     K ++PA+  +P
Sbjct  866  AEVEAPVVTEQAAEIEAPVVTEQPTKVEAPVVTEQPAKVEAPVVTEQPAKVEAPAVTEQP  925

Query  358  TMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
                 P+  + PA +  P +   P K ++P +  +P     P+
Sbjct  926  AKVEAPVVTEQPAKVEAPVVTEQPAKVEAPVVTEQPAKVEAPV  968



>gb|EMC77394.1| putative serine/threonine-protein kinase kinX [Columba livia]
Length=703

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 32/119 (27%), Positives = 47/119 (39%), Gaps = 0/119 (0%)
 Frame = +1

Query  130  PITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTM  309
            P+ ++    P+  + P  L EP     P+  + P  L EP     P+  E P  L EP  
Sbjct  139  PVGLVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVG  198

Query  310  PNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
                +  + P  L EP     P+  + P  L EP     P+  + P  L EP     P+
Sbjct  199  LEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPV  257


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 35/128 (27%), Positives = 49/128 (38%), Gaps = 7/128 (5%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  L EP     P+  + P  L EP     P+  E P  L EP      +  + 
Sbjct  196  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEE  255

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSP------  498
            P  L EP     P+  + P  L EP     P+  + P  L EP     P+          
Sbjct  256  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLVG  315

Query  499  -EQ*SLWH  519
             E+ +LWH
Sbjct  316  LEELALWH  323


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 43/110 (39%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  L EP     P+  + P  L EP     P+  E P  L EP      +  + 
Sbjct  154  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEE  213

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  L EP     P+  + P  L EP     P+  + P  L EP     P+
Sbjct  214  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPV  263


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 43/110 (39%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  L EP     P+  + P  L EP     P+  E P  L EP      +  + 
Sbjct  160  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEE  219

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  L EP     P+  + P  L EP     P+  + P  L EP     P+
Sbjct  220  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPV  269


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 43/110 (39%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  L EP     P+  + P  L EP     P+  E P  L EP      +  + 
Sbjct  166  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEE  225

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  L EP     P+  + P  L EP     P+  + P  L EP     P+
Sbjct  226  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPV  275


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 43/110 (39%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  L EP     P+  + P  L EP     P+  E P  L EP      +  + 
Sbjct  172  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEE  231

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  L EP     P+  + P  L EP     P+  + P  L EP     P+
Sbjct  232  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPV  281


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 43/110 (39%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  L EP     P+  + P  L EP     P+  E P  L EP      +  + 
Sbjct  178  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEE  237

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  L EP     P+  + P  L EP     P+  + P  L EP     P+
Sbjct  238  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPV  287


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 43/110 (39%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  L EP     P+  + P  L EP     P+  E P  L EP      +  + 
Sbjct  184  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEE  243

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  L EP     P+  + P  L EP     P+  + P  L EP     P+
Sbjct  244  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPV  293


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 43/110 (39%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  L EP     P+  + P  L EP     P+  E P  L EP      +  + 
Sbjct  190  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEE  249

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  L EP     P+  + P  L EP     P+  + P  L EP     P+
Sbjct  250  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPV  299



>gb|EFB22434.1| hypothetical protein PANDA_020193 [Ailuropoda melanoleuca]
Length=122

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 53/105 (50%), Gaps = 0/105 (0%)
 Frame = +1

Query  169  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
             +P   + PT+P  P    +P  LS PT+P  P    +P + + PT+        +P +L
Sbjct  6    TAPGAPTAPTIPTAPTVPTAPTALSAPTIPTAPTILTAPTIPTAPTILTAPTIPTAPTIL  65

Query  349  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            + PT+P  P    +P + + PT+ + P    +P +L+ PT+P  P
Sbjct  66   TAPTIPTAPTILTAPTIPTAPTILTAPTIPTAPTILTAPTIPTAP  110


 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 55/111 (50%), Gaps = 6/111 (5%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P    +P  LS PT+P       +P +L+ PT+P  P    +P + + PT+       
Sbjct  18   TAPTVPTAPTALSAPTIPT------APTILTAPTIPTAPTILTAPTIPTAPTILTAPTIP  71

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             +P +L+ PT+P  P    +P + + PT+ + P    +P +L+ PT+P  P
Sbjct  72   TAPTILTAPTIPTAPTILTAPTIPTAPTILTAPTIPTAPTILTAPTIPTAP  122



>ref|WP_016527324.1| adherence-associated mucus-binding protein,LPXTG-motif cell wall 
anchor [Lactobacillus plantarum]
 gb|AGO09071.1| adherence-associated mucus-binding protein,LPXTG-motif cell wall 
anchor [Lactobacillus plantarum 16]
Length=1357

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 41/95 (43%), Gaps = 6/95 (6%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             EP  P  P + + P    +P+ P  P   E P+   EP  P      + P+   EP  P 
Sbjct  1163  EPGQPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHP------EQPSQPEEPGHPE  1216

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
              P + + P    +P+ P  P + + P  L +P+ P
Sbjct  1217  QPSQPEEPGQHEQPSQPEEPGQSEKPGELQKPSQP  1251


 Score = 52.0 bits (123),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 23/89 (26%), Positives = 40/89 (45%), Gaps = 0/89 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + P+   EP  P  P + + P    +P+ P  P   E P+   EP  P    + + 
Sbjct  1164  PGQPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEE  1223

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPS  423
             P    +P+ P  P + + P  L +P+ P+
Sbjct  1224  PGQHEQPSQPEEPGQSEKPGELQKPSQPA  1252



>gb|KEK46499.1| LPXTG cell wall anchor domain protein, partial [Staphylococcus 
warneri Lyso 1 2011]
Length=1859

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 33/112 (29%), Positives = 49/112 (44%), Gaps = 0/112 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             HP    +P   ++P+ P  P     P   S+PT P +P +   P+  +EPT P       
Sbjct  1610  HPTDPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPS  1669

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
              P   + P  P  P +   P    EPT PS P +  +P   ++P+ P  P N
Sbjct  1670  QPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTN  1721


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 33/112 (29%), Positives = 48/112 (43%), Gaps = 0/112 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             HP     P   ++P+ P  P     P   S+PT P +P +   P+  +EPT P       
Sbjct  1595  HPTDPTDPGKPTDPSHPTDPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPS  1654

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
              P   + P  P  P +   P    EPT PS P +  +P   ++P+ P  P N
Sbjct  1655  QPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTN  1706


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 33/112 (29%), Positives = 48/112 (43%), Gaps = 0/112 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P +  +P   ++P+ P  P     P   S+PT P +P +   P+  +EPT P       
Sbjct  1640  QPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPS  1699

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
              P   + P  P  P +   P    EPT PS P +  +P   +EP  P  P N
Sbjct  1700  QPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTEPGQPTEPTN  1751


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 32/112 (29%), Positives = 49/112 (44%), Gaps = 0/112 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P +  +P   ++P+ P  P     P   S+PT P +P +   P+  +EPT P       
Sbjct  1625  QPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPS  1684

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
              P   + P  P  P +   P    EPT PS P +  +P   ++P+ P  P N
Sbjct  1685  QPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTN  1736


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 33/114 (29%), Positives = 52/114 (46%), Gaps = 0/114 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             +P +   P+  +EPT P  P     P   + P  P  P +   P    EPT P+   +  
Sbjct  1616  NPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPT  1675

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  495
             +P   ++P+ P  P     P   S+PT P++P +   P+  +EPT P  P + S
Sbjct  1676  NPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPS  1729


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 0/110 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             +P +   P+  +EPT P  P     P   + P  P  P +   P    EPT P+   +  
Sbjct  1631  NPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPT  1690

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             +P   ++P+ P  P     P   S+PT P++P +   P+  +EPT P  P
Sbjct  1691  NPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEP  1740


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 49/110 (45%), Gaps = 0/110 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             +P +   P+  +EPT P  P     P   + P  P  P +   P    EPT P+   +  
Sbjct  1646  NPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPT  1705

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             +P   ++P+ P  P     P   S+PT P++P +   P   +EPT P  P
Sbjct  1706  NPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTEPGQPTEPTNPGEP  1755


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 32/112 (29%), Positives = 47/112 (42%), Gaps = 0/112 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P +  +P   ++P+ P  P     P   S+PT P +P +   P+  +EPT P       
Sbjct  1655  QPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPS  1714

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
              P   + P  P  P +   P    EPT P  P +  +P   +EP  P  P N
Sbjct  1715  QPTEPTNPGEPTDPSQPTEPTNPGEPTEPGQPTEPTNPGEPTEPGQPAEPTN  1766


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 56/120 (47%), Gaps = 3/120 (3%)
 Frame = +1

Query  136   TMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPN  315
             T++ +  P+    P   ++P  P  P     P    +PT P+HP    +P    EPT P+
Sbjct  1568  TVIDDGKPVDPSQPTDPTDPGKPTDPSHPTDPTDPGKPTDPSHPTDPTNPG---EPTDPS  1624

Query  316   YHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  495
                +  +P   ++P+ P  P     P   S+PT P++P +   P+  +EPT P  P + S
Sbjct  1625  QPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPS  1684



>ref|XP_001622881.1| predicted protein [Nematostella vectensis]
 gb|EDO30781.1| predicted protein, partial [Nematostella vectensis]
Length=148

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 62/106 (58%), Gaps = 6/106 (6%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
            HP     P+++S P++ +HP     P+++S P++ +HP     P+++S P++        
Sbjct  1    HPSLISHPSLISHPSLISHPFLISHPSLISHPSLISHPSLISHPSLISHPSL------IS  54

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  471
             P+++S P++ +HP     P+++S P++ SHP     P+++S P++
Sbjct  55   HPSLISHPSLISHPSLISHPSLISHPSLISHPSLISHPSLISHPSL  100



>gb|AHM26124.1| RGI orf47L-like protein [Frog virus 3]
Length=187

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 37/102 (36%), Gaps = 0/102 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+K  SP     P     P+K  SP     P     P+K +SP     P      +K  S
Sbjct  78   PVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKS  137

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  462
            P     P     P+K  SP     P     P+K  SPA   +
Sbjct  138  PVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPAKRRQ  179


 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 38/114 (33%), Gaps = 1/114 (1%)
 Frame = +1

Query  148  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  327
               PLK  S  M + P     P+K  SP     P     P+K +SP     P      +K
Sbjct  64   KRSPLKKRS-QMRTSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVK  122

Query  328  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
              SP     P     P+K  SP     P     P+K  SP     P     P  
Sbjct  123  RKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPAK  176



>ref|XP_004916500.1| PREDICTED: salivary glue protein Sgs-4-like [Xenopus (Silurana) 
tropicalis]
Length=282

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 63/105 (60%), Gaps = 5/105 (5%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P  +  P+M SEP+M + P  +  P+M SEP+M + P  +  P+M SEP+M       + 
Sbjct  176  PSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSM-----HSEP  230

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  471
            P+M SEP+M + P  +  P+M SEP+M S P  +  P+M SEP+M
Sbjct  231  PSMHSEPSMHSEPSMHSEPSMHSEPSMYSEPSMHSEPSMHSEPSM  275


 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 67/111 (60%), Gaps = 7/111 (6%)
 Frame = +1

Query  160  LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTM---PNYHLK-  327
            +  + P+M SEP+M + P  +  P+M SEP+M + P  +  P+M SEP+M   P+ H + 
Sbjct  159  MHSEPPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEP  218

Query  328  --YDSPAMLSE-PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  471
              +  P+M SE P+M + P  +  P+M SEP+M S P  Y  P+M SEP+M
Sbjct  219  SMHSEPSMHSEPPSMHSEPSMHSEPSMHSEPSMHSEPSMYSEPSMHSEPSM  269


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 67/120 (56%), Gaps = 15/120 (13%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTM---PNYH--  321
            P  +  P+M SEP+M + P  +  P+M SEP+M + P  +  P+M SEP+M   P+ H  
Sbjct  5    PSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSMHSE  64

Query  322  ----------LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  471
                      +  + P+M SEP+M + P  +  P+M SEP+M S P  +  P+M SEP+M
Sbjct  65   PPSMHSEPPSMHSEPPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSM  124



>gb|AJI79873.1| hypothetical protein CSING_11890 [Corynebacterium singulare]
Length=1947

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 34/104 (33%), Positives = 46/104 (44%), Gaps = 0/104 (0%)
 Frame = +1

Query  172   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLS  351
             +P    E T PN P +  +P    E T PN P +  +P    E T PN   +  +P    
Sbjct  1712  TPNKPGEETTPNKPGEETTPNKPGEETTPNKPGEETTPNKPGEETTPNKPGEETTPNKPG  1771

Query  352   EPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             E T PN P +  +P    E T P+ P +  +P    E T PN P
Sbjct  1772  EETTPNKPGEETTPNKPGEETTPNKPGEETTPNKPGEETTPNKP  1815


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 32/96 (33%), Positives = 43/96 (45%), Gaps = 0/96 (0%)
 Frame = +1

Query  196   TMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHP  375
             T PN P +  +P    E T PN P +  +P    E T PN   +  +P    E T PN P
Sbjct  1711  TTPNKPGEETTPNKPGEETTPNKPGEETTPNKPGEETTPNKPGEETTPNKPGEETTPNKP  1770

Query  376   LKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              +  +P    E T P+ P +  +P    E T PN P
Sbjct  1771  GEETTPNKPGEETTPNKPGEETTPNKPGEETTPNKP  1806



>ref|WP_024596135.1| ribonuclease [Pseudoalteromonas haloplanktis]
Length=1085

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 42/110 (38%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+K   PA    P     P+K ++P    EP     P+  E PA    P       K ++
Sbjct  865  PVKAKEPAKAETPVATEEPVKVETPVATEEPAKVETPVATEEPAKAETPVATEEPAKVET  924

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P    EP     P+  + PA    P     P K ++PA   EP     P+
Sbjct  925  PVATEEPDKVETPVATEEPAKAETPVATKEPAKAETPAATEEPAKVETPV  974


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 45/120 (38%), Gaps = 0/120 (0%)
 Frame = +1

Query  124  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
            A+  T +    P+K ++P    EP     P+  + PA    P     P K E+P    EP
Sbjct  872  AKAETPVATEEPVKVETPVATEEPAKVETPVATEEPAKAETPVATEEPAKVETPVATEEP  931

Query  304  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
                  +  + PA    P     P K ++PA   EP     P+  +  A    P +   P
Sbjct  932  DKVETPVATEEPAKAETPVATKEPAKAETPAATEEPAKVETPVATEESAKAETPVVTEEP  991


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/116 (24%), Positives = 41/116 (35%), Gaps = 0/116 (0%)
 Frame = +1

Query  136   TMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPN  315
             T +    P K ++P    EP     P+  + PA +  P     P K E+P    EP    
Sbjct  888   TPVATEEPAKVETPVATEEPAKAETPVATEEPAKVETPVATEEPDKVETPVATEEPAKAE  947

Query  316   YHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
               +    PA    P     P K ++P    E      P+  + PA +  P     P
Sbjct  948   TPVATKEPAKAETPAATEEPAKVETPVATEESAKAETPVVTEEPAKVETPVATEEP  1003


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 26/110 (24%), Positives = 39/110 (35%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +  P     P K ++P    EP     P+  E PA +  P       K ++
Sbjct  877  PVATEEPVKVETPVATEEPAKVETPVATEEPAKAETPVATEEPAKVETPVATEEPDKVET  936

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P    EP     P+    PA    P     P K ++P    E      P+
Sbjct  937  PVATEEPAKAETPVATKEPAKAETPAATEEPAKVETPVATEESAKAETPV  986



>ref|WP_010557308.1| ribonuclease [Pseudoalteromonas marina]
 gb|ERG24786.1| RNase E [Pseudoalteromonas marina mano4]
Length=1052

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/101 (25%), Positives = 41/101 (41%), Gaps = 0/101 (0%)
 Frame = +1

Query  160  LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSP  339
            +K + P    EP     P++ + P    EP     P++ E P    EP      ++ + P
Sbjct  857  VKAEEPVKTEEPVKAEEPVQTEEPVQTEEPVQTEEPVQTEEPVKAEEPVQAEELVQAEEP  916

Query  340  AMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  462
                EP     P++ + P    EP      +K D PA+ +E
Sbjct  917  VQTEEPVQAEEPVQAEEPVKAEEPVKAEESVKADEPALEAE  957



>ref|XP_005531742.1| PREDICTED: collagen alpha-1(XXIV) chain-like [Pseudopodoces humilis]
Length=202

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 47/104 (45%), Gaps = 0/104 (0%)
 Frame = -1

Query  473  GIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**FGIVGSD  294
            GI G   I GES   G  G+ G   I GES  +G  GI G   I GES      GI G  
Sbjct  53   GIRGESGICGESGICGESGVHGKSGIHGESGIRGESGICGESGIHGESGIHGESGIRGES  112

Query  293  SIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
             I G+S   G  GI G     GES  +G  GI G   I GES  
Sbjct  113  RIHGESRIHGKSGIPGESGSRGESGIRGESGIRGESRIHGESRI  156


 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 47/105 (45%), Gaps = 0/105 (0%)
 Frame = -1

Query  473  GIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**FGIVGSD  294
            G+ G   I GES  +G  GI G   I GES   G  GI G   I GES      GI G  
Sbjct  71   GVHGKSGIHGESGIRGESGICGESGIHGESGIHGESGIRGESRIHGESRIHGKSGIPGES  130

Query  293  SIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  159
               G+S  +G  GI G   I GES   G  GI G     GES  +
Sbjct  131  GSRGESGIRGESGIRGESRIHGESRIHGKSGIPGESGSRGESGIR  175


 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 47/106 (44%), Gaps = 0/106 (0%)
 Frame = -1

Query  476  FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**FGIVGS  297
             GI G   I G+S   G  GI G   I GES   G  G+ G   I GES  +   GI G 
Sbjct  34   LGICGESGIRGKSGVHGKSGIRGESGICGESGICGESGVHGKSGIHGESGIRGESGICGE  93

Query  296  DSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  159
              I G+S   G  GI G   I GES   G  GI G     GES  +
Sbjct  94   SGIHGESGIHGESGIRGESRIHGESRIHGKSGIPGESGSRGESGIR  139


 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 52/114 (46%), Gaps = 1/114 (1%)
 Frame = -1

Query  497  GDPFK-G*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  321
            GDP   G  G VG+  I GES  +G  G+ G   I GES   G  GI G   + G+S   
Sbjct  20   GDPGSVGNLGSVGNLGICGESGIRGKSGVHGKSGIRGESGICGESGICGESGVHGKSGIH  79

Query  320  **FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  159
               GI G   I G+S   G  GI G   I GES   G   I G   I GES  +
Sbjct  80   GESGIRGESGICGESGIHGESGIHGESGIRGESRIHGESRIHGKSGIPGESGSR  133


 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 48/109 (44%), Gaps = 0/109 (0%)
 Frame = -1

Query  488  FKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**FG  309
             +G  G+ G   I GES   G  GI G   + G+S   G  GI G   I GES      G
Sbjct  42   IRGKSGVHGKSGIRGESGICGESGICGESGVHGKSGIHGESGIRGESGICGESGIHGESG  101

Query  308  IVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
            I G   I G+S   G   I G   I GES  +G  GI G   I GES  
Sbjct  102  IHGESGIRGESRIHGESRIHGKSGIPGESGSRGESGIRGESGIRGESRI  150


 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 44/99 (44%), Gaps = 0/99 (0%)
 Frame = -1

Query  488  FKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**FG  309
             +G  GI G   I GES   G  GI G   I GES   G  GI G     GES  +   G
Sbjct  84   IRGESGICGESGIHGESGIHGESGIRGESRIHGESRIHGKSGIPGESGSRGESGIRGESG  143

Query  308  IVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVG  192
            I G   I G+S   G  GI G     GES  +G  GI G
Sbjct  144  IRGESRIHGESRIHGKSGIPGESGSRGESGIRGESGIRG  182



>ref|XP_011194718.1| PREDICTED: uncharacterized protein LOC105220036, partial [Bactrocera 
cucurbitae]
Length=879

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 32/107 (30%), Positives = 51/107 (48%), Gaps = 6/107 (6%)
 Frame = +1

Query  169  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
            + P + ++PT P+ P +  +P+   +PT P  P+   +P   +EP+ P        P+  
Sbjct  697  EPPVIPTDPTEPSKPTEPTTPSEPEKPTEPTTPIDPGTPVEPTEPSDPT------EPSQP  750

Query  349  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
            +EPT P+ P K  +P    EPT P  P K   P     P  P  P++
Sbjct  751  TEPTTPSEPEKPVTPEQPKEPTQPVIPEKPAEPETPKTPEQPTKPID  797



>ref|XP_008310537.1| PREDICTED: protein SPT2 homolog isoform X2 [Cynoglossus semilaevis]
Length=752

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 35/103 (34%), Gaps = 0/103 (0%)
 Frame = +1

Query  175  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  354
            P + S+P MP  P     P M  EP MP  P   + P M   P M         P M   
Sbjct  529  PGLSSQPGMPQRPGIQQRPGMPQEPGMPQRPGMQQGPGMQQGPGMQQGPGMQQRPGMQQR  588

Query  355  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            P M   P     P M   P M   P     P M   P M   P
Sbjct  589  PGMQQRPGMQQRPGMQQRPGMQQRPGMQQGPGMQQRPGMQQRP  631



>ref|XP_008310536.1| PREDICTED: protein SPT2 homolog isoform X1 [Cynoglossus semilaevis]
Length=753

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 35/103 (34%), Gaps = 0/103 (0%)
 Frame = +1

Query  175  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  354
            P + S+P MP  P     P M  EP MP  P   + P M   P M         P M   
Sbjct  530  PGLSSQPGMPQRPGIQQRPGMPQEPGMPQRPGMQQGPGMQQGPGMQQGPGMQQRPGMQQR  589

Query  355  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            P M   P     P M   P M   P     P M   P M   P
Sbjct  590  PGMQQRPGMQQRPGMQQRPGMQQRPGMQQGPGMQQRPGMQQRP  632



>gb|EMC77213.1| Ovarian abundant message protein, partial [Columba livia]
Length=190

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 47/110 (43%), Gaps = 1/110 (1%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAML-SEPTMPNYHLKYD  333
            P     P +L  PT+  +P     P +L   T P HP     P +L   PT+  +     
Sbjct  81   PTVLGHPTLLGHPTLSGYPTLLRHPTILGHLTSPGHPTLLGHPTLLLGHPTLLGHPTSPG  140

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              A+L  PT+  HP     P +L  PT P HP     P +  +PT+  HP
Sbjct  141  HSAILGYPTVQRHPTLLGHPTILGHPTSPGHPTLLGHPTLSGQPTLLGHP  190


 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 45/105 (43%), Gaps = 6/105 (6%)
 Frame = +1

Query  190  EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             PT+  HP     P +L  PT P H      P +L  PT+   H     P +L  PT+  
Sbjct  1    HPTLLGHPTVLGHPTVLGHPTSPGHSTILGYPTVLEHPTLLGQH-----PTLLENPTLLE  55

Query  370  HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP-LNGSPE  501
            HP     P +L  P  P H      P +L  PT+  HP L+G P 
Sbjct  56   HPNVLGHPTILGHPASPGHSTILGDPTVLGHPTLLGHPTLSGYPT  100


 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 47/110 (43%), Gaps = 1/110 (1%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHP-LKYESPAMLSEPTMPNYHLKY  330
            HP     P +L  PT+  HP       +L  PT+  HP L  + P +L  PT+  +    
Sbjct  1    HPTLLGHPTVLGHPTVLGHPTSPGHSTILGYPTVLEHPTLLGQHPTLLENPTLLEHPNVL  60

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNH  480
              P +L  P  P H      P +L  PT+  HP     P +L  PT+  H
Sbjct  61   GHPTILGHPASPGHSTILGDPTVLGHPTLLGHPTLSGYPTLLRHPTILGH  110


 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 46/115 (40%), Gaps = 7/115 (6%)
 Frame = +1

Query  160  LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNH------PLKYESPAMLSEPTMPNYH  321
            L    P +L  PT+  HP     P +L  P  P H      P     P +L  PT+  Y 
Sbjct  40   LLGQHPTLLENPTLLEHPNVLGHPTILGHPASPGHSTILGDPTVLGHPTLLGHPTLSGYP  99

Query  322  LKYDSPAMLSEPTMPNHPLKYDSPA-MLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
                 P +L   T P HP     P  +L  PT+  HP      A+L  PT+  HP
Sbjct  100  TLLRHPTILGHLTSPGHPTLLGHPTLLLGHPTLLGHPTSPGHSAILGYPTVQRHP  154


 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 45/119 (38%), Gaps = 13/119 (11%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNH-------------PLKYDSPAMLSEPTMPNHPLKYESPAML  294
            HP     P +L  PT P H              L    P +L  PT+  HP     P +L
Sbjct  7    HPTVLGHPTVLGHPTSPGHSTILGYPTVLEHPTLLGQHPTLLENPTLLEHPNVLGHPTIL  66

Query  295  SEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  471
              P  P +      P +L  PT+  HP     P +L  PT+  H      P +L  PT+
Sbjct  67   GHPASPGHSTILGDPTVLGHPTLLGHPTLSGYPTLLRHPTILGHLTSPGHPTLLGHPTL  125



>ref|WP_034092386.1| hypothetical protein, partial [Streptacidiphilus albus]
Length=144

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 53/103 (51%), Gaps = 3/103 (3%)
 Frame = +1

Query  175  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  354
            PA+ + PT+P  P     PA+ +EPT P  P     PA+ +EPT P        PA+ +E
Sbjct  27   PAVPTVPTVPAVPTAPTVPAVPTEPTEPTAPTAPTVPAVPTEPTEPTAPTAPTVPAVPTE  86

Query  355  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            PT P  P     PA+   PT+P+ P     PA+ + PT P+ P
Sbjct  87   PTEPTAPTAPTVPAV---PTVPTEPTARTVPAVPTAPTEPSAP  126


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 53/103 (51%), Gaps = 6/103 (6%)
 Frame = +1

Query  175  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  354
            PA+ +EPT P  P     PA+ +EPT P  P     PA+ +EPT P        PA+   
Sbjct  45   PAVPTEPTEPTAPTAPTVPAVPTEPTEPTAPTAPTVPAVPTEPTEPTAPTAPTVPAV---  101

Query  355  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            PT+P  P     PA+ + PT PS P    +PA+ + PT+P  P
Sbjct  102  PTVPTEPTARTVPAVPTAPTEPSAP---TAPAVPTAPTVPAVP  141



>gb|EKB57246.1| LPXTG-domain-containing protein cell wall anchor domain, partial 
[Facklamia ignava CCUG 37419]
Length=432

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 41/105 (39%), Gaps = 0/105 (0%)
 Frame = +1

Query  169  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
            D P    +P MP+ P   D P    EP  P+ P   + P M  EP  P+     D P   
Sbjct  263  DEPDTPDKPGMPDEPGTPDEPGTPDEPGTPDEPGTPDKPGMPDEPGTPDEQGTPDEPGTP  322

Query  349  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             EP  P+     D P    EP  P  P   D P    EP  P+ P
Sbjct  323  DEPGTPDESGTPDEPGTPDEPGTPDEPGTPDEPGTPDEPGTPDEP  367


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 45/111 (41%), Gaps = 8/111 (7%)
 Frame = +1

Query  172  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLS  351
             P +  EP  P+ P   D P    EP  P+ P   + P M  EP  P      D P    
Sbjct  234  DPEIRDEPGTPDEPGTPDEPGTPDEPGTPDEPDTPDKPGMPDEPGTP------DEPGTPD  287

Query  352  EPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
            EP  P+ P   D P M  EP  P      D P    EP  P+   +G+P++
Sbjct  288  EPGTPDEPGTPDKPGMPDEPGTPDEQGTPDEPGTPDEPGTPDE--SGTPDE  336


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 44/112 (39%), Gaps = 8/112 (7%)
 Frame = +1

Query  169  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
            D P    EP  P+ P   D P M  EP  P+ P   + P    EP  P      D P M 
Sbjct  251  DEPGTPDEPGTPDEPDTPDKPGMPDEPGTPDEPGTPDEPGTPDEPGTP------DKPGMP  304

Query  349  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
             EP  P+     D P    EP  P      D P    EP  P+ P  G+P++
Sbjct  305  DEPGTPDEQGTPDEPGTPDEPGTPDESGTPDEPGTPDEPGTPDEP--GTPDE  354



>gb|KDS93254.1| surface protein [Dermabacter hominis 1368]
Length=1384

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 32/111 (29%), Positives = 44/111 (40%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P + + P    EP  P  P K + P    +P  P  P +   P    EP  P    + +
Sbjct  1239  QPGEPEQPGQPEEPGKPGQPGKPEQPGKPGQPEQPGKPEQPGEPEQPGEPEQPGKPGQPE  1298

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P    +P  P  P K + P    +P  P  P K   PA  S+P+ P  PL
Sbjct  1299  EPGKPEQPGQPEEPGKPEQPGKPEQPGQPEQPAKPADPAHPSKPSKPGLPL  1349


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 29/109 (27%), Positives = 42/109 (39%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P K + P    +P  P  P K   P    +P  P  P +   P    EP  P    +   
Sbjct  1234  PGKPEQPGEPEQPGQPEEPGKPGQPGKPEQPGKPGQPEQPGKPEQPGEPEQPGEPEQPGK  1293

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             P    EP  P  P + + P    +P  P  P + + PA  ++P  P+ P
Sbjct  1294  PGQPEEPGKPEQPGQPEEPGKPEQPGKPEQPGQPEQPAKPADPAHPSKP  1342


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 39/105 (37%), Gaps = 8/105 (8%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             EP  P  P + + P    EP  P  P K E P    +P  P        P    EP  P 
Sbjct  1233  EPGKPEQPGEPEQPGQPEEPGKPGQPGKPEQPGKPGQPEQPG------KPEQPGEPEQPG  1286

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
              P +   P    EP  P  P + + P    +P  P  P  G PEQ
Sbjct  1287  EPEQPGKPGQPEEPGKPEQPGQPEEPGKPEQPGKPEQP--GQPEQ  1329



>ref|WP_039162097.1| hypothetical protein, partial [Gallibacterium anatis]
 gb|KGQ23242.1| hypothetical protein JP33_10920, partial [Gallibacterium anatis 
CCM5995]
Length=1018

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+    P + ++P     P+  + PA  ++P + N P+    P + ++P +    +  +
Sbjct  905   QPVAETQPVVTNQPVAETQPVVANQPAAETQPVVANQPVVETQPVVANQPAVETQPVVAN  964

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P + N P+    P + ++P + + P+    P + ++P     P+
Sbjct  965   QPVVETQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPV  1015


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/108 (20%), Positives = 50/108 (46%), Gaps = 0/108 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P   ++P + N P     P + ++P +   P+    PA+ ++P + N  +   
Sbjct  911   QPVVTNQPVAETQPVVANQPAAETQPVVANQPVVETQPVVANQPAVETQPVVANQPVVET  970

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPN  477
              P + ++P +   P     P + ++P + + P+  + PA   +P + N
Sbjct  971   QPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVAN  1018


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 50/111 (45%), Gaps = 6/111 (5%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+    P   ++P + N P+    P + ++P     P+    P + ++P + N      
Sbjct  899   QPVAETQPVAETQPVVTNQPVAETQPVVANQPAAETQPVVANQPVVETQPVVAN------  952

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              PA+ ++P + N P+    P + ++P + + P     P + ++P +   P+
Sbjct  953   QPAVETQPVVANQPVVETQPVVTNQPVVETQPEVATQPVVANQPVVEAQPV  1003



>ref|WP_028835759.1| ribonuclease [Pseudoalteromonas sp. 6BO_GOM-1096m]
Length=1072

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 38/100 (38%), Gaps = 0/100 (0%)
 Frame = +1

Query  163  KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPA  342
            K + P    EP     P+K + P    EP     P+K E P    EP      +K + P 
Sbjct  859  KVEEPVKAEEPVKAEEPVKTEEPVKTDEPVKTVEPVKAEEPVQAEEPVKAEELVKTEEPV  918

Query  343  MLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  462
               EP     P++ + P    EP     P+K + P    E
Sbjct  919  KAEEPVKAEEPVQAEEPVKTEEPVKAEEPVKAEEPVKAEE  958


 Score = 52.0 bits (123),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 26/93 (28%), Positives = 36/93 (39%), Gaps = 0/93 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+K + P    EP     P+K D P    EP     P++ E P    E       +K + 
Sbjct  863  PVKAEEPVKAEEPVKTEEPVKTDEPVKTVEPVKAEEPVQAEEPVKAEELVKTEEPVKAEE  922

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLK  435
            P    EP     P+K + P    EP     P+K
Sbjct  923  PVKAEEPVQAEEPVKTEEPVKAEEPVKAEEPVK  955


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 37/96 (39%), Gaps = 0/96 (0%)
 Frame = +1

Query  178  AMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEP  357
            A + EP     P+K + P    EP   + P+K   P    EP      +K +      EP
Sbjct  858  AKVEEPVKAEEPVKAEEPVKTEEPVKTDEPVKTVEPVKAEEPVQAEEPVKAEELVKTEEP  917

Query  358  TMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  465
                 P+K + P    EP     P+K + P    EP
Sbjct  918  VKAEEPVKAEEPVQAEEPVKTEEPVKAEEPVKAEEP  953



>ref|WP_010188733.1| hypothetical protein, partial [Corynebacterium aurimucosum]
Length=264

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 49/109 (45%), Gaps = 0/109 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P +  +P    E T PN P +  +P    E T PN+P +  +P    E T PN   +  +
Sbjct  8    PTEETTPNNPGEETTPNEPGEETTPNQPGEETTPNNPGEETTPNQPGEETTPNQPGEETT  67

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            P    E T PN P +  +P    E T P+ P +  +P    E T PN P
Sbjct  68   PNNPGEETTPNQPGEETTPNNPGEETTPNQPGEETTPNNPGEETTPNEP  116



>ref|WP_018346332.1| hypothetical protein [Gallibacterium anatis]
Length=747

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 56/112 (50%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
            + P     P + ++P     P+  + PA+ ++P + N P+    P + ++P +    +  
Sbjct  237  NQPAAEVQPVVANQPAAEVQPVVANQPAVETQPVVANQPVVETQPVVTNQPVVETQPVVT  296

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            + P + ++P + N P+    P + ++P + + P+  + P + ++P + N P+
Sbjct  297  NQPVVETQPVVTNQPVVETQPVVTNQPAVETQPVVANQPVVETQPVVANQPV  348


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+    P + ++P     P+  + PA  ++P + N P     P + ++P      +  +
Sbjct  202  QPVVETQPVVANQPVAETQPVVANQPAAETQPEVANQPAAEVQPVVANQPAAEVQPVVAN  261

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             PA+ ++P + N P+    P + ++P + + P+  + P + ++P + N P+
Sbjct  262  QPAVETQPVVANQPVVETQPVVTNQPVVETQPVVTNQPVVETQPVVTNQPV  312


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/115 (21%), Positives = 53/115 (46%), Gaps = 0/115 (0%)
 Frame = +1

Query  142  MPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYH  321
            M  + P   D P + ++P +   P+    P + ++P + N P+    P + ++P      
Sbjct  174  MVANQPAVEDQPVVANQPAVEAQPVAETQPVVETQPVVANQPVAETQPVVANQPAAETQP  233

Query  322  LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
               + PA   +P + N P     P + ++P + + P+  + P + ++P + N P+
Sbjct  234  EVANQPAAEVQPVVANQPAAEVQPVVANQPAVETQPVVANQPVVETQPVVTNQPV  288


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/112 (21%), Positives = 54/112 (48%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
            + P     P + ++P     P+  + PA   +P + N P     P + ++P +    +  
Sbjct  225  NQPAAETQPEVANQPAAEVQPVVANQPAAEVQPVVANQPAVETQPVVANQPVVETQPVVT  284

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            + P + ++P + N P+    P + ++P + + P+  + PA+ ++P + N P+
Sbjct  285  NQPVVETQPVVTNQPVVETQPVVTNQPVVETQPVVTNQPAVETQPVVANQPV  336


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/106 (20%), Positives = 54/106 (51%), Gaps = 0/106 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + PA+ ++P + N P+    P + ++P +   P+    P + ++P + N  +   
Sbjct  256  QPVVANQPAVETQPVVANQPVVETQPVVTNQPVVETQPVVTNQPVVETQPVVTNQPVVET  315

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  471
             P + ++P +   P+  + P + ++P + + P+  D P + ++P +
Sbjct  316  QPVVTNQPAVETQPVVANQPVVETQPVVANQPVVEDQPEVATQPVV  361


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
            + P+    P + ++P     P   + PA   +P + N P     P + ++P +    +  
Sbjct  213  NQPVAETQPVVANQPAAETQPEVANQPAAEVQPVVANQPAAEVQPVVANQPAVETQPVVA  272

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            + P + ++P + N P+    P + ++P + + P+  + P + ++P + N P
Sbjct  273  NQPVVETQPVVTNQPVVETQPVVTNQPVVETQPVVTNQPVVETQPVVTNQP  323


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/112 (18%), Positives = 53/112 (47%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
            + P     P + ++P +   P+  + P + ++P + N P+    P + ++P +    +  
Sbjct  249  NQPAAEVQPVVANQPAVETQPVVANQPVVETQPVVTNQPVVETQPVVTNQPVVETQPVVT  308

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            + P + ++P + N P     P + ++P + + P+  + P +  +P +   P+
Sbjct  309  NQPVVETQPVVTNQPAVETQPVVANQPVVETQPVVANQPVVEDQPEVATQPV  360


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/111 (23%), Positives = 50/111 (45%), Gaps = 6/111 (5%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
            H +  + PA+  +P + N P     P   ++P +   P+    P   ++P + N      
Sbjct  172  HNMVANQPAVEDQPVVANQPAVEAQPVAETQPVVETQPVVANQPVAETQPVVAN------  225

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             PA  ++P + N P     P + ++P     P+  + PA+ ++P + N P+
Sbjct  226  QPAAETQPEVANQPAAEVQPVVANQPAAEVQPVVANQPAVETQPVVANQPV  276


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 50/112 (45%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
            + P     P   ++P +   P+  + P   ++P + N P     P + ++P      +  
Sbjct  189  NQPAVEAQPVAETQPVVETQPVVANQPVAETQPVVANQPAAETQPEVANQPAAEVQPVVA  248

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            + PA   +P + N P     P + ++P + + P+  + P + ++P + N P+
Sbjct  249  NQPAAEVQPVVANQPAVETQPVVANQPVVETQPVVTNQPVVETQPVVTNQPV  300



>ref|WP_024590363.1| MULTISPECIES: ribonuclease [Pseudoalteromonas]
Length=1043

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/109 (26%), Positives = 44/109 (40%), Gaps = 0/109 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P K  +P +  EP     P+  + PA +  P     P K E+P    EP      +  + 
Sbjct  867  PAKVGAPVVTEEPAKVETPVATEEPAKVETPVATEEPAKVETPVATEEPAKVETPVVTEE  926

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            PA +  P     P K ++P +  EP     P+  ++PA    P +   P
Sbjct  927  PAKVEAPVATEEPAKVETPVVTEEPAKVETPVVTEAPAKTETPVVTKAP  975


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/106 (25%), Positives = 44/106 (42%), Gaps = 0/106 (0%)
 Frame = +1

Query  169  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
            + PA +  P +   P K ++P    EP     P+  E PA +  P       K ++P + 
Sbjct  865  EEPAKVGAPVVTEEPAKVETPVATEEPAKVETPVATEEPAKVETPVATEEPAKVETPVVT  924

Query  349  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             EP     P+  + PA +  P +   P K ++P +   P     P+
Sbjct  925  EEPAKVEAPVATEEPAKVETPVVTEEPAKVETPVVTEAPAKTETPV  970


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 28/113 (25%), Positives = 46/113 (41%), Gaps = 0/113 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + PA +  P     P K ++P    EP     P+  E PA +  P +     K ++
Sbjct  873  PVVTEEPAKVETPVATEEPAKVETPVATEEPAKVETPVATEEPAKVETPVVTEEPAKVEA  932

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  495
            P    EP     P+  + PA +  P +   P K ++P +   P +      GS
Sbjct  933  PVATEEPAKVETPVVTEEPAKVETPVVTEAPAKTETPVVTKAPHVKTAVTQGS  985


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 27/115 (23%), Positives = 50/115 (43%), Gaps = 0/115 (0%)
 Frame = +1

Query  124  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
            A+  T +    P K ++P    EP     P+  + PA +  P +   P K E+P    EP
Sbjct  880  AKVETPVATEEPAKVETPVATEEPAKVETPVATEEPAKVETPVVTEEPAKVEAPVATEEP  939

Query  304  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPT  468
                  +  + PA +  P +   P K ++P +   P + +   +  + A +++PT
Sbjct  940  AKVETPVVTEEPAKVETPVVTEAPAKTETPVVTKAPHVKTAVTQGSASAPMAQPT  994



>ref|WP_039152156.1| hypothetical protein, partial [Gallibacterium anatis]
 gb|KGQ58243.1| hypothetical protein IE01_02485, partial [Gallibacterium anatis 
DSM 16844 = F 149]
Length=724

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 56/112 (50%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
            + P     P + ++P     P+  + PA+ ++P + N P+    P + ++P +    +  
Sbjct  214  NQPAAEVQPVVANQPAAEVQPVVANQPAVETQPVVANQPVVETQPVVTNQPVVETQPVVT  273

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            + P + ++P + N P+    P + ++P + + P+  + P + ++P + N P+
Sbjct  274  NQPVVETQPVVTNQPVVETQPVVTNQPAVETQPVVANQPVVETQPVVANQPV  325


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+    P + ++P     P+  + PA  ++P + N P     P + ++P      +  +
Sbjct  179  QPVVETQPVVANQPVAETQPVVANQPAAETQPEVANQPAAEVQPVVANQPAAEVQPVVAN  238

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             PA+ ++P + N P+    P + ++P + + P+  + P + ++P + N P+
Sbjct  239  QPAVETQPVVANQPVVETQPVVTNQPVVETQPVVTNQPVVETQPVVTNQPV  289


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/115 (21%), Positives = 53/115 (46%), Gaps = 0/115 (0%)
 Frame = +1

Query  142  MPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYH  321
            M  + P   D P + ++P +   P+    P + ++P + N P+    P + ++P      
Sbjct  151  MVANQPAVEDQPVVANQPAVEAQPVAETQPVVETQPVVANQPVAETQPVVANQPAAETQP  210

Query  322  LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
               + PA   +P + N P     P + ++P + + P+  + P + ++P + N P+
Sbjct  211  EVANQPAAEVQPVVANQPAAEVQPVVANQPAVETQPVVANQPVVETQPVVTNQPV  265


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/112 (21%), Positives = 54/112 (48%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
            + P     P + ++P     P+  + PA   +P + N P     P + ++P +    +  
Sbjct  202  NQPAAETQPEVANQPAAEVQPVVANQPAAEVQPVVANQPAVETQPVVANQPVVETQPVVT  261

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            + P + ++P + N P+    P + ++P + + P+  + PA+ ++P + N P+
Sbjct  262  NQPVVETQPVVTNQPVVETQPVVTNQPVVETQPVVTNQPAVETQPVVANQPV  313


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/106 (20%), Positives = 54/106 (51%), Gaps = 0/106 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + PA+ ++P + N P+    P + ++P +   P+    P + ++P + N  +   
Sbjct  233  QPVVANQPAVETQPVVANQPVVETQPVVTNQPVVETQPVVTNQPVVETQPVVTNQPVVET  292

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  471
             P + ++P +   P+  + P + ++P + + P+  D P + ++P +
Sbjct  293  QPVVTNQPAVETQPVVANQPVVETQPVVANQPVVEDQPEVATQPVV  338


 Score = 52.0 bits (123),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
            + P+    P + ++P     P   + PA   +P + N P     P + ++P +    +  
Sbjct  190  NQPVAETQPVVANQPAAETQPEVANQPAAEVQPVVANQPAAEVQPVVANQPAVETQPVVA  249

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            + P + ++P + N P+    P + ++P + + P+  + P + ++P + N P
Sbjct  250  NQPVVETQPVVTNQPVVETQPVVTNQPVVETQPVVTNQPVVETQPVVTNQP  300


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/112 (18%), Positives = 53/112 (47%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
            + P     P + ++P +   P+  + P + ++P + N P+    P + ++P +    +  
Sbjct  226  NQPAAEVQPVVANQPAVETQPVVANQPVVETQPVVTNQPVVETQPVVTNQPVVETQPVVT  285

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            + P + ++P + N P     P + ++P + + P+  + P +  +P +   P+
Sbjct  286  NQPVVETQPVVTNQPAVETQPVVANQPVVETQPVVANQPVVEDQPEVATQPV  337


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 25/111 (23%), Positives = 50/111 (45%), Gaps = 6/111 (5%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
            H +  + PA+  +P + N P     P   ++P +   P+    P   ++P + N      
Sbjct  149  HNMVANQPAVEDQPVVANQPAVEAQPVAETQPVVETQPVVANQPVAETQPVVAN------  202

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             PA  ++P + N P     P + ++P     P+  + PA+ ++P + N P+
Sbjct  203  QPAAETQPEVANQPAAEVQPVVANQPAAEVQPVVANQPAVETQPVVANQPV  253


 Score = 48.9 bits (115),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 50/112 (45%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
            + P     P   ++P +   P+  + P   ++P + N P     P + ++P      +  
Sbjct  166  NQPAVEAQPVAETQPVVETQPVVANQPVAETQPVVANQPAAETQPEVANQPAAEVQPVVA  225

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            + PA   +P + N P     P + ++P + + P+  + P + ++P + N P+
Sbjct  226  NQPAAEVQPVVANQPAVETQPVVANQPVVETQPVVTNQPVVETQPVVTNQPV  277



>ref|WP_033102701.1| MULTISPECIES: ribonuclease [Alteromonadales]
 gb|KGK02706.1| ribonuclease, Rne/Rng family [Pseudoalteromonas sp. ND6B]
Length=1059

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 37/95 (39%), Gaps = 0/95 (0%)
 Frame = +1

Query  178  AMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEP  357
            A + EP     P+K + P    EP     P+K E P    EP      ++ + P    EP
Sbjct  851  AKVEEPVKAEEPVKAEEPVKAEEPVKTEEPVKAEEPVKAEEPVQAEEPVQTEEPVQTEEP  910

Query  358  TMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  462
                 P+K + P    EP     P+K + P    E
Sbjct  911  VQTEEPVKAEEPVKAEEPVKTEEPVKTEEPVKTEE  945


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 25/91 (27%), Positives = 35/91 (38%), Gaps = 0/91 (0%)
 Frame = +1

Query  163  KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPA  342
            K + P    EP     P+K + P    EP     P+K E P    EP      ++ + P 
Sbjct  852  KVEEPVKAEEPVKAEEPVKAEEPVKTEEPVKAEEPVKAEEPVQAEEPVQTEEPVQTEEPV  911

Query  343  MLSEPTMPNHPLKYDSPAMLSEPTMPSHPLK  435
               EP     P+K + P    EP     P+K
Sbjct  912  QTEEPVKAEEPVKAEEPVKTEEPVKTEEPVK  942


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/111 (23%), Positives = 40/111 (36%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
            H    D+   + +  +     K + P    EP     P+K E P    EP      +K +
Sbjct  831  HTTAVDASDAVEQNIVEEELAKVEEPVKAEEPVKAEEPVKAEEPVKTEEPVKAEEPVKAE  890

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P    EP     P++ + P    EP     P+K + P    EP     P+
Sbjct  891  EPVQAEEPVQTEEPVQTEEPVQTEEPVKAEEPVKAEEPVKTEEPVKTEEPV  941


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/102 (25%), Positives = 40/102 (39%), Gaps = 0/102 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+K + P    EP     P+K + P    EP     P++ E P    EP      ++ + 
Sbjct  856  PVKAEEPVKAEEPVKAEEPVKTEEPVKAEEPVKAEEPVQAEEPVQTEEPVQTEEPVQTEE  915

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  462
            P    EP     P+K + P    EP      +  +  A+ +E
Sbjct  916  PVKAEEPVKAEEPVKTEEPVKTEEPVKTEESVPAEEVAVEAE  957



>gb|AGC91524.1| putative biofilm-associated protein [Staphylococcus warneri SG1]
Length=2922

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 33/113 (29%), Positives = 50/113 (44%), Gaps = 3/113 (3%)
 Frame = +1

Query  136   TMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPN  315
             T++ +  P+    P   ++P  P  P     P    +PT P+HP    +P   ++P+ P 
Sbjct  2721  TVIDDGKPVDPSQPTDPTDPGKPTDPSHPTDPTDPGKPTDPSHPTDPTNPGEPTDPSQPT  2780

Query  316   YHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
                    P   S+PT P +P +   P   +EPT P  P +   PA   EPT P
Sbjct  2781  EPTNPGEPTDPSQPTEPTNPGEPTEPGQPTEPTNPGEPTEPGQPA---EPTNP  2830


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 34/105 (32%), Positives = 43/105 (41%), Gaps = 3/105 (3%)
 Frame = +1

Query  175   PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  354
             P   S+PT P  P K   P   S PT P  P K   P+  ++PT P        P   + 
Sbjct  2728  PVDPSQPTDPTDPGKPTDP---SHPTDPTDPGKPTDPSHPTDPTNPGEPTDPSQPTEPTN  2784

Query  355   PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
             P  P  P +   P    EPT P  P +  +P   +EP  P  P N
Sbjct  2785  PGEPTDPSQPTEPTNPGEPTEPGQPTEPTNPGEPTEPGQPAEPTN  2829


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 32/107 (30%), Positives = 46/107 (43%), Gaps = 15/107 (14%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             HP     P   ++P+ P  P     P   S+PT P +P +   P+  +EPT P       
Sbjct  2748  HPTDPTDPGKPTDPSHPTDPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNP-------  2800

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
                   EPT P  P +  +P    EPT P  P +  +P  ++EP  P
Sbjct  2801  -----GEPTEPGQPTEPTNPG---EPTEPGQPAEPTNPGEVTEPGQP  2839



>ref|WP_039147361.1| hypothetical protein, partial [Gallibacterium anatis]
 gb|KGQ36928.1| hypothetical protein JP30_11480, partial [Gallibacterium anatis 
IPDH697-78]
Length=994

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/105 (22%), Positives = 52/105 (50%), Gaps = 6/105 (6%)
 Frame = +1

Query  169  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
            + PA  ++P + N P+    P + ++P +    +    PA+  +P + N H      A+ 
Sbjct  894  NQPAAEAQPVVTNQPVAEVQPVVANQPAVETQAVAANQPAVEDQPAVANQH------AVE  947

Query  349  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            ++P + N P+    P + ++P + + P+  + P + ++P + N P
Sbjct  948  AQPVVANQPVVEAQPEVANQPAVEAQPVVANQPVVEAQPEVANQP  992


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 28/122 (23%), Positives = 58/122 (48%), Gaps = 7/122 (6%)
 Frame = +1

Query  154  HPLKYDSP-----AMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNY  318
             P+  D P     A+ + PT  N+ +  + PA  ++P + N P+    P + ++P +   
Sbjct  867  QPVTEDQPVVEDSAVDTAPTETNN-IVANQPAAEAQPVVTNQPVAEVQPVVANQPAVETQ  925

Query  319  HLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP-LNGS  495
             +  + PA+  +P + N       P + ++P + + P   + PA+ ++P + N P +   
Sbjct  926  AVAANQPAVEDQPAVANQHAVEAQPVVANQPVVEAQPEVANQPAVEAQPVVANQPVVEAQ  985

Query  496  PE  501
            PE
Sbjct  986  PE  987



>ref|WP_016085848.1| hypothetical protein [Bacillus cereus]
 gb|EOP14475.1| hypothetical protein ICS_00732 [Bacillus cereus BAG2O-3]
 gb|EOQ08019.1| hypothetical protein KQ3_04121 [Bacillus cereus B5-2]
Length=191

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 49/112 (44%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P+  + P +   P +P  P+    P +   P MP  P+  E P +   P MP   +  
Sbjct  57   EGPVLPEGPVLPEGPVLPEGPVIPVGPVLPEGPVMPEGPVLPEGPVLPEGPVMPEGPVLP  116

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            + P +   P MP  P+  + P +  +P MP  P+  + P +   P MP  P+
Sbjct  117  EGPVLPEGPVMPVDPVFPEGPVLPVDPVMPEGPVLPEGPVLPEGPVMPEGPV  168


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 48/112 (43%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P+  + P +   P +P  P+  + P M   P +P  P+  E P M   P +P   +  
Sbjct  63   EGPVLPEGPVLPEGPVIPVGPVLPEGPVMPEGPVLPEGPVLPEGPVMPEGPVLPEGPVLP  122

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            + P M  +P  P  P+    P M   P +P  P+  + P M   P +P  P+
Sbjct  123  EGPVMPVDPVFPEGPVLPVDPVMPEGPVLPEGPVLPEGPVMPEGPVLPEGPV  174


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 51/112 (46%), Gaps = 6/112 (5%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + P M   P +P  P+  + P M   P +P  P+  E P M  +P  P      +
Sbjct  82   GPVLPEGPVMPEGPVLPEGPVLPEGPVMPEGPVLPEGPVLPEGPVMPVDPVFP------E  135

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
             P +  +P MP  P+  + P +   P MP  P+  + P +  +P +P  PL+
Sbjct  136  GPVLPVDPVMPEGPVLPEGPVLPEGPVMPEGPVLPEGPVLPVDPVLPVGPLS  187



>gb|ETN66453.1| Unc-89 protein [Anopheles darlingi]
Length=5569

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 34/99 (34%), Positives = 45/99 (45%), Gaps = 3/99 (3%)
 Frame = +1

Query  187   SEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMP  366
             S PT P    K   PA   EP  P    K  +P  ++EPT P    K  +PA  +EP  P
Sbjct  1348  SVPTKPAEQQKSAVPAKAVEPAKPTEQPKPATPTKVAEPTKPAEQPKPATPAKPAEPAKP  1407

Query  367   NHPLKYDSPAMLSE---PTMPSHPLKYDSPAMLSEPTMP  474
               P K   PA L+E     +P+ P++   PA  S+   P
Sbjct  1408  ATPTKVSEPAKLAEQAKTVVPTKPVEQPKPATPSKVVEP  1446



>ref|WP_037886013.1| hypothetical protein, partial [Streptomyces viridochromogenes]
Length=157

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 49/103 (48%), Gaps = 0/103 (0%)
 Frame = +1

Query  175  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  354
            PA  + P  P +P K   PA  ++P  P  P K   PA  + P  P Y  K   PA  ++
Sbjct  32   PAKPAYPVKPAYPAKPAKPAYPAKPAYPAKPAKPAYPAKPAYPAKPAYPAKPAYPAKPAK  91

Query  355  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            P  P HP K D PA   +P  P+HP K D PA  + P  P  P
Sbjct  92   PAYPAHPKKPDYPAHPKKPAYPAHPKKPDYPAKPAYPAHPKKP  134


 Score = 47.4 bits (111),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 49/106 (46%), Gaps = 0/106 (0%)
 Frame = +1

Query  172  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLS  351
             PA  ++P  P  P K   PA  + P  P +P K   PA  ++P  P    K   PA  +
Sbjct  13   KPAYPAKPAYPAKPAKPAYPAKPAYPVKPAYPAKPAKPAYPAKPAYPAKPAKPAYPAKPA  72

Query  352  EPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
             P  P +P K   PA  ++P  P+HP K D PA   +P  P HP  
Sbjct  73   YPAKPAYPAKPAYPAKPAKPAYPAHPKKPDYPAHPKKPAYPAHPKK  118


 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 57/119 (48%), Gaps = 3/119 (3%)
 Frame = +1

Query  124  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
            A+P   +   +P K   PA  ++P  P  P K   PA  + P  P +P K   PA  ++P
Sbjct  33   AKPAYPVKPAYPAKPAKPAYPAKPAYPAKPAKPAYPAKPAYPAKPAYPAKPAYPAKPAKP  92

Query  304  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNH  480
              P +  K D PA   +P  P HP K D PA   +P  P+HP K D P   + P  P+H
Sbjct  93   AYPAHPKKPDYPAHPKKPAYPAHPKKPDYPA---KPAYPAHPKKPDYPDKPAHPKKPHH  148



>ref|WP_033608953.1| cell wall anchor protein [Lactobacillus plantarum]
Length=1344

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/89 (26%), Positives = 40/89 (45%), Gaps = 0/89 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + P+   EP  P  P + + P    +P+ P  P   E P+   EP  P    + + 
Sbjct  1151  PGQPEQPSQPEEPGQPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQSSQPEE  1210

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPS  423
             P    +P+ P  P + + P  L +P+ P+
Sbjct  1211  PGQHEQPSQPEEPGQSEKPGELQKPSQPA  1239


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 40/95 (42%), Gaps = 6/95 (6%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             EP  P  P + + P    +P+ P  P   E P+   EP  P      + P+   EP  P 
Sbjct  1150  EPGQPEQPSQPEEPGQPEQPSQPEEPGHPEQPSQPEEPGHP------EQPSQPEEPGHPE  1203

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
                + + P    +P+ P  P + + P  L +P+ P
Sbjct  1204  QSSQPEEPGQHEQPSQPEEPGQSEKPGELQKPSQP  1238



>gb|KEZ12787.1| LPXTG-motif cell wall anchor containing protein [Lactobacillus 
plantarum]
Length=1316

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/89 (26%), Positives = 40/89 (45%), Gaps = 0/89 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P + + P+   EP  P  P + + P    +P+ P  P   E P+   EP  P    + + 
Sbjct  1123  PGQPEQPSQPEEPGQPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQSSQPEE  1182

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPS  423
             P    +P+ P  P + + P  L +P+ P+
Sbjct  1183  PGQHEQPSQPEEPGQSEKPGELQKPSQPA  1211


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 40/95 (42%), Gaps = 6/95 (6%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             EP  P  P + + P    +P+ P  P   E P+   EP  P      + P+   EP  P 
Sbjct  1122  EPGQPEQPSQPEEPGQPEQPSQPEEPGHPEQPSQPEEPGHP------EQPSQPEEPGHPE  1175

Query  370   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
                + + P    +P+ P  P + + P  L +P+ P
Sbjct  1176  QSSQPEEPGQHEQPSQPEEPGQSEKPGELQKPSQP  1210



>ref|XP_007182705.1| PREDICTED: LOW QUALITY PROTEIN: G2/mitotic-specific cyclin-B3 
[Balaenoptera acutorostrata scammoni]
Length=1428

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 56/98 (57%), Gaps = 0/98 (0%)
 Frame = -2

Query  457   IALPENHTSKDDLASSAPIALPENHTLKDDLASSAPIALPENHTSNDNLASSAPIALQEI  278
             + L EN T++++     P+AL EN +++ ++     +AL E  TS        P+ALQE 
Sbjct  982   LTLQENLTTEEEAILKEPLALQENPSIEKEIILRESLALQEKPTSEKETLFEEPLALQEN  1041

Query  277   HTLKDDLASSAPIALPENHTLKDDLASSAPIALQENHT  164
              T++++     P+AL E  + + DL+S  P+ALQ+N T
Sbjct  1042  PTIEEEAILKEPLALQEKPSSEKDLSSKEPLALQKNLT  1079



>gb|EWZ85759.1| hypothetical protein FOWG_10855 [Fusarium oxysporum f. sp. lycopersici 
MN25]
Length=682

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 40/109 (37%), Gaps = 0/109 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P   + PA  SEP     P     PA  + P   N P     PA  SEP   N       
Sbjct  256  PATQNGPATQSEPATQTLPATQSEPATQTLPATQNGPATQSEPATQSEPATENGPATQTG  315

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            PA  + P   N P     PA  + P   + P+    PA  SEP   N P
Sbjct  316  PATQTLPATQNGPATQSEPATQNGPATQTLPVTQSEPATQSEPATQNGP  364



>ref|WP_039141203.1| hypothetical protein [Gallibacterium anatis]
 gb|KGQ51116.1| hypothetical protein JL12_03840 [Gallibacterium anatis 10672-6]
Length=1476

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 20/99 (20%), Positives = 49/99 (49%), Gaps = 0/99 (0%)
 Frame = +1

Query  187   SEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMP  366
             ++P + N P+    P +  +P + N P+    P + ++P +    +  +  A  ++P + 
Sbjct  940   AQPVVVNQPVAETQPVVKDQPVVANQPVTETQPVVANQPVVETQPVVANQLAAETQPVVA  999

Query  367   NHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             N P+    P + ++P + + P+  + P + ++P + N P
Sbjct  1000  NQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQP  1038


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/111 (18%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + P   ++P + + P+  + P   ++P + N P+    P + ++       +  +
Sbjct  941   QPVVVNQPVAETQPVVKDQPVVANQPVTETQPVVANQPVVETQPVVANQLAAETQPVVAN  1000

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P + N P     P + ++P + + P+  + PA+ ++P +   P+
Sbjct  1001  QPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPVVETQPV  1051


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 51/111 (46%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+    P +  +P + N P+    P + ++P +   P+  +     ++P + N  +   
Sbjct  893   QPVAETQPVVKDQPVVANQPVTEAQPVVSNQPAVEAQPVVEKQAVTEAQPVVVNQPVAET  952

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P +  +P + N P+    P + ++P + + P+  +  A  ++P + N P+
Sbjct  953   QPVVKDQPVVANQPVTETQPVVANQPVVETQPVVANQLAAETQPVVANQPV  1003


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/111 (18%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  + PA+ ++P +    +    P ++++P     P+  + P + ++P      +  +
Sbjct  917   QPVVSNQPAVEAQPVVEKQAVTEAQPVVVNQPVAETQPVVKDQPVVANQPVTETQPVVAN  976

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P + ++P + N       P + ++P + + P   + PA+ ++P + N P+
Sbjct  977   QPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQPAVETQPVVANQPV  1027


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/98 (19%), Positives = 46/98 (47%), Gaps = 0/98 (0%)
 Frame = +1

Query  187  SEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMP  366
            ++P     P+  D P + ++P     P+    PA+ ++P +    +    P ++++P   
Sbjct  892  TQPVAETQPVVKDQPVVANQPVTEAQPVVSNQPAVEAQPVVEKQAVTEAQPVVVNQPVAE  951

Query  367  NHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNH  480
              P+  D P + ++P   + P+  + P + ++P + N 
Sbjct  952  TQPVVKDQPVVANQPVTETQPVVANQPVVETQPVVANQ  989


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/116 (18%), Positives = 53/116 (46%), Gaps = 6/116 (5%)
 Frame = +1

Query  154   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
              P+  D P + ++P     P+  + PA+ ++P +    +    P ++++P      +  D
Sbjct  899   QPVVKDQPVVANQPVTEAQPVVSNQPAVEAQPVVEKQAVTEAQPVVVNQPVAETQPVVKD  958

Query  334   SPAMLSEPTMPNHPLKYDSPAMLSEPTMP------SHPLKYDSPAMLSEPTMPNHP  483
              P + ++P     P+  + P + ++P +       + P+  + P + ++P + N P
Sbjct  959   QPVVANQPVTETQPVVANQPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQP  1014



>ref|WP_003657303.1| Hypothetical protein, partial [Lactobacillus gasseri]
 gb|EJN53460.1| Hypothetical protein A131_138851, partial [Lactobacillus gasseri 
CECT 5714]
Length=179

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 36/79 (46%), Gaps = 6/79 (8%)
 Frame = +1

Query  244  EPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPS  423
            EPT P+ P +   P    EPT P      D PA  SEP  P  P   D PA  SEPT P 
Sbjct  4    EPTTPDKPARPTEPTKPEEPTTP------DKPAQPSEPIKPEEPTTPDKPAQPSEPTEPK  57

Query  424  HPLKYDSPAMLSEPTMPNH  480
             P   D P   SEPT P  
Sbjct  58   EPTTPDKPTQPSEPTKPEE  76


 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 34/75 (45%), Gaps = 0/75 (0%)
 Frame = +1

Query  202  PNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLK  381
            P  P   D PA  +EPT P  P   + PA  SEP  P      D PA  SEPT P  P  
Sbjct  2    PEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEPTT  61

Query  382  YDSPAMLSEPTMPSH  426
             D P   SEPT P  
Sbjct  62   PDKPTQPSEPTKPEE  76


 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 33/74 (45%), Gaps = 0/74 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P   D PA  +EPT P  P   D PA  SEP  P  P   + PA  SEPT P      
Sbjct  3    EEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEPTTP  62

Query  331  DSPAMLSEPTMPNH  372
            D P   SEPT P  
Sbjct  63   DKPTQPSEPTKPEE  76



>gb|ACB11440.1| neurofilament triplet H1-like protein, partial [Ambystoma tigrinum 
virus]
Length=291

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 38/112 (34%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P+K  SP     P     P+K  SP     P     P+K +SP     P      +K 
Sbjct  117  KSPVKTRSPVKRKSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVNCKSPVKRKSPVKR  176

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             SP     P     P+K  SP     P     P+K  SP     P     P+
Sbjct  177  KSPVNCKSPVKTRSPVKRKSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPV  228


 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 36/106 (34%), Gaps = 0/106 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P+K  SP     P     P+K  SP     P     P+K +SP     P      +K 
Sbjct  135  KSPVKRKSPVNCKSPVKTRSPVKRKSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVKR  194

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPT  468
             SP     P     P+K  SP     P     P+K  SP     P 
Sbjct  195  KSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVKRKSPV  240


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 38/112 (34%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P+K  SP     P     P+K  SP     P     P+K +SP     P      +K 
Sbjct  99   KSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVKRKSPVKRKSPVNCKSPVKTRSPVKR  158

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             SP     P     P+K  SP     P     P+K  SP     P     P+
Sbjct  159  KSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVNCKSPVKRKSPV  210


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/116 (28%), Positives = 40/116 (34%), Gaps = 0/116 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P+K  SP     P     P+K  SP     P     P+K +SP     P      +K 
Sbjct  129  KSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVNCKSPVKRKSPVKRKSPVNCKSPVKT  188

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSP  498
             SP     P     P+K  SP     P     P+K  SP     P     P+  SP
Sbjct  189  RSPVKRKSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVKRKSPVKRSP  244


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 37/112 (33%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P+K  SP     P     P+K  SP     P     P+K  SP     P      +K 
Sbjct  81   KSPVKKRSPVNRKSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVKRKSPVKR  140

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             SP     P     P+K  SP     P     P+K  SP     P     P+
Sbjct  141  KSPVNCKSPVKTRSPVKRKSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPV  192



>gb|EXA35697.1| hypothetical protein FOVG_12852 [Fusarium oxysporum f. sp. pisi 
HDV247]
Length=739

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 35/104 (34%), Positives = 39/104 (38%), Gaps = 0/104 (0%)
 Frame = +1

Query  172  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLS  351
            +PA  + P     P     PA  SEP   N P     PA  SEP   N       PA  S
Sbjct  312  TPATQNGPATQTLPATQSEPATQSEPATQNGPATQSEPATQSEPATQNGPATQTLPATQS  371

Query  352  EPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            EP   + P      A  SEP   S P     PA  SEP   + P
Sbjct  372  EPVTQSKPATQSESATQSEPATQSEPATQSEPATQSEPATQSEP  415


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 37/109 (34%), Positives = 43/109 (39%), Gaps = 3/109 (3%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P   + PA  SEP   N P     PA  SEP   N P     PA  SEP   +   +  +
Sbjct  256  PATQNGPATQSEPATQNGPATQTLPATQSEPATQNGPATQTLPATQSEPATQS---EPAT  312

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            PA  + P     P     PA  SEP   + P     PA  SEP   N P
Sbjct  313  PATQNGPATQTLPATQSEPATQSEPATQNGPATQSEPATQSEPATQNGP  361


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 37/125 (30%), Positives = 48/125 (38%), Gaps = 1/125 (1%)
 Frame = +1

Query  124  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
            + P T    + P     PA  SEP   + P   + PA  SEP   + P     PA  + P
Sbjct  308  SEPATPATQNGPATQTLPATQSEPATQSEPATQNGPATQSEPATQSEPATQNGPATQTLP  367

Query  304  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP-TMPNH  480
               +  +    PA  SE    + P     PA  SEP   S P     PA  + P T  N 
Sbjct  368  ATQSEPVTQSKPATQSESATQSEPATQSEPATQSEPATQSEPATQSEPATQNGPSTATNA  427

Query  481  PLNGS  495
            P  G+
Sbjct  428  PNQGT  432



>ref|WP_008126344.1| ribonuclease [Pseudoalteromonas sp. BSi20480]
 dbj|GAA73643.1| ribonuclease E [Pseudoalteromonas sp. BSi20480]
Length=1040

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 27/91 (30%), Positives = 38/91 (42%), Gaps = 6/91 (7%)
 Frame = +1

Query  190  EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
            EP     P+K + P    EP     P+K E P    EP      +K + P    EP    
Sbjct  861  EPVQTEEPVKAEEPVQTEEPVKAEEPVKAEEPVKAEEP------VKAEEPVQAEEPVKAE  914

Query  370  HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  462
             P+K + P    EP     P+K + PA+ +E
Sbjct  915  EPVKAEEPVKAEEPVKAEEPVKAEEPALEAE  945


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/84 (29%), Positives = 36/84 (43%), Gaps = 0/84 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P++ + P    EP     P+K + P    EP     P+K E P    EP      +K + 
Sbjct  862  PVQTEEPVKAEEPVQTEEPVKAEEPVKAEEPVKAEEPVKAEEPVQAEEPVKAEEPVKAEE  921

Query  337  PAMLSEPTMPNHPLKYDSPAMLSE  408
            P    EP     P+K + PA+ +E
Sbjct  922  PVKAEEPVKAEEPVKAEEPALEAE  945


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 24/96 (25%), Positives = 38/96 (40%), Gaps = 0/96 (0%)
 Frame = +1

Query  184  LSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTM  363
            L++  +    +K + P    EP     P++ E P    EP      +K + P    EP  
Sbjct  847  LAKVEVAQEQVKAEEPVQTEEPVKAEEPVQTEEPVKAEEPVKAEEPVKAEEPVKAEEPVQ  906

Query  364  PNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  471
               P+K + P    EP     P+K + P    EP +
Sbjct  907  AEEPVKAEEPVKAEEPVKAEEPVKAEEPVKAEEPAL  942


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 23/86 (27%), Positives = 34/86 (40%), Gaps = 0/86 (0%)
 Frame = +1

Query  160  LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSP  339
            +K + P    EP     P++ + P    EP     P+K E P    EP      +K + P
Sbjct  857  VKAEEPVQTEEPVKAEEPVQTEEPVKAEEPVKAEEPVKAEEPVKAEEPVQAEEPVKAEEP  916

Query  340  AMLSEPTMPNHPLKYDSPAMLSEPTM  417
                EP     P+K + P    EP +
Sbjct  917  VKAEEPVKAEEPVKAEEPVKAEEPAL  942



>ref|WP_024604127.1| ribonuclease [Pseudoalteromonas haloplanktis]
Length=1062

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 27/97 (28%), Positives = 39/97 (40%), Gaps = 0/97 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+K   PA    P     P+K ++P    EP     P+  E PA    P       K ++
Sbjct  865  PVKAKEPAKAETPVATEEPVKVETPVATEEPAKVETPVATEEPAKAETPVATEEPAKVET  924

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSP  447
            PA   EP     P+  + PA +  P     P K ++P
Sbjct  925  PAATEEPAKVETPVATEEPAKVETPVATEEPAKVETP  961


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 26/101 (26%), Positives = 38/101 (38%), Gaps = 0/101 (0%)
 Frame = +1

Query  184  LSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTM  363
            + EP     P K ++P    EP     P+  E PA +  P       K ++P    EP  
Sbjct  862  VEEPVKAKEPAKAETPVATEEPVKVETPVATEEPAKVETPVATEEPAKAETPVATEEPAK  921

Query  364  PNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
               P   + PA +  P     P K ++P    EP     P+
Sbjct  922  VETPAATEEPAKVETPVATEEPAKVETPVATEEPAKVETPV  962


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 29/114 (25%), Positives = 45/114 (39%), Gaps = 6/114 (5%)
 Frame = +1

Query  124  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
            A+  T +    P+K ++P    EP     P+  + PA    P     P K E+PA   EP
Sbjct  872  AKAETPVATEEPVKVETPVATEEPAKVETPVATEEPAKAETPVATEEPAKVETPAATEEP  931

Query  304  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  465
                   K ++P    EP     P+  + PA +  P       K ++  +  EP
Sbjct  932  A------KVETPVATEEPAKVETPVATEEPAKVETPVATEKSAKAETSVVTKEP  979


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 37/99 (37%), Gaps = 0/99 (0%)
 Frame = +1

Query  169  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
            + P    EP     P+  + P  +  P     P K E+P    EP      +  + PA +
Sbjct  863  EEPVKAKEPAKAETPVATEEPVKVETPVATEEPAKVETPVATEEPAKAETPVATEEPAKV  922

Query  349  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  465
              P     P K ++P    EP     P+  + PA +  P
Sbjct  923  ETPAATEEPAKVETPVATEEPAKVETPVATEEPAKVETP  961



>gb|EGU75460.1| hypothetical protein FOXB_14029 [Fusarium oxysporum Fo5176]
Length=670

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 35/115 (30%), Positives = 45/115 (39%), Gaps = 2/115 (2%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P     PA  + P   + P   + PA  SEP   N P     PA  SEP   N       
Sbjct  256  PATQSEPATQNGPATQSEPATQNGPATQSEPATQNGPATQTLPATQSEPATQNGPATQTL  315

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPE  501
            PA  SEP   + P   + PA  SEP   S P   + P+  +    PN     +P+
Sbjct  316  PATQSEPATQSEPATQNGPATQSEPATQSEPATQNGPS--TATNAPNQGTTTAPQ  368


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 37/109 (34%), Positives = 42/109 (39%), Gaps = 6/109 (6%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P     PA  + P   + P   + PA  SEP   N       PA  SEP   N       
Sbjct  244  PTTQRGPATQTLPATQSEPATQNGPATQSEPATQN------GPATQSEPATQNGPATQTL  297

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            PA  SEP   N P     PA  SEP   S P   + PA  SEP   + P
Sbjct  298  PATQSEPATQNGPATQTLPATQSEPATQSEPATQNGPATQSEPATQSEP  346



>gb|ACB11439.1| neurofilament triplet H1-like protein, partial [Ambystoma tigrinum 
virus]
Length=250

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 37/113 (33%), Gaps = 0/113 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P+K  SP     P     P+K  SP     P     P+K  SP     P      +K 
Sbjct  111  KSPVKTRSPVKRKSPVKTRSPVKRKSPVKTRSPVKRKSPVKTRSPVKRKSPVKSRSPVKR  170

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
             SP     P     P+K  SP     P     P+K  SP     P     PL 
Sbjct  171  KSPVKTRSPVKRKSPVKTRSPVKRKSPVKTRSPVKRKSPVKTRSPVKRKSPLK  223


 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 39/113 (35%), Gaps = 0/113 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P+K  SP     P     P+K  SP     P     P+K +SP     P      +K 
Sbjct  117  RSPVKRKSPVKTRSPVKRKSPVKTRSPVKRKSPVKTRSPVKRKSPVKSRSPVKRKSPVKT  176

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
             SP     P     P+K  SP     P     P+K  SP     P     P+N
Sbjct  177  RSPVKRKSPVKTRSPVKRKSPVKTRSPVKRKSPVKTRSPVKRKSPLKRKSPMN  229


 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 38/113 (34%), Gaps = 0/113 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P+K  SP     P     P+K  SP     P     P+K +SP     P      +K 
Sbjct  129  RSPVKRKSPVKTRSPVKRKSPVKTRSPVKRKSPVKSRSPVKRKSPVKTRSPVKRKSPVKT  188

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
             SP     P     P+K  SP     P     PLK  SP     P     PL 
Sbjct  189  RSPVKRKSPVKTRSPVKRKSPVKTRSPVKRKSPLKRKSPMNKRSPVKRKSPLK  241


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 37/114 (32%), Gaps = 0/114 (0%)
 Frame = +1

Query  148  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  327
               P+K  SP     P     P+K  SP     P     P+K  SP     P      +K
Sbjct  98   RKSPVKRKSPVNCKSPVKTRSPVKRKSPVKTRSPVKRKSPVKTRSPVKRKSPVKTRSPVK  157

Query  328  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
              SP     P     P+K  SP     P     P+K  SP     P     P+ 
Sbjct  158  RKSPVKSRSPVKRKSPVKTRSPVKRKSPVKTRSPVKRKSPVKTRSPVKRKSPVK  211


 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 34/100 (34%), Gaps = 0/100 (0%)
 Frame = +1

Query  148  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  327
               P+K  SP     P     P+K  SP     P     P+K  SP     P      +K
Sbjct  146  RKSPVKTRSPVKRKSPVKSRSPVKRKSPVKTRSPVKRKSPVKTRSPVKRKSPVKTRSPVK  205

Query  328  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSP  447
              SP     P     PLK  SP     P     PLK  SP
Sbjct  206  RKSPVKTRSPVKRKSPLKRKSPMNKRSPVKRKSPLKRKSP  245



>ref|WP_039139264.1| hypothetical protein, partial [Gallibacterium anatis]
 gb|KGQ24584.1| hypothetical protein JP31_08525, partial [Gallibacterium anatis]
Length=746

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/112 (21%), Positives = 55/112 (49%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
            + P+    P + ++P +   P+  + PA+ ++P + N P     P + ++P      +  
Sbjct  124  NQPVVEAQPVVTNQPAVETQPVVANQPAVETQPVVANQPAAEVQPVVTNQPVAEVQPVVA  183

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            + PA+ ++P + N P+    P + ++P +   P+  + P   ++P + N P+
Sbjct  184  NQPAVEAQPVVANQPVVEAQPEVATQPVVEDQPVVANQPVTEAQPVVVNQPV  235


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/112 (21%), Positives = 55/112 (49%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
            + P+    P + ++P +   P+  +  A  ++P + N P+    P + ++P +    +  
Sbjct  88   NQPVAEAQPVVANQPAVETQPVVANQSAAETQPEVANQPVVEAQPVVTNQPAVETQPVVA  147

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            + PA+ ++P + N P     P + ++P     P+  + PA+ ++P + N P+
Sbjct  148  NQPAVETQPVVANQPAAEVQPVVTNQPVAEVQPVVANQPAVEAQPVVANQPV  199


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
            + P     P + ++P     P+  + PA+ ++P + N P+    P + ++P + +  +  
Sbjct  160  NQPAAEVQPVVTNQPVAEVQPVVANQPAVEAQPVVANQPVVEAQPEVATQPVVEDQPVVA  219

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            + P   ++P + N P+    P + ++P   + P+  + P    +P + N P
Sbjct  220  NQPVTEAQPVVVNQPVAETQPVVETQPVAETQPVVTNQPVAEVQPVVANQP  270


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + PA+ ++P + N P     P + ++P     P+    PA+ ++P + N  +   
Sbjct  143  QPVVANQPAVETQPVVANQPAAEVQPVVTNQPVAEVQPVVANQPAVEAQPVVANQPVVEA  202

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P + ++P + + P+  + P   ++P + + P+    P + ++P     P+
Sbjct  203  QPEVATQPVVEDQPVVANQPVTEAQPVVVNQPVAETQPVVETQPVAETQPV  253


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 53/111 (48%), Gaps = 6/111 (5%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + PA+ ++P + N P+    P + ++P + + P+    P   ++P + N      
Sbjct  179  QPVVANQPAVEAQPVVANQPVVEAQPEVATQPVVEDQPVVANQPVTEAQPVVVN------  232

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P   ++P +   P+    P + ++P     P+  + PA+ ++P + N P+
Sbjct  233  QPVAETQPVVETQPVAETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPV  283


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  +  A  ++P + N P+    P + ++P +   P+    PA+ ++P + N      
Sbjct  107  QPVVANQSAAETQPEVANQPVVEAQPVVTNQPAVETQPVVANQPAVETQPVVANQPAAEV  166

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P + ++P     P+  + PA+ ++P + + P+    P + ++P + + P+
Sbjct  167  QPVVTNQPVAEVQPVVANQPAVEAQPVVANQPVVEAQPEVATQPVVEDQPV  217



>ref|XP_002780730.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER12525.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
Length=659

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 52/115 (45%), Gaps = 5/115 (4%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P +   P   +EPT P  P +   P   +EPT P  P +   P   +EPT P    +  
Sbjct  83   KPTRPTKPTRPTEPTRPTKPTRPTKPTRPTEPTRPTKPTRPTKPTRPTEPTRPTKPTRPT  142

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP--LNG  492
             P   ++PT P  P +   P M + PTMP+ P     P M + PTMP  P   NG
Sbjct  143  EPTRPTKPTRPTEPTR---PTMPTRPTMPTRPTMPTRPTMPTRPTMPTRPHCKNG  194


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 50/111 (45%), Gaps = 3/111 (3%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P +   P   ++PT P  P +   P   +EPT P  P +   P   +EPT P    +  
Sbjct  65   KPTRPTKPTRPTKPTRPTKPTRPTKPTRPTEPTRPTKPTRPTKPTRPTEPTRPTKPTRPT  124

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P   +EPT P  P +   P   ++PT P+ P +   P M + PTMP  P 
Sbjct  125  KPTRPTEPTRPTKPTRPTEPTRPTKPTRPTEPTR---PTMPTRPTMPTRPT  172



>ref|WP_014940697.1| signal peptide protein [Lactobacillus buchneri]
 gb|AFS01238.1| hypothetical protein LBUCD034_2264 [Lactobacillus buchneri CD034]
Length=614

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 57/119 (48%), Gaps = 20/119 (17%)
 Frame = +1

Query  151  HHPLKYDSPAML--------SEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  306
             +P+  D P ++        ++PT PN P + + P   ++PT PN P +   P   ++PT
Sbjct  394  QYPILSDVPGIILWVTPSTPNQPTGPNQPTEPNQPTQPNQPTQPNQPTQPNQPTQPNQPT  453

Query  307  MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             PN            +PT PN P + + P   ++PT P+ P K + P   ++P  PN P
Sbjct  454  QPN------------QPTQPNQPTQPNQPTQPNQPTQPNQPNKPNKPNRPNQPNKPNKP  500



>gb|EMC89538.1| Collagen-like protein 2, partial [Columba livia]
Length=130

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 54/111 (49%), Gaps = 6/111 (5%)
 Frame = -1

Query  491  PFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**F  312
              +G   + G  S+ G+S  +G   + G  S+ G+S  +G  G+ G  S+ G+S  +   
Sbjct  17   SVQGNCSVQGDSSVQGDSNVQGDCSVQGDRSVQGDSSMQGDSGVQGDRSVQGDSSVQ---  73

Query  311  GIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  159
               G  S+ GDS  +G  G+ G  S+ G+S  +G   + G  S+ G+   +
Sbjct  74   ---GDSSVQGDSSMQGDSGVQGDHSVQGDSSVQGDSSVQGDSSVQGDCSVQ  121


 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/109 (28%), Positives = 54/109 (50%), Gaps = 0/109 (0%)
 Frame = -1

Query  485  KG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**FGI  306
            +G   + G+ S+ G    +G   + G  S+ G+S  +G   + G  S+ G+S  +   G+
Sbjct  1    RGNCSVQGNRSVQGNRSVQGNCSVQGDSSVQGDSNVQGDCSVQGDRSVQGDSSMQGDSGV  60

Query  305  VGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  159
             G  S+ GDS  +G   + G  S+ G+S  +G   + G  S+ G+S  +
Sbjct  61   QGDRSVQGDSSVQGDSSVQGDSSMQGDSGVQGDHSVQGDSSVQGDSSVQ  109



>ref|WP_035427023.1| cell wall anchor protein, partial [Lactobacillus gasseri]
Length=1015

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 29/62 (47%), Positives = 30/62 (48%), Gaps = 6/62 (10%)
 Frame = +1

Query  298   EPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPN  477
             EPT P      D PA  SEPT P  P   D PA  +EPT P  P   D PA  SEP  P 
Sbjct  956   EPTTP------DKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPE  1009

Query  478   HP  483
              P
Sbjct  1010  EP  1011



>gb|ERS35519.1| hypothetical protein HMPREF1275_00471 [Propionibacterium sp. 
KPL1844]
Length=615

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 59/116 (51%), Gaps = 0/116 (0%)
 Frame = +1

Query  124  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
            A+ +T +  H P ++++P      T P+ P K    +  ++P  P  P K  +PA  ++P
Sbjct  185  AKYLTSVSAHRPARHNAPIKPGRATKPSTPGKSTKTSKQAKPRTPARPAKPSTPAKPAKP  244

Query  304  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  471
            T P   ++  +P   + P  P+ P K  +PA  S PT P+HP K   P+  ++P +
Sbjct  245  TTPTKPVRPSTPVAPTTPARPSTPAKATTPAKPSTPTKPTHPTKPAKPSTPAKPVV  300



>gb|EHJ07815.1| accumulation-associated protein [Staphylococcus simiae CCM 7213]
Length=154

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  175  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  354
            P+   EP +P++P   + P    EP +P++P     P+   EP +P+     + P    E
Sbjct  3    PSTPGEPDVPSNPDTPNDPGTPGEPDVPSNPDTPNDPSTPGEPDVPSNPDTPNDPGTPGE  62

Query  355  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            P +P++P   + P   SEP +PS+P   ++P    E  +P++P
Sbjct  63   PNVPSNPDTPNDPGTPSEPDVPSNPDTPNNPGTPGESDVPSNP  105



>ref|WP_011082576.1| accumulation-associated protein [Staphylococcus epidermidis]
 ref|NP_763730.1| accumulation-associated protein [Staphylococcus epidermidis ATCC 
12228]
 sp|Q8CQD9.1|PLS_STAES RecName: Full=Accumulation-associated protein; Flags: Precursor 
[Staphylococcus epidermidis ATCC 12228]
 gb|AAO03772.1|AE016744_175 accumulation-associated protein [Staphylococcus epidermidis ATCC 
12228]
Length=1469

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 40/120 (33%), Positives = 49/120 (41%), Gaps = 4/120 (3%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P K   P   +EP  P  P K   P   +EP  P  P K   P   +EP  P    K   
Sbjct  1299  PGKPAEPGKPAEPGKPAEPGKPAEPGTPAEPGKPAEPGKPAEPGKPAEPGKPAEPGKPAE  1358

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP----LNGSPEQ  504
             P   +EP  P  P K   P   +EP  P+ P K   P   +EP  P  P     +G+PEQ
Sbjct  1359  PGTPAEPGKPAEPGKPAEPGKPAEPGTPAEPGKPAEPGTPAEPGKPAEPGTPTQSGAPEQ  1418



>ref|XP_004646348.1| PREDICTED: G2/mitotic-specific cyclin-B3 [Octodon degus]
Length=1313

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 59/124 (48%), Gaps = 3/124 (2%)
 Frame = -2

Query  526  FHHAINFTA-PVIRLKDDLASSAPIALPENHTSKDDLASSAPIALPENHTLKDDLASSAP  350
            F   +N    P I  ++    + P+AL E    K +     P+AL E H+ K       P
Sbjct  857  FQECLNLQKNPTI--EEGTIFTEPLALQEKAGLKSEAILKEPLALQEKHSPKMKAVLEEP  914

Query  349  IALPENHTSNDNLASSAPIALQEIHTLKDDLASSAPIALPENHTLKDDLASSAPIALQEN  170
            +AL E  +S +    + P+A QE   L D + S  P+AL E  T  ++L+   P+ L+EN
Sbjct  915  LALEEKPSSEEEAIHNEPLAFQEKSDLDDKVISEEPLALDEKSTTGNELSFQEPLILEEN  974

Query  169  HTLK  158
             T K
Sbjct  975  PTEK  978


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 60/116 (52%), Gaps = 5/116 (4%)
 Frame = -2

Query  508  FTAPV-IRLKDDLASSA----PIALPENHTSKDDLASSAPIALPENHTLKDDLASSAPIA  344
            FT P+ ++ K  L S A    P+AL E H+ K       P+AL E  + +++   + P+A
Sbjct  875  FTEPLALQEKAGLKSEAILKEPLALQEKHSPKMKAVLEEPLALEEKPSSEEEAIHNEPLA  934

Query  343  LPENHTSNDNLASSAPIALQEIHTLKDDLASSAPIALPENHTLKDDLASSAPIALQ  176
              E    +D + S  P+AL E  T  ++L+   P+ L EN T K+DL   A + L+
Sbjct  935  FQEKSDLDDKVISEEPLALDEKSTTGNELSFQEPLILEENPTEKEDLFPEAFLILE  990



>ref|WP_039093011.1| hypothetical protein, partial [Gallibacterium anatis]
 gb|KGQ24386.1| hypothetical protein JP27_09745, partial [Gallibacterium anatis]
Length=588

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
            + P     P + ++P     P+  + PA+ ++P + N P+    P + ++P + +  +  
Sbjct  2    NQPAAEVQPVVTNQPVAEVQPVVANQPAVEAQPVVANQPVVEAQPEVATQPVVEDQPVVA  61

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            + P   ++P + N P+    P + ++P   + P+  + P    +P + N P
Sbjct  62   NQPVTEAQPVVVNQPVAETQPVVETQPVAETQPVVTNQPVAEVQPVVANQP  112


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 53/111 (48%), Gaps = 6/111 (5%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + PA+ ++P + N P+    P + ++P + + P+    P   ++P + N      
Sbjct  21   QPVVANQPAVEAQPVVANQPVVEAQPEVATQPVVEDQPVVANQPVTEAQPVVVN------  74

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
             P   ++P +   P+    P + ++P     P+  + PA+ ++P + N P+
Sbjct  75   QPVAETQPVVETQPVAETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPV  125


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 20/106 (19%), Positives = 50/106 (47%), Gaps = 0/106 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P+  + P + ++P +   P+  D P + ++P     P+    P   ++P +    +   
Sbjct  33   QPVVANQPVVEAQPEVATQPVVEDQPVVANQPVTEAQPVVVNQPVAETQPVVETQPVAET  92

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  471
             P + ++P     P+  + PA+ ++P + + P+  D P + ++P +
Sbjct  93   QPVVTNQPVAEVQPVVANQPAVETQPVVANQPVVEDQPEVATQPVV  138



>gb|EPD15416.1| accumulation-associated protein, partial [Streptococcus pneumoniae 
MNZ11b]
Length=948

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 31/94 (33%), Positives = 46/94 (49%), Gaps = 9/94 (10%)
 Frame = +1

Query  202  PNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLK  381
            P  P +  +PA  +EP  P  P +  +PA  +EP  P       +PA  +EP  P  P +
Sbjct  863  PAEPAEPANPAQPAEPANPAEPAEPANPAQPAEPAEPA------NPAQPAEPANPAQPAE  916

Query  382  YDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
              +PA  +EP  P++P +   PA  +EP  P  P
Sbjct  917  PANPAQPAEPAEPANPAQ---PAEPAEPANPAQP  947


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 29/87 (33%), Positives = 41/87 (47%), Gaps = 6/87 (7%)
 Frame = +1

Query  229  PAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSE  408
            PA  +EP  P  P +  +PA  +EP  P        PA  +EP  P  P +  +PA  +E
Sbjct  863  PAEPAEPANPAQPAEPANPAEPAEPANPA------QPAEPAEPANPAQPAEPANPAQPAE  916

Query  409  PTMPSHPLKYDSPAMLSEPTMPNHPLN  489
            P  P+ P +   PA  ++P  P  P N
Sbjct  917  PANPAQPAEPAEPANPAQPAEPAEPAN  943


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 29/92 (32%), Positives = 42/92 (46%), Gaps = 6/92 (7%)
 Frame = +1

Query  175  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  354
            PA  +EP  P  P +  +PA  +EP  P  P +   PA  ++P  P       +PA  +E
Sbjct  863  PAEPAEPANPAQPAEPANPAEPAEPANPAQPAEPAEPANPAQPAEPA------NPAQPAE  916

Query  355  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPA  450
            P  P  P +   PA  ++P  P+ P     PA
Sbjct  917  PANPAQPAEPAEPANPAQPAEPAEPANPAQPA  948



>ref|WP_007585714.1| ribonuclease [Pseudoalteromonas sp. BSi20429]
 dbj|GAA69088.1| ribonuclease E [Pseudoalteromonas sp. BSi20429]
Length=1044

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 44/99 (44%), Gaps = 0/99 (0%)
 Frame = +1

Query  169  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
            + PA +  P +   P K ++P +  EP     P+  E  A +  P +     K ++P + 
Sbjct  864  EEPAKVETPVVTEEPAKVETPVVTEEPAKVETPVATEEQAKVEAPVVTEEPAKVETPVVT  923

Query  349  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  465
             EP     P+  + PA +  P +   P K ++P +  EP
Sbjct  924  EEPAKVETPVVTEEPAKVEAPVVTEEPAKVETPVVTEEP  962


 Score = 48.9 bits (115),  Expect = 0.001, Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 40/92 (43%), Gaps = 0/92 (0%)
 Frame = +1

Query  211  PLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDS  390
            P K ++P +  EP     P+  E PA +  P       K ++P +  EP     P+  + 
Sbjct  866  PAKVETPVVTEEPAKVETPVVTEEPAKVETPVATEEQAKVEAPVVTEEPAKVETPVVTEE  925

Query  391  PAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            PA +  P +   P K ++P +  EP     P+
Sbjct  926  PAKVETPVVTEEPAKVEAPVVTEEPAKVETPV  957



>ref|WP_036322739.1| hypothetical protein, partial [Microbacterium gubbeenense]
Length=125

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 50/108 (46%), Gaps = 3/108 (3%)
 Frame = +1

Query  175  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAML---SEPTMPNYHLKYDSPAM  345
            PA  SEP  P  P +   PA  +EPT P  P +   PA     +EPT P        P+ 
Sbjct  5    PAEPSEPAEPGEPAEPTDPAEPAEPTDPAEPTEPTEPAEPTEPAEPTDPAEPTDPTEPSE  64

Query  346  LSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
             +EPT P  P +   PA  +EPT P+ P     P   +EPT P  P +
Sbjct  65   PAEPTEPTDPAEPTGPAEPAEPTSPAEPTGPAEPTSPAEPTDPAEPTD  112



>ref|WP_032667851.1| hypothetical protein, partial [Mycobacterium kansasii]
Length=121

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/97 (27%), Positives = 49/97 (51%), Gaps = 0/97 (0%)
 Frame = -1

Query  452  IAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**FGIVGSDSIAGDSY  273
            +AG +   G  G+ G+  +AG +   G  G+ G+  +AG +      G+ G+  +AG++ 
Sbjct  1    LAGNAGLAGNAGLAGNAGLAGNAGLAGNAGLAGNAGLAGNAGLAGNAGLAGNAGLAGNAG  60

Query  272  FKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  162
              G  G+ G+  +AG +   G  G+ G+  +AG +  
Sbjct  61   LAGNAGLAGNAGLAGNAGLAGNAGLAGNAGLAGNAGL  97



>gb|AIN82002.1| hypothetical protein DR71_1244 [Corynebacterium sp. ATCC 6931]
Length=996

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 33/105 (31%), Positives = 50/105 (48%), Gaps = 7/105 (7%)
 Frame = +1

Query  169  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
            D P+   E T P  P +  +P+  SE   P+ P   E P+  ++P  P      + P+  
Sbjct  681  DEPSEQPETTQPEEPSETTTPSK-SESEKPSKPAHPEKPSKPTKPAQP------EKPSKP  733

Query  349  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            ++PT P  P K   P   ++P  PS P K   P   S+P+ P+HP
Sbjct  734  TKPTKPAQPEKPSKPTKPAQPEKPSKPSKPAQPEKPSKPSKPSHP  778



>ref|WP_040802052.1| hypothetical protein, partial [Staphylococcus simiae]
Length=108

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  175  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  354
            P+   EP +P++P   + P    EP +P++P     P+   EP +P+     + P    E
Sbjct  3    PSTPGEPDVPSNPDTPNDPGTPGEPDVPSNPDTPNDPSTPGEPDVPSNPDTPNDPGTPGE  62

Query  355  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            P +P++P   + P   SEP +PS+P   ++P    E  +P++P
Sbjct  63   PNVPSNPDTPNDPGTPSEPDVPSNPDTPNNPGTPGESDVPSNP  105



>ref|XP_002777995.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER09790.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
Length=645

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 53/118 (45%), Gaps = 5/118 (4%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P +   P   +EPT P  P +   P   +EPT P  P +   P   +EPT P    +  
Sbjct  95   EPTRPTKPTRPTEPTRPTKPTRPTEPTRPTEPTRPTEPTRPTMPTRPTEPTRPTKPTRPT  154

Query  334  SPAMLSEPTMPNHPLKYDSPA---MLSEPTMPSHPLKYDSPAMLSEPTMPNHP--LNG  492
             P   ++PT P  P +   P    M + PTMP+ P K   P M + PTMP  P   NG
Sbjct  155  KPTRPTKPTRPTKPTRPTEPTRPTMPTRPTMPTMPTKPTRPTMPTRPTMPTRPHCKNG  212



>gb|EPQ06187.1| Sialidase, partial [Myotis brandtii]
Length=175

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 60/115 (52%), Gaps = 0/115 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
            + P++  +P+  +EP  P+ P   + P   S P+ PN P++  +P+  +EP  P+     
Sbjct  8    NEPIEPSAPSAPNEPIEPSAPSAPNEPIEPSAPSAPNEPIEPSAPSAPNEPIEPSAPSAP  67

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  495
            + P   S P+ PN P++  +P+  +EP  PS P   + P   S P+ PN P+  S
Sbjct  68   NEPIEPSAPSAPNEPIEPSAPSAPNEPIEPSAPSAPNEPIEPSAPSAPNEPIEPS  122


 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 6/109 (6%)
 Frame = +1

Query  187  SEPTMPNHPLKYDSPAMLSEP------TMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  348
            S P+ PN P++  +P+  +EP      + PN P++  +P+  +EP  P+     + P   
Sbjct  2    SAPSAPNEPIEPSAPSAPNEPIEPSAPSAPNEPIEPSAPSAPNEPIEPSAPSAPNEPIEP  61

Query  349  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  495
            S P+ PN P++  +P+  +EP  PS P   + P   S P+ PN P+  S
Sbjct  62   SAPSAPNEPIEPSAPSAPNEPIEPSAPSAPNEPIEPSAPSAPNEPIEPS  110



>ref|WP_033605890.1| alpha-L-fucosidase, partial [Streptococcus sp. CM6]
Length=1746

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 34/82 (41%), Gaps = 6/82 (7%)
 Frame = +1

Query  244   EPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPS  423
             E   P  P + E P    +PT P      + PA   +P  P  P + + PA   +P  P 
Sbjct  1671  EAAQPEKPAQPEKPVQPEKPTQP------EKPAEPEKPAQPEKPAQPEKPAQPEKPAQPE  1724

Query  424   HPLKYDSPAMLSEPTMPNHPLN  489
              P + + PA    P  P  PLN
Sbjct  1725  KPAQPEKPAQPENPVQPEQPLN  1746


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 24/81 (30%), Positives = 33/81 (41%), Gaps = 6/81 (7%)
 Frame = +1

Query  190   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  369
             E   P  P + + P    +PT P  P + E PA   +P  P      + PA   +P  P 
Sbjct  1671  EAAQPEKPAQPEKPVQPEKPTQPEKPAEPEKPAQPEKPAQP------EKPAQPEKPAQPE  1724

Query  370   HPLKYDSPAMLSEPTMPSHPL  432
              P + + PA    P  P  PL
Sbjct  1725  KPAQPEKPAQPENPVQPEQPL  1745



>ref|WP_009730655.1| LPXTG-domain-containing protein, partial [Streptococcus sp. F0441]
 gb|EKS16123.1| LPXTG-domain-containing protein, partial [Streptococcus sp. F0441]
Length=318

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 52/114 (46%), Gaps = 0/114 (0%)
 Frame = +1

Query  148  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  327
            +  P + ++PA   +P  P  P++ + PA    P  P  P + E PA   +P  P    +
Sbjct  28   SEKPAQPETPAQPEKPAQPETPVQPEKPAQPETPVQPEKPAQPEKPAEPEKPAQPETPAQ  87

Query  328  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
             ++P    +P  P  P + + PA   +P  P  P + + PA   +PT P  P+ 
Sbjct  88   PETPVQPEKPVQPEKPAEPEKPAQPEKPAEPEKPAQPEKPAQPEKPTQPETPVQ  141



>gb|ACB11429.1| neurofilament triplet H1-like protein, partial [Ambystoma tigrinum 
virus]
Length=249

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 38/114 (33%), Gaps = 1/114 (1%)
 Frame = +1

Query  148  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  327
               P+K  SP     P     P+K  SP     P     P+K +SP     P      +K
Sbjct  128  RKSPVKRKSPVNCKSPVKTRSPVKRKSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVK  187

Query  328  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
              SP     P     PLK  SP     P     PLK  SP     P     PL 
Sbjct  188  RKSPVKRKSPVK-RSPLKRKSPVNKRSPVKRKSPLKRKSPVNKRSPVKRKSPLK  240


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 39/117 (33%), Gaps = 0/117 (0%)
 Frame = +1

Query  148  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  327
               P+   SP     P     P+K  SP     P     P+K +SP     P      +K
Sbjct  86   KRSPVNRKSPVNCKSPVKRKSPVKRKSPVKTRSPVNCKSPVKRKSPVKRKSPVNCKSPVK  145

Query  328  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSP  498
              SP     P     P+K  SP     P     P+K  SP     P     P+  SP
Sbjct  146  TRSPVKRKSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVKRKSPVKRSP  202


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 36/114 (32%), Gaps = 0/114 (0%)
 Frame = +1

Query  148  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  327
               P+K  SP     P     P+   SP     P     P+K  SP     P      +K
Sbjct  74   RKSPVKRKSPVKKRSPVNRKSPVNCKSPVKRKSPVKRKSPVKTRSPVNCKSPVKRKSPVK  133

Query  328  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
              SP     P     P+K  SP     P     P+K  SP     P     P+ 
Sbjct  134  RKSPVNCKSPVKTRSPVKRKSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVK  187



>gb|ACB11433.1| neurofilament triplet H1-like protein, partial [Ambystoma tigrinum 
virus]
 gb|ACB11436.1| neurofilament triplet H1-like protein, partial [Ambystoma tigrinum 
virus]
 gb|ACB11444.1| neurofilament triplet H1-like protein, partial [Ambystoma tigrinum 
virus]
Length=273

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 36/106 (34%), Gaps = 0/106 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P+K  SP     P     P+K  SP     P     P+K +SP     P      +K 
Sbjct  99   KSPVKRKSPVNCKSPVKRKSPVKTRSPVKRKSPVKRKSPVKRKSPVNCKSPVKTRSPVKR  158

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPT  468
             SP     P     P+K  SP     P     P+K  SP     P 
Sbjct  159  KSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVKRKSPV  204


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/113 (27%), Positives = 37/113 (33%), Gaps = 0/113 (0%)
 Frame = +1

Query  148  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  327
               P+K  SP     P     P+K  SP     P     P+K  SP     P      +K
Sbjct  80   RKSPVKKRSPVNRKSPVNCKSPVKRKSPVNCKSPVKRKSPVKTRSPVKRKSPVKRKSPVK  139

Query  328  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              SP     P     P+K  SP     P     P+K  SP     P     P+
Sbjct  140  RKSPVNCKSPVKTRSPVKRKSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPV  192



>ref|WP_036903336.1| hypothetical protein, partial [Propionibacterium sp. KPL1844]
Length=98

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 46/90 (51%), Gaps = 0/90 (0%)
 Frame = +1

Query  196  TMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHP  375
            T P+ P K    +  ++P  P  P K  +PA  ++PT P   ++  +P   + P  P+ P
Sbjct  9    TKPSTPGKSTKTSKQAKPRTPARPAKPSTPAKPAKPTTPTKPVRPSTPVAPTTPARPSTP  68

Query  376  LKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  465
             K  +PA  S PT P+HP K   P+  ++P
Sbjct  69   AKATTPAKPSTPTKPTHPTKPAKPSTPAKP  98



>ref|WP_012715328.1| hypothetical protein [Corynebacterium aurimucosum]
 gb|ACP33883.1| hypothetical protein cauri_2292 [Corynebacterium aurimucosum 
ATCC 700975]
Length=939

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 49/109 (45%), Gaps = 0/109 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P +  +P    E T PN P +  +P    E T PN+P +  +P    E T PN   +  +
Sbjct  683  PTEETTPNNPGEETTPNEPGEETTPNQPGEETTPNNPGEETTPNQPGEETTPNQPGEETT  742

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            P    E T PN P +  +P    E T P+ P +  +P    E T PN P
Sbjct  743  PNNPGEETTPNQPGEETTPNNPGEETTPNQPGEETTPNNPGEETTPNEP  791



>gb|ACB11441.1| neurofilament triplet H1-like protein, partial [Ambystoma tigrinum 
virus]
Length=237

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 36/106 (34%), Gaps = 0/106 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P+K  SP     P     P+K  SP     P     P+K +SP     P      +K 
Sbjct  99   KSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVKRKSPVKRKSPVNCKSPVKTRSPVKR  158

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPT  468
             SP     P     P+K  SP     P     P+K  SP     P 
Sbjct  159  KSPVNCKSPVKRKSPVKRKSPVNCKSPVKTKSPVKRKSPVKRKSPV  204


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 37/114 (32%), Gaps = 0/114 (0%)
 Frame = +1

Query  148  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  327
               P+K  SP     P     P+K  SP     P     P+K  SP     P      +K
Sbjct  80   RKSPVKKRSPVNRKSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVKRKSPVK  139

Query  328  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
              SP     P     P+K  SP     P     P+K  SP     P     P+ 
Sbjct  140  RKSPVNCKSPVKTRSPVKRKSPVNCKSPVKRKSPVKRKSPVNCKSPVKTKSPVK  193



>gb|KEK51840.1| LPXTG cell wall anchor domain protein, partial [Staphylococcus 
warneri Lyso 2 2011]
Length=1567

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 33/113 (29%), Positives = 50/113 (44%), Gaps = 3/113 (3%)
 Frame = +1

Query  136   TMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPN  315
             T++ +  P+    P   ++P  P  P     P    +PT P+HP    +P   ++P+ P 
Sbjct  1366  TVIDDGKPVDPSQPTDPTDPGKPTDPSHPTDPTDPGKPTDPSHPTDPTNPGEPTDPSQPT  1425

Query  316   YHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
                    P   S+PT P +P +   P   +EPT P  P +   PA   EPT P
Sbjct  1426  EPTNPGEPTDPSQPTEPTNPGEPTEPGQPTEPTNPGEPTEPGQPA---EPTNP  1475


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 34/105 (32%), Positives = 43/105 (41%), Gaps = 3/105 (3%)
 Frame = +1

Query  175   PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  354
             P   S+PT P  P K   P   S PT P  P K   P+  ++PT P        P   + 
Sbjct  1373  PVDPSQPTDPTDPGKPTDP---SHPTDPTDPGKPTDPSHPTDPTNPGEPTDPSQPTEPTN  1429

Query  355   PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
             P  P  P +   P    EPT P  P +  +P   +EP  P  P N
Sbjct  1430  PGEPTDPSQPTEPTNPGEPTEPGQPTEPTNPGEPTEPGQPAEPTN  1474



>ref|WP_035756719.1| hypothetical protein, partial [Granulicoccus phenolivorans]
Length=128

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 53/128 (41%), Gaps = 24/128 (19%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLS---------------------EPTMPNHPL  270
             P +   P   S+PT P+ P +   P+  +                     EPT P+ P 
Sbjct  4    EPSQPSQPTQPSQPTQPSQPTQPSQPSQPTEPSQPSQPSQPSQPSQPTQPTEPTQPSQPT  63

Query  271  KYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPA  450
            +   P   S+P+ P    +   P+  S+PT P  P +   P+  S+PT PS P +   P 
Sbjct  64   QPTEPTQPSQPSQPTEPTQ---PSQPSQPTQPTEPSQPTQPSQPSQPTEPSQPTQPTEPT  120

Query  451  MLSEPTMP  474
              SEPT P
Sbjct  121  QPSEPTQP  128


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 51/122 (42%), Gaps = 21/122 (17%)
 Frame = +1

Query  181  MLSEPTMPNHPLKYDSPAMLSEPTMPNHPLK---------------------YESPAMLS  297
              +EP+ P+ P +   P   S+PT P+ P +                        P   S
Sbjct  1    QPTEPSQPSQPTQPSQPTQPSQPTQPSQPSQPTEPSQPSQPSQPSQPSQPTQPTEPTQPS  60

Query  298  EPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPN  477
            +PT P    +   P+  +EPT P+ P +   P   S+PT PS P +   P+  ++PT P 
Sbjct  61   QPTQPTEPTQPSQPSQPTEPTQPSQPSQPTQPTEPSQPTQPSQPSQPTEPSQPTQPTEPT  120

Query  478  HP  483
             P
Sbjct  121  QP  122



>gb|ACB11434.1| neurofilament triplet H1-like protein, partial [Ambystoma tigrinum 
virus]
Length=273

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 36/106 (34%), Gaps = 0/106 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P+K  SP     P     P+K  SP     P     P+K +SP     P      +K 
Sbjct  99   KSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVKRKSPVKRKSPVNCKSPVKTRSPVKR  158

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPT  468
             SP     P     P+K  SP     P     P+K  SP     P 
Sbjct  159  KSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVKRKSPV  204


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 37/114 (32%), Gaps = 0/114 (0%)
 Frame = +1

Query  148  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  327
               P+K  SP     P     P+K  SP     P     P+K  SP     P      +K
Sbjct  80   RKSPVKKRSPVNRKSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVKRKSPVK  139

Query  328  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
              SP     P     P+K  SP     P     P+K  SP     P     P+ 
Sbjct  140  RKSPVNCKSPVKTRSPVKRKSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVK  193



>ref|XP_010871682.1| PREDICTED: sporozoite surface protein 2-like [Esox lucius]
Length=253

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 53/114 (46%), Gaps = 7/114 (6%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMP------NHPLKYESPAMLSEPTMPNY  318
            PL+ + P   ++P   N P +    A  ++PT P      N P +   PA  ++PT P +
Sbjct  140  PLQTNQPTQPAQPAQTNQPTQPAQSAQTNQPTQPAPPLQTNQPTQPAQPAQTNQPTQPAH  199

Query  319  HLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDS-PAMLSEPTMPN  477
                + P   ++P+  N P +   P   ++PT P+ P K    PA  ++P  PN
Sbjct  200  PAITNQPTQPAQPSQTNRPTQPAQPVQTNQPTQPAQPAKQACQPAQPNKPVQPN  253


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 55/123 (45%), Gaps = 12/123 (10%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNH------------PLKYDSPAMLSEPTMPNHPLKYESPAML  294
            + P +   PA  ++PT P              PL+ + P   ++P   N P +    A  
Sbjct  108  NQPTQPAQPAQTNQPTQPAQTAQTNQTTQPAPPLQTNQPTQPAQPAQTNQPTQPAQSAQT  167

Query  295  SEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  474
            ++PT P   L+ + P   ++P   N P +   PA+ ++PT P+ P + + P   ++P   
Sbjct  168  NQPTQPAPPLQTNQPTQPAQPAQTNQPTQPAHPAITNQPTQPAQPSQTNRPTQPAQPVQT  227

Query  475  NHP  483
            N P
Sbjct  228  NQP  230



>ref|WP_044019725.1| hypothetical protein [Staphylococcus lugdunensis]
Length=442

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 54/117 (46%), Gaps = 15/117 (13%)
 Frame = +1

Query  136  TMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPN  315
            T +    P K + P   SEP  PN P K   P+  SEP  P+ P K   P   SEP  PN
Sbjct  270  TCICKCEPNKPNEPGKPSEPGKPNEPNKPSEPSKPSEPNKPSEPSKPSEPGKPSEPNKPN  329

Query  316  YHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
                        EP+ P+ P K + P+  SEPT PS P K   P+   +P+ PN  +
Sbjct  330  ------------EPSKPSEPNKPNEPSKPSEPTKPSEPNK---PSEPGKPSKPNKSV  371



>ref|XP_007812695.1| Neurofilament triplet H protein [Metarhizium acridum CQMa 102]
 gb|EFY87643.1| Neurofilament triplet H protein [Metarhizium acridum CQMa 102]
Length=467

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/113 (20%), Positives = 56/113 (50%), Gaps = 0/113 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  327  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  386

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  495
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P++ +
Sbjct  387  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHAN  439


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  9    PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  68

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  69   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  118


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  15   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  74

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  75   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  124


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  21   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  80

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  81   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  130


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  27   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  86

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  87   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  136


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  33   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  92

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  93   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  142


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  39   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  98

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  99   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  148


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  45   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  104

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  105  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  154


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  51   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  110

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  111  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  160


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  57   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  116

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  117  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  166


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  63   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  122

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  123  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  172


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  69   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  128

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  129  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  178


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  75   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  134

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  135  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  184


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  81   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  140

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  141  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  190


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  87   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  146

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  147  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  196


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  93   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  152

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  153  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  202


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  99   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  158

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  159  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  208


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  105  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  164

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  165  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  214


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  111  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  170

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  171  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  220


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  117  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  176

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  177  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  226


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  123  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  182

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  183  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  232


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  129  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  188

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  189  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  238


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  135  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  194

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  195  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  244


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  141  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  200

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  201  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  250


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  147  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  206

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  207  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  256


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  153  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  212

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  213  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  262


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  159  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  218

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  219  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  268


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  165  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  224

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  225  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  274


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  171  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  230

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  231  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  280


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  177  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  236

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  237  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  286


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  183  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  242

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  243  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  292


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  189  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  248

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  249  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  298


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  195  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  254

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  255  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  304


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  201  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  260

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  261  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  310


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  207  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  266

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  267  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  316


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  213  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  272

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  273  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  322


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  219  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  278

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  279  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  328


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  225  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  284

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  285  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  334


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  231  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  290

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  291  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  340


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  237  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  296

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  297  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  346


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  243  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  302

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  303  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  352


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  249  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  308

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  309  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  358


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  255  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  314

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  315  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  364


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  261  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  320

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  321  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  370


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  267  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  326

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  327  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  376


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  273  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  332

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  333  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  382


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  279  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  338

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  339  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  388


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  285  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  344

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  345  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  394


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  291  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  350

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  351  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  400


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  297  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  356

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  357  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  406


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  303  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  362

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  363  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  412


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  309  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  368

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  369  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  418


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  315  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  374

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  375  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  424


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  321  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  380

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  381  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  430


 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/116 (20%), Positives = 56/116 (48%), Gaps = 0/116 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  333  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  392

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P   + ++
Sbjct  393  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHANGPACATKQE  448



>gb|KFY21541.1| hypothetical protein V493_07318, partial [Pseudogymnoascus pannorum 
VKM F-4281 (FW-2241)]
Length=874

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 40/95 (42%), Gaps = 1/95 (1%)
 Frame = +1

Query  205  NHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKY  384
              P+     A   EP + N     E P  + EP +     K + PA + EPT    P   
Sbjct  571  EEPVTASEVAEAKEPVVANEAAAVEEPTKVEEPAVVEEITKVEEPAAIQEPTKVEEPAAV  630

Query  385  DSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
            + P+ + EPT  +   K D+P +  E T    P++
Sbjct  631  EEPSSIKEPTA-AEQAKVDAPVVSEEATKAEEPVS  664



>gb|ACX55818.1| Aap [Staphylococcus epidermidis]
Length=114

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 42/109 (39%), Gaps = 3/109 (3%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P K   P   +EP  P  P     P   +EP  P  P K   P   +EP  P    K  
Sbjct  9    EPGKPAEPGTPAEPGKPAEPGTPAEPGKPAEPGTPAEPGKPAEPGKPAEPGKPAEPGKPA  68

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNH  480
             P   +EP  P  P K   PA   +P  P  P++  +PA    P  PN 
Sbjct  69   EPGTPAEPGTPAEPGK---PAESGKPVEPGKPVEPGTPAQSGAPEQPNR  114



>emb|CCC17559.1| cell surface protein [Lactobacillus pentosus IG1]
Length=1939

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 32/83 (39%), Positives = 39/83 (47%), Gaps = 6/83 (7%)
 Frame = +1

Query  187   SEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMP  366
             +EP  P  P K   P   +EPT P  P K E PA   +PT P   +K   P   ++PT P
Sbjct  1736  NEPVKPTEPTK---PVKPTEPTKPGQPTKPEKPAEPVKPTEPAKPVK---PTKSTKPTEP  1789

Query  367   NHPLKYDSPAMLSEPTMPSHPLK  435
               P K   P   +EPT P  P K
Sbjct  1790  AKPAKPVKPTKPTEPTKPVKPTK  1812



>ref|XP_011244138.1| PREDICTED: endochitinase A-like [Mus musculus]
 ref|XP_011243012.1| PREDICTED: endochitinase A-like [Mus musculus]
Length=248

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/113 (25%), Positives = 56/113 (50%), Gaps = 0/113 (0%)
 Frame = +1

Query  148  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  327
            +  P     PA+ +EP +   P+   +PA+ +EP +   P    +PA+ +EP +    + 
Sbjct  15   STEPAVSTEPAVSTEPAVSTEPMVSTAPAVSTEPMVSTEPAVSTAPAVSTEPAVSTEPMV  74

Query  328  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              +PA+ + P +   P+    PA+ +EP + + P+    P + +EP +   P+
Sbjct  75   STAPAVSTAPAVSTEPMVSTEPAVSTEPAVSTEPVVSTEPMVSTEPVVSTEPM  127



>gb|ELT92048.1| hypothetical protein CAPTEDRAFT_227575 [Capitella teleta]
Length=1981

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 71/148 (48%), Gaps = 19/148 (13%)
 Frame = +1

Query  121   MARPITMMPNHHPL---------------KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTM  255
             +++P  +   HHPL               ++   A+LS+P       +  + A+LS+P  
Sbjct  1503  LSQPAQLALQHHPLAAALLSQPAQLALQHQFLVAALLSQPAQLALQHRLLAAALLSQPAQ  1562

Query  256   PNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLK  435
             P    ++ + A+LS+P       ++ + A+LS+P  P    ++ + A+LS+P  P+   +
Sbjct  1563  PALQHQFLAAALLSQPAQSALQHQFLAAALLSQPAQPALQHQFLAAALLSQPAQPALQHR  1622

Query  436   YDSPAMLSEPTMPNHPLNGSPEQ*SLWH  519
             + + A+LS+P  P       P Q +L H
Sbjct  1623  FLAAALLSQPAQPAR----QPAQSALQH  1646



>ref|XP_007582940.1| putative gelsolin repeat protein [Neofusicoccum parvum UCRNP2]
 gb|EOD49563.1| putative gelsolin repeat protein [Neofusicoccum parvum UCRNP2]
Length=1408

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 52/119 (44%), Gaps = 12/119 (10%)
 Frame = +1

Query  163  KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYES------PAMLSEPTMPNYHL  324
            K DSP     PT    P+K  SP  +  P  P+ P K E       PA +  PT     +
Sbjct  640  KVDSPKKTDSPTKAVSPVKAASPTKIESPIKPSSPFKMEISTKPAPPAKVESPTKVVSPV  699

Query  325  KYDSPAMLSEPTMPNHPLKYD------SPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
            K  SP  +  P  P+ P K +      +PA +  PT P  PLK ++P+    PT  + P
Sbjct  700  KAASPTKIESPIKPSSPFKMEISTKPAAPAKVESPTKPVSPLKSETPSKPESPTKTDVP  758



>ref|WP_042132036.1| hypothetical protein [Paenibacillus sp. FSL R5-0345]
 gb|AIQ34959.1| hypothetical protein R50345_10300 [Paenibacillus sp. FSL R5-0345]
Length=497

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = -1

Query  473  GIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**FGIVGSD  294
            G VG+  +AG +   G  G VG+  +AG +   G  G VG+  +AG +      G VG+ 
Sbjct  140  GAVGAPGVAGATGVTGAPGAVGAPGVAGATGATGAPGAVGTPGVAGATGATGAPGAVGTP  199

Query  293  SIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGES  168
             +AG +   G  G+ G+  +AG +   G  G VG+  +AG +
Sbjct  200  GVAGATGVTGAPGVAGAPGVAGATGVTGAPGAVGAPGVAGAT  241



>gb|AAA29628.1| interspersed repeat antigen, partial [Plasmodium falciparum]
Length=700

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 26/112 (23%), Positives = 37/112 (33%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P+    P  + EP     P+    P    EP  P  P+  + P    EP  P   +  
Sbjct  249  QEPVTVQEPVTVQEPVTVQEPVTVQEPVTSQEPVTPQEPVTPQEPVTPQEPVTPQEPVTT  308

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P    EP     P+    P  + EP     P+  + P    EP     P+
Sbjct  309  QEPVTTQEPVTIEEPVTTQEPVTIEEPVTTQEPVTIEEPVTTQEPVTTQEPV  360


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 26/112 (23%), Positives = 37/112 (33%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P+    P  + EP     P+    P  + EP     P+  + P    EP  P   +  
Sbjct  231  QEPITVQEPVTVQEPVTVQEPVTVQEPVTVQEPVTVQEPVTVQEPVTSQEPVTPQEPVTP  290

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P    EP  P  P+    P    EP     P+    P  + EP     P+
Sbjct  291  QEPVTPQEPVTPQEPVTTQEPVTTQEPVTIEEPVTTQEPVTIEEPVTTQEPV  342


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 26/112 (23%), Positives = 36/112 (32%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P+    P    EP     P+    P    EP     P+  + P  + EP      +  
Sbjct  195  QEPVTTQEPVTTQEPVTTQEPVTTQEPVTTQEPVTTQEPITVQEPVTVQEPVTVQEPVTV  254

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P  + EP     P+    P    EP  P  P+    P    EP  P  P+
Sbjct  255  QEPVTVQEPVTVQEPVTVQEPVTSQEPVTPQEPVTPQEPVTPQEPVTPQEPV  306


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 26/112 (23%), Positives = 36/112 (32%), Gaps = 0/112 (0%)
 Frame = +1

Query  151  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  330
              P+    P    EP  P  P+    P    EP  P  P+  + P    EP      +  
Sbjct  267  QEPVTVQEPVTSQEPVTPQEPVTPQEPVTPQEPVTPQEPVTTQEPVTTQEPVTIEEPVTT  326

Query  331  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
              P  + EP     P+  + P    EP     P+    P    EP     P+
Sbjct  327  QEPVTIEEPVTTQEPVTIEEPVTTQEPVTTQEPVTTQEPVTTQEPVTTQEPV  378



>gb|ACB11427.1| neurofilament triplet H1-like protein, partial [Ambystoma tigrinum 
virus]
Length=277

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 39/117 (33%), Gaps = 0/117 (0%)
 Frame = +1

Query  148  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  327
               P+K  SP     P     P+K  SP     P     P+  +SP     P      +K
Sbjct  104  RKSPVKRKSPVNCKSPVKTRSPVKRKSPVKRKSPVKRKSPVNCKSPVKTRSPVNCKSPVK  163

Query  328  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSP  498
              SP     P     P+K  SP     P     P+K  SP     P     P+  SP
Sbjct  164  TRSPVKRKSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVKRKSPVKRSP  220



>ref|XP_008820989.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger and SCAN domain-containing 
protein 18 [Nannospalax galili]
Length=1035

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 23/110 (21%), Positives = 47/110 (43%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P++ D P    +P   +  ++ + P    E    + P++ + P    EP   + H++ + 
Sbjct  232  PIQQDEPVQRDKPIQQDEHIQQEEPIQQVESIQQDEPIQQDEPIQQEEPIQQDEHIQQEE  291

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
                +EP   + P++ D P    EP     P++ + P    EP   + P+
Sbjct  292  SIQQNEPIQQDEPIQQDEPIQQDEPIQGDEPIQQEEPTQWDEPIQQDEPI  341


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 27/109 (25%), Positives = 44/109 (40%), Gaps = 0/109 (0%)
 Frame = +1

Query  160  LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSP  339
            ++ D P    EP     P++ D      E    N P++ + P    EP   +  ++ D P
Sbjct  263  IQQDEPIQQDEPIQQEEPIQQDEHIQQEESIQQNEPIQQDEPIQQDEPIQQDEPIQGDEP  322

Query  340  AMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  486
                EPT  + P++ D P    EP      ++ D P    EP   + P+
Sbjct  323  IQQEEPTQWDEPIQQDEPIQQDEPIQQEEHIQKDEPISQEEPIQQDEPI  371


 Score = 48.9 bits (115),  Expect = 0.001, Method: Composition-based stats.
 Identities = 27/124 (22%), Positives = 49/124 (40%), Gaps = 12/124 (10%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P++ + P    EP     P++ D P    EP   + P++ + P    +P   + H++ + 
Sbjct  196  PIQQEEPIQQDEPIQQEEPIQQDEPIQQVEPIQQDEPIQQDEPVQRDKPIQQDEHIQQEE  255

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMP------------SHPLKYDSPAMLSEPTMPNH  480
            P    E    + P++ D P    EP               + P++ D P    EP   + 
Sbjct  256  PIQQVESIQQDEPIQQDEPIQQEEPIQQDEHIQQEESIQQNEPIQQDEPIQQDEPIQQDE  315

Query  481  PLNG  492
            P+ G
Sbjct  316  PIQG  319



>ref|XP_009134942.1| PREDICTED: proline-rich extensin-like protein EPR1 [Brassica 
rapa]
Length=167

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 58/87 (67%), Gaps = 6/87 (7%)
 Frame = +1

Query  163  KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMP-NHPLKYESPAMLSEPTMPNYHLKYDSP  339
            K  +P++ SE  +P    +Y +P++LSEP +P +H  K  +P++L EP +P  H +Y +P
Sbjct  78   KSSTPSIFSELVIPPDHKRY-APSILSEPVIPPDH--KRFAPSILFEPVIPPDHKRY-AP  133

Query  340  AMLSEPTMPNHPLKYDSPAMLSEPTMP  420
            ++LSEP +P    +Y +P++LSEP +P
Sbjct  134  SILSEPVIPPDHKRY-APSILSEPVIP  159


 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 57/86 (66%), Gaps = 4/86 (5%)
 Frame = +1

Query  217  KYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPA  396
            K  +P++ SE  +P    +Y +P++LSEP +P  H ++ +P++L EP +P    +Y +P+
Sbjct  78   KSSTPSIFSELVIPPDHKRY-APSILSEPVIPPDHKRF-APSILFEPVIPPDHKRY-APS  134

Query  397  MLSEPTMPSHPLKYDSPAMLSEPTMP  474
            +LSEP +P    +Y +P++LSEP +P
Sbjct  135  ILSEPVIPPDHKRY-APSILSEPVIP  159



>ref|WP_037683329.1| hypothetical protein, partial [Streptomyces cellulosae]
Length=4654

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 26/103 (25%), Positives = 47/103 (46%), Gaps = 0/103 (0%)
 Frame = +1

Query  157  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
            P+  +SP  +  P   N P    SP+ +  P   N P   ++P+ ++ P   +     D+
Sbjct  596  PVTLESPVAVDSPGTVNSPNAVTSPSTVDTPNAVNSPNAVDTPSTVNSPNAVDSPNAVDT  655

Query  337  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  465
            P  ++ P   N P   D+P+ +  P   + P   D+P+  S+P
Sbjct  656  PNAVNSPNAVNSPNAVDTPSTVDSPNAVNSPNTVDTPSTGSDP  698



>ref|WP_041896497.1| hypothetical protein, partial [Marine Group II euryarchaeote 
SCGC AB-629-J06]
Length=237

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 51/106 (48%), Gaps = 0/106 (0%)
 Frame = -1

Query  485  KG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**FGI  306
            KG  G+ G+D   G++  KG  GI G++   G    KG  GI G++   G    K   GI
Sbjct  50   KGLTGVDGTDGAKGDTGLKGIAGIDGTNGTNGSKGQKGLGGIDGTNGTNGSKGQKGLTGI  109

Query  305  VGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGES  168
             G+D + GD+  KG  GI G D   G+    G  G  G++   GE 
Sbjct  110  DGTDGVKGDTGLKGVAGIDGIDGTKGQKGLGGIDGTNGTNGTKGEQ  155



>gb|ACX55817.1| Aap [Staphylococcus epidermidis]
 gb|ACX55822.1| Aap [Staphylococcus epidermidis]
Length=120

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 45/117 (38%), Gaps = 2/117 (2%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P K   P   +EP  P  P K   P   +EP  P  P     P   +EP  P    K  
Sbjct  3    EPGKPAEPGKPAEPGTPAEPGKPAEPGTPAEPGKPAEPGTPAEPGKPAEPGKPAEPGKPA  62

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  504
             P   +EP  P  P K   P   +EP  P+   K   P    EP  P    +G+PEQ
Sbjct  63   EPGKPAEPGTPAEPGKPAEPGTPAEPGKPAESGKPVEPGKPVEPGTPAQ--SGAPEQ  117



>ref|WP_037540642.1| hypothetical protein, partial [Staphylococcus warneri]
Length=274

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 49/112 (44%), Gaps = 0/112 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
            HP    +P   ++P+ P  P     P   S+PT P +P +   P+  +EPT P       
Sbjct  25   HPTDPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPS  84

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  489
             P   + P  P  P +   P    EPT PS P +  +P   ++P+ P  P N
Sbjct  85   QPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTN  136



>gb|ETW50981.1| hypothetical protein PFMALIP_00929 [Plasmodium falciparum MaliPS096_E11]
Length=486

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 40/121 (33%), Gaps = 6/121 (5%)
 Frame = +1

Query  124  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  303
            A P   +    P+  + P    EP     P+    P  + EP     P+  + P  + EP
Sbjct  162  ATPQETVETQEPVTIEEPVTTQEPVTTQEPITVQEPVTVQEPVTVQEPVTVQEPVTVQEP  221

Query  304  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
                  +    P    EP  P  P+    P    EP  P  P+    P    E   P  P
Sbjct  222  ------VTVQEPVTSQEPVTPQEPVTPQEPVTPQEPVTPQEPVTPQEPVTTQESVTPQEP  275

Query  484  L  486
            +
Sbjct  276  V  276



>ref|XP_001270917.1| cell surface protein, putative [Aspergillus clavatus NRRL 1]
 gb|EAW09491.1| cell surface protein, putative [Aspergillus clavatus NRRL 1]
Length=527

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/110 (25%), Positives = 47/110 (43%), Gaps = 0/110 (0%)
 Frame = +1

Query  154  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  333
             P     P+   +P+ P  P     P+   +P++P  P     P +  +P+ P       
Sbjct  366  QPSTPGQPSTPGQPSTPGQPSTPGQPSAPGQPSVPGQPSTPGQPGVPEQPSTPGQPSTPG  425

Query  334  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             P+   +P++P  P   + P+   +P +P HP     PA   E ++P HP
Sbjct  426  QPSTPGQPSVPGQPGVPEQPSTPGQPGVPEHPSTPGQPAAPGESSVPGHP  475



>ref|XP_009317823.1| PREDICTED: neurofilament medium polypeptide [Pygoscelis adeliae]
Length=733

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 35/107 (33%), Positives = 43/107 (40%), Gaps = 6/107 (6%)
 Frame = +1

Query  127  RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  306
            +P+T    H P K   PA   +P  P  P   + P    +P  P  P   E PA   +P 
Sbjct  492  KPVTPEKPHSPEK---PATPEKPRSPEKPATPEKPRSPEKPATPEKPRSPEKPATPEKPR  548

Query  307  MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSP  447
             P    K  +P  L  P  P  P K  SP  L+ P  P  P K  SP
Sbjct  549  SPE---KPATPEKLRSPEKPATPEKPRSPEKLATPEKPRSPEKPASP  592



>gb|ADK78216.1| accumulation associated protein [Staphylococcus epidermidis]
Length=2455

 Score = 49.3 bits (116),  Expect = 0.001, Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 42/109 (39%), Gaps = 0/109 (0%)
 Frame = +1

Query  157   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  336
             P K   P   +EP  P  P K   P   +EP  P  P K   P   +EP  P    K   
Sbjct  2243  PGKPAEPGKPAEPGTPAEPGKPAEPGTPAEPGKPAEPGKPAEPGKPAEPGTPAEPGKPAE  2302

Query  337   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  483
             P   +EP  P  P K   P   +EP  P+ P     P   +EP  P  P
Sbjct  2303  PGTPAEPGKPAEPGKPAEPGKPAEPGTPAEPGTPAEPGKPAEPGTPAEP  2351



Lambda      K        H        a         alpha
   0.317    0.132    0.422    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 682974011750