BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP015B06 543 bp,

Length=516
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006339929.1|  PREDICTED: uncharacterized protein LOC102603902    107   1e-23   Solanum tuberosum [potatoes]
ref|XP_009800611.1|  PREDICTED: uncharacterized protein LOC104246496  99.4    5e-21   Nicotiana sylvestris
ref|XP_009621706.1|  PREDICTED: uncharacterized protein LOC104113292  99.4    5e-21   Nicotiana tomentosiformis
ref|XP_004248816.1|  PREDICTED: uncharacterized protein LOC101249871  97.4    2e-20   Solanum lycopersicum
ref|XP_009761238.1|  PREDICTED: uncharacterized protein LOC104213436  91.7    3e-18   Nicotiana sylvestris
ref|XP_009630601.1|  PREDICTED: uncharacterized protein LOC104120529  90.9    6e-18   Nicotiana tomentosiformis
ref|XP_011087770.1|  PREDICTED: uncharacterized protein LOC105169153  89.4    2e-17   
gb|EYU26549.1|  hypothetical protein MIMGU_mgv1a004490mg              81.6    9e-15   Erythranthe guttata [common monkey flower]
ref|XP_008218806.1|  PREDICTED: uncharacterized protein LOC103319089  80.1    3e-14   Prunus mume [ume]
ref|XP_007225720.1|  hypothetical protein PRUPE_ppa004314mg           79.7    3e-14   Prunus persica
ref|XP_004230505.1|  PREDICTED: uncharacterized protein LOC101257411  78.2    1e-13   Solanum lycopersicum
ref|XP_006349389.1|  PREDICTED: uncharacterized protein LOC102582751  77.8    2e-13   Solanum tuberosum [potatoes]
ref|XP_008378858.1|  PREDICTED: uncharacterized protein LOC103441920  76.3    5e-13   
ref|XP_010274324.1|  PREDICTED: uncharacterized protein LOC104609658  76.3    5e-13   Nelumbo nucifera [Indian lotus]
ref|XP_004140107.1|  PREDICTED: uncharacterized protein LOC101205574  75.9    7e-13   Cucumis sativus [cucumbers]
ref|XP_008347897.1|  PREDICTED: uncharacterized protein LOC103411030  75.5    7e-13   
ref|XP_008361657.1|  PREDICTED: uncharacterized protein LOC103425358  74.3    2e-12   
ref|XP_008449416.1|  PREDICTED: uncharacterized protein LOC103491309  72.0    2e-11   Cucumis melo [Oriental melon]
gb|KJB32772.1|  hypothetical protein B456_005G260700                  71.2    2e-11   Gossypium raimondii
ref|XP_010681792.1|  PREDICTED: uncharacterized protein LOC104896717  71.6    2e-11   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB32771.1|  hypothetical protein B456_005G260700                  71.2    3e-11   Gossypium raimondii
gb|KJB32773.1|  hypothetical protein B456_005G260700                  71.2    3e-11   Gossypium raimondii
emb|CDX87117.1|  BnaC09g04320D                                        71.2    3e-11   
ref|XP_002273537.1|  PREDICTED: uncharacterized protein LOC100246257  70.5    5e-11   Vitis vinifera
emb|CDX80466.1|  BnaC07g29780D                                        70.1    7e-11   
emb|CDO97538.1|  unnamed protein product                              69.7    1e-10   Coffea canephora [robusta coffee]
ref|XP_009111641.1|  PREDICTED: uncharacterized protein LOC103837067  68.6    2e-10   Brassica rapa
ref|XP_006394722.1|  hypothetical protein EUTSA_v10003985mg           68.6    2e-10   Eutrema salsugineum [saltwater cress]
gb|KJB47793.1|  hypothetical protein B456_008G041900                  67.8    4e-10   Gossypium raimondii
ref|XP_009385832.1|  PREDICTED: uncharacterized protein LOC103973087  67.8    4e-10   
gb|KHG04044.1|  Ribonuclease 3                                        67.4    5e-10   Gossypium arboreum [tree cotton]
gb|KJB47795.1|  hypothetical protein B456_008G041900                  67.4    5e-10   Gossypium raimondii
gb|KJB47790.1|  hypothetical protein B456_008G041900                  67.4    5e-10   Gossypium raimondii
gb|EPS60635.1|  hypothetical protein M569_14164                       67.4    5e-10   Genlisea aurea
ref|XP_004299952.1|  PREDICTED: uncharacterized protein LOC101315147  65.5    3e-09   Fragaria vesca subsp. vesca
ref|XP_010065497.1|  PREDICTED: uncharacterized protein LOC104452727  65.5    3e-09   Eucalyptus grandis [rose gum]
ref|XP_010103891.1|  hypothetical protein L484_024194                 64.7    4e-09   Morus notabilis
ref|XP_007041517.1|  Uncharacterized protein TCM_006400               64.3    6e-09   
gb|KHG12509.1|  Ribonuclease 3                                        63.9    6e-09   Gossypium arboreum [tree cotton]
ref|XP_002531414.1|  conserved hypothetical protein                   63.9    7e-09   
ref|XP_010272809.1|  PREDICTED: uncharacterized protein LOC104608494  63.5    1e-08   Nelumbo nucifera [Indian lotus]
ref|XP_003531582.1|  PREDICTED: uncharacterized protein LOC100805854  63.5    1e-08   Glycine max [soybeans]
gb|ACJ84181.1|  unknown                                               60.8    1e-08   Medicago truncatula
ref|XP_006289599.1|  hypothetical protein CARUB_v10003151mg           63.2    1e-08   
gb|KFK27747.1|  hypothetical protein AALP_AA8G423900                  63.2    1e-08   Arabis alpina [alpine rockcress]
ref|XP_006385218.1|  hypothetical protein POPTR_0003s01390g           62.4    2e-08   
ref|XP_002303156.2|  hypothetical protein POPTR_0003s01390g           62.8    2e-08   
ref|XP_009150996.1|  PREDICTED: uncharacterized protein LOC103874341  62.4    2e-08   Brassica rapa
ref|XP_002874216.1|  hypothetical protein ARALYDRAFT_910514           62.0    3e-08   Arabidopsis lyrata subsp. lyrata
emb|CDX88129.1|  BnaA06g27200D                                        62.8    3e-08   
ref|XP_011012909.1|  PREDICTED: uncharacterized protein LOC105117065  61.6    4e-08   Populus euphratica
gb|KDP38884.1|  hypothetical protein JCGZ_05041                       61.6    4e-08   Jatropha curcas
dbj|BAF02184.1|  hypothetical protein                                 61.2    6e-08   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF02139.1|  hypothetical protein                                 61.2    6e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197857.2|  uncharacterized protein                             61.2    6e-08   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01744.1|  hypothetical protein                                 61.2    7e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454795.1|  PREDICTED: uncharacterized protein LOC104736493  60.8    7e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010421305.1|  PREDICTED: uncharacterized protein LOC104706781  60.8    7e-08   Camelina sativa [gold-of-pleasure]
dbj|BAF01720.1|  hypothetical protein                                 60.5    1e-07   Arabidopsis thaliana [mouse-ear cress]
gb|KDO41863.1|  hypothetical protein CISIN_1g0096211mg                60.1    1e-07   Citrus sinensis [apfelsine]
gb|AFK33980.1|  unknown                                               60.1    1e-07   Medicago truncatula
gb|KDO41865.1|  hypothetical protein CISIN_1g0096211mg                59.7    1e-07   Citrus sinensis [apfelsine]
gb|KDO41864.1|  hypothetical protein CISIN_1g0096211mg                60.1    1e-07   Citrus sinensis [apfelsine]
ref|XP_006471043.1|  PREDICTED: uncharacterized protein LOC102620240  60.1    1e-07   Citrus sinensis [apfelsine]
dbj|BAF02072.1|  hypothetical protein                                 59.7    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003596481.1|  hypothetical protein MTR_2g081000                59.7    2e-07   Medicago truncatula
dbj|BAB09652.1|  unnamed protein product                              56.2    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007148497.1|  hypothetical protein PHAVU_006G213600g           59.3    3e-07   Phaseolus vulgaris [French bean]
gb|AGV54185.1|  hypothetical protein                                  58.9    3e-07   Phaseolus vulgaris [French bean]
ref|XP_003547548.1|  PREDICTED: uncharacterized protein LOC100783760  58.9    4e-07   Glycine max [soybeans]
ref|XP_010519583.1|  PREDICTED: uncharacterized protein LOC104798997  57.0    2e-06   Tarenaya hassleriana [spider flower]
ref|XP_010912913.1|  PREDICTED: uncharacterized protein LOC105038739  55.5    4e-06   Elaeis guineensis
ref|XP_008808156.1|  PREDICTED: uncharacterized protein LOC103720294  54.7    9e-06   Phoenix dactylifera
ref|XP_010525543.1|  PREDICTED: uncharacterized protein LOC104803318  53.1    2e-05   Tarenaya hassleriana [spider flower]
emb|CBI23847.3|  unnamed protein product                              51.6    7e-05   Vitis vinifera
gb|EMS50816.1|  hypothetical protein TRIUR3_22949                     50.1    2e-04   Triticum urartu
gb|EMT15742.1|  hypothetical protein F775_08643                       50.4    2e-04   
ref|XP_010929985.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  50.1    3e-04   
ref|XP_003578716.1|  PREDICTED: uncharacterized protein LOC100839151  49.7    3e-04   Brachypodium distachyon [annual false brome]
dbj|BAJ89837.1|  predicted protein                                    49.7    4e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006851061.1|  hypothetical protein AMTR_s00025p00237700        49.3    5e-04   Amborella trichopoda
ref|XP_009596329.1|  PREDICTED: uncharacterized protein LOC104092429  48.9    5e-04   Nicotiana tomentosiformis
ref|XP_008796030.1|  PREDICTED: uncharacterized protein LOC103711596  48.5    8e-04   
ref|XP_002443144.1|  hypothetical protein SORBIDRAFT_08g011730        48.5    8e-04   Sorghum bicolor [broomcorn]



>ref|XP_006339929.1| PREDICTED: uncharacterized protein LOC102603902 [Solanum tuberosum]
Length=531

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 86/127 (68%), Gaps = 3/127 (2%)
 Frame = +2

Query  65   MSHSVFQAVQIMPIHTQTskslpsssflkpllppaapvvagklRKFCLIKAS-SAVVDGD  241
            MSHSVFQ  QIMPI+TQ   +     F   ++      V  KLRK  +I+AS S V++GD
Sbjct  1    MSHSVFQTAQIMPINTQLLPTSTKPLFPAIVIRRPVLGVGRKLRKINVIRASTSPVINGD  60

Query  242  GIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEKSKLDMTQKQTK  421
             IA LERCFQASP     SSSSS  +      VMKGGKYG+ GAVTLEKSKLDMTQKQT+
Sbjct  61   AIAGLERCFQASPVDSPSSSSSSATNMFAP--VMKGGKYGAFGAVTLEKSKLDMTQKQTQ  118

Query  422  SSPELAT  442
            SSPEL+T
Sbjct  119  SSPELST  125



>ref|XP_009800611.1| PREDICTED: uncharacterized protein LOC104246496 [Nicotiana sylvestris]
Length=528

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 88/127 (69%), Gaps = 4/127 (3%)
 Frame = +2

Query  65   MSHSVFQAVQIMPIHTQTskslpsssflkpllppaapvvagklRKFCLIKASSA-VVDGD  241
            MSHSVFQ  Q MPI+TQ   +         +  PA  V     R+  +IKAS+A  +DGD
Sbjct  1    MSHSVFQTAQFMPINTQIVPTSKPLFPAVVIRRPAPVVAGKL-RQTNVIKASTAPAIDGD  59

Query  242  GIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEKSKLDMTQKQTK  421
             I  LERCFQASPS+DSPS SSS++       VMKGGKYG+LGAVTLEKSKLD+TQKQTK
Sbjct  60   AIDGLERCFQASPSIDSPSPSSSSSVMYAP--VMKGGKYGALGAVTLEKSKLDLTQKQTK  117

Query  422  SSPELAT  442
            SSPEL+T
Sbjct  118  SSPELST  124



>ref|XP_009621706.1| PREDICTED: uncharacterized protein LOC104113292 [Nicotiana tomentosiformis]
 ref|XP_009621707.1| PREDICTED: uncharacterized protein LOC104113292 [Nicotiana tomentosiformis]
Length=530

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 89/127 (70%), Gaps = 4/127 (3%)
 Frame = +2

Query  65   MSHSVFQAVQIMPIHTQTskslpsssflkpllppaapvvagklRKFCLIKASSA-VVDGD  241
            MSHSVFQ  Q MPI+TQ   +         +  PA  V     R+  +IKAS+A  +DGD
Sbjct  1    MSHSVFQTAQFMPINTQIVPTSKPLFPAVVIRRPAPVVAGKL-RQTNVIKASTAPAIDGD  59

Query  242  GIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEKSKLDMTQKQTK  421
             I  LERCFQASPS+DSPSSSSS++       VMKGGKYG+LGAVTLEKSKLD+TQKQTK
Sbjct  60   AIDGLERCFQASPSIDSPSSSSSSSVMYAP--VMKGGKYGALGAVTLEKSKLDLTQKQTK  117

Query  422  SSPELAT  442
            SSPEL+T
Sbjct  118  SSPELST  124



>ref|XP_004248816.1| PREDICTED: uncharacterized protein LOC101249871 [Solanum lycopersicum]
Length=531

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 76/128 (59%), Positives = 92/128 (72%), Gaps = 5/128 (4%)
 Frame = +2

Query  65   MSHSVFQAVQIMPIHTQTskslpsssflkpllppaapvvagklRKFCLIKAS-SAVVDGD  241
            MSHSVFQ  QIMPI+TQ   +     F   ++      V G LRK  +I+AS S V+DGD
Sbjct  1    MSHSVFQTAQIMPINTQLLPTSTKPLFPAIVIRRPVLRVGGTLRKINVIRASTSPVIDGD  60

Query  242  GIAALERCFQaspsldspssssstasparyapVMKGG-KYGSLGAVTLEKSKLDMTQKQT  418
             IA LERCFQA+PS+D PSSSSST+  A    VMKGG KYG+ GAVTLEKSKL++TQKQT
Sbjct  61   AIAGLERCFQATPSVDPPSSSSSTSMSAP---VMKGGGKYGAFGAVTLEKSKLNLTQKQT  117

Query  419  KSSPELAT  442
            +SSPE++T
Sbjct  118  QSSPEIST  125



>ref|XP_009761238.1| PREDICTED: uncharacterized protein LOC104213436 [Nicotiana sylvestris]
Length=539

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 92/133 (69%), Gaps = 8/133 (6%)
 Frame = +2

Query  65   MSHSVFQAVQIMPIHTQTskslpsssflkpllppaapvvagklRKF-----CLIKAS-SA  226
            MSHSVFQ  QIMPI+TQ   S       KPLLPP     +    K       ++KA+ S 
Sbjct  1    MSHSVFQTAQIMPINTQIIPSSKPHLSSKPLLPPLLCRPSVFAGKVRKTNGVIVKATASP  60

Query  227  VVDGDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEKSKLDMT  406
             VDGD IAALERCFQASPS+DSP+SSSS++S      VMKGGKYG+ GA TLEKSKLD+T
Sbjct  61   AVDGDPIAALERCFQASPSIDSPASSSSSSSVMYAP-VMKGGKYGAFGATTLEKSKLDLT  119

Query  407  -QKQTKSSPELAT  442
             QKQT+SSPEL+T
Sbjct  120  QQKQTRSSPELST  132



>ref|XP_009630601.1| PREDICTED: uncharacterized protein LOC104120529 [Nicotiana tomentosiformis]
Length=533

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 90/133 (68%), Gaps = 12/133 (9%)
 Frame = +2

Query  65   MSHSVFQAVQIMPIHTQTskslpsssflkpllppaapvvagklRKF-----CLIKAS-SA  226
            MSHSVFQ  QIMPI+TQ   S       KPLLPP+    +    K       +IKA+ S 
Sbjct  1    MSHSVFQTAQIMPINTQIIPSSKPHLSSKPLLPPSLCRPSLFAGKVRKTNVVIIKATASP  60

Query  227  VVDGDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEKSKLDMT  406
             VDGD +A LERCFQASPSLDSP+SSS   +P     VMKGGKYG+ GA TLEKSKLD+T
Sbjct  61   AVDGDPMAVLERCFQASPSLDSPASSSVMYAP-----VMKGGKYGAFGATTLEKSKLDLT  115

Query  407  -QKQTKSSPELAT  442
             QKQT+SSPEL+T
Sbjct  116  QQKQTRSSPELST  128



>ref|XP_011087770.1| PREDICTED: uncharacterized protein LOC105169153 [Sesamum indicum]
Length=530

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 73/130 (56%), Positives = 86/130 (66%), Gaps = 6/130 (5%)
 Frame = +2

Query  65   MSHSVFQAVQIMPIHT--QTskslpsssflkpllppaapvvagklRKFCL-IKASS-AVV  232
            MSHSVFQ  QIMP+     T  S              +P VAGKLR+ C  +KASS AVV
Sbjct  1    MSHSVFQTAQIMPLAPTPNTLSSKSLLPTTATFRSTVSPAVAGKLRRCCFTVKASSSAVV  60

Query  233  DGDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEKSKLDMTQK  412
            D D +A+LERCFQASP      SS+S+++      VMKG KYG+ GAVTLEKSKLD+TQK
Sbjct  61   DDDAVASLERCFQASPPAADAPSSTSSSTADFGP-VMKG-KYGAFGAVTLEKSKLDLTQK  118

Query  413  QTKSSPELAT  442
            QTKSSPEL+T
Sbjct  119  QTKSSPELST  128



>gb|EYU26549.1| hypothetical protein MIMGU_mgv1a004490mg [Erythranthe guttata]
Length=524

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 62/82 (76%), Gaps = 3/82 (4%)
 Frame = +2

Query  203  CL--IKASSAVVDGDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAV  376
            CL  I+ASSAV D   IA LERCFQASP      SS+S++S      VMKGGK+GSLGAV
Sbjct  38   CLPGIRASSAVSDDSAIATLERCFQASPPSADAPSSASSSSADFGP-VMKGGKFGSLGAV  96

Query  377  TLEKSKLDMTQKQTKSSPELAT  442
            TLEKSKLDMTQK TKSSPE++T
Sbjct  97   TLEKSKLDMTQKITKSSPEIST  118



>ref|XP_008218806.1| PREDICTED: uncharacterized protein LOC103319089 [Prunus mume]
Length=517

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 54/125 (43%), Positives = 69/125 (55%), Gaps = 16/125 (13%)
 Frame = +2

Query  65   MSHSVFQAVQIMPIHTQTskslpsssflkpllppaapvvagklRKFCLIKASSAVVDGDG  244
            MSH+VFQ  QIMPI+TQ          ++  +     +V       C   ++S  VDGD 
Sbjct  1    MSHAVFQTAQIMPINTQLPTKPKLMGPIQLRMSERRGLVLKAN---CAAPSTSGFVDGDS  57

Query  245  IAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEKSKLDMTQKQTKS  424
            +A LERCF               +    + PVMK G+YG+LGAVTLEK KLDM+QKQ+KS
Sbjct  58   MALLERCF------------VGPSVTGGFGPVMK-GQYGALGAVTLEKGKLDMSQKQSKS  104

Query  425  SPELA  439
            SPE A
Sbjct  105  SPETA  109



>ref|XP_007225720.1| hypothetical protein PRUPE_ppa004314mg [Prunus persica]
 gb|EMJ26919.1| hypothetical protein PRUPE_ppa004314mg [Prunus persica]
Length=517

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 53/125 (42%), Positives = 69/125 (55%), Gaps = 16/125 (13%)
 Frame = +2

Query  65   MSHSVFQAVQIMPIHTQTskslpsssflkpllppaapvvagklRKFCLIKASSAVVDGDG  244
            MSH+VFQ  QIMPI+TQ          ++  +     ++       C   ++S  VDGD 
Sbjct  1    MSHAVFQTAQIMPINTQLPTKPKLMGPIQLRMSERRGLLLKAN---CAAPSTSGFVDGDS  57

Query  245  IAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEKSKLDMTQKQTKS  424
            +A LERCF               +    + PVMK G+YG+LGAVTLEK KLDM+QKQ+KS
Sbjct  58   MALLERCF------------VGPSVAGGFGPVMK-GQYGALGAVTLEKGKLDMSQKQSKS  104

Query  425  SPELA  439
            SPE A
Sbjct  105  SPETA  109



>ref|XP_004230505.1| PREDICTED: uncharacterized protein LOC101257411 [Solanum lycopersicum]
Length=524

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 63/128 (49%), Positives = 75/128 (59%), Gaps = 11/128 (9%)
 Frame = +2

Query  65   MSHSVFQAVQIMPIHTQTskslpsssflkpllppaapvvagklRKFCLIKA-SSAVVDGD  241
            MS  VFQ  QI PI+TQ                           K C IKA SS  VDGD
Sbjct  1    MSLPVFQTAQIKPINTQIIPYSKPLFPPLLCSQIRVY-------KVCKIKATSSPAVDGD  53

Query  242  GIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEKSKLDMTQK-QT  418
             ++ LERCFQ SP+LD P+SSSS+        VMKGGKYG+LG+VTLEK KLD++ K QT
Sbjct  54   PVSGLERCFQGSPALDHPTSSSSSTVMFAP--VMKGGKYGALGSVTLEKGKLDLSSKQQT  111

Query  419  KSSPELAT  442
             S+PEL+T
Sbjct  112  SSTPELST  119



>ref|XP_006349389.1| PREDICTED: uncharacterized protein LOC102582751 [Solanum tuberosum]
Length=524

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 64/128 (50%), Positives = 76/128 (59%), Gaps = 11/128 (9%)
 Frame = +2

Query  65   MSHSVFQAVQIMPIHTQTskslpsssflkpllppaapvvagklRKFCLIKAS-SAVVDGD  241
            MS  VFQ  QI PI+TQ               P           K C IKA+ S  VDGD
Sbjct  1    MSLPVFQTAQIKPINTQIIPYSKPLFPPLLCRPIRVY-------KVCKIKATASPAVDGD  53

Query  242  GIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEKSKLDMTQK-QT  418
             ++ LERCFQ SP+LD P+SSSS+        VMKGGKYG+LG+VTLEK KLDM+ K QT
Sbjct  54   PVSGLERCFQGSPALDHPASSSSSTVMFAP--VMKGGKYGALGSVTLEKGKLDMSSKQQT  111

Query  419  KSSPELAT  442
             S+PEL+T
Sbjct  112  SSTPELST  119



>ref|XP_008378858.1| PREDICTED: uncharacterized protein LOC103441920 [Malus domestica]
Length=429

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 70/133 (53%), Gaps = 29/133 (22%)
 Frame = +2

Query  65   MSHSVFQAVQIMPIHTQTskslpsssflkpllppaapvvagklRKFCLIKASSA------  226
            MSH+VFQ  QIMPI+TQ              +      +    R+  ++KA+ A      
Sbjct  1    MSHAVFQTAQIMPINTQL---------PTKPMLAVPAQLRMVERRGLVLKANCAPPPSTS  51

Query  227  -VVDGDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEKSKLDM  403
              VDGD +A LERCF               + P  + PVMK G+YG+ GAVTLEK KLDM
Sbjct  52   DAVDGDSMAMLERCF------------VGPSVPGGFGPVMK-GQYGAFGAVTLEKGKLDM  98

Query  404  TQKQTKSSPELAT  442
            +QKQ+KSSPE A 
Sbjct  99   SQKQSKSSPETAV  111



>ref|XP_010274324.1| PREDICTED: uncharacterized protein LOC104609658 [Nelumbo nucifera]
Length=540

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 65/134 (49%), Positives = 77/134 (57%), Gaps = 12/134 (9%)
 Frame = +2

Query  65   MSHSVFQAVQIMPIHTQTskslpsssflkp--------llppaapvvagklRKFCL-IKA  217
            MS +VFQ  QIMP+  Q      S S                +  +  GK RK  L IKA
Sbjct  1    MSQAVFQTAQIMPLGYQIPNKTFSPSTSSYPHPSLFVPRRIQSPSISVGKPRKLVLDIKA  60

Query  218  SSAVVDGDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEKSKL  397
            SS++VD D IA LERCF  SP     S+SSS++       VMKG +YG+ GAVTLEKSKL
Sbjct  61   SSSLVDSDPIAHLERCFSVSPDSGVGSASSSSSRMTAP--VMKG-QYGAFGAVTLEKSKL  117

Query  398  DMTQKQTKSSPELA  439
            DM+ KQTKSSPE A
Sbjct  118  DMSSKQTKSSPETA  131



>ref|XP_004140107.1| PREDICTED: uncharacterized protein LOC101205574 [Cucumis sativus]
 ref|XP_004158620.1| PREDICTED: uncharacterized LOC101205574 [Cucumis sativus]
 gb|KGN47925.1| hypothetical protein Csa_6G411290 [Cucumis sativus]
Length=534

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 58/128 (45%), Positives = 75/128 (59%), Gaps = 5/128 (4%)
 Frame = +2

Query  65   MSHSVFQAVQIMPIHTQTskslpsssflkpllppaapvvagklRKFC---LIKASSAVVD  235
            MSH+VFQ  QIMPI+TQ + +      +  L P         ++ F       +SS V  
Sbjct  1    MSHAVFQTAQIMPINTQLTTNNLWLPAVVKLGPSYRNRAVLVVKAFTASPPSSSSSGVSY  60

Query  236  GDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEKSKLDMTQKQ  415
            GD I+ LERCF+ S        S + +S +    VMKG KYG+ GAVTLEKSKLD++QKQ
Sbjct  61   GDSISFLERCFETSFPPAGVDPSLAVSSSSFGP-VMKG-KYGAFGAVTLEKSKLDLSQKQ  118

Query  416  TKSSPELA  439
            +KSSPELA
Sbjct  119  SKSSPELA  126



>ref|XP_008347897.1| PREDICTED: uncharacterized protein LOC103411030 [Malus domestica]
Length=451

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 70/133 (53%), Gaps = 29/133 (22%)
 Frame = +2

Query  65   MSHSVFQAVQIMPIHTQTskslpsssflkpllppaapvvagklRKFCLIKASSA------  226
            MSH+VFQ  QIMPI+TQ              +      +    R+  ++KA+ A      
Sbjct  1    MSHAVFQTAQIMPINTQL---------PTKPMLAVPAQLRMXERRGLVLKANCAPPPSTS  51

Query  227  -VVDGDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEKSKLDM  403
              VDGD +A LERCF               + P  + PVMK G+YG+ GAVTLEK KLDM
Sbjct  52   DAVDGDSMAMLERCF------------VGPSVPGGFGPVMK-GQYGAFGAVTLEKGKLDM  98

Query  404  TQKQTKSSPELAT  442
            +QKQ+KSSPE A 
Sbjct  99   SQKQSKSSPETAV  111



>ref|XP_008361657.1| PREDICTED: uncharacterized protein LOC103425358 [Malus domestica]
Length=519

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 68/126 (54%), Gaps = 16/126 (13%)
 Frame = +2

Query  65   MSHSVFQAVQIMPIHTQTskslpsssflkpllppaapvvagklRKFCLIKAS-SAVVDGD  241
            MSH+VFQ  QIMPI+ Q       +     L       +  K    CL   S S  VDGD
Sbjct  1    MSHAVFQTAQIMPINXQLPTKPKLAVLPTQLRMMERRGLVLKAN--CLPSPSTSDAVDGD  58

Query  242  GIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEKSKLDMTQKQTK  421
             +A +ERCF            +  ++P    PVMK G+YG+ GAVTLEK KLDM+QKQ+K
Sbjct  59   SMAMMERCF------------AXPSAPGGLGPVMK-GQYGAFGAVTLEKGKLDMSQKQSK  105

Query  422  SSPELA  439
            SSPE A
Sbjct  106  SSPETA  111



>ref|XP_008449416.1| PREDICTED: uncharacterized protein LOC103491309 [Cucumis melo]
Length=537

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 58/131 (44%), Positives = 78/131 (60%), Gaps = 8/131 (6%)
 Frame = +2

Query  65   MSHSVFQAVQIMPIHTQTskslpsssflkpllppaapvvagklRKFC------LIKASSA  226
            MSH+VFQ  QIMPI+TQ + +      +  L P         ++ F          +SS 
Sbjct  1    MSHAVFQTAQIMPINTQLTTNKLWLPSVVKLGPSYRNRAVLVVKAFTTSSPSSPSSSSSG  60

Query  227  VVDGDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEKSKLDMT  406
            V  GD IA LERCF+ +PS  + S      S + + PVMK G++G+LG+VTLEKSKLD++
Sbjct  61   VPYGDSIAFLERCFE-TPSAPAGSDPFLAISSSSFGPVMK-GQFGALGSVTLEKSKLDLS  118

Query  407  QKQTKSSPELA  439
            QKQ+KSSPE A
Sbjct  119  QKQSKSSPETA  129



>gb|KJB32772.1| hypothetical protein B456_005G260700 [Gossypium raimondii]
Length=437

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 55/78 (71%), Gaps = 6/78 (8%)
 Frame = +2

Query  215  ASSAVVDG--DGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEK  388
            +SS+++DG    +AALERCF A P+    SSS S         VMKGGKYG+ GAVTLEK
Sbjct  42   SSSSLIDGGDSSVAALERCFSAPPAPVETSSSGSGDVGP----VMKGGKYGAFGAVTLEK  97

Query  389  SKLDMTQKQTKSSPELAT  442
             KLDM+QKQ+ SSPELAT
Sbjct  98   GKLDMSQKQSTSSPELAT  115



>ref|XP_010681792.1| PREDICTED: uncharacterized protein LOC104896717 [Beta vulgaris 
subsp. vulgaris]
Length=531

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 60/131 (46%), Positives = 75/131 (57%), Gaps = 10/131 (8%)
 Frame = +2

Query  65   MSHSVFQAVQIMPIHTQTskslpsssflkpllppaapvvagklRKFCLIKASSA----VV  232
            MSH+VFQA QIMP++TQ       +      +     +     +   L    S      V
Sbjct  1    MSHAVFQAAQIMPMNTQIPNKSIFTKPTIFPIISCHSIGGKSRKSTSLYIRDSVSPVPTV  60

Query  233  DGDG-IAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEKSKLDMTQ  409
            D D  I  LERC      + S S SS+++  A +AP MKG K+GS+GAVTLEKSKLDMTQ
Sbjct  61   DWDSSIVHLERCL----VVPSESQSSTSSGLAMFAPTMKG-KFGSMGAVTLEKSKLDMTQ  115

Query  410  KQTKSSPELAT  442
            KQT+SSPELAT
Sbjct  116  KQTRSSPELAT  126



>gb|KJB32771.1| hypothetical protein B456_005G260700 [Gossypium raimondii]
Length=522

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 55/78 (71%), Gaps = 6/78 (8%)
 Frame = +2

Query  215  ASSAVVDG--DGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEK  388
            +SS+++DG    +AALERCF A P+    SSS S         VMKGGKYG+ GAVTLEK
Sbjct  42   SSSSLIDGGDSSVAALERCFSAPPAPVETSSSGSGDVGP----VMKGGKYGAFGAVTLEK  97

Query  389  SKLDMTQKQTKSSPELAT  442
             KLDM+QKQ+ SSPELAT
Sbjct  98   GKLDMSQKQSTSSPELAT  115



>gb|KJB32773.1| hypothetical protein B456_005G260700 [Gossypium raimondii]
Length=523

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 55/78 (71%), Gaps = 6/78 (8%)
 Frame = +2

Query  215  ASSAVVDG--DGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEK  388
            +SS+++DG    +AALERCF A P+    SSS S         VMKGGKYG+ GAVTLEK
Sbjct  42   SSSSLIDGGDSSVAALERCFSAPPAPVETSSSGSGDVGP----VMKGGKYGAFGAVTLEK  97

Query  389  SKLDMTQKQTKSSPELAT  442
             KLDM+QKQ+ SSPELAT
Sbjct  98   GKLDMSQKQSTSSPELAT  115



>emb|CDX87117.1| BnaC09g04320D [Brassica napus]
Length=526

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 78/139 (56%), Gaps = 31/139 (22%)
 Frame = +2

Query  65   MSHSVFQAV----QIMPIHTQTskslpsssflkpllppaapvvagklRKFCLIKASSAVV  232
            MSH VFQ+V      +PI   T+                        R+   ++ASSA +
Sbjct  1    MSHMVFQSVAAPKPCLPIPRSTAALPCKL------------------RRVSFVRASSASL  42

Query  233  D---GDGIAALERCFQa------spsldspssssstasparyapVMKGGKYGSLGAVTLE  385
                GD ++ LERCFQ       SPS  S S S+S++  A+  PVMKGGK+GS+GAVTLE
Sbjct  43   IESVGDSVSGLERCFQLPFSGDASPSSSSISISASSSPTAQMCPVMKGGKFGSVGAVTLE  102

Query  386  KSKLDMTQKQTKSSPELAT  442
            K KLDMTQK+ +SSPE+AT
Sbjct  103  KGKLDMTQKKVESSPEIAT  121



>ref|XP_002273537.1| PREDICTED: uncharacterized protein LOC100246257 [Vitis vinifera]
Length=531

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 77/130 (59%), Gaps = 12/130 (9%)
 Frame = +2

Query  65   MSHSVFQAVQIMPIH-TQTskslp----sssflkpllppaapvvagklRKFCLIKASSAV  229
            MSHSVF A QIMP+  T+T  S        +        A+     K R   +  +SSA+
Sbjct  1    MSHSVF-APQIMPVAPTKTIYSSNPLLPIHTLSSLRPAAASASAFAKRRSLAVRASSSAL  59

Query  230  VDGDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEKSKLDMTQ  409
            VDGD +A LERCF     L   +S  S+++ A   PVMKG KYGS GAVTLEKSKLD++Q
Sbjct  60   VDGDSVALLERCF-----LADSASVPSSSASAMPLPVMKG-KYGSFGAVTLEKSKLDLSQ  113

Query  410  KQTKSSPELA  439
            KQ++ SPE A
Sbjct  114  KQSRLSPETA  123



>emb|CDX80466.1| BnaC07g29780D [Brassica napus]
Length=527

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 64/87 (74%), Gaps = 4/87 (5%)
 Frame = +2

Query  194  RKFCLIKASSA-VVD--GDGIAALERCFQaspsldspssssstasparyapV-MKGGKYG  361
            R+ C I+ASS+ ++D  GD ++ LERC Q   S +  +SSS +ASP+      MKGGK+G
Sbjct  36   RRSCFIRASSSSLIDSVGDSVSGLERCLQLQFSGELGASSSGSASPSAQMCPEMKGGKFG  95

Query  362  SLGAVTLEKSKLDMTQKQTKSSPELAT  442
            S+GAVTLEK KLDMTQK+ +S+PE+AT
Sbjct  96   SVGAVTLEKGKLDMTQKKVESTPEIAT  122



>emb|CDO97538.1| unnamed protein product [Coffea canephora]
Length=527

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 67/135 (50%), Positives = 76/135 (56%), Gaps = 24/135 (18%)
 Frame = +2

Query  65   MSHSVFQAVQIMPIHTQTskslpsssflkpllppaapvvagklRKFCLIKASS-------  223
            MSHS FQ  QIMPI T  S    SS                   K  LIKASS       
Sbjct  1    MSHSNFQTAQIMPIKTIPSTQTLSSKISLLPPSTLC--------KPLLIKASSTSSSSSS  52

Query  224  AVVD--GDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEKSKL  397
             +VD  GD +  LERCFQA P++DS ++S S++       VMK   YG+ GAVTLEKSKL
Sbjct  53   GLVDRVGDTVPHLERCFQALPAVDSAAASLSSSP------VMKK-DYGAFGAVTLEKSKL  105

Query  398  DMTQKQTKSSPELAT  442
            DMTQKQ KSSPELAT
Sbjct  106  DMTQKQAKSSPELAT  120



>ref|XP_009111641.1| PREDICTED: uncharacterized protein LOC103837067 [Brassica rapa]
Length=520

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 47/88 (53%), Positives = 62/88 (70%), Gaps = 5/88 (6%)
 Frame = +2

Query  194  RKFCLIKASSA-VVD--GDGIAALERCFQaspsldspssssstasparyap--VMKGGKY  358
            R+   ++ASS+ ++D  GD ++ LERCFQ   S DS +SS S +S        VMKGGK+
Sbjct  30   RRVSFVRASSSSLIDSVGDSVSRLERCFQLPFSGDSSTSSYSISSSPSAQMCPVMKGGKF  89

Query  359  GSLGAVTLEKSKLDMTQKQTKSSPELAT  442
            GS+GAVTLEK KLD TQK+ +SSPE+AT
Sbjct  90   GSVGAVTLEKGKLDTTQKKVESSPEIAT  117



>ref|XP_006394722.1| hypothetical protein EUTSA_v10003985mg [Eutrema salsugineum]
 gb|ESQ32008.1| hypothetical protein EUTSA_v10003985mg [Eutrema salsugineum]
Length=527

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 60/82 (73%), Gaps = 6/82 (7%)
 Frame = +2

Query  215  ASSAVVD--GDGIAALERCFQasps----ldspssssstasparyapVMKGGKYGSLGAV  376
            +SS+++D  GD ++ LERC Q   +      S  S S+ +S A+ +PVMKGGK+GS+GAV
Sbjct  43   SSSSLIDSVGDSVSGLERCLQLPSTGELGTSSSGSFSAASSGAQMSPVMKGGKFGSVGAV  102

Query  377  TLEKSKLDMTQKQTKSSPELAT  442
            TLEK KLDMTQK+ +SSPE+AT
Sbjct  103  TLEKGKLDMTQKKVESSPEIAT  124



>gb|KJB47793.1| hypothetical protein B456_008G041900 [Gossypium raimondii]
Length=527

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 53/78 (68%), Gaps = 6/78 (8%)
 Frame = +2

Query  215  ASSAVVDG--DGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEK  388
            +SS+++DG    +A+LERCF            S+++      PVMKGG+YG+ GAVTLEK
Sbjct  37   SSSSLIDGGESSVASLERCF----LAPPAPVESASSGSGEVGPVMKGGQYGAFGAVTLEK  92

Query  389  SKLDMTQKQTKSSPELAT  442
             KLD++QKQ+ SSPELAT
Sbjct  93   GKLDLSQKQSTSSPELAT  110



>ref|XP_009385832.1| PREDICTED: uncharacterized protein LOC103973087 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009385841.1| PREDICTED: uncharacterized protein LOC103973087 [Musa acuminata 
subsp. malaccensis]
Length=551

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 41/70 (59%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +2

Query  230  VDGDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEKSKLDMTQ  409
            VD D   ALERCF  S      S  SS A+     PVMKGGKYG+ GAVTLEKSKLD++Q
Sbjct  77   VDSDVRDALERCFALSTESGPLSYLSSPATSGAAMPVMKGGKYGAFGAVTLEKSKLDLSQ  136

Query  410  KQTKSSPELA  439
            K  ++SPELA
Sbjct  137  KTRRTSPELA  146



>gb|KHG04044.1| Ribonuclease 3 [Gossypium arboreum]
Length=465

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 52/76 (68%), Gaps = 6/76 (8%)
 Frame = +2

Query  215  ASSAVVDG--DGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEK  388
            +SS+++DG    +AALERCF A P+     SS S         VMKGGKYG+ GAVTLEK
Sbjct  42   SSSSLIDGGDSSVAALERCFSAPPAPVETGSSGSGEVGP----VMKGGKYGAFGAVTLEK  97

Query  389  SKLDMTQKQTKSSPEL  436
             KLDM+QKQ+ SSPEL
Sbjct  98   GKLDMSQKQSTSSPEL  113



>gb|KJB47795.1| hypothetical protein B456_008G041900 [Gossypium raimondii]
Length=422

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 53/78 (68%), Gaps = 6/78 (8%)
 Frame = +2

Query  215  ASSAVVDG--DGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEK  388
            +SS+++DG    +A+LERCF            S+++      PVMKGG+YG+ GAVTLEK
Sbjct  37   SSSSLIDGGESSVASLERCF----LAPPAPVESASSGSGEVGPVMKGGQYGAFGAVTLEK  92

Query  389  SKLDMTQKQTKSSPELAT  442
             KLD++QKQ+ SSPELAT
Sbjct  93   GKLDLSQKQSTSSPELAT  110



>gb|KJB47790.1| hypothetical protein B456_008G041900 [Gossypium raimondii]
Length=517

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 53/78 (68%), Gaps = 6/78 (8%)
 Frame = +2

Query  215  ASSAVVDG--DGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEK  388
            +SS+++DG    +A+LERCF            S+++      PVMKGG+YG+ GAVTLEK
Sbjct  37   SSSSLIDGGESSVASLERCF----LAPPAPVESASSGSGEVGPVMKGGQYGAFGAVTLEK  92

Query  389  SKLDMTQKQTKSSPELAT  442
             KLD++QKQ+ SSPELAT
Sbjct  93   GKLDLSQKQSTSSPELAT  110



>gb|EPS60635.1| hypothetical protein M569_14164, partial [Genlisea aurea]
Length=484

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 51/80 (64%), Gaps = 5/80 (6%)
 Frame = +2

Query  203  CLIKASSAVVDGDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTL  382
            C    ++A V+GD ++ LERCF          S S  +      PVMKG KYG+ GAVTL
Sbjct  2    CFTVKAAAAVEGDTVSHLERCF----LGPDAPSPSDISGSWDSGPVMKG-KYGAFGAVTL  56

Query  383  EKSKLDMTQKQTKSSPELAT  442
            EKSKLD+TQK TKS+PELAT
Sbjct  57   EKSKLDLTQKLTKSNPELAT  76



>ref|XP_004299952.1| PREDICTED: uncharacterized protein LOC101315147 [Fragaria vesca 
subsp. vesca]
Length=526

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 52/132 (39%), Positives = 67/132 (51%), Gaps = 16/132 (12%)
 Frame = +2

Query  65   MSHSVFQAVQIMPIHTQTskslpsssflkpllppaapvvagklRKF------CLIKASSA  226
            M+H+VF   Q MP++TQ  K       L+            K R+       C   ++S 
Sbjct  1    MAHAVFHTAQFMPMNTQLPKKPRLPGPLQQQPTMMMIAQPLKPRRSLSVKGCCASPSTSD  60

Query  227  VVDGDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEKSKLDMT  406
             V+G      ERCF          + SS  +   + PVMKG +YG+ GAVTLEK KLDMT
Sbjct  61   SVEGGQSTLWERCF---------VAPSSLPARNEFGPVMKG-QYGAFGAVTLEKGKLDMT  110

Query  407  QKQTKSSPELAT  442
            QKQ+KSSPEL T
Sbjct  111  QKQSKSSPELQT  122



>ref|XP_010065497.1| PREDICTED: uncharacterized protein LOC104452727 [Eucalyptus grandis]
 gb|KCW63005.1| hypothetical protein EUGRSUZ_G00606 [Eucalyptus grandis]
 gb|KCW63006.1| hypothetical protein EUGRSUZ_G00606 [Eucalyptus grandis]
Length=546

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 54/150 (36%), Positives = 67/150 (45%), Gaps = 32/150 (21%)
 Frame = +2

Query  65   MSHSVFQAVQIMPIHTQTskslpsssf-------------lkpllppaapvvagklRKFC  205
            MSH VF+  QIMP+ +Q   +   +                    P          R   
Sbjct  1    MSHPVFRTAQIMPLSSQAQVAAAKNPALPCPFLKPVLPAPKLGGPPSPPVFGKAVRRVGV  60

Query  206  LIKASSAVV-----------DGDGIAALERCFQaspsldspssssstasparyapVMKGG  352
             ++ SSA              G+  A LE+CF+A  S    S             VMKGG
Sbjct  61   AVRCSSAPAYEPAALDGSSGGGEARALLEKCFRAPSSAGGGSDGGGP--------VMKGG  112

Query  353  KYGSLGAVTLEKSKLDMTQKQTKSSPELAT  442
            ++G+LGAVTLEK KLDMTQKQT SSPELAT
Sbjct  113  QFGALGAVTLEKGKLDMTQKQTTSSPELAT  142



>ref|XP_010103891.1| hypothetical protein L484_024194 [Morus notabilis]
 gb|EXB97332.1| hypothetical protein L484_024194 [Morus notabilis]
Length=538

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 53/142 (37%), Positives = 64/142 (45%), Gaps = 29/142 (20%)
 Frame = +2

Query  65   MSHSVFQAVQIMPIHTQTskslpsssflkpllppaapvvagklRKFCLIKASSA------  226
            MSH+ FQ  QIM I+TQ          L              +RK     A  A      
Sbjct  1    MSHAAFQTAQIMLINTQHPVKPKGLPSLPTPKVKPVGPTQLVVRKIWRGVAVPAPLKVSA  60

Query  227  -----------VVDGDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGA  373
                       V   D +  LERCF             +  +P    PVMKGGKYG+LGA
Sbjct  61   SSSSSSSSSSAVAGEDSMTLLERCF------------VAPPAPGTTGPVMKGGKYGALGA  108

Query  374  VTLEKSKLDMTQKQTKSSPELA  439
            VTLEKSKL+++QKQ+KSSPE A
Sbjct  109  VTLEKSKLNLSQKQSKSSPETA  130



>ref|XP_007041517.1| Uncharacterized protein TCM_006400 [Theobroma cacao]
 gb|EOX97348.1| Uncharacterized protein TCM_006400 [Theobroma cacao]
Length=516

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 50/78 (64%), Gaps = 9/78 (12%)
 Frame = +2

Query  215  ASSAVVD--GDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEK  388
            +SS+++D     +AALERCF         S     +      PVMKGG+YG+ GAVTLEK
Sbjct  39   SSSSLMDCGESSVAALERCF-------LASPGPVESGSGEVGPVMKGGQYGAFGAVTLEK  91

Query  389  SKLDMTQKQTKSSPELAT  442
             KLD++QKQ+ SSPELAT
Sbjct  92   GKLDLSQKQSTSSPELAT  109



>gb|KHG12509.1| Ribonuclease 3 [Gossypium arboreum]
Length=462

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 51/76 (67%), Gaps = 6/76 (8%)
 Frame = +2

Query  215  ASSAVVDG--DGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEK  388
            +SS+++DG    +A+LERCF            S+++      PVMKGG+YG+ GAVTLEK
Sbjct  37   SSSSLIDGGESSVASLERCF----LAPPAPVESASSGSGEVGPVMKGGQYGAFGAVTLEK  92

Query  389  SKLDMTQKQTKSSPEL  436
             KLD++QKQ+ SSPEL
Sbjct  93   GKLDLSQKQSTSSPEL  108



>ref|XP_002531414.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30956.1| conserved hypothetical protein [Ricinus communis]
Length=525

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 40/78 (51%), Positives = 54/78 (69%), Gaps = 5/78 (6%)
 Frame = +2

Query  215  ASSAVVDG---DGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLE  385
            +SS+V+DG   + +AALERCF       SP     ++S   + PVMKG K+G+ GAVTLE
Sbjct  62   SSSSVIDGGCGESVAALERCF--IAPDASPPVDLGSSSRGEFVPVMKGSKFGAFGAVTLE  119

Query  386  KSKLDMTQKQTKSSPELA  439
            K KLD+TQK++K SPE+A
Sbjct  120  KGKLDLTQKESKVSPEVA  137



>ref|XP_010272809.1| PREDICTED: uncharacterized protein LOC104608494 [Nelumbo nucifera]
Length=541

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 77/135 (57%), Gaps = 11/135 (8%)
 Frame = +2

Query  65   MSHSVFQAVQIMPIHTQTskslpsssflkpllppaapvvagkl--------RKFCLIKAS  220
            MSH+VFQ  QIM +++Q +    S+S      P                  R   L   S
Sbjct  1    MSHTVFQTAQIMLLNSQITNKTLSNSPSPHSHPSLFVPCRTPSPSGSFGKPRMAVLEIKS  60

Query  221  SAVVDGDGIAALERCFQ--aspsldspssssstasparyapVMKGGKYGSLGAVTLEKSK  394
            SA+V+ D  A LERCF+      + S SSS+S +S +  APVMKG +YG+ GAVTLEKSK
Sbjct  61   SALVESDPGAHLERCFKISPDSDVGSSSSSTSASSSSMVAPVMKG-QYGAFGAVTLEKSK  119

Query  395  LDMTQKQTKSSPELA  439
            LD++ KQTKSSPE A
Sbjct  120  LDLSSKQTKSSPETA  134



>ref|XP_003531582.1| PREDICTED: uncharacterized protein LOC100805854 [Glycine max]
 gb|KHN26686.1| hypothetical protein glysoja_011278 [Glycine soja]
Length=519

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 39/72 (54%), Positives = 46/72 (64%), Gaps = 12/72 (17%)
 Frame = +2

Query  221  SAVVDGDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEKSKLD  400
            +A V+ D    LERCF A  +   PS S            MKGG+YG+ GAVTLEKSKLD
Sbjct  52   TAHVETDSTVHLERCFNAPVASHLPSIS------------MKGGQYGAFGAVTLEKSKLD  99

Query  401  MTQKQTKSSPEL  436
            M+QKQT+SSPEL
Sbjct  100  MSQKQTRSSPEL  111



>gb|ACJ84181.1| unknown [Medicago truncatula]
Length=209

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 71/129 (55%), Gaps = 16/129 (12%)
 Frame = +2

Query  68   SHSVFQAVQIMPIHTQTskslpsssflkpllppaapvvagklRKFCLIKASSAVVDGD--  241
            SH++FQA QI+P+++       S      L           +R +    AS A VD D  
Sbjct  3    SHALFQAAQILPMNSPIPSKTLSPKTFPKLPLLRNRHHRLVIRSWS---ASPADVDSDTS  59

Query  242  -GIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEKSKLDMTQKQT  418
             G + LERCF A  +  S S + +         VMKG KYG+ GAVTLEKS+L+++Q+Q+
Sbjct  60   FGSSLLERCFAAPAAPPSASGNINP--------VMKG-KYGAFGAVTLEKSELEISQQQS  110

Query  419  -KSSPELAT  442
             KS+PELAT
Sbjct  111  NKSAPELAT  119



>ref|XP_006289599.1| hypothetical protein CARUB_v10003151mg [Capsella rubella]
 gb|EOA22497.1| hypothetical protein CARUB_v10003151mg [Capsella rubella]
Length=532

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +2

Query  206  LIKASSAVVDGDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLE  385
             ++ASS+ +  D ++ LERC Q    ++   SSS++ S +     +  GK+GS+GAVTLE
Sbjct  39   FVRASSSFLVDDSVSGLERCLQLPSGVELGPSSSASFSASTQMSPVMKGKFGSVGAVTLE  98

Query  386  KSKLDMTQKQTKSSPELAT  442
            K KLDMTQK +++SPE+AT
Sbjct  99   KGKLDMTQKISETSPEIAT  117



>gb|KFK27747.1| hypothetical protein AALP_AA8G423900 [Arabis alpina]
Length=521

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 43/84 (51%), Positives = 54/84 (64%), Gaps = 5/84 (6%)
 Frame = +2

Query  206  LIKASSAVVD---GDGIAALERCFQaspsldspssssstasparyap--VMKGGKYGSLG  370
             I+AS++ V    G  I+ LE C Q   S D   SSS + + +      VMKGGK+GS+G
Sbjct  37   FIRASASSVSDYVGGSISGLEHCLQLPSSGDLGPSSSGSFTVSAAQMCPVMKGGKFGSVG  96

Query  371  AVTLEKSKLDMTQKQTKSSPELAT  442
            AVTLEK KLDMTQK  +SSPE+AT
Sbjct  97   AVTLEKGKLDMTQKIVESSPEIAT  120



>ref|XP_006385218.1| hypothetical protein POPTR_0003s01390g [Populus trichocarpa]
 gb|ERP63015.1| hypothetical protein POPTR_0003s01390g [Populus trichocarpa]
Length=374

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 51/81 (63%), Gaps = 13/81 (16%)
 Frame = +2

Query  203  CLIKASSAVVDG--DGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAV  376
            C   +S  ++DG  D +AALERCF A P+                  VMKG K+GSLGAV
Sbjct  48   CSSSSSCPMIDGGGDSVAALERCFSAPPAPVVGDFGP----------VMKG-KFGSLGAV  96

Query  377  TLEKSKLDMTQKQTKSSPELA  439
            TLEK KLDM+QKQ++S+PE+A
Sbjct  97   TLEKGKLDMSQKQSQSTPEVA  117



>ref|XP_002303156.2| hypothetical protein POPTR_0003s01390g [Populus trichocarpa]
 gb|EEE78135.2| hypothetical protein POPTR_0003s01390g [Populus trichocarpa]
Length=524

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 51/81 (63%), Gaps = 13/81 (16%)
 Frame = +2

Query  203  CLIKASSAVVDG--DGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAV  376
            C   +S  ++DG  D +AALERCF A P+                  VMKG K+GSLGAV
Sbjct  48   CSSSSSCPMIDGGGDSVAALERCFSAPPAPVVGDFGP----------VMKG-KFGSLGAV  96

Query  377  TLEKSKLDMTQKQTKSSPELA  439
            TLEK KLDM+QKQ++S+PE+A
Sbjct  97   TLEKGKLDMSQKQSQSTPEVA  117



>ref|XP_009150996.1| PREDICTED: uncharacterized protein LOC103874341 [Brassica rapa]
Length=529

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = +2

Query  236  GDGIAALERCFQaspsldspssssstasparya-pVMKGGKYGSLGAVTLEKSKLDMTQK  412
            GD ++ LERC Q   S  S +SSS +ASP+    P MKGGK+GS+GAVTLEK KLDMTQK
Sbjct  54   GDSVSGLERCLQLQFSGGSGTSSSGSASPSAQMCPEMKGGKFGSVGAVTLEKGKLDMTQK  113

Query  413  QTKSSPELAT  442
            + +S+PE+AT
Sbjct  114  KVESTPEIAT  123



>ref|XP_002874216.1| hypothetical protein ARALYDRAFT_910514 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50475.1| hypothetical protein ARALYDRAFT_910514 [Arabidopsis lyrata subsp. 
lyrata]
Length=520

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +2

Query  206  LIKASSAVVDGDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLE  385
             ++ASS+ +  D ++ LERC Q    ++   SSS + S +     +  GK+GS+GAVTLE
Sbjct  39   FVRASSSFLVDDSVSGLERCLQLPSGVELGPSSSGSFSASTQMCPVMKGKFGSVGAVTLE  98

Query  386  KSKLDMTQKQTKSSPELAT  442
            K KLDMTQK +++SPE+AT
Sbjct  99   KGKLDMTQKISETSPEIAT  117



>emb|CDX88129.1| BnaA06g27200D [Brassica napus]
Length=1730

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 42/70 (60%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = +2

Query  236   GDGIAALERCFQaspsldspssssstasparya-pVMKGGKYGSLGAVTLEKSKLDMTQK  412
             GD ++ LERC Q   S  S +SSS +ASP+    P MKGGK+GS+GAVTLEK KLDMTQK
Sbjct  1255  GDSVSGLERCLQLQFSGGSGTSSSGSASPSAQMCPEMKGGKFGSVGAVTLEKGKLDMTQK  1314

Query  413   QTKSSPELAT  442
             + +S+PE+AT
Sbjct  1315  KVESTPEIAT  1324



>ref|XP_011012909.1| PREDICTED: uncharacterized protein LOC105117065 [Populus euphratica]
Length=525

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 37/68 (54%), Positives = 45/68 (66%), Gaps = 11/68 (16%)
 Frame = +2

Query  236  GDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEKSKLDMTQKQ  415
            GD +AALERCF A P+                  VMKG K+GSLGAVTLEK KLDM+QKQ
Sbjct  62   GDSVAALERCFSAPPAPVVGDFGP----------VMKG-KFGSLGAVTLEKGKLDMSQKQ  110

Query  416  TKSSPELA  439
            ++S+PE+A
Sbjct  111  SQSTPEVA  118



>gb|KDP38884.1| hypothetical protein JCGZ_05041 [Jatropha curcas]
Length=538

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 42/84 (50%), Positives = 60/84 (71%), Gaps = 4/84 (5%)
 Frame = +2

Query  194  RKFCLIKASS-AVVDG-DGIAALERCFQaspsldspssssstasparyapVMKGGKYGSL  367
            R+  +IK SS +++DG D ++ALERCF  +P        S+++S   + PVMKG K+G+ 
Sbjct  50   RRNLIIKCSSPSIIDGADAVSALERCF-LAPDAAPVDLGSASSSRGEFGPVMKG-KFGAF  107

Query  368  GAVTLEKSKLDMTQKQTKSSPELA  439
            GAVTLEK KLD+TQK++K SPE+A
Sbjct  108  GAVTLEKGKLDLTQKESKVSPEVA  131



>dbj|BAF02184.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF02208.1| hypothetical protein [Arabidopsis thaliana]
Length=521

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 55/83 (66%), Gaps = 1/83 (1%)
 Frame = +2

Query  194  RKFCLIKASSAVVDGDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGA  373
            R F    +SS +VD D ++ LERC Q    ++  +SSS + S +     +  GK+GS+GA
Sbjct  37   RGFVRASSSSFLVD-DSVSGLERCLQLPSGVELGTSSSGSFSASTQMCPVMKGKFGSVGA  95

Query  374  VTLEKSKLDMTQKQTKSSPELAT  442
            VTLEK KLDMTQK +++SPE+AT
Sbjct  96   VTLEKGKLDMTQKISETSPEIAT  118



>dbj|BAF02139.1| hypothetical protein [Arabidopsis thaliana]
Length=521

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 55/83 (66%), Gaps = 1/83 (1%)
 Frame = +2

Query  194  RKFCLIKASSAVVDGDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGA  373
            R F    +SS +VD D ++ LERC Q    ++  +SSS + S +     +  GK+GS+GA
Sbjct  37   RGFVRASSSSFLVD-DSVSGLERCLQLPSGVELGTSSSGSFSASTQMCPVMKGKFGSVGA  95

Query  374  VTLEKSKLDMTQKQTKSSPELAT  442
            VTLEK KLDMTQK +++SPE+AT
Sbjct  96   VTLEKGKLDMTQKISETSPEIAT  118



>ref|NP_197857.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK44019.1|AF370204_1 unknown protein [Arabidopsis thaliana]
 gb|AAL08290.1| AT5g24690/MXC17_8 [Arabidopsis thaliana]
 gb|AAM91801.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF01609.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01649.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01708.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01716.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01768.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01785.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01883.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01887.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01917.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01918.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF02110.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF02120.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF02212.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED93350.1| uncharacterized protein AT5G24690 [Arabidopsis thaliana]
Length=521

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 55/83 (66%), Gaps = 1/83 (1%)
 Frame = +2

Query  194  RKFCLIKASSAVVDGDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGA  373
            R F    +SS +VD D ++ LERC Q    ++  +SSS + S +     +  GK+GS+GA
Sbjct  37   RGFVRASSSSFLVD-DSVSGLERCLQLPSGVELGTSSSGSFSASTQMCPVMKGKFGSVGA  95

Query  374  VTLEKSKLDMTQKQTKSSPELAT  442
            VTLEK KLDMTQK +++SPE+AT
Sbjct  96   VTLEKGKLDMTQKISETSPEIAT  118



>dbj|BAF01744.1| hypothetical protein [Arabidopsis thaliana]
Length=521

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 55/83 (66%), Gaps = 1/83 (1%)
 Frame = +2

Query  194  RKFCLIKASSAVVDGDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGA  373
            R F    +SS +VD D ++ LERC Q    ++  +SSS + S +     +  GK+GS+GA
Sbjct  37   RGFVRASSSSFLVD-DSVSGLERCLQLPSGVELGTSSSGSFSASTQMCPVMKGKFGSVGA  95

Query  374  VTLEKSKLDMTQKQTKSSPELAT  442
            VTLEK KLDMTQK +++SPE+AT
Sbjct  96   VTLEKGKLDMTQKISETSPEIAT  118



>ref|XP_010454795.1| PREDICTED: uncharacterized protein LOC104736493 [Camelina sativa]
Length=520

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +2

Query  206  LIKASSAVVDGDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLE  385
             ++A+S+ +  D ++ LERC Q    ++   SSS + S +     +  GK+GS+GAVTLE
Sbjct  39   FVRATSSFLVDDSVSGLERCLQLPTGVELGPSSSGSFSASTQMCPVMKGKFGSVGAVTLE  98

Query  386  KSKLDMTQKQTKSSPELAT  442
            K KLDMTQK +++SPE+AT
Sbjct  99   KGKLDMTQKISETSPEIAT  117



>ref|XP_010421305.1| PREDICTED: uncharacterized protein LOC104706781 [Camelina sativa]
 ref|XP_010421306.1| PREDICTED: uncharacterized protein LOC104706781 [Camelina sativa]
Length=520

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +2

Query  206  LIKASSAVVDGDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLE  385
             ++A+S+ +  D ++ LERC Q    ++   SSS + S +     +  GK+GS+GAVTLE
Sbjct  39   FVRATSSFLVDDSVSGLERCLQLPTGVELGPSSSGSFSASTQMCPVMKGKFGSVGAVTLE  98

Query  386  KSKLDMTQKQTKSSPELAT  442
            K KLDMTQK +++SPE+AT
Sbjct  99   KGKLDMTQKISETSPEIAT  117



>dbj|BAF01720.1| hypothetical protein [Arabidopsis thaliana]
Length=521

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 55/83 (66%), Gaps = 1/83 (1%)
 Frame = +2

Query  194  RKFCLIKASSAVVDGDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGA  373
            R F    +SS +VD D ++ LERC Q    ++  +SSS + S +     +  GK+GS+GA
Sbjct  37   RGFVRASSSSFLVD-DSVSGLERCLQLPSGVELGTSSSGSFSASTQMCPVMKGKFGSVGA  95

Query  374  VTLEKSKLDMTQKQTKSSPELAT  442
            VTLEK KLDMTQK +++SPE+AT
Sbjct  96   VTLEKGKLDMTQKISETSPEIAT  118



>gb|KDO41863.1| hypothetical protein CISIN_1g0096211mg [Citrus sinensis]
Length=481

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 56/87 (64%), Gaps = 11/87 (13%)
 Frame = +2

Query  194  RKFCLIKAS--SAVVDG--DGIAALERCFQaspsldspssssstasparyapVMKGGKYG  361
            RK  LI  S  S ++DG    +  LERC++A  +L S S++           +MKGG+YG
Sbjct  45   RKNMLITCSVPSPLIDGGDHSVVLLERCYKAPSALPSGSTAEYGP-------LMKGGQYG  97

Query  362  SLGAVTLEKSKLDMTQKQTKSSPELAT  442
            + GAVTLEK KLD TQ+Q++++PELAT
Sbjct  98   AFGAVTLEKGKLDTTQQQSETTPELAT  124



>gb|AFK33980.1| unknown [Medicago truncatula]
Length=540

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 52/129 (40%), Positives = 71/129 (55%), Gaps = 16/129 (12%)
 Frame = +2

Query  68   SHSVFQAVQIMPIHTQTskslpsssflkpllppaapvvagklRKFCLIKASSAVVDGD--  241
            SH++FQA QI+P+++       S      L           +R +    AS A VD D  
Sbjct  3    SHALFQAAQILPMNSPIPSKTLSPKTFPKLPLLRNRHRRLVIRSW---SASPADVDSDTS  59

Query  242  -GIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEKSKLDMTQKQT  418
             G + LERCF A  +  S S + +         VMKG KYG+ GAVTLEKSKL+++Q+Q+
Sbjct  60   FGSSLLERCFAAPAAPPSASGNINP--------VMKG-KYGAFGAVTLEKSKLEISQQQS  110

Query  419  -KSSPELAT  442
             KS+PELAT
Sbjct  111  NKSAPELAT  119



>gb|KDO41865.1| hypothetical protein CISIN_1g0096211mg, partial [Citrus sinensis]
Length=434

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 56/87 (64%), Gaps = 11/87 (13%)
 Frame = +2

Query  194  RKFCLIKAS--SAVVDG--DGIAALERCFQaspsldspssssstasparyapVMKGGKYG  361
            RK  LI  S  S ++DG    +  LERC++A  +L S S++           +MKGG+YG
Sbjct  45   RKNMLITCSVPSPLIDGGDHSVVLLERCYKAPSALPSGSTAEYGP-------LMKGGQYG  97

Query  362  SLGAVTLEKSKLDMTQKQTKSSPELAT  442
            + GAVTLEK KLD TQ+Q++++PELAT
Sbjct  98   AFGAVTLEKGKLDTTQQQSETTPELAT  124



>gb|KDO41864.1| hypothetical protein CISIN_1g0096211mg [Citrus sinensis]
Length=530

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 40/87 (46%), Positives = 56/87 (64%), Gaps = 11/87 (13%)
 Frame = +2

Query  194  RKFCLIKAS--SAVVDG--DGIAALERCFQaspsldspssssstasparyapVMKGGKYG  361
            RK  LI  S  S ++DG    +  LERC++A  +L S S++           +MKGG+YG
Sbjct  45   RKNMLITCSVPSPLIDGGDHSVVLLERCYKAPSALPSGSTAEYGP-------LMKGGQYG  97

Query  362  SLGAVTLEKSKLDMTQKQTKSSPELAT  442
            + GAVTLEK KLD TQ+Q++++PELAT
Sbjct  98   AFGAVTLEKGKLDTTQQQSETTPELAT  124



>ref|XP_006471043.1| PREDICTED: uncharacterized protein LOC102620240 [Citrus sinensis]
Length=530

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 40/87 (46%), Positives = 56/87 (64%), Gaps = 11/87 (13%)
 Frame = +2

Query  194  RKFCLIKAS--SAVVDG--DGIAALERCFQaspsldspssssstasparyapVMKGGKYG  361
            RK  LI  S  S ++DG    +  LERC++A  +L S S++           +MKGG+YG
Sbjct  45   RKNMLITCSVPSPLIDGGDHSVVLLERCYKAPSALPSGSTAEYGP-------LMKGGQYG  97

Query  362  SLGAVTLEKSKLDMTQKQTKSSPELAT  442
            + GAVTLEK KLD TQ+Q++++PELAT
Sbjct  98   AFGAVTLEKGKLDTTQQQSETTPELAT  124



>dbj|BAF02072.1| hypothetical protein [Arabidopsis thaliana]
Length=521

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 54/83 (65%), Gaps = 1/83 (1%)
 Frame = +2

Query  194  RKFCLIKASSAVVDGDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGA  373
            R F    +SS +VD D ++ LERC Q    ++  +SSS + S +     +  GK+GS+GA
Sbjct  37   RGFVRASSSSFLVD-DSVSGLERCLQLPSGVELGTSSSGSFSASTQMCPVMKGKFGSVGA  95

Query  374  VTLEKSKLDMTQKQTKSSPELAT  442
            VTLEK KLDMTQK ++ SPE+AT
Sbjct  96   VTLEKGKLDMTQKISEISPEIAT  118



>ref|XP_003596481.1| hypothetical protein MTR_2g081000 [Medicago truncatula]
 gb|AES66732.1| plant/MXC17-8 protein [Medicago truncatula]
Length=526

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 52/129 (40%), Positives = 71/129 (55%), Gaps = 16/129 (12%)
 Frame = +2

Query  68   SHSVFQAVQIMPIHTQTskslpsssflkpllppaapvvagklRKFCLIKASSAVVDGD--  241
            SH++FQA QI+P+++       S      L           +R +    AS A VD D  
Sbjct  3    SHALFQAAQILPMNSPIPSKTLSPKTFPKLPLLRNRHRRLVIRSW---SASPADVDSDTS  59

Query  242  -GIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEKSKLDMTQKQT  418
             G + LERCF A  +  S S + +         VMKG KYG+ GAVTLEKSKL+++Q+Q+
Sbjct  60   FGSSLLERCFAAPAAPPSASGNINP--------VMKG-KYGAFGAVTLEKSKLEISQQQS  110

Query  419  -KSSPELAT  442
             KS+PELAT
Sbjct  111  NKSAPELAT  119



>dbj|BAB09652.1| unnamed protein product [Arabidopsis thaliana]
Length=129

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +2

Query  194  RKFCLIKASSAVVDGDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGA  373
            R F    +SS +VD D ++ LERC Q    ++  +SSS + S +     +  GK+GS+GA
Sbjct  37   RGFVRASSSSFLVD-DSVSGLERCLQLPSGVELGTSSSGSFSASTQMCPVMKGKFGSVGA  95

Query  374  VTLEKSKLDMTQKQTKSSPELA  439
            VTLEK KLDMTQK +++SPE++
Sbjct  96   VTLEKGKLDMTQKISETSPEVS  117



>ref|XP_007148497.1| hypothetical protein PHAVU_006G213600g [Phaseolus vulgaris]
 gb|ESW20491.1| hypothetical protein PHAVU_006G213600g [Phaseolus vulgaris]
Length=522

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  341  MKGGKYGSLGAVTLEKSKLDMTQKQTKSSPEL  436
            MKGG+YGSLGAVTLEKSKLD++QK+T SSPEL
Sbjct  83   MKGGQYGSLGAVTLEKSKLDLSQKETVSSPEL  114



>gb|AGV54185.1| hypothetical protein [Phaseolus vulgaris]
Length=519

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  341  MKGGKYGSLGAVTLEKSKLDMTQKQTKSSPEL  436
            MKGG+YGSLGAVTLEKSKLD++QK+T SSPEL
Sbjct  80   MKGGQYGSLGAVTLEKSKLDLSQKETVSSPEL  111



>ref|XP_003547548.1| PREDICTED: uncharacterized protein LOC100783760 [Glycine max]
 gb|KHN33466.1| hypothetical protein glysoja_005508 [Glycine soja]
Length=523

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 38/72 (53%), Positives = 44/72 (61%), Gaps = 12/72 (17%)
 Frame = +2

Query  221  SAVVDGDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEKSKLD  400
            +A V+ D    LERCF A  S   PS S            MKGG+YG+ GAVTLEKSKLD
Sbjct  56   TAHVETDSTVHLERCFNAPVSSHLPSIS------------MKGGQYGAFGAVTLEKSKLD  103

Query  401  MTQKQTKSSPEL  436
            ++QKQT  SPEL
Sbjct  104  LSQKQTSFSPEL  115



>ref|XP_010519583.1| PREDICTED: uncharacterized protein LOC104798997 [Tarenaya hassleriana]
Length=533

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 53/81 (65%), Gaps = 8/81 (10%)
 Frame = +2

Query  215  ASSAVVD--GDGIAALERCFQaspsl-----dspssssstasparyapVMKGGKYGSLGA  373
            +SS  VD  GD I+ALE+CF    S       S  S S+  + A+  PVMKG K+GS GA
Sbjct  47   SSSPPVDATGDSISALEQCFMLPSSGGELGPSSSGSCSAVPTGAQVGPVMKG-KFGSFGA  105

Query  374  VTLEKSKLDMTQKQTKSSPEL  436
            VTLEK KLD+TQK+ +SSPEL
Sbjct  106  VTLEKGKLDLTQKKAESSPEL  126



>ref|XP_010912913.1| PREDICTED: uncharacterized protein LOC105038739 [Elaeis guineensis]
Length=550

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 44/72 (61%), Positives = 52/72 (72%), Gaps = 3/72 (4%)
 Frame = +2

Query  230  VDGDGIAALERCFQaspsldspssssstasparyap--VMKGGKYGSLGAVTLEKSKLDM  403
            V+ D   ALERCF ASP  + PS SSS++S    A   VMKG +YG+ GAVTLEKSKLD+
Sbjct  75   VEPDHRGALERCFAASPDSEPPSCSSSSSSLLSAAMEPVMKG-EYGAFGAVTLEKSKLDL  133

Query  404  TQKQTKSSPELA  439
            +QK TKSSPE A
Sbjct  134  SQKSTKSSPETA  145



>ref|XP_008808156.1| PREDICTED: uncharacterized protein LOC103720294 [Phoenix dactylifera]
Length=552

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 43/72 (60%), Positives = 52/72 (72%), Gaps = 3/72 (4%)
 Frame = +2

Query  230  VDGDGIAALERCFQaspsldspssssstasparyap--VMKGGKYGSLGAVTLEKSKLDM  403
            V+ D   ALERCF ASP  + PS SSS++  +  A   VMKG K+G+ GAVTLEKSKLD+
Sbjct  77   VEPDHRGALERCFAASPDSEPPSCSSSSSLLSSAAMEPVMKG-KHGAFGAVTLEKSKLDL  135

Query  404  TQKQTKSSPELA  439
            +QK TKSSPE A
Sbjct  136  SQKSTKSSPETA  147



>ref|XP_010525543.1| PREDICTED: uncharacterized protein LOC104803318 [Tarenaya hassleriana]
Length=524

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 39/73 (53%), Positives = 51/73 (70%), Gaps = 6/73 (8%)
 Frame = +2

Query  236  GDGIAALERCFQaspsl-----dspssssstasparyapVMKGGKYGSLGAVTLEKSKLD  400
            G+ I++LERCF    S       S +S SS ++ A+  PVMKG KYGS GAVTLEK KL+
Sbjct  54   GESISSLERCFMLPSSGGELGPSSSASCSSASAGAQLGPVMKG-KYGSFGAVTLEKGKLE  112

Query  401  MTQKQTKSSPELA  439
            ++QK+ +SSPELA
Sbjct  113  ISQKKAESSPELA  125



>emb|CBI23847.3| unnamed protein product [Vitis vinifera]
Length=440

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  350  GKYGSLGAVTLEKSKLDMTQKQTKSSPELA  439
            GKYGS GAVTLEKSKLD++QKQ++ SPE A
Sbjct  3    GKYGSFGAVTLEKSKLDLSQKQSRLSPETA  32



>gb|EMS50816.1| hypothetical protein TRIUR3_22949 [Triticum urartu]
Length=447

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +2

Query  341  MKGGK-YGSLGAVTLEKSKLDMTQKQTKSSPELAT  442
            MKGGK YG+ GAVTLEK+KLD++Q++ K  PELAT
Sbjct  1    MKGGKQYGAFGAVTLEKAKLDLSQRKKKIMPELAT  35



>gb|EMT15742.1| hypothetical protein F775_08643 [Aegilops tauschii]
Length=558

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +2

Query  341  MKGGK-YGSLGAVTLEKSKLDMTQKQTKSSPELAT  442
            MKGGK YG+ GAVTLEK+KLD++Q++ K  PELAT
Sbjct  99   MKGGKQYGAFGAVTLEKAKLDLSQRKKKIMPELAT  133



>ref|XP_010929985.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105051314 
[Elaeis guineensis]
Length=557

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +2

Query  251  ALERCFQaspsldspssssstas---paryapVMKGGKYGSLGAVTLEKSKLDMTQKQTK  421
            ALERCF ASP  D PS SSS++S       APVMKG +YG+ GAVTLEKSKLD++QK T+
Sbjct  90   ALERCFAASPDSDPPSCSSSSSSLLVSGVMAPVMKG-QYGAFGAVTLEKSKLDLSQKTTQ  148

Query  422  SSPELAT  442
            SS E AT
Sbjct  149  SSAETAT  155



>ref|XP_003578716.1| PREDICTED: uncharacterized protein LOC100839151 [Brachypodium 
distachyon]
Length=539

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +2

Query  341  MKGGK-YGSLGAVTLEKSKLDMTQKQTKSSPELAT  442
            MKGGK YG+ GAVTLEK+KLD++Q++ K  PELAT
Sbjct  105  MKGGKQYGAFGAVTLEKAKLDLSQRRKKIMPELAT  139



>dbj|BAJ89837.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=533

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +2

Query  341  MKGGK-YGSLGAVTLEKSKLDMTQKQTKSSPELAT  442
            MKGGK YG+ GAVTLEK+KLD++Q++ K  PELAT
Sbjct  99   MKGGKQYGAFGAVTLEKAKLDLSQRKKKIMPELAT  133



>ref|XP_006851061.1| hypothetical protein AMTR_s00025p00237700 [Amborella trichopoda]
 gb|ERN12642.1| hypothetical protein AMTR_s00025p00237700 [Amborella trichopoda]
Length=542

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +2

Query  209  IKASSAVVDGDGIAALERCFQaspsldspssssstasparyapVMKGGKYGSLGAVTLEK  388
            I+AS  VV+ +G    E C +        +S +++ +   ++P MK  +YG+ G VTLEK
Sbjct  60   IRASLGVVEREGFIEREDCGREYLERCFNASGATSGAVRSFSPSMKK-EYGAFGTVTLEK  118

Query  389  SKLDMTQKQTKSSPELA  439
            SKLDM+QK T+SSP+ A
Sbjct  119  SKLDMSQKTTRSSPQTA  135



>ref|XP_009596329.1| PREDICTED: uncharacterized protein LOC104092429 [Nicotiana tomentosiformis]
Length=417

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  338  VMKGGKYGSLGAVTLEKSKLDMTQKQTKSSPE  433
            VMKG KYG+LGA TLE SKL +TQ QT SSPE
Sbjct  84   VMKGEKYGALGADTLEISKLGLTQTQTNSSPE  115



>ref|XP_008796030.1| PREDICTED: uncharacterized protein LOC103711596 [Phoenix dactylifera]
Length=481

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +2

Query  251  ALERCFQaspsldspsssss---tasparyapVMKGGKYGSLGAVTLEKSKLDMTQKQTK  421
            ALERCF ASP  D PS SSS     + A  APVMKG +YG+ G VTLEKSKLD++QK TK
Sbjct  12   ALERCFAASPVSDPPSCSSSPSSLLASAAMAPVMKG-QYGAFGGVTLEKSKLDLSQKTTK  70

Query  422  SSPELAT  442
            SS E AT
Sbjct  71   SSAETAT  77



>ref|XP_002443144.1| hypothetical protein SORBIDRAFT_08g011730 [Sorghum bicolor]
 gb|EES16982.1| hypothetical protein SORBIDRAFT_08g011730 [Sorghum bicolor]
Length=538

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 2/36 (6%)
 Frame = +2

Query  341  MKGGK--YGSLGAVTLEKSKLDMTQKQTKSSPELAT  442
            MKGG+  YG+ GAVTLEK+KLD++Q++ K  PELAT
Sbjct  105  MKGGRKQYGAFGAVTLEKAKLDLSQRRKKIMPELAT  140



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552470516325