BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP015B04 234 bp,:Filtered

Length=208
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006354195.1|  PREDICTED: callose synthase 9-like                 134   3e-34   Solanum tuberosum [potatoes]
ref|XP_009769310.1|  PREDICTED: callose synthase 9 isoform X1           134   4e-34   Nicotiana sylvestris
ref|XP_009608251.1|  PREDICTED: callose synthase 9                      134   5e-34   Nicotiana tomentosiformis
ref|XP_009769311.1|  PREDICTED: callose synthase 9 isoform X2           134   5e-34   Nicotiana sylvestris
ref|XP_002528123.1|  1,3-beta-glucan synthase, putative                 134   5e-34   
gb|KDP44403.1|  hypothetical protein JCGZ_19418                         133   1e-33   Jatropha curcas
ref|XP_007208346.1|  hypothetical protein PRUPE_ppa001863mg             131   1e-33   Prunus persica
ref|XP_010315995.1|  PREDICTED: callose synthase 9                      132   1e-33   Solanum lycopersicum
gb|EYU17998.1|  hypothetical protein MIMGU_mgv1a000080mg                132   2e-33   Erythranthe guttata [common monkey flower]
ref|XP_007142644.1|  hypothetical protein PHAVU_007G004900g             131   3e-33   Phaseolus vulgaris [French bean]
gb|KHN27111.1|  Callose synthase 9                                      127   4e-33   Glycine soja [wild soybean]
ref|XP_007142646.1|  hypothetical protein PHAVU_007G004900g             130   7e-33   Phaseolus vulgaris [French bean]
ref|XP_010087400.1|  Callose synthase 9                                 130   1e-32   Morus notabilis
gb|KJB21395.1|  hypothetical protein B456_004G018200                    130   1e-32   Gossypium raimondii
gb|KHN37283.1|  Callose synthase 9                                      130   1e-32   Glycine soja [wild soybean]
ref|XP_003536799.1|  PREDICTED: callose synthase 9-like isoformX1       130   1e-32   Glycine max [soybeans]
ref|XP_003556562.1|  PREDICTED: callose synthase 9-like isoformX1       129   2e-32   Glycine max [soybeans]
ref|XP_007014805.1|  Glucan synthase-like 10 isoform 1                  129   2e-32   Theobroma cacao [chocolate]
ref|XP_002297824.2|  hypothetical protein POPTR_0001s04940g             129   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_008225069.1|  PREDICTED: callose synthase 9                      129   2e-32   Prunus mume [ume]
ref|XP_011037937.1|  PREDICTED: callose synthase 9                      129   2e-32   Populus euphratica
gb|AAD25952.1|AF085717_1  putative callose synthase catalytic sub...    129   2e-32   Gossypium hirsutum [American cotton]
gb|KJB21396.1|  hypothetical protein B456_004G018200                    129   2e-32   Gossypium raimondii
gb|KJB21397.1|  hypothetical protein B456_004G018200                    129   3e-32   Gossypium raimondii
ref|XP_008361463.1|  PREDICTED: LOW QUALITY PROTEIN: callose synt...    129   3e-32   
ref|XP_010044973.1|  PREDICTED: callose synthase 9                      129   4e-32   Eucalyptus grandis [rose gum]
ref|XP_003592825.1|  Callose synthase                                   128   4e-32   
ref|XP_011461841.1|  PREDICTED: callose synthase 9                      128   4e-32   Fragaria vesca subsp. vesca
gb|KDO56424.1|  hypothetical protein CISIN_1g000179mg                   128   4e-32   Citrus sinensis [Valencia orange]
gb|KDO56426.1|  hypothetical protein CISIN_1g000179mg                   128   5e-32   Citrus sinensis [Valencia orange]
emb|CDY05323.1|  BnaC05g44800D                                          128   5e-32   Brassica napus [oilseed rape]
ref|XP_006445912.1|  hypothetical protein CICLE_v10014066mg             128   5e-32   Citrus clementina
ref|XP_009364087.1|  PREDICTED: callose synthase 9 isoform X6           128   5e-32   Pyrus x bretschneideri [bai li]
gb|KDO56425.1|  hypothetical protein CISIN_1g000179mg                   127   5e-32   Citrus sinensis [Valencia orange]
ref|XP_009364084.1|  PREDICTED: callose synthase 9 isoform X3           128   6e-32   Pyrus x bretschneideri [bai li]
ref|XP_009364083.1|  PREDICTED: callose synthase 9 isoform X2           128   6e-32   Pyrus x bretschneideri [bai li]
emb|CDP11096.1|  unnamed protein product                                128   6e-32   Coffea canephora [robusta coffee]
ref|XP_009364082.1|  PREDICTED: callose synthase 9 isoform X1           128   6e-32   Pyrus x bretschneideri [bai li]
ref|XP_011083140.1|  PREDICTED: callose synthase 9                      128   6e-32   Sesamum indicum [beniseed]
ref|XP_006855626.1|  hypothetical protein AMTR_s00044p00088780          127   7e-32   
ref|XP_009364085.1|  PREDICTED: callose synthase 9 isoform X4           127   7e-32   Pyrus x bretschneideri [bai li]
ref|XP_007014806.1|  Glucan synthase-like 10 isoform 2                  127   8e-32   Theobroma cacao [chocolate]
ref|XP_009364086.1|  PREDICTED: callose synthase 9 isoform X5           127   8e-32   Pyrus x bretschneideri [bai li]
gb|AES63076.2|  callose synthase-like protein                           127   8e-32   Medicago truncatula
ref|XP_009147103.1|  PREDICTED: callose synthase 9                      127   8e-32   Brassica rapa
gb|KGN66426.1|  hypothetical protein Csa_1G604850                       126   9e-32   Cucumis sativus [cucumbers]
emb|CDY24642.1|  BnaA05g30410D                                          127   9e-32   Brassica napus [oilseed rape]
gb|KEH44542.1|  callose synthase-like protein                           127   9e-32   Medicago truncatula
gb|KDO56421.1|  hypothetical protein CISIN_1g000179mg                   127   1e-31   Citrus sinensis [Valencia orange]
gb|KDO56422.1|  hypothetical protein CISIN_1g000179mg                   127   1e-31   Citrus sinensis [Valencia orange]
ref|XP_006492665.1|  PREDICTED: callose synthase 9-like isoform X1      127   1e-31   Citrus sinensis [Valencia orange]
ref|XP_009124472.1|  PREDICTED: LOW QUALITY PROTEIN: callose synt...    127   2e-31   Brassica rapa
gb|KDO56428.1|  hypothetical protein CISIN_1g000179mg                   126   2e-31   Citrus sinensis [Valencia orange]
ref|XP_008794562.1|  PREDICTED: callose synthase 9-like                 126   2e-31   
gb|KDO56427.1|  hypothetical protein CISIN_1g000179mg                   126   2e-31   Citrus sinensis [Valencia orange]
gb|KCW87113.1|  hypothetical protein EUGRSUZ_B036401                    126   3e-31   Eucalyptus grandis [rose gum]
ref|XP_008451107.1|  PREDICTED: callose synthase 9                      126   3e-31   Cucumis melo [Oriental melon]
ref|XP_004149020.1|  PREDICTED: callose synthase 9-like                 126   3e-31   
gb|EPS67036.1|  hypothetical protein M569_07740                         125   4e-31   Genlisea aurea
ref|XP_010257473.1|  PREDICTED: callose synthase 9                      125   4e-31   Nelumbo nucifera [Indian lotus]
emb|CDY34913.1|  BnaA01g32440D                                          125   4e-31   Brassica napus [oilseed rape]
ref|XP_004161577.1|  PREDICTED: callose synthase 3-like                 125   5e-31   
ref|XP_002884630.1|  hypothetical protein ARALYDRAFT_340908             125   6e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_010464324.1|  PREDICTED: callose synthase 9-like isoform X1      125   6e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010449316.1|  PREDICTED: callose synthase 9-like                 125   7e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010486258.1|  PREDICTED: callose synthase 9                      125   7e-31   Camelina sativa [gold-of-pleasure]
gb|AAF20230.1|AC012395_17  putative glucan synthase                     125   8e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009400322.1|  PREDICTED: callose synthase 9                      124   9e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010535891.1|  PREDICTED: callose synthase 9 isoform X1           124   1e-30   Tarenaya hassleriana [spider flower]
gb|KDO56429.1|  hypothetical protein CISIN_1g000179mg                   124   1e-30   Citrus sinensis [Valencia orange]
ref|NP_187372.5|  callose synthase 9                                    124   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004497387.1|  PREDICTED: callose synthase 9-like isoform X2      124   1e-30   
ref|XP_004497386.1|  PREDICTED: callose synthase 9-like isoform X1      124   1e-30   Cicer arietinum [garbanzo]
emb|CAD23545.1|  putative callose synthase                              118   2e-30   Vitis vinifera
ref|XP_010464325.1|  PREDICTED: callose synthase 9-like isoform X2      123   3e-30   Camelina sativa [gold-of-pleasure]
emb|CDY08011.1|  BnaC03g35120D                                          123   3e-30   Brassica napus [oilseed rape]
emb|CDX74058.1|  BnaA03g29890D                                          123   4e-30   Brassica napus [oilseed rape]
ref|XP_010909209.1|  PREDICTED: callose synthase 9                      122   4e-30   Elaeis guineensis
ref|XP_009134953.1|  PREDICTED: callose synthase 9-like                 122   4e-30   Brassica rapa
ref|XP_010673534.1|  PREDICTED: callose synthase 9                      122   6e-30   Beta vulgaris subsp. vulgaris [Swiss chard]
emb|CBI16463.3|  unnamed protein product                                121   1e-29   Vitis vinifera
ref|XP_006407863.1|  hypothetical protein EUTSA_v10019878mg             121   1e-29   Eutrema salsugineum
ref|XP_010651329.1|  PREDICTED: callose synthase 9 isoform X1           121   1e-29   Vitis vinifera
ref|XP_010651333.1|  PREDICTED: callose synthase 9 isoform X2           120   3e-29   Vitis vinifera
ref|XP_004985950.1|  PREDICTED: callose synthase 9-like                 117   5e-28   Setaria italica
gb|EEC74403.1|  hypothetical protein OsI_09759                          110   8e-26   Oryza sativa Indica Group [Indian rice]
gb|EEE58225.1|  hypothetical protein OsJ_09196                          109   1e-25   Oryza sativa Japonica Group [Japonica rice]
gb|AAO15292.1|  Putative callose synthase                               109   2e-25   Oryza sativa Japonica Group [Japonica rice]
gb|EEE64970.1|  hypothetical protein OsJ_19875                          108   3e-25   Oryza sativa Japonica Group [Japonica rice]
gb|AAO46087.1|  putative callose synthase                               108   4e-25   Hordeum vulgare subsp. vulgare [barley]
gb|EEC79862.1|  hypothetical protein OsI_21355                          108   4e-25   Oryza sativa Indica Group [Indian rice]
gb|EMS56501.1|  Callose synthase 9                                      108   6e-25   Triticum urartu
gb|EMT21982.1|  Callose synthase 9                                      108   6e-25   Aegilops tauschii
dbj|BAD67750.1|  putative beta 1,3 glucan synthase                      108   6e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006649287.1|  PREDICTED: callose synthase 9-like                 108   6e-25   Oryza brachyantha
ref|XP_010228114.1|  PREDICTED: callose synthase 10                     107   1e-24   Brachypodium distachyon [annual false brome]
ref|XP_003558953.1|  PREDICTED: callose synthase 9                      105   3e-24   Brachypodium distachyon [annual false brome]
gb|EMS54246.1|  Callose synthase 10                                     105   3e-24   Triticum urartu
ref|XP_006655702.1|  PREDICTED: callose synthase 10-like                105   3e-24   Oryza brachyantha
gb|KJB19540.1|  hypothetical protein B456_003G109000                    105   4e-24   Gossypium raimondii
gb|KJB19539.1|  hypothetical protein B456_003G109000                    105   5e-24   Gossypium raimondii
ref|XP_004983400.1|  PREDICTED: callose synthase 10-like isoform X1     105   5e-24   
ref|XP_004983401.1|  PREDICTED: callose synthase 10-like isoform X2     105   6e-24   Setaria italica
gb|KJB19541.1|  hypothetical protein B456_003G109000                    105   7e-24   Gossypium raimondii
tpg|DAA46675.1|  TPA: putative glycosyl transferase family protein      104   8e-24   Zea mays [maize]
tpg|DAA46673.1|  TPA: putative glycosyl transferase family protein      104   8e-24   Zea mays [maize]
tpg|DAA46676.1|  TPA: putative glycosyl transferase family protein      104   8e-24   Zea mays [maize]
gb|KJB19542.1|  hypothetical protein B456_003G109000                    104   8e-24   Gossypium raimondii
gb|AAQ17229.1|  beta 1,3 glucan synthase                                104   8e-24   Lolium multiflorum
gb|KJB19543.1|  hypothetical protein B456_003G109000                    104   9e-24   Gossypium raimondii
tpg|DAA46674.1|  TPA: putative glycosyl transferase family protein      104   1e-23   Zea mays [maize]
ref|XP_008788670.1|  PREDICTED: callose synthase 10                     104   1e-23   Phoenix dactylifera
gb|EMT01086.1|  Callose synthase 9                                      104   1e-23   Aegilops tauschii
ref|XP_007037861.1|  Glucan synthase-like 8 isoform 1                   103   2e-23   Theobroma cacao [chocolate]
ref|XP_007037862.1|  Glucan synthase-like 8 isoform 2                   103   2e-23   Theobroma cacao [chocolate]
ref|XP_010935011.1|  PREDICTED: callose synthase 10                     103   2e-23   Elaeis guineensis
gb|KJB19544.1|  hypothetical protein B456_003G109000                    103   3e-23   Gossypium raimondii
ref|XP_007037863.1|  Glucan synthase-like 8 isoform 3                   103   3e-23   Theobroma cacao [chocolate]
gb|EPS70833.1|  hypothetical protein M569_03926                         100   5e-23   Genlisea aurea
ref|XP_011072986.1|  PREDICTED: callose synthase 10                     101   9e-23   Sesamum indicum [beniseed]
ref|XP_006837416.1|  hypothetical protein AMTR_s00111p00150590          101   1e-22   
gb|EYU40120.1|  hypothetical protein MIMGU_mgv1a000075mg                101   1e-22   Erythranthe guttata [common monkey flower]
ref|XP_009384671.1|  PREDICTED: callose synthase 10 isoform X2          100   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384664.1|  PREDICTED: callose synthase 10 isoform X1          100   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK36562.1|  hypothetical protein AALP_AA4G139500                    100   2e-22   Arabis alpina [alpine rockcress]
ref|XP_010101941.1|  Callose synthase 10                              99.8    5e-22   Morus notabilis
gb|KDO69366.1|  hypothetical protein CISIN_1g0001801mg                99.4    5e-22   Citrus sinensis [Valencia orange]
gb|KDO69364.1|  hypothetical protein CISIN_1g0001801mg                99.4    5e-22   Citrus sinensis [Valencia orange]
ref|XP_006440015.1|  hypothetical protein CICLE_v100184562mg          99.4    6e-22   Citrus clementina
ref|XP_006440014.1|  hypothetical protein CICLE_v100184562mg          99.4    6e-22   Citrus clementina
ref|XP_010545980.1|  PREDICTED: callose synthase 10 isoform X1        99.4    7e-22   Tarenaya hassleriana [spider flower]
ref|XP_010545981.1|  PREDICTED: callose synthase 10 isoform X2        99.4    7e-22   Tarenaya hassleriana [spider flower]
emb|CDY33198.1|  BnaC04g08410D                                        99.0    1e-21   Brassica napus [oilseed rape]
ref|XP_009143552.1|  PREDICTED: callose synthase 10                   99.0    1e-21   Brassica rapa
emb|CDX75010.1|  BnaA05g07560D                                        99.0    1e-21   Brassica napus [oilseed rape]
gb|ABI14554.1|  glucan synthase-like 1                                92.8    1e-21   Helianthus annuus x Helianthus debilis subsp. debilis
ref|XP_006476953.1|  PREDICTED: callose synthase 10-like              98.6    1e-21   Citrus sinensis [Valencia orange]
ref|XP_010026813.1|  PREDICTED: callose synthase 10 isoform X2        98.6    1e-21   Eucalyptus grandis [rose gum]
ref|XP_010026809.1|  PREDICTED: callose synthase 10 isoform X1        98.6    1e-21   Eucalyptus grandis [rose gum]
ref|XP_010026823.1|  PREDICTED: callose synthase 10 isoform X4        98.6    1e-21   Eucalyptus grandis [rose gum]
ref|XP_010026817.1|  PREDICTED: callose synthase 10 isoform X3        98.6    1e-21   Eucalyptus grandis [rose gum]
gb|KDP30983.1|  hypothetical protein JCGZ_11359                       98.2    1e-21   Jatropha curcas
gb|KDO69367.1|  hypothetical protein CISIN_1g0001801mg                97.4    2e-21   Citrus sinensis [Valencia orange]
emb|CBI14881.3|  unnamed protein product                              98.2    2e-21   Vitis vinifera
gb|KHN31929.1|  Callose synthase 10                                   97.8    2e-21   Glycine soja [wild soybean]
ref|XP_009359501.1|  PREDICTED: callose synthase 10-like              97.8    2e-21   Pyrus x bretschneideri [bai li]
ref|XP_010663054.1|  PREDICTED: callose synthase 10 isoform X2        97.8    2e-21   Vitis vinifera
ref|XP_010663053.1|  PREDICTED: callose synthase 10 isoform X1        97.8    2e-21   Vitis vinifera
ref|XP_010507586.1|  PREDICTED: callose synthase 10-like              97.8    2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010516914.1|  PREDICTED: callose synthase 10                   97.8    2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010509427.1|  PREDICTED: callose synthase 10-like              97.8    2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_002511263.1|  transferase, transferring glycosyl groups, p...  97.4    3e-21   
ref|XP_006581889.1|  PREDICTED: callose synthase 10-like              97.4    3e-21   
ref|XP_006578682.1|  PREDICTED: callose synthase 10-like              97.4    3e-21   Glycine max [soybeans]
gb|KHN05791.1|  Callose synthase 10                                   97.4    3e-21   Glycine soja [wild soybean]
ref|XP_004501831.1|  PREDICTED: callose synthase 10-like              97.1    4e-21   Cicer arietinum [garbanzo]
gb|KEH34985.1|  callose synthase-like protein                         97.1    4e-21   Medicago truncatula
gb|KEH34986.1|  callose synthase-like protein                         97.1    4e-21   Medicago truncatula
ref|XP_008464454.1|  PREDICTED: callose synthase 10                   97.1    5e-21   Cucumis melo [Oriental melon]
ref|XP_007137962.1|  hypothetical protein PHAVU_009G169400g           96.7    5e-21   Phaseolus vulgaris [French bean]
ref|XP_004138064.1|  PREDICTED: callose synthase 10-like              96.7    5e-21   
gb|KGN63502.1|  hypothetical protein Csa_1G002710                     96.7    5e-21   Cucumis sativus [cucumbers]
ref|XP_008239401.1|  PREDICTED: callose synthase 10                   96.7    6e-21   Prunus mume [ume]
ref|XP_006293554.1|  hypothetical protein CARUB_v10022498mg           96.3    7e-21   Capsella rubella
ref|XP_004236315.1|  PREDICTED: callose synthase 10                   96.3    7e-21   Solanum lycopersicum
ref|XP_006351455.1|  PREDICTED: callose synthase 10-like              96.3    8e-21   Solanum tuberosum [potatoes]
ref|XP_009333831.1|  PREDICTED: callose synthase 10-like              96.3    8e-21   Pyrus x bretschneideri [bai li]
ref|XP_002322219.1|  GLUCAN SYNTHASE-LIKE 8 family protein            96.3    9e-21   Populus trichocarpa [western balsam poplar]
ref|XP_004299187.1|  PREDICTED: callose synthase 10                   95.9    9e-21   Fragaria vesca subsp. vesca
ref|XP_009613174.1|  PREDICTED: callose synthase 10                   95.9    1e-20   Nicotiana tomentosiformis
ref|XP_010248781.1|  PREDICTED: callose synthase 10                   95.9    1e-20   Nelumbo nucifera [Indian lotus]
ref|XP_009791092.1|  PREDICTED: callose synthase 10                   95.9    1e-20   Nicotiana sylvestris
gb|AAK49453.1|AF304373_1  putative beta-1,3-glucan synthase           92.0    1e-20   Nicotiana alata [Indian tobacco]
ref|XP_010667393.1|  PREDICTED: callose synthase 10 isoform X2        95.9    1e-20   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010667392.1|  PREDICTED: callose synthase 10 isoform X1        95.9    1e-20   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_006410857.1|  hypothetical protein EUTSA_v10016126mg           95.5    2e-20   Eutrema salsugineum
ref|XP_008392970.1|  PREDICTED: callose synthase 10-like              94.4    3e-20   Malus domestica [apple tree]
gb|AAD31571.1|  putative glucan synthase                              92.8    7e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011024097.1|  PREDICTED: callose synthase 10 isoform X2        93.2    8e-20   Populus euphratica
ref|XP_011024096.1|  PREDICTED: callose synthase 10 isoform X1        93.2    8e-20   Populus euphratica
ref|XP_002881474.1|  hypothetical protein ARALYDRAFT_482666           93.2    9e-20   Arabidopsis lyrata subsp. lyrata
ref|NP_850271.5|  glucan synthase-like 8                              92.8    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008337073.1|  PREDICTED: callose synthase 10                   92.4    1e-19   Malus domestica [apple tree]
ref|XP_002993846.1|  glucan synthase like 7                           86.3    2e-17   Selaginella moellendorffii
ref|XP_002991456.1|  glucan synthase like 7                           86.3    2e-17   Selaginella moellendorffii
ref|XP_008665818.1|  PREDICTED: LOW QUALITY PROTEIN: callose synt...  80.5    2e-15   Zea mays [maize]
ref|XP_004170812.1|  PREDICTED: callose synthase 10-like              80.1    2e-15   
ref|XP_001773231.1|  predicted protein                                76.3    7e-14   Physcomitrella patens
ref|XP_001766872.1|  predicted protein                                75.1    2e-13   Physcomitrella patens
ref|XP_010919535.1|  PREDICTED: callose synthase 12-like              71.6    2e-12   Elaeis guineensis
gb|KCW54228.1|  hypothetical protein EUGRSUZ_I00208                   71.6    2e-12   Eucalyptus grandis [rose gum]
ref|XP_010027661.1|  PREDICTED: LOW QUALITY PROTEIN: callose synt...  71.6    2e-12   Eucalyptus grandis [rose gum]
ref|XP_006447310.1|  hypothetical protein CICLE_v10018223mg           70.9    5e-12   Citrus clementina
gb|KDO51558.1|  hypothetical protein CISIN_1g000259mg                 70.9    5e-12   Citrus sinensis [Valencia orange]
ref|XP_006491624.1|  PREDICTED: callose synthase 12-like              70.9    5e-12   Citrus sinensis [Valencia orange]
ref|XP_010269904.1|  PREDICTED: callose synthase 12-like              70.1    9e-12   Nelumbo nucifera [Indian lotus]
emb|CDP14784.1|  unnamed protein product                              70.1    9e-12   Coffea canephora [robusta coffee]
gb|KHG16154.1|  Callose synthase 12 -like protein                     70.1    1e-11   Gossypium arboreum [tree cotton]
gb|EPS66162.1|  hypothetical protein M569_08614                       70.1    1e-11   Genlisea aurea
ref|XP_011086366.1|  PREDICTED: callose synthase 12                   70.1    1e-11   Sesamum indicum [beniseed]
ref|XP_006594852.1|  PREDICTED: callose synthase 12-like isoform X2   69.7    1e-11   
gb|KHN36638.1|  Callose synthase 12                                   69.7    1e-11   Glycine soja [wild soybean]
ref|XP_003526282.2|  PREDICTED: callose synthase 12-like isoform X1   69.3    1e-11   
ref|XP_003541911.1|  PREDICTED: callose synthase 12-like isoform X1   69.7    1e-11   Glycine max [soybeans]
gb|KHN35252.1|  Callose synthase 12                                   69.3    2e-11   Glycine soja [wild soybean]
gb|KHN31989.1|  Callose synthase 12                                   69.3    2e-11   Glycine soja [wild soybean]
ref|XP_008386400.1|  PREDICTED: putative callose synthase 8 isofo...  68.9    2e-11   Malus domestica [apple tree]
ref|XP_007149848.1|  hypothetical protein PHAVU_005G103600g           68.9    2e-11   Phaseolus vulgaris [French bean]
ref|XP_010097906.1|  Callose synthase 12                              68.6    3e-11   Morus notabilis
ref|XP_010274605.1|  PREDICTED: callose synthase 12-like              68.6    3e-11   Nelumbo nucifera [Indian lotus]
ref|XP_007043597.1|  Glucan synthase-like 5                           68.6    3e-11   Theobroma cacao [chocolate]
ref|XP_009782977.1|  PREDICTED: callose synthase 12-like              68.6    3e-11   Nicotiana sylvestris
ref|XP_004505578.1|  PREDICTED: callose synthase 12-like isoform X1   68.6    3e-11   
ref|XP_006357481.1|  PREDICTED: callose synthase 12-like              68.6    3e-11   Solanum tuberosum [potatoes]
ref|XP_004243352.1|  PREDICTED: callose synthase 12                   68.6    3e-11   Solanum lycopersicum
gb|KJB79972.1|  hypothetical protein B456_013G075600                  68.6    3e-11   Gossypium raimondii
ref|XP_003607458.1|  Callose synthase                                 68.6    3e-11   Medicago truncatula
ref|XP_010038677.1|  PREDICTED: callose synthase 12-like              68.2    3e-11   Eucalyptus grandis [rose gum]
gb|KCW76242.1|  hypothetical protein EUGRSUZ_D00621                   68.2    3e-11   Eucalyptus grandis [rose gum]
gb|KDP24129.1|  hypothetical protein JCGZ_25786                       68.2    3e-11   Jatropha curcas
ref|XP_010052310.1|  PREDICTED: LOW QUALITY PROTEIN: callose synt...  68.2    3e-11   Eucalyptus grandis [rose gum]
ref|XP_001764343.1|  predicted protein                                68.2    4e-11   Physcomitrella patens
gb|KCW47213.1|  hypothetical protein EUGRSUZ_K010271                  68.2    4e-11   Eucalyptus grandis [rose gum]
ref|XP_008811912.1|  PREDICTED: callose synthase 12-like              68.2    4e-11   Phoenix dactylifera
ref|XP_007146339.1|  hypothetical protein PHAVU_006G032100g           68.2    4e-11   Phaseolus vulgaris [French bean]
gb|KJB77266.1|  hypothetical protein B456_012G128700                  67.8    4e-11   Gossypium raimondii
ref|XP_010052311.1|  PREDICTED: callose synthase 11-like              68.2    4e-11   Eucalyptus grandis [rose gum]
ref|XP_009395035.1|  PREDICTED: callose synthase 12-like              67.8    5e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006376492.1|  hypothetical protein POPTR_0013s134902g          67.8    5e-11   Populus trichocarpa [western balsam poplar]
gb|KEH39135.1|  1,3-beta-glucan synthase component-like protein       67.8    6e-11   Medicago truncatula
ref|XP_008386401.1|  PREDICTED: putative callose synthase 8 isofo...  67.8    6e-11   Malus domestica [apple tree]
ref|XP_002517915.1|  transferase, transferring glycosyl groups, p...  67.8    6e-11   Ricinus communis
ref|XP_011037332.1|  PREDICTED: callose synthase 12                   67.8    6e-11   Populus euphratica
gb|KHN08524.1|  Callose synthase 11                                   67.4    6e-11   Glycine soja [wild soybean]
ref|XP_006597437.1|  PREDICTED: callose synthase 11-like isoform X1   67.4    7e-11   Glycine max [soybeans]
gb|EMT05385.1|  Callose synthase 12                                   67.4    7e-11   Aegilops tauschii
ref|XP_007132658.1|  hypothetical protein PHAVU_011G113800g           67.4    7e-11   Phaseolus vulgaris [French bean]
gb|ACS36253.1|  glucan synthase-like 7                                67.4    8e-11   Hordeum vulgare [barley]
gb|EYU28588.1|  hypothetical protein MIMGU_mgv1a000108mg              67.0    9e-11   Erythranthe guttata [common monkey flower]
ref|XP_006396582.1|  hypothetical protein EUTSA_v10028360mg           67.0    9e-11   Eutrema salsugineum
ref|XP_010455882.1|  PREDICTED: callose synthase 12-like              67.0    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010422451.1|  PREDICTED: callose synthase 12 isoform X1        67.0    1e-10   Camelina sativa [gold-of-pleasure]
ref|NP_192264.1|  callose synthase 12                                 67.0    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009121761.1|  PREDICTED: callose synthase 12                   67.0    1e-10   Brassica rapa
emb|CDY21974.1|  BnaC09g00800D                                        67.0    1e-10   Brassica napus [oilseed rape]
emb|CDY48567.1|  BnaA09g01630D                                        67.0    1e-10   Brassica napus [oilseed rape]
gb|EMS50509.1|  Callose synthase 11                                   67.0    1e-10   Triticum urartu
emb|CDM84125.1|  unnamed protein product                              67.0    1e-10   Triticum aestivum [Canadian hard winter wheat]
dbj|BAK06274.1|  predicted protein                                    67.0    1e-10   Hordeum vulgare subsp. vulgare [barley]
ref|XP_007198905.1|  hypothetical protein PRUPE_ppa000167m2g          66.6    1e-10   Prunus persica
ref|XP_009339333.1|  PREDICTED: putative callose synthase 8 isofo...  66.6    1e-10   Pyrus x bretschneideri [bai li]
ref|XP_009375102.1|  PREDICTED: callose synthase 3-like               66.6    1e-10   Pyrus x bretschneideri [bai li]
ref|XP_008229065.1|  PREDICTED: callose synthase 12                   66.6    1e-10   Prunus mume [ume]
ref|XP_008352143.1|  PREDICTED: LOW QUALITY PROTEIN: callose synt...  66.6    1e-10   
ref|XP_001764315.1|  predicted protein                                66.6    1e-10   Physcomitrella patens
ref|XP_004305416.1|  PREDICTED: callose synthase 12                   66.6    1e-10   Fragaria vesca subsp. vesca
ref|XP_010054174.1|  PREDICTED: callose synthase 11-like              66.2    2e-10   Eucalyptus grandis [rose gum]
ref|XP_007022118.1|  Glucan synthase-like 4                           66.2    2e-10   Theobroma cacao [chocolate]
ref|XP_002978171.1|  hypothetical protein SELMODRAFT_107957           66.2    2e-10   Selaginella moellendorffii
ref|XP_002966392.1|  glucan synthase like 1                           66.2    2e-10   Selaginella moellendorffii
gb|KDO58320.1|  hypothetical protein CISIN_1g0457373mg                65.5    2e-10   Citrus sinensis [Valencia orange]
ref|XP_004487377.1|  PREDICTED: callose synthase 12-like              66.2    2e-10   Cicer arietinum [garbanzo]
ref|XP_008645116.1|  PREDICTED: callose synthase 3-like               66.2    2e-10   Zea mays [maize]
ref|XP_004301958.1|  PREDICTED: putative callose synthase 8           65.9    2e-10   Fragaria vesca subsp. vesca
gb|KJB57551.1|  hypothetical protein B456_009G169700                  65.9    2e-10   Gossypium raimondii
gb|KHG04936.1|  Callose synthase 11 -like protein                     65.9    2e-10   Gossypium arboreum [tree cotton]
ref|XP_009339332.1|  PREDICTED: putative callose synthase 8 isofo...  65.9    2e-10   Pyrus x bretschneideri [bai li]
gb|KJB31688.1|  hypothetical protein B456_005G201500                  65.9    2e-10   Gossypium raimondii
gb|KHG26810.1|  Callose synthase 12 -like protein                     65.9    2e-10   Gossypium arboreum [tree cotton]
ref|XP_010667745.1|  PREDICTED: callose synthase 12                   65.9    2e-10   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_008675041.1|  PREDICTED: callose synthase 11-like              65.9    2e-10   Zea mays [maize]
gb|KCW47214.1|  hypothetical protein EUGRSUZ_K01028                   65.9    3e-10   Eucalyptus grandis [rose gum]
ref|XP_010522609.1|  PREDICTED: callose synthase 12                   65.9    3e-10   Tarenaya hassleriana [spider flower]
ref|XP_008607550.1|  hypothetical protein SDRG_03691                  65.9    3e-10   Saprolegnia diclina VS20
ref|XP_010035759.1|  PREDICTED: LOW QUALITY PROTEIN: callose synt...  65.9    3e-10   Eucalyptus grandis [rose gum]
gb|EPS70715.1|  hypothetical protein M569_04038                       65.9    3e-10   Genlisea aurea
ref|XP_007025627.1|  Glucan synthase-like 1 isoform 1                 65.9    3e-10   Theobroma cacao [chocolate]
ref|XP_006432235.1|  hypothetical protein CICLE_v10000018mg           65.9    3e-10   Citrus clementina
ref|XP_006464876.1|  PREDICTED: LOW QUALITY PROTEIN: callose synt...  65.9    3e-10   
ref|XP_008448292.1|  PREDICTED: callose synthase 12-like              65.5    3e-10   
ref|XP_004154600.1|  PREDICTED: LOW QUALITY PROTEIN: callose synt...  65.5    3e-10   
ref|XP_004140034.1|  PREDICTED: callose synthase 12-like              65.5    3e-10   
gb|KDO19933.1|  hypothetical protein SPRG_21467                       65.5    3e-10   
ref|XP_009381794.1|  PREDICTED: callose synthase 5-like               65.5    3e-10   
ref|XP_009341978.1|  PREDICTED: callose synthase 12-like              65.5    3e-10   
ref|XP_007146338.1|  hypothetical protein PHAVU_006G0319000g          65.1    4e-10   
ref|XP_006347039.1|  PREDICTED: callose synthase 11-like isoform X1   65.1    5e-10   
ref|XP_010930063.1|  PREDICTED: callose synthase 5                    65.1    5e-10   
gb|ADK74831.1|  CalS5-like protein                                    65.1    5e-10   
ref|XP_010656968.1|  PREDICTED: callose synthase 12                   64.7    5e-10   
ref|XP_006644723.1|  PREDICTED: callose synthase 12-like              64.7    6e-10   
ref|XP_009773312.1|  PREDICTED: callose synthase 11-like              64.7    6e-10   
ref|XP_009605284.1|  PREDICTED: callose synthase 11-like              64.7    6e-10   
gb|KEH36548.1|  callose synthase-like protein                         64.7    6e-10   
ref|XP_002437961.1|  hypothetical protein SORBIDRAFT_10g005550        64.7    6e-10   
ref|XP_004232875.1|  PREDICTED: callose synthase 11-like              64.7    6e-10   
ref|XP_002439067.1|  hypothetical protein SORBIDRAFT_10g030970        64.7    6e-10   
ref|XP_007148164.1|  hypothetical protein PHAVU_006G185600g           64.7    6e-10   
ref|XP_009357876.1|  PREDICTED: callose synthase 12-like              64.7    6e-10   
ref|XP_009357857.1|  PREDICTED: callose synthase 12-like              64.7    6e-10   
ref|XP_008337476.1|  PREDICTED: callose synthase 12                   64.7    6e-10   
ref|XP_010242908.1|  PREDICTED: callose synthase 12-like              64.7    7e-10   
emb|CCA22421.1|  unnamed protein product                              64.7    7e-10   
emb|CBI23964.3|  unnamed protein product                              64.7    7e-10   
ref|XP_004964671.1|  PREDICTED: LOW QUALITY PROTEIN: callose synt...  64.7    7e-10   
ref|XP_009773654.1|  PREDICTED: putative callose synthase 8 isofo...  64.3    7e-10   
ref|XP_004485779.1|  PREDICTED: callose synthase 11-like isoform X1   64.7    7e-10   
ref|XP_009773653.1|  PREDICTED: putative callose synthase 8 isofo...  64.3    7e-10   
ref|XP_009773652.1|  PREDICTED: putative callose synthase 8 isofo...  64.3    7e-10   
ref|XP_010646655.1|  PREDICTED: callose synthase 11-like              64.7    7e-10   
gb|AFW75705.1|  putative glycosyl transferase family protein          64.3    8e-10   
gb|EMT08785.1|  Callose synthase 5                                    64.3    8e-10   
ref|XP_011080223.1|  PREDICTED: callose synthase 3-like               64.3    8e-10   
ref|XP_004163443.1|  PREDICTED: LOW QUALITY PROTEIN: callose synt...  64.3    8e-10   
ref|XP_004146651.1|  PREDICTED: callose synthase 11-like              64.3    8e-10   
ref|XP_009622152.1|  PREDICTED: putative callose synthase 8 isofo...  64.3    8e-10   
gb|KCW89536.1|  hypothetical protein EUGRSUZ_A01821                   64.3    8e-10   
ref|XP_010052007.1|  PREDICTED: callose synthase 12-like              64.3    8e-10   
ref|XP_006656707.1|  PREDICTED: callose synthase 5-like               64.3    8e-10   
dbj|BAD72533.1|  putative callose synthase 1 catalytic subunit        64.3    8e-10   
ref|XP_010227953.1|  PREDICTED: callose synthase 5                    64.3    8e-10   
ref|XP_009622154.1|  PREDICTED: putative callose synthase 8 isofo...  64.3    9e-10   
gb|EEE56653.1|  hypothetical protein OsJ_06065                        63.9    9e-10   
ref|XP_008442573.1|  PREDICTED: callose synthase 11                   64.3    9e-10   
ref|XP_002453103.1|  hypothetical protein SORBIDRAFT_04g038510        63.9    1e-09   
ref|XP_002977416.1|  glucan synthase like 4                           63.9    1e-09   
ref|XP_002974999.1|  glucan synthase like 4                           63.9    1e-09   
ref|XP_009624392.1|  PREDICTED: callose synthase 12-like              63.9    1e-09   
gb|KCW89532.1|  hypothetical protein EUGRSUZ_A01817                   63.9    1e-09   
ref|XP_010051930.1|  PREDICTED: callose synthase 12-like              63.9    1e-09   
ref|XP_008783935.1|  PREDICTED: putative callose synthase 8           63.9    1e-09   
gb|EPS65323.1|  hypothetical protein M569_09455                       63.5    1e-09   
emb|CDX85677.1|  BnaA02g01360D                                        63.9    1e-09   
ref|XP_010453351.1|  PREDICTED: callose synthase 3                    63.9    1e-09   
ref|XP_009125875.1|  PREDICTED: callose synthase 3                    63.9    1e-09   
emb|CDX91152.1|  BnaC02g04450D                                        63.9    1e-09   
ref|XP_006399785.1|  hypothetical protein EUTSA_v10012412mg           63.9    1e-09   
ref|XP_010419861.1|  PREDICTED: callose synthase 3                    63.9    1e-09   
gb|KFK25536.1|  hypothetical protein AALP_AA8G127800                  63.9    1e-09   
gb|EMT28537.1|  Callose synthase 3                                    63.9    1e-09   
gb|EMS45036.1|  Callose synthase 3                                    63.9    1e-09   
gb|KHN12582.1|  Callose synthase 3                                    63.9    1e-09   
ref|XP_003551859.1|  PREDICTED: callose synthase 3-like               63.9    1e-09   
gb|KDP36220.1|  hypothetical protein JCGZ_09973                       63.5    1e-09   
ref|NP_196804.6|  callose synthase 3                                  63.9    1e-09   
ref|NP_001154712.2|  callose synthase 3                               63.5    1e-09   
emb|CDP07677.1|  unnamed protein product                              63.5    1e-09   
gb|KHG05156.1|  Callose synthase 5 -like protein                      63.5    1e-09   
ref|XP_010940236.1|  PREDICTED: callose synthase 3-like               63.5    1e-09   
ref|XP_011461843.1|  PREDICTED: callose synthase 3                    63.5    1e-09   
gb|EMS60773.1|  Callose synthase 5                                    63.5    1e-09   
gb|ADM72799.1|  callose synthase 3                                    63.5    2e-09   
gb|ETL34117.1|  hypothetical protein L916_13581                       63.2    2e-09   
gb|ETK80695.1|  hypothetical protein L915_13681                       63.2    2e-09   
ref|XP_004954534.1|  PREDICTED: callose synthase 3-like               63.5    2e-09   
ref|XP_009364077.1|  PREDICTED: callose synthase 3 isoform X2         63.5    2e-09   
gb|KHM99634.1|  Callose synthase 7                                    63.5    2e-09   
gb|ABN09771.1|  Glycosyl transferase, family 48                       63.5    2e-09   
ref|XP_006602253.1|  PREDICTED: callose synthase 7-like isoform X3    63.5    2e-09   
gb|KJB71385.1|  hypothetical protein B456_011G119900                  63.5    2e-09   
gb|KJB71389.1|  hypothetical protein B456_011G120300                  63.5    2e-09   
ref|XP_006855633.1|  hypothetical protein AMTR_s00044p00098420        63.5    2e-09   
ref|XP_011025210.1|  PREDICTED: callose synthase 3-like isoform X1    63.5    2e-09   
ref|XP_006586073.1|  PREDICTED: callose synthase 7-like               63.5    2e-09   
gb|KEH21471.1|  glucan synthase-like protein                          63.5    2e-09   
gb|AES77225.2|  glucan synthase-like protein                          63.5    2e-09   
ref|XP_003621007.1|  Callose synthase                                 63.5    2e-09   
gb|EEC72828.1|  hypothetical protein OsI_06552                        63.2    2e-09   
ref|XP_011083139.1|  PREDICTED: callose synthase 3                    63.5    2e-09   
ref|XP_008338497.1|  PREDICTED: callose synthase 3-like               63.5    2e-09   
ref|XP_009364075.1|  PREDICTED: callose synthase 3 isoform X1         63.5    2e-09   
emb|CCA25481.1|  PREDICTED: hypothetical protein                      63.2    2e-09   
emb|CCI39288.1|  unnamed protein product                              63.2    2e-09   
emb|CAB88264.1|  callose synthase catalytic subunit-like protein      63.2    2e-09   
ref|XP_006602251.1|  PREDICTED: callose synthase 7-like isoform X1    63.2    2e-09   
gb|EYU17999.1|  hypothetical protein MIMGU_mgv1a000067mg              63.2    2e-09   
ref|XP_002906408.1|  callose synthase, putative                       63.2    2e-09   
ref|XP_009515447.1|  putative glycosyl transferase family 48 protein  63.2    2e-09   
gb|ETP35627.1|  hypothetical protein F442_16258                       63.2    2e-09   
gb|ETP07599.1|  hypothetical protein F441_16244                       63.2    2e-09   
ref|XP_008911544.1|  hypothetical protein PPTG_16032                  63.2    2e-09   
gb|ETM37749.1|  hypothetical protein L914_15783                       63.2    2e-09   
gb|ETK77956.1|  hypothetical protein L915_15953                       63.2    2e-09   
gb|ETI37691.1|  hypothetical protein F443_16415                       63.2    2e-09   
ref|XP_009622155.1|  PREDICTED: putative callose synthase 8 isofo...  63.2    2e-09   
emb|CCI43915.1|  unnamed protein product                              63.2    2e-09   
gb|AFW75706.1|  putative glycosyl transferase family protein          63.2    2e-09   
ref|XP_002873593.1|  hypothetical protein ARALYDRAFT_325786           63.2    2e-09   
ref|XP_008812531.1|  PREDICTED: callose synthase 3-like               63.2    2e-09   
ref|XP_010467197.1|  PREDICTED: LOW QUALITY PROTEIN: callose synt...  63.2    2e-09   
ref|XP_006846854.1|  hypothetical protein AMTR_s00150p00030620        63.2    2e-09   
ref|NP_001056983.1|  Os06g0182300                                     62.8    2e-09   
ref|XP_002874861.1|  hypothetical protein ARALYDRAFT_490214           63.2    2e-09   
gb|KHN18084.1|  Callose synthase 7                                    62.8    2e-09   
ref|XP_009401070.1|  PREDICTED: callose synthase 5-like               63.2    2e-09   
gb|KHN29244.1|  Callose synthase 5                                    63.2    2e-09   
ref|XP_006585361.1|  PREDICTED: callose synthase 5-like               63.2    2e-09   
ref|XP_010424295.1|  PREDICTED: callose synthase 5-like               63.2    2e-09   
ref|XP_008864771.1|  hypothetical protein H310_02877                  63.2    2e-09   
ref|XP_011002293.1|  PREDICTED: callose synthase 2-like               63.2    2e-09   
ref|XP_011083304.1|  PREDICTED: putative callose synthase 8           62.8    2e-09   
ref|XP_003563235.1|  PREDICTED: callose synthase 3-like               62.8    2e-09   
gb|AAM15369.1|  putative 1,3-beta-D-glucan synthase                   62.8    2e-09   
gb|AAM15250.1|  putative 1,3-beta-D-glucan synthase                   62.8    2e-09   
ref|NP_001266467.1|  callose synthase                                 62.8    3e-09   
emb|CDP11070.1|  unnamed protein product                              62.8    3e-09   
gb|KGN62159.1|  hypothetical protein Csa_2G302250                     62.8    3e-09   
ref|XP_008227660.1|  PREDICTED: LOW QUALITY PROTEIN: callose synt...  62.8    3e-09   
ref|XP_007214351.1|  hypothetical protein PRUPE_ppa000071mg           62.8    3e-09   
ref|XP_006369467.1|  hypothetical protein POPTR_0001s23710g           62.8    3e-09   
gb|ABI14557.1|  glucan synthase-like 4                                59.7    3e-09   
ref|XP_009409788.1|  PREDICTED: callose synthase 5-like               62.8    3e-09   
ref|XP_008460894.1|  PREDICTED: callose synthase 5-like               62.8    3e-09   
ref|XP_008243622.1|  PREDICTED: callose synthase 3                    62.8    3e-09   
ref|XP_007014816.1|  Glucan synthase-like 12 isoform 1                62.8    3e-09   
emb|CCA19936.1|  unnamed protein product                              62.8    3e-09   
ref|XP_009112237.1|  PREDICTED: callose synthase 5                    62.8    3e-09   
ref|XP_008338766.1|  PREDICTED: callose synthase 5-like               62.8    3e-09   
gb|KDP20970.1|  hypothetical protein JCGZ_21441                       62.8    3e-09   
ref|XP_002274337.1|  PREDICTED: callose synthase 5                    62.8    3e-09   
ref|XP_004147369.1|  PREDICTED: callose synthase 5-like               62.8    3e-09   
emb|CDX81451.1|  BnaC09g08620D                                        62.8    3e-09   
emb|CAN80181.1|  hypothetical protein VITISV_008958                   62.8    3e-09   
ref|XP_007048384.1|  Callose synthase 5                               62.8    3e-09   
emb|CBI37540.3|  unnamed protein product                              62.8    3e-09   
gb|KDP42593.1|  hypothetical protein JCGZ_24367                       62.4    3e-09   
ref|XP_006409678.1|  hypothetical protein EUTSA_v10022518mg           62.8    3e-09   
ref|XP_006467800.1|  PREDICTED: callose synthase 11-like              62.8    3e-09   
gb|ETP38518.1|  hypothetical protein F442_13880                       62.8    3e-09   
ref|XP_008801869.1|  PREDICTED: callose synthase 5-like               62.8    3e-09   
ref|XP_010060790.1|  PREDICTED: putative callose synthase 8           62.4    3e-09   
gb|ACV04900.1|  callose synthase 5                                    62.4    3e-09   
ref|XP_002883808.1|  hypothetical protein ARALYDRAFT_899601           62.4    3e-09   
gb|ETO69294.1|  hypothetical protein F444_14069                       62.4    3e-09   
ref|XP_008909502.1|  hypothetical protein PPTG_14740                  62.4    3e-09   
gb|ETI40597.1|  hypothetical protein F443_14039                       62.4    3e-09   
ref|NP_849953.2|  callose synthase 5                                  62.4    3e-09   
ref|XP_009515584.1|  hypothetical protein PHYSODRAFT_537023           62.4    3e-09   
ref|XP_002299147.2|  GLUCAN SYNTHASE-LIKE 9 family protein            62.4    4e-09   
ref|XP_008880043.1|  hypothetical protein H310_14083                  62.4    4e-09   
dbj|BAD87286.1|  putative callose synthase 1 catalytic subunit        62.4    4e-09   
ref|XP_004164294.1|  PREDICTED: callose synthase 5-like               62.4    4e-09   
ref|XP_010234098.1|  PREDICTED: putative callose synthase 8 isofo...  62.4    4e-09   
ref|XP_010234097.1|  PREDICTED: putative callose synthase 8 isofo...  62.4    4e-09   
ref|NP_001044278.1|  Os01g0754200                                     62.4    4e-09   
emb|CCI39470.1|  unnamed protein product                              62.4    4e-09   
gb|KGN62150.1|  hypothetical protein Csa_2G302170                     62.4    4e-09   
ref|XP_009364078.1|  PREDICTED: callose synthase 3 isoform X3         62.4    4e-09   
ref|XP_006844910.1|  hypothetical protein AMTR_s00058p00146190        62.4    4e-09   
gb|KCW67657.1|  hypothetical protein EUGRSUZ_F01403                   62.4    4e-09   
ref|XP_010519718.1|  PREDICTED: callose synthase 3                    62.4    4e-09   
gb|EAZ13575.1|  hypothetical protein OsJ_03491                        62.4    4e-09   
ref|XP_009121813.1|  PREDICTED: callose synthase 3-like isoform X1    62.4    4e-09   
ref|XP_011037935.1|  PREDICTED: callose synthase 3                    62.4    4e-09   
ref|XP_010530602.1|  PREDICTED: callose synthase 5                    62.4    4e-09   
dbj|BAO02523.1|  putative callose synthase                            62.4    4e-09   
gb|AAK49452.2|AF304372_1  putative beta-1,3-glucan synthase           62.4    4e-09   
gb|EPS72207.1|  hypothetical protein M569_02539                       62.0    4e-09   
emb|CBJ32439.1|  1,3-beta-glucan synthase, family GT48                62.0    4e-09   
gb|AAY90060.1|  putative 1,3-beta-glucan synthase 10                  58.9    5e-09   
gb|ETK80736.1|  hypothetical protein L915_13679                       62.0    5e-09   
ref|XP_011466916.1|  PREDICTED: callose synthase 5                    62.0    5e-09   
ref|XP_009767103.1|  PREDICTED: callose synthase 5                    62.0    5e-09   
ref|XP_009621016.1|  PREDICTED: callose synthase 5                    62.0    5e-09   
ref|XP_006645965.1|  PREDICTED: callose synthase 7-like               62.0    5e-09   
ref|XP_003569838.1|  PREDICTED: callose synthase 11-like              62.0    5e-09   
ref|XP_009121816.1|  PREDICTED: callose synthase 3-like isoform X2    62.0    5e-09   
ref|XP_001759994.1|  predicted protein                                62.0    5e-09   
gb|AET04740.2|  glucan synthase-like protein                          62.0    5e-09   
emb|CDX97217.1|  BnaC09g44080D                                        62.0    5e-09   
ref|XP_006647118.1|  PREDICTED: putative callose synthase 8-like      62.0    5e-09   
ref|XP_003630264.1|  Callose synthase                                 62.0    5e-09   
gb|EYU45040.1|  hypothetical protein MIMGU_mgv1a000068mg              62.0    5e-09   
ref|XP_008778336.1|  PREDICTED: callose synthase 5-like               62.0    5e-09   
ref|XP_002529727.1|  transferase, transferring glycosyl groups, p...  62.0    5e-09   
ref|XP_009419994.1|  PREDICTED: callose synthase 12-like              62.0    5e-09   
gb|EMT12293.1|  Putative callose synthase 8                           62.0    5e-09   
emb|CDX69678.1|  BnaA10g20270D                                        62.0    5e-09   
gb|KHG21671.1|  Callose synthase 5                                    62.0    5e-09   
gb|KHG21670.1|  Callose synthase 5                                    62.0    5e-09   
ref|XP_008775540.1|  PREDICTED: callose synthase 5-like               62.0    5e-09   
ref|XP_002906540.1|  callose synthase, putative                       62.0    6e-09   
ref|XP_007014820.1|  Glucan synthase-like 12                          62.0    6e-09   
ref|XP_008460898.1|  PREDICTED: LOW QUALITY PROTEIN: callose synt...  62.0    6e-09   
ref|XP_008619201.1|  hypothetical protein SDRG_14823                  62.0    6e-09   
gb|EEC71499.1|  hypothetical protein OsI_03775                        61.6    6e-09   
ref|XP_009515585.1|  hypothetical protein PHYSODRAFT_475612           61.6    6e-09   
ref|XP_010932705.1|  PREDICTED: callose synthase 5-like               61.6    6e-09   
ref|XP_011099745.1|  PREDICTED: callose synthase 5                    61.6    6e-09   
ref|XP_009419769.1|  PREDICTED: putative callose synthase 8 isofo...  61.6    7e-09   
ref|XP_009419770.1|  PREDICTED: putative callose synthase 8 isofo...  61.6    7e-09   
ref|XP_009419768.1|  PREDICTED: putative callose synthase 8 isofo...  61.6    7e-09   
ref|XP_009419766.1|  PREDICTED: putative callose synthase 8 isofo...  61.6    7e-09   
gb|ETP38567.1|  hypothetical protein F442_13878                       61.2    7e-09   
ref|XP_004294021.1|  PREDICTED: callose synthase 11                   61.6    7e-09   
ref|XP_007214346.1|  hypothetical protein PRUPE_ppa000112mg           61.6    7e-09   
ref|XP_007214347.1|  hypothetical protein PRUPE_ppa000112mg           61.6    7e-09   
ref|XP_002530134.1|  transferase, transferring glycosyl groups, p...  61.6    7e-09   
ref|XP_004503941.1|  PREDICTED: callose synthase 5-like               61.6    7e-09   
ref|XP_009831678.1|  hypothetical protein H257_07745                  61.6    7e-09   



>ref|XP_006354195.1| PREDICTED: callose synthase 9-like [Solanum tuberosum]
Length=1912

 Score =   134 bits (338),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 62/66 (94%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             TDT+GF+LSPE+RAQADLKFTYVVTCQIYGKQKE+QKPEAADIALLMQRNEALRVAFIDE
Sbjct  1185  TDTQGFDLSPESRAQADLKFTYVVTCQIYGKQKEEQKPEAADIALLMQRNEALRVAFIDE  1244

Query  189   VETLKD  206
             VETLKD
Sbjct  1245  VETLKD  1250



>ref|XP_009769310.1| PREDICTED: callose synthase 9 isoform X1 [Nicotiana sylvestris]
Length=1924

 Score =   134 bits (337),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 62/68 (91%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +3

Query  3     AATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
               TDT+GF LSPE+RAQADLKFTYVVTCQIYGKQKE+QKPEAADIALLMQRNEALRVAFI
Sbjct  1182  GTTDTQGFHLSPESRAQADLKFTYVVTCQIYGKQKEEQKPEAADIALLMQRNEALRVAFI  1241

Query  183   DEVETLKD  206
             DEVETLKD
Sbjct  1242  DEVETLKD  1249



>ref|XP_009608251.1| PREDICTED: callose synthase 9 [Nicotiana tomentosiformis]
Length=1910

 Score =   134 bits (337),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 62/66 (94%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             TDT+GF LSPE+RAQADLKFTYVVTCQIYGKQKE+QKPEAADIALLMQRNEALRVAFIDE
Sbjct  1184  TDTQGFHLSPESRAQADLKFTYVVTCQIYGKQKEEQKPEAADIALLMQRNEALRVAFIDE  1243

Query  189   VETLKD  206
             VETLKD
Sbjct  1244  VETLKD  1249



>ref|XP_009769311.1| PREDICTED: callose synthase 9 isoform X2 [Nicotiana sylvestris]
Length=1910

 Score =   134 bits (337),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 62/68 (91%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +3

Query  3     AATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
               TDT+GF LSPE+RAQADLKFTYVVTCQIYGKQKE+QKPEAADIALLMQRNEALRVAFI
Sbjct  1182  GTTDTQGFHLSPESRAQADLKFTYVVTCQIYGKQKEEQKPEAADIALLMQRNEALRVAFI  1241

Query  183   DEVETLKD  206
             DEVETLKD
Sbjct  1242  DEVETLKD  1249



>ref|XP_002528123.1| 1,3-beta-glucan synthase, putative [Ricinus communis]
 gb|EEF34253.1| 1,3-beta-glucan synthase, putative [Ricinus communis]
Length=1914

 Score =   134 bits (336),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 62/67 (93%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             ATDT GFELSPEARAQ DLKFTYVVTCQIYGKQKE+QKPEAADIALLMQRNEALRVAFID
Sbjct  1186  ATDTGGFELSPEARAQVDLKFTYVVTCQIYGKQKEEQKPEAADIALLMQRNEALRVAFID  1245

Query  186   EVETLKD  206
             ++ETLKD
Sbjct  1246  DIETLKD  1252



>gb|KDP44403.1| hypothetical protein JCGZ_19418 [Jatropha curcas]
Length=1904

 Score =   133 bits (334),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 63/66 (95%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             TD  GFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID+
Sbjct  1177  TDIGGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDD  1236

Query  189   VETLKD  206
             VETLKD
Sbjct  1237  VETLKD  1242



>ref|XP_007208346.1| hypothetical protein PRUPE_ppa001863mg [Prunus persica]
 gb|EMJ09545.1| hypothetical protein PRUPE_ppa001863mg [Prunus persica]
Length=753

 Score =   131 bits (330),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 62/65 (95%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  12   DTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
            DT  FELSPEARAQADLKFTYVVTCQIYGKQKE QKPEAADIALLMQRNEALRVAFIDEV
Sbjct  27   DTRAFELSPEARAQADLKFTYVVTCQIYGKQKEGQKPEAADIALLMQRNEALRVAFIDEV  86

Query  192  ETLKD  206
            ETLKD
Sbjct  87   ETLKD  91



>ref|XP_010315995.1| PREDICTED: callose synthase 9 [Solanum lycopersicum]
Length=1912

 Score =   132 bits (333),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 61/66 (92%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             TDT+GF+LSPE+RAQADLKFTYVVTCQIYGKQKE+QKPEAADIALLMQRNEALRVAFIDE
Sbjct  1185  TDTQGFDLSPESRAQADLKFTYVVTCQIYGKQKEEQKPEAADIALLMQRNEALRVAFIDE  1244

Query  189   VETLKD  206
             VETLK+
Sbjct  1245  VETLKE  1250



>gb|EYU17998.1| hypothetical protein MIMGU_mgv1a000080mg [Erythranthe guttata]
Length=1877

 Score =   132 bits (331),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 61/67 (91%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             +TD +GFELSPEARAQADLKFTYVVTCQIYGKQ+E+QKPEAADIALLMQRNEALRVAFID
Sbjct  1149  STDVQGFELSPEARAQADLKFTYVVTCQIYGKQREEQKPEAADIALLMQRNEALRVAFID  1208

Query  186   EVETLKD  206
              VETLKD
Sbjct  1209  VVETLKD  1215



>ref|XP_007142644.1| hypothetical protein PHAVU_007G004900g [Phaseolus vulgaris]
 ref|XP_007142645.1| hypothetical protein PHAVU_007G004900g [Phaseolus vulgaris]
 gb|ESW14638.1| hypothetical protein PHAVU_007G004900g [Phaseolus vulgaris]
 gb|ESW14639.1| hypothetical protein PHAVU_007G004900g [Phaseolus vulgaris]
Length=1899

 Score =   131 bits (330),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 62/66 (94%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             TDT GFELSPEARAQADLKFTYVVTCQIYGKQKE+QKPEAADIALLMQRNEALRVAFID 
Sbjct  1172  TDTHGFELSPEARAQADLKFTYVVTCQIYGKQKEEQKPEAADIALLMQRNEALRVAFIDV  1231

Query  189   VETLKD  206
             VETLK+
Sbjct  1232  VETLKE  1237



>gb|KHN27111.1| Callose synthase 9 [Glycine soja]
Length=463

 Score =   127 bits (320),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +3

Query  6    ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             T+T GFELSPEARAQADLKFTYVVTCQIYGKQKE+QKPEAADIALLMQRNEALRVAFID
Sbjct  342  VTNTHGFELSPEARAQADLKFTYVVTCQIYGKQKEEQKPEAADIALLMQRNEALRVAFID  401

Query  186  EVETLKD  206
             VETLK+
Sbjct  402  VVETLKE  408



>ref|XP_007142646.1| hypothetical protein PHAVU_007G004900g [Phaseolus vulgaris]
 gb|ESW14640.1| hypothetical protein PHAVU_007G004900g [Phaseolus vulgaris]
Length=1762

 Score =   130 bits (328),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 62/66 (94%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             TDT GFELSPEARAQADLKFTYVVTCQIYGKQKE+QKPEAADIALLMQRNEALRVAFID 
Sbjct  1172  TDTHGFELSPEARAQADLKFTYVVTCQIYGKQKEEQKPEAADIALLMQRNEALRVAFIDV  1231

Query  189   VETLKD  206
             VETLK+
Sbjct  1232  VETLKE  1237



>ref|XP_010087400.1| Callose synthase 9 [Morus notabilis]
 gb|EXB29010.1| Callose synthase 9 [Morus notabilis]
Length=1827

 Score =   130 bits (326),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 60/67 (90%), Positives = 66/67 (99%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             ATDT+GFELSP+ARAQADLKFTYVVTCQIYGKQKED+KPEAADIALLMQRNEALRVAFID
Sbjct  1099  ATDTQGFELSPQARAQADLKFTYVVTCQIYGKQKEDKKPEAADIALLMQRNEALRVAFID  1158

Query  186   EVETLKD  206
             +VE+L +
Sbjct  1159  DVESLTE  1165



>gb|KJB21395.1| hypothetical protein B456_004G018200 [Gossypium raimondii]
Length=1760

 Score =   130 bits (326),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 60/66 (91%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             TDT+G+ELSPEARA+ADLKFTYVVTCQIYG+QKE+QKPEAADIALLMQRNEALRVAFID 
Sbjct  1034  TDTQGYELSPEARARADLKFTYVVTCQIYGRQKEEQKPEAADIALLMQRNEALRVAFIDV  1093

Query  189   VETLKD  206
             VETLKD
Sbjct  1094  VETLKD  1099



>gb|KHN37283.1| Callose synthase 9 [Glycine soja]
Length=1810

 Score =   130 bits (326),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 61/66 (92%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             TDT GFELSPEARAQADLKFTYV+TCQIYGKQKE+QKPEAADIALLMQRNEALRVAFID 
Sbjct  1083  TDTHGFELSPEARAQADLKFTYVLTCQIYGKQKEEQKPEAADIALLMQRNEALRVAFIDV  1142

Query  189   VETLKD  206
             VETLK+
Sbjct  1143  VETLKE  1148



>ref|XP_003536799.1| PREDICTED: callose synthase 9-like isoformX1 [Glycine max]
 ref|XP_006589788.1| PREDICTED: callose synthase 9-like isoform X2 [Glycine max]
Length=1906

 Score =   130 bits (326),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 61/66 (92%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             TDT GFELSPEARAQADLKFTYV+TCQIYGKQKE+QKPEAADIALLMQRNEALRVAFID 
Sbjct  1179  TDTHGFELSPEARAQADLKFTYVLTCQIYGKQKEEQKPEAADIALLMQRNEALRVAFIDV  1238

Query  189   VETLKD  206
             VETLK+
Sbjct  1239  VETLKE  1244



>ref|XP_003556562.1| PREDICTED: callose synthase 9-like isoformX1 [Glycine max]
 ref|XP_006606585.1| PREDICTED: callose synthase 9-like isoform X2 [Glycine max]
Length=1905

 Score =   129 bits (325),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 61/66 (92%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             T+T GFELSPEARAQADLKFTYVVTCQIYGKQKE+QKPEAADIALLMQRNEALRVAFID 
Sbjct  1178  TNTHGFELSPEARAQADLKFTYVVTCQIYGKQKEEQKPEAADIALLMQRNEALRVAFIDV  1237

Query  189   VETLKD  206
             VETLK+
Sbjct  1238  VETLKE  1243



>ref|XP_007014805.1| Glucan synthase-like 10 isoform 1 [Theobroma cacao]
 gb|EOY32424.1| Glucan synthase-like 10 isoform 1 [Theobroma cacao]
Length=1905

 Score =   129 bits (325),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 61/66 (92%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             TDT+GFELSPEARA+ADLKFTYVVTCQIYGKQKE+QKPEAADIALLMQRNEALRVAFID 
Sbjct  1178  TDTQGFELSPEARARADLKFTYVVTCQIYGKQKEEQKPEAADIALLMQRNEALRVAFIDV  1237

Query  189   VETLKD  206
             VE LKD
Sbjct  1238  VEILKD  1243



>ref|XP_002297824.2| hypothetical protein POPTR_0001s04940g [Populus trichocarpa]
 gb|EEE82629.2| hypothetical protein POPTR_0001s04940g [Populus trichocarpa]
Length=1535

 Score =   129 bits (324),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 60/65 (92%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  12   DTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
            D +GF+LSPEARA ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV
Sbjct  809  DAKGFDLSPEARALADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  868

Query  192  ETLKD  206
            E+LKD
Sbjct  869  ESLKD  873



>ref|XP_008225069.1| PREDICTED: callose synthase 9 [Prunus mume]
Length=1905

 Score =   129 bits (324),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 61/65 (94%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  12    DTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             DT  FELSPEARAQADLKFTYV+TCQIYGKQKE QKPEAADIALLMQRNEALRVAFIDEV
Sbjct  1179  DTRAFELSPEARAQADLKFTYVLTCQIYGKQKEGQKPEAADIALLMQRNEALRVAFIDEV  1238

Query  192   ETLKD  206
             ETLKD
Sbjct  1239  ETLKD  1243



>ref|XP_011037937.1| PREDICTED: callose synthase 9 [Populus euphratica]
 ref|XP_011037938.1| PREDICTED: callose synthase 9 [Populus euphratica]
Length=1905

 Score =   129 bits (324),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 60/65 (92%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  12    DTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             D +GF+LSPEARA ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV
Sbjct  1179  DAKGFDLSPEARALADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  1238

Query  192   ETLKD  206
             E+LKD
Sbjct  1239  ESLKD  1243



>gb|AAD25952.1|AF085717_1 putative callose synthase catalytic subunit [Gossypium hirsutum]
Length=1899

 Score =   129 bits (324),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 60/66 (91%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             TDT+G+ELSPEARA+ADLKFTYVVTCQIYG+QKE+QKPEAADIALLMQRNEALRVAFID 
Sbjct  1173  TDTQGYELSPEARARADLKFTYVVTCQIYGRQKEEQKPEAADIALLMQRNEALRVAFIDV  1232

Query  189   VETLKD  206
             VETLKD
Sbjct  1233  VETLKD  1238



>gb|KJB21396.1| hypothetical protein B456_004G018200 [Gossypium raimondii]
Length=1897

 Score =   129 bits (324),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 60/66 (91%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             TDT+G+ELSPEARA+ADLKFTYVVTCQIYG+QKE+QKPEAADIALLMQRNEALRVAFID 
Sbjct  1171  TDTQGYELSPEARARADLKFTYVVTCQIYGRQKEEQKPEAADIALLMQRNEALRVAFIDV  1230

Query  189   VETLKD  206
             VETLKD
Sbjct  1231  VETLKD  1236



>gb|KJB21397.1| hypothetical protein B456_004G018200 [Gossypium raimondii]
Length=1899

 Score =   129 bits (324),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 60/66 (91%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             TDT+G+ELSPEARA+ADLKFTYVVTCQIYG+QKE+QKPEAADIALLMQRNEALRVAFID 
Sbjct  1173  TDTQGYELSPEARARADLKFTYVVTCQIYGRQKEEQKPEAADIALLMQRNEALRVAFIDV  1232

Query  189   VETLKD  206
             VETLKD
Sbjct  1233  VETLKD  1238



>ref|XP_008361463.1| PREDICTED: LOW QUALITY PROTEIN: callose synthase 9-like [Malus 
domestica]
Length=1727

 Score =   129 bits (323),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 61/67 (91%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             ATDT  FELSPEARA ADLKFTYVVTCQIYGKQKE QKPEAADIA+LMQR EALRVAFID
Sbjct  998   ATDTRAFELSPEARAHADLKFTYVVTCQIYGKQKEGQKPEAADIAMLMQRYEALRVAFID  1057

Query  186   EVETLKD  206
             EVETLKD
Sbjct  1058  EVETLKD  1064



>ref|XP_010044973.1| PREDICTED: callose synthase 9 [Eucalyptus grandis]
Length=1907

 Score =   129 bits (323),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 59/66 (89%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             TDT+GFE SP+ARA ADLKFTYVVTCQIYGKQKE+QKPEAADIALLMQRNEALRVAFIDE
Sbjct  1180  TDTQGFEFSPDARAHADLKFTYVVTCQIYGKQKEEQKPEAADIALLMQRNEALRVAFIDE  1239

Query  189   VETLKD  206
             VETL++
Sbjct  1240  VETLEN  1245



>ref|XP_003592825.1| Callose synthase [Medicago truncatula]
Length=1126

 Score =   128 bits (321),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 59/66 (89%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  9    TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
            +DT GF+LSPEARAQADLKFTYVVTCQIYGKQKE+QKPEA DIALLMQRNEALRVAFID 
Sbjct  378  SDTRGFDLSPEARAQADLKFTYVVTCQIYGKQKEEQKPEAVDIALLMQRNEALRVAFIDV  437

Query  189  VETLKD  206
            VETL+D
Sbjct  438  VETLRD  443



>ref|XP_011461841.1| PREDICTED: callose synthase 9 [Fragaria vesca subsp. vesca]
Length=1906

 Score =   128 bits (322),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 61/67 (91%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             A +T  F LSPEARAQADLKFTYVVTCQIYGKQKE QKPEAADIALLMQRNEALRVAFID
Sbjct  1177  AAETRAFALSPEARAQADLKFTYVVTCQIYGKQKEGQKPEAADIALLMQRNEALRVAFID  1236

Query  186   EVETLKD  206
             EVETLKD
Sbjct  1237  EVETLKD  1243



>gb|KDO56424.1| hypothetical protein CISIN_1g000179mg [Citrus sinensis]
Length=1597

 Score =   128 bits (322),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 61/67 (91%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +3

Query  6    ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
            A+DT+GFELS EARA ADLKFTYVVT QIYGKQKEDQKPEAADIALLMQRNEALRVAFID
Sbjct  869  ASDTQGFELSREARAHADLKFTYVVTSQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  928

Query  186  EVETLKD  206
            +VETLKD
Sbjct  929  DVETLKD  935



>gb|KDO56426.1| hypothetical protein CISIN_1g000179mg [Citrus sinensis]
Length=1212

 Score =   128 bits (321),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 61/67 (91%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +3

Query  6    ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
            A+DT+GFELS EARA ADLKFTYVVT QIYGKQKEDQKPEAADIALLMQRNEALRVAFID
Sbjct  484  ASDTQGFELSREARAHADLKFTYVVTSQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  543

Query  186  EVETLKD  206
            +VETLKD
Sbjct  544  DVETLKD  550



>emb|CDY05323.1| BnaC05g44800D, partial [Brassica napus]
Length=1202

 Score =   128 bits (321),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 59/67 (88%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +3

Query  6    ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
            ATD EGFELSPEARAQADLKFTYVVTCQIYG+QKEDQKPEAADIALLMQRNEALR+A+ID
Sbjct  472  ATDAEGFELSPEARAQADLKFTYVVTCQIYGRQKEDQKPEAADIALLMQRNEALRIAYID  531

Query  186  EVETLKD  206
             V+T K+
Sbjct  532  VVDTPKE  538



>ref|XP_006445912.1| hypothetical protein CICLE_v10014066mg [Citrus clementina]
 gb|ESR59152.1| hypothetical protein CICLE_v10014066mg [Citrus clementina]
Length=1237

 Score =   128 bits (321),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 61/67 (91%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +3

Query  6    ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
            A+DT+GFELS EARA ADLKFTYVVT QIYGKQKEDQKPEAADIALLMQRNEALRVAFID
Sbjct  509  ASDTQGFELSREARAHADLKFTYVVTSQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  568

Query  186  EVETLKD  206
            +VETLKD
Sbjct  569  DVETLKD  575



>ref|XP_009364087.1| PREDICTED: callose synthase 9 isoform X6 [Pyrus x bretschneideri]
Length=1762

 Score =   128 bits (321),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 61/67 (91%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             ATDT  FELSPEARA ADLKFTYVVTCQIYGKQKE QKPEAADIA+LMQR EALRVAFID
Sbjct  1034  ATDTRAFELSPEARAHADLKFTYVVTCQIYGKQKEGQKPEAADIAMLMQRYEALRVAFID  1093

Query  186   EVETLKD  206
             EVETLKD
Sbjct  1094  EVETLKD  1100



>gb|KDO56425.1| hypothetical protein CISIN_1g000179mg [Citrus sinensis]
Length=1270

 Score =   127 bits (320),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 61/67 (91%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +3

Query  6    ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
            A+DT+GFELS EARA ADLKFTYVVT QIYGKQKEDQKPEAADIALLMQRNEALRVAFID
Sbjct  542  ASDTQGFELSREARAHADLKFTYVVTSQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  601

Query  186  EVETLKD  206
            +VETLKD
Sbjct  602  DVETLKD  608



>ref|XP_009364084.1| PREDICTED: callose synthase 9 isoform X3 [Pyrus x bretschneideri]
Length=1903

 Score =   128 bits (321),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 61/67 (91%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             ATDT  FELSPEARA ADLKFTYVVTCQIYGKQKE QKPEAADIA+LMQR EALRVAFID
Sbjct  1175  ATDTRAFELSPEARAHADLKFTYVVTCQIYGKQKEGQKPEAADIAMLMQRYEALRVAFID  1234

Query  186   EVETLKD  206
             EVETLKD
Sbjct  1235  EVETLKD  1241



>ref|XP_009364083.1| PREDICTED: callose synthase 9 isoform X2 [Pyrus x bretschneideri]
Length=1905

 Score =   128 bits (321),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 61/67 (91%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             ATDT  FELSPEARA ADLKFTYVVTCQIYGKQKE QKPEAADIA+LMQR EALRVAFID
Sbjct  1177  ATDTRAFELSPEARAHADLKFTYVVTCQIYGKQKEGQKPEAADIAMLMQRYEALRVAFID  1236

Query  186   EVETLKD  206
             EVETLKD
Sbjct  1237  EVETLKD  1243



>emb|CDP11096.1| unnamed protein product [Coffea canephora]
Length=1916

 Score =   128 bits (321),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 60/65 (92%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  12    DTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             D +GFELSPEARAQADLKFTYVVTCQIYGKQKE++KPEAADIALLMQRNEALRVAFID V
Sbjct  1190  DIQGFELSPEARAQADLKFTYVVTCQIYGKQKEERKPEAADIALLMQRNEALRVAFIDVV  1249

Query  192   ETLKD  206
             ETLKD
Sbjct  1250  ETLKD  1254



>ref|XP_009364082.1| PREDICTED: callose synthase 9 isoform X1 [Pyrus x bretschneideri]
Length=1906

 Score =   128 bits (321),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 61/67 (91%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             ATDT  FELSPEARA ADLKFTYVVTCQIYGKQKE QKPEAADIA+LMQR EALRVAFID
Sbjct  1178  ATDTRAFELSPEARAHADLKFTYVVTCQIYGKQKEGQKPEAADIAMLMQRYEALRVAFID  1237

Query  186   EVETLKD  206
             EVETLKD
Sbjct  1238  EVETLKD  1244



>ref|XP_011083140.1| PREDICTED: callose synthase 9 [Sesamum indicum]
Length=1910

 Score =   128 bits (321),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 60/67 (90%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             +TD + FELSPEARAQADLKFTYVVTCQIYGKQKE+ KPEAADIALLMQRNEALRVAFID
Sbjct  1184  STDIQSFELSPEARAQADLKFTYVVTCQIYGKQKEEHKPEAADIALLMQRNEALRVAFID  1243

Query  186   EVETLKD  206
              VETLKD
Sbjct  1244  VVETLKD  1250



>ref|XP_006855626.1| hypothetical protein AMTR_s00044p00088780 [Amborella trichopoda]
 gb|ERN17093.1| hypothetical protein AMTR_s00044p00088780 [Amborella trichopoda]
Length=1211

 Score =   127 bits (320),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 60/67 (90%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +3

Query  6    ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
            A++T+GFELS EARAQADLKFTYVVTCQIYGKQKE  KPEA+DIALLMQRNEALRVAFID
Sbjct  483  ASNTQGFELSREARAQADLKFTYVVTCQIYGKQKEQHKPEASDIALLMQRNEALRVAFID  542

Query  186  EVETLKD  206
            EVETLKD
Sbjct  543  EVETLKD  549



>ref|XP_009364085.1| PREDICTED: callose synthase 9 isoform X4 [Pyrus x bretschneideri]
Length=1847

 Score =   127 bits (320),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 61/67 (91%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             ATDT  FELSPEARA ADLKFTYVVTCQIYGKQKE QKPEAADIA+LMQR EALRVAFID
Sbjct  1178  ATDTRAFELSPEARAHADLKFTYVVTCQIYGKQKEGQKPEAADIAMLMQRYEALRVAFID  1237

Query  186   EVETLKD  206
             EVETLKD
Sbjct  1238  EVETLKD  1244



>ref|XP_007014806.1| Glucan synthase-like 10 isoform 2 [Theobroma cacao]
 gb|EOY32425.1| Glucan synthase-like 10 isoform 2 [Theobroma cacao]
Length=1622

 Score =   127 bits (320),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 61/66 (92%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             TDT+GFELSPEARA+ADLKFTYVVTCQIYGKQKE+QKPEAADIALLMQRNEALRVAFID 
Sbjct  1178  TDTQGFELSPEARARADLKFTYVVTCQIYGKQKEEQKPEAADIALLMQRNEALRVAFIDV  1237

Query  189   VETLKD  206
             VE LKD
Sbjct  1238  VEILKD  1243



>ref|XP_009364086.1| PREDICTED: callose synthase 9 isoform X5 [Pyrus x bretschneideri]
Length=1831

 Score =   127 bits (320),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 61/67 (91%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             ATDT  FELSPEARA ADLKFTYVVTCQIYGKQKE QKPEAADIA+LMQR EALRVAFID
Sbjct  1178  ATDTRAFELSPEARAHADLKFTYVVTCQIYGKQKEGQKPEAADIAMLMQRYEALRVAFID  1237

Query  186   EVETLKD  206
             EVETLKD
Sbjct  1238  EVETLKD  1244



>gb|AES63076.2| callose synthase-like protein [Medicago truncatula]
Length=1902

 Score =   127 bits (320),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 59/66 (89%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             +DT GF+LSPEARAQADLKFTYVVTCQIYGKQKE+QKPEA DIALLMQRNEALRVAFID 
Sbjct  1175  SDTRGFDLSPEARAQADLKFTYVVTCQIYGKQKEEQKPEAVDIALLMQRNEALRVAFIDV  1234

Query  189   VETLKD  206
             VETL+D
Sbjct  1235  VETLRD  1240



>ref|XP_009147103.1| PREDICTED: callose synthase 9 [Brassica rapa]
Length=1909

 Score =   127 bits (320),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 59/67 (88%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             ATD+EGFELSPEARAQADLKFTYVVTCQIYG+QKEDQKPEAADIALLMQRNEALR+A+ID
Sbjct  1179  ATDSEGFELSPEARAQADLKFTYVVTCQIYGRQKEDQKPEAADIALLMQRNEALRIAYID  1238

Query  186   EVETLKD  206
              V+T K+
Sbjct  1239  VVDTPKE  1245



>gb|KGN66426.1| hypothetical protein Csa_1G604850 [Cucumis sativus]
Length=759

 Score =   126 bits (317),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  9    TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
            TDT GF+LSPEARAQADLKFTYVVTCQIYG+Q+E QKPEA+DIALLMQRNEALR+A+ID+
Sbjct  32   TDTRGFDLSPEARAQADLKFTYVVTCQIYGRQREQQKPEASDIALLMQRNEALRIAYIDD  91

Query  189  VETLKD  206
            +E+LKD
Sbjct  92   IESLKD  97



>emb|CDY24642.1| BnaA05g30410D [Brassica napus]
Length=1909

 Score =   127 bits (320),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 59/67 (88%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             ATD+EGFELSPEARAQADLKFTYVVTCQIYG+QKEDQKPEAADIALLMQRNEALR+A+ID
Sbjct  1179  ATDSEGFELSPEARAQADLKFTYVVTCQIYGRQKEDQKPEAADIALLMQRNEALRIAYID  1238

Query  186   EVETLKD  206
              V+T K+
Sbjct  1239  VVDTPKE  1245



>gb|KEH44542.1| callose synthase-like protein [Medicago truncatula]
Length=1897

 Score =   127 bits (320),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 59/66 (89%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             +DT GF+LSPEARAQADLKFTYVVTCQIYGKQKE+QKPEA DIALLMQRNEALRVAFID 
Sbjct  1170  SDTRGFDLSPEARAQADLKFTYVVTCQIYGKQKEEQKPEAVDIALLMQRNEALRVAFIDV  1229

Query  189   VETLKD  206
             VETL+D
Sbjct  1230  VETLRD  1235



>gb|KDO56421.1| hypothetical protein CISIN_1g000179mg [Citrus sinensis]
Length=1845

 Score =   127 bits (319),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 61/67 (91%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             A+DT+GFELS EARA ADLKFTYVVT QIYGKQKEDQKPEAADIALLMQRNEALRVAFID
Sbjct  1117  ASDTQGFELSREARAHADLKFTYVVTSQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  1176

Query  186   EVETLKD  206
             +VETLKD
Sbjct  1177  DVETLKD  1183



>gb|KDO56422.1| hypothetical protein CISIN_1g000179mg [Citrus sinensis]
Length=1864

 Score =   127 bits (319),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 61/67 (91%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             A+DT+GFELS EARA ADLKFTYVVT QIYGKQKEDQKPEAADIALLMQRNEALRVAFID
Sbjct  1176  ASDTQGFELSREARAHADLKFTYVVTSQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  1235

Query  186   EVETLKD  206
             +VETLKD
Sbjct  1236  DVETLKD  1242



>ref|XP_006492665.1| PREDICTED: callose synthase 9-like isoform X1 [Citrus sinensis]
 ref|XP_006492666.1| PREDICTED: callose synthase 9-like isoform X2 [Citrus sinensis]
 ref|XP_006492667.1| PREDICTED: callose synthase 9-like isoform X3 [Citrus sinensis]
 gb|KDO56423.1| hypothetical protein CISIN_1g000179mg [Citrus sinensis]
Length=1904

 Score =   127 bits (319),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 61/67 (91%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             A+DT+GFELS EARA ADLKFTYVVT QIYGKQKEDQKPEAADIALLMQRNEALRVAFID
Sbjct  1176  ASDTQGFELSREARAHADLKFTYVVTSQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  1235

Query  186   EVETLKD  206
             +VETLKD
Sbjct  1236  DVETLKD  1242



>ref|XP_009124472.1| PREDICTED: LOW QUALITY PROTEIN: callose synthase 9-like [Brassica 
rapa]
Length=1870

 Score =   127 bits (318),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             TD EGFELSPEARAQADLKFTYVVTCQ+YG+QKEDQKPEAADIALLMQRNEALR+A+ID 
Sbjct  1156  TDAEGFELSPEARAQADLKFTYVVTCQMYGRQKEDQKPEAADIALLMQRNEALRIAYIDV  1215

Query  189   VETLKD  206
             V+TLK+
Sbjct  1216  VDTLKE  1221



>gb|KDO56428.1| hypothetical protein CISIN_1g000179mg [Citrus sinensis]
Length=1770

 Score =   126 bits (317),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 61/67 (91%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             A+DT+GFELS EARA ADLKFTYVVT QIYGKQKEDQKPEAADIALLMQRNEALRVAFID
Sbjct  1176  ASDTQGFELSREARAHADLKFTYVVTSQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  1235

Query  186   EVETLKD  206
             +VETLKD
Sbjct  1236  DVETLKD  1242



>ref|XP_008794562.1| PREDICTED: callose synthase 9-like [Phoenix dactylifera]
Length=1539

 Score =   126 bits (317),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  9    TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
            T+T+GF+LSPEARAQADLKFTYVVTCQIYGKQKE+QKPEAADIALLMQRNEALRVA+ID 
Sbjct  876  TETQGFDLSPEARAQADLKFTYVVTCQIYGKQKEEQKPEAADIALLMQRNEALRVAYIDF  935

Query  189  VETLKD  206
            VE +KD
Sbjct  936  VENVKD  941



>gb|KDO56427.1| hypothetical protein CISIN_1g000179mg [Citrus sinensis]
Length=1780

 Score =   126 bits (317),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 61/67 (91%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             A+DT+GFELS EARA ADLKFTYVVT QIYGKQKEDQKPEAADIALLMQRNEALRVAFID
Sbjct  1176  ASDTQGFELSREARAHADLKFTYVVTSQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  1235

Query  186   EVETLKD  206
             +VETLKD
Sbjct  1236  DVETLKD  1242



>gb|KCW87113.1| hypothetical protein EUGRSUZ_B036401, partial [Eucalyptus grandis]
 gb|KCW87114.1| hypothetical protein EUGRSUZ_B036401, partial [Eucalyptus grandis]
Length=1503

 Score =   126 bits (316),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 59/66 (89%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             TDT+GFE SP+ARA ADLKFTYVVTCQIYGKQKE+QKPEAADIALLMQRNEALRVAFIDE
Sbjct  1180  TDTQGFEFSPDARAHADLKFTYVVTCQIYGKQKEEQKPEAADIALLMQRNEALRVAFIDE  1239

Query  189   VETLKD  206
             VETL++
Sbjct  1240  VETLEN  1245



>ref|XP_008451107.1| PREDICTED: callose synthase 9 [Cucumis melo]
Length=1903

 Score =   126 bits (316),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             TDT GF+LSPEARAQADLKFTYVVTCQIYG+Q+E QKPEA+DIALLMQRNEALR+A+ID+
Sbjct  1176  TDTRGFDLSPEARAQADLKFTYVVTCQIYGRQREQQKPEASDIALLMQRNEALRIAYIDD  1235

Query  189   VETLKD  206
             +E+LKD
Sbjct  1236  IESLKD  1241



>ref|XP_004149020.1| PREDICTED: callose synthase 9-like [Cucumis sativus]
Length=1905

 Score =   126 bits (316),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             TDT GF+LSPEARAQADLKFTYVVTCQIYG+Q+E QKPEA+DIALLMQRNEALR+A+ID+
Sbjct  1178  TDTRGFDLSPEARAQADLKFTYVVTCQIYGRQREQQKPEASDIALLMQRNEALRIAYIDD  1237

Query  189   VETLKD  206
             +E+LKD
Sbjct  1238  IESLKD  1243



>gb|EPS67036.1| hypothetical protein M569_07740, partial [Genlisea aurea]
Length=1505

 Score =   125 bits (315),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +3

Query  9    TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
            TD +GFELSPEAR +ADLKFTYVVTCQIYGKQKE+ KPEAADIA+LMQRNEALRVAFID 
Sbjct  779  TDVQGFELSPEARGRADLKFTYVVTCQIYGKQKEEHKPEAADIAMLMQRNEALRVAFIDV  838

Query  189  VETLKD  206
            VET+KD
Sbjct  839  VETMKD  844



>ref|XP_010257473.1| PREDICTED: callose synthase 9 [Nelumbo nucifera]
 ref|XP_010257474.1| PREDICTED: callose synthase 9 [Nelumbo nucifera]
Length=1907

 Score =   125 bits (315),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 60/67 (90%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             ATD +GFE S EARAQADLKFTYVVTCQIYGKQKE+QKPEAADIALLMQRNEALRVAFID
Sbjct  1179  ATDKQGFEFSREARAQADLKFTYVVTCQIYGKQKEEQKPEAADIALLMQRNEALRVAFID  1238

Query  186   EVETLKD  206
              VET KD
Sbjct  1239  SVETKKD  1245



>emb|CDY34913.1| BnaA01g32440D [Brassica napus]
Length=1891

 Score =   125 bits (315),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             TD EGFELSPEA+AQADLKFTYVVTCQ+YG+QKED+KPEAADIALLMQRNEALRVA+ID 
Sbjct  1189  TDAEGFELSPEAKAQADLKFTYVVTCQMYGRQKEDRKPEAADIALLMQRNEALRVAYIDV  1248

Query  189   VETLKD  206
             VETLK+
Sbjct  1249  VETLKE  1254



>ref|XP_004161577.1| PREDICTED: callose synthase 3-like [Cucumis sativus]
Length=2915

 Score =   125 bits (314),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             TDT GF+LSPEARAQADLKFTYVVTCQIYG+Q+E QKPEA+DIALLMQRNEALR+A+ID+
Sbjct  2188  TDTRGFDLSPEARAQADLKFTYVVTCQIYGRQREQQKPEASDIALLMQRNEALRIAYIDD  2247

Query  189   VETLKD  206
             +E+LKD
Sbjct  2248  IESLKD  2253


 Score = 59.3 bits (142),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  45    RAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             +A +D+KFTYVV+CQ YG QK+     A DI  LM +  +LRVA+IDEVE
Sbjct  1214  QAISDMKFTYVVSCQQYGIQKQSGDARAQDILKLMTKYPSLRVAYIDEVE  1263



>ref|XP_002884630.1| hypothetical protein ARALYDRAFT_340908 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60889.1| hypothetical protein ARALYDRAFT_340908 [Arabidopsis lyrata subsp. 
lyrata]
Length=1871

 Score =   125 bits (313),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 58/67 (87%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             ATD EGFELSPEARAQADLKFTYVVTCQIYG+QKEDQKPEA DIALLMQRNEALR+A+ID
Sbjct  1166  ATDAEGFELSPEARAQADLKFTYVVTCQIYGRQKEDQKPEAVDIALLMQRNEALRIAYID  1225

Query  186   EVETLKD  206
              V+T K+
Sbjct  1226  VVDTPKE  1232



>ref|XP_010464324.1| PREDICTED: callose synthase 9-like isoform X1 [Camelina sativa]
 ref|XP_010464326.1| PREDICTED: callose synthase 9-like isoform X3 [Camelina sativa]
Length=1900

 Score =   125 bits (313),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 58/67 (87%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             ATD EGFELSPEARAQADLKFTYVVTCQIYG+QKEDQKPEA DIALLMQRNEALR+A+ID
Sbjct  1172  ATDAEGFELSPEARAQADLKFTYVVTCQIYGRQKEDQKPEAVDIALLMQRNEALRIAYID  1231

Query  186   EVETLKD  206
              V+T K+
Sbjct  1232  VVDTPKE  1238



>ref|XP_010449316.1| PREDICTED: callose synthase 9-like [Camelina sativa]
Length=1899

 Score =   125 bits (313),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 58/67 (87%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             ATD EGFELSPEARAQADLKFTYVVTCQIYG+QKEDQKPEA DIALLMQRNEALR+A+ID
Sbjct  1171  ATDAEGFELSPEARAQADLKFTYVVTCQIYGRQKEDQKPEAVDIALLMQRNEALRIAYID  1230

Query  186   EVETLKD  206
              V+T K+
Sbjct  1231  VVDTPKE  1237



>ref|XP_010486258.1| PREDICTED: callose synthase 9 [Camelina sativa]
Length=1900

 Score =   125 bits (313),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 58/67 (87%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             ATD EGFELSPEARAQADLKFTYVVTCQIYG+QKEDQKPEA DIALLMQRNEALR+A+ID
Sbjct  1172  ATDAEGFELSPEARAQADLKFTYVVTCQIYGRQKEDQKPEAVDIALLMQRNEALRIAYID  1231

Query  186   EVETLKD  206
              V+T K+
Sbjct  1232  VVDTPKE  1238



>gb|AAF20230.1|AC012395_17 putative glucan synthase [Arabidopsis thaliana]
Length=1931

 Score =   125 bits (313),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 57/67 (85%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             ATD EGFELSPEARAQADLKFTYVVTCQIYG+QKEDQKPEA DIALLMQRNEALR+A+ID
Sbjct  1203  ATDAEGFELSPEARAQADLKFTYVVTCQIYGRQKEDQKPEAVDIALLMQRNEALRIAYID  1262

Query  186   EVETLKD  206
              V++ K+
Sbjct  1263  VVDSPKE  1269



>ref|XP_009400322.1| PREDICTED: callose synthase 9 [Musa acuminata subsp. malaccensis]
Length=1908

 Score =   124 bits (312),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 57/63 (90%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  18    EGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVET  197
             EGF LSPEARAQADLKFTYVVTCQIYGKQKE+QKPEAADIA+LMQRNEALRVA+ID VET
Sbjct  1184  EGFNLSPEARAQADLKFTYVVTCQIYGKQKEEQKPEAADIAMLMQRNEALRVAYIDTVET  1243

Query  198   LKD  206
             +KD
Sbjct  1244  VKD  1246



>ref|XP_010535891.1| PREDICTED: callose synthase 9 isoform X1 [Tarenaya hassleriana]
 ref|XP_010535892.1| PREDICTED: callose synthase 9 isoform X2 [Tarenaya hassleriana]
 ref|XP_010535893.1| PREDICTED: callose synthase 9 isoform X1 [Tarenaya hassleriana]
 ref|XP_010535894.1| PREDICTED: callose synthase 9 isoform X1 [Tarenaya hassleriana]
Length=1905

 Score =   124 bits (312),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 58/67 (87%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             A D++GFELSPEARAQADLKFTYVVTCQIYG+QKE+QKPEAADIALLMQRNEALRVA+ID
Sbjct  1177  AMDSDGFELSPEARAQADLKFTYVVTCQIYGRQKEEQKPEAADIALLMQRNEALRVAYID  1236

Query  186   EVETLKD  206
              VET K+
Sbjct  1237  VVETPKE  1243



>gb|KDO56429.1| hypothetical protein CISIN_1g000179mg [Citrus sinensis]
Length=1296

 Score =   124 bits (311),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 61/67 (91%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             A+DT+GFELS EARA ADLKFTYVVT QIYGKQKEDQKPEAADIALLMQRNEALRVAFID
Sbjct  1176  ASDTQGFELSREARAHADLKFTYVVTSQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  1235

Query  186   EVETLKD  206
             +VETLKD
Sbjct  1236  DVETLKD  1242



>ref|NP_187372.5| callose synthase 9 [Arabidopsis thaliana]
 sp|Q9SFU6.2|CALS9_ARATH RecName: Full=Callose synthase 9; AltName: Full=1,3-beta-glucan 
synthase; AltName: Full=Protein GLUCAN SYNTHASE-LIKE 10 [Arabidopsis 
thaliana]
 gb|AEE74506.1| callose synthase 9 [Arabidopsis thaliana]
Length=1890

 Score =   124 bits (311),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 57/67 (85%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             ATD EGFELSPEARAQADLKFTYVVTCQIYG+QKEDQKPEA DIALLMQRNEALR+A+ID
Sbjct  1162  ATDAEGFELSPEARAQADLKFTYVVTCQIYGRQKEDQKPEAVDIALLMQRNEALRIAYID  1221

Query  186   EVETLKD  206
              V++ K+
Sbjct  1222  VVDSPKE  1228



>ref|XP_004497387.1| PREDICTED: callose synthase 9-like isoform X2 [Cicer arietinum]
Length=1905

 Score =   124 bits (311),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             +DT  F+LSPEARAQADLKFTY+VTCQIYGKQKE+QKPEA DIALLMQRNEALRVAFID 
Sbjct  1178  SDTHSFDLSPEARAQADLKFTYLVTCQIYGKQKEEQKPEAVDIALLMQRNEALRVAFIDV  1237

Query  189   VETLKD  206
             VETL+D
Sbjct  1238  VETLRD  1243



>ref|XP_004497386.1| PREDICTED: callose synthase 9-like isoform X1 [Cicer arietinum]
Length=1901

 Score =   124 bits (311),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             +DT  F+LSPEARAQADLKFTY+VTCQIYGKQKE+QKPEA DIALLMQRNEALRVAFID 
Sbjct  1174  SDTHSFDLSPEARAQADLKFTYLVTCQIYGKQKEEQKPEAVDIALLMQRNEALRVAFIDV  1233

Query  189   VETLKD  206
             VETL+D
Sbjct  1234  VETLRD  1239



>emb|CAD23545.1| putative callose synthase [Vitis vinifera]
Length=282

 Score =   118 bits (295),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 56/67 (84%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +3

Query  6    ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
            ATDT+G+E SP ARA ADLKFTYVVTCQIYG Q+E+QKPEA DIALLMQRNEALRVA+ID
Sbjct  34   ATDTQGYEFSPAARALADLKFTYVVTCQIYGIQREEQKPEAVDIALLMQRNEALRVAYID  93

Query  186  EVETLKD  206
             VETLKD
Sbjct  94   SVETLKD  100



>ref|XP_010464325.1| PREDICTED: callose synthase 9-like isoform X2 [Camelina sativa]
Length=1900

 Score =   123 bits (308),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 57/67 (85%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             ATD EGFE SPEARAQADLKFTYVVTCQIYG+QKEDQKPEA DIALLMQRNEALR+A+ID
Sbjct  1172  ATDAEGFEXSPEARAQADLKFTYVVTCQIYGRQKEDQKPEAVDIALLMQRNEALRIAYID  1231

Query  186   EVETLKD  206
              V+T K+
Sbjct  1232  VVDTPKE  1238



>emb|CDY08011.1| BnaC03g35120D [Brassica napus]
Length=1901

 Score =   123 bits (308),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             TD EGFELSPEARAQADLKFTYVVTCQIYG+QKED+KPEA DIALLMQRNEALR+A+ID 
Sbjct  1174  TDAEGFELSPEARAQADLKFTYVVTCQIYGRQKEDKKPEAVDIALLMQRNEALRIAYIDV  1233

Query  189   VETLKD  206
             V+T K+
Sbjct  1234  VDTPKE  1239



>emb|CDX74058.1| BnaA03g29890D [Brassica napus]
Length=1954

 Score =   123 bits (308),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             TD EGFELSPEARAQADLKFTYVVTCQIYG+QKED+KPEA DIALLMQRNEALR+A+ID 
Sbjct  1227  TDAEGFELSPEARAQADLKFTYVVTCQIYGRQKEDKKPEAVDIALLMQRNEALRIAYIDV  1286

Query  189   VETLKD  206
             V+T K+
Sbjct  1287  VDTPKE  1292



>ref|XP_010909209.1| PREDICTED: callose synthase 9 [Elaeis guineensis]
Length=1908

 Score =   122 bits (307),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             T+T+GF LSPEARAQADLKFTYVVTCQIYG+QKE++KPEAADIALLMQRNEALRVA+ID 
Sbjct  1181  TETQGFHLSPEARAQADLKFTYVVTCQIYGRQKEERKPEAADIALLMQRNEALRVAYIDF  1240

Query  189   VETLKD  206
             VE +KD
Sbjct  1241  VENVKD  1246



>ref|XP_009134953.1| PREDICTED: callose synthase 9-like [Brassica rapa]
Length=1907

 Score =   122 bits (307),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             TD EGFELSP+ARAQADLKFTYVVTCQIYG+QKED+KPEA DIALLMQRNEALR+A+ID 
Sbjct  1180  TDAEGFELSPKARAQADLKFTYVVTCQIYGRQKEDKKPEAVDIALLMQRNEALRIAYIDV  1239

Query  189   VETLKD  206
             V+T KD
Sbjct  1240  VDTPKD  1245



>ref|XP_010673534.1| PREDICTED: callose synthase 9 [Beta vulgaris subsp. vulgaris]
Length=1904

 Score =   122 bits (306),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 56/65 (86%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  12    DTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             + +GFELSPEARAQADLKFTYVVTCQIYGKQKE+ KPEAADI+LLMQRNEALRVAFID V
Sbjct  1178  NVQGFELSPEARAQADLKFTYVVTCQIYGKQKEEGKPEAADISLLMQRNEALRVAFIDVV  1237

Query  192   ETLKD  206
             ET++D
Sbjct  1238  ETMRD  1242



>emb|CBI16463.3| unnamed protein product [Vitis vinifera]
Length=1132

 Score =   121 bits (303),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 56/67 (84%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +3

Query  6    ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
            ATDT+G+E SP ARA ADLKFTYVVTCQIYG Q+E+QKPEA DIALLMQRNEALRVA+ID
Sbjct  405  ATDTQGYEFSPAARALADLKFTYVVTCQIYGIQREEQKPEAVDIALLMQRNEALRVAYID  464

Query  186  EVETLKD  206
             VETLKD
Sbjct  465  SVETLKD  471



>ref|XP_006407863.1| hypothetical protein EUTSA_v10019878mg [Eutrema salsugineum]
 gb|ESQ49316.1| hypothetical protein EUTSA_v10019878mg [Eutrema salsugineum]
Length=1904

 Score =   121 bits (304),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +3

Query  12    DTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             D EGFELSPEARAQADLKFTYVVTCQIYG+QKEDQKPEA DIALLMQRNEALR+A+ID V
Sbjct  1178  DAEGFELSPEARAQADLKFTYVVTCQIYGRQKEDQKPEAVDIALLMQRNEALRIAYIDIV  1237

Query  192   ETLKD  206
             +T K+
Sbjct  1238  DTPKE  1242



>ref|XP_010651329.1| PREDICTED: callose synthase 9 isoform X1 [Vitis vinifera]
 ref|XP_010651330.1| PREDICTED: callose synthase 9 isoform X1 [Vitis vinifera]
 ref|XP_010651331.1| PREDICTED: callose synthase 9 isoform X1 [Vitis vinifera]
 ref|XP_010651332.1| PREDICTED: callose synthase 9 isoform X1 [Vitis vinifera]
Length=1914

 Score =   121 bits (303),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 56/67 (84%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             ATDT+G+E SP ARA ADLKFTYVVTCQIYG Q+E+QKPEA DIALLMQRNEALRVA+ID
Sbjct  1187  ATDTQGYEFSPAARALADLKFTYVVTCQIYGIQREEQKPEAVDIALLMQRNEALRVAYID  1246

Query  186   EVETLKD  206
              VETLKD
Sbjct  1247  SVETLKD  1253



>ref|XP_010651333.1| PREDICTED: callose synthase 9 isoform X2 [Vitis vinifera]
Length=1723

 Score =   120 bits (300),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 56/67 (84%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             ATDT+G+E SP ARA ADLKFTYVVTCQIYG Q+E+QKPEA DIALLMQRNEALRVA+ID
Sbjct  1187  ATDTQGYEFSPAARALADLKFTYVVTCQIYGIQREEQKPEAVDIALLMQRNEALRVAYID  1246

Query  186   EVETLKD  206
              VETLKD
Sbjct  1247  SVETLKD  1253



>ref|XP_004985950.1| PREDICTED: callose synthase 9-like [Setaria italica]
Length=1906

 Score =   117 bits (292),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 56/68 (82%), Positives = 62/68 (91%), Gaps = 1/68 (1%)
 Frame = +3

Query  3     AATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
              + DT  FELSPEARAQADLKFTYVVTCQIYGKQK + KPEAADIALLMQRNEALRVA+I
Sbjct  1178  GSADTH-FELSPEARAQADLKFTYVVTCQIYGKQKGEGKPEAADIALLMQRNEALRVAYI  1236

Query  183   DEVETLKD  206
             DEVE++K+
Sbjct  1237  DEVESVKN  1244



>gb|EEC74403.1| hypothetical protein OsI_09759 [Oryza sativa Indica Group]
Length=1598

 Score =   110 bits (275),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 51/61 (84%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   FELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLK  203
            FELSPEARAQADLKFTYVVTCQIYG QK ++KPEAADIALLMQRNEALRVA++D VE++K
Sbjct  876  FELSPEARAQADLKFTYVVTCQIYGVQKAERKPEAADIALLMQRNEALRVAYVDIVESVK  935

Query  204  D  206
            +
Sbjct  936  N  936



>gb|EEE58225.1| hypothetical protein OsJ_09196 [Oryza sativa Japonica Group]
Length=1623

 Score =   109 bits (273),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 51/61 (84%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   FELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLK  203
            FELSPEARAQADLKFTYVVTCQIYG QK ++KPEAADIALLMQRNEALRVA++D VE++K
Sbjct  901  FELSPEARAQADLKFTYVVTCQIYGVQKAERKPEAADIALLMQRNEALRVAYVDIVESVK  960

Query  204  D  206
            +
Sbjct  961  N  961



>gb|AAO15292.1| Putative callose synthase [Oryza sativa Japonica Group]
Length=2055

 Score =   109 bits (273),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 51/61 (84%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   FELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLK  203
            FELSPEARAQADLKFTYVVTCQIYG QK ++KPEAADIALLMQRNEALRVA++D VE++K
Sbjct  898  FELSPEARAQADLKFTYVVTCQIYGVQKAERKPEAADIALLMQRNEALRVAYVDIVESVK  957

Query  204  D  206
            +
Sbjct  958  N  958



>gb|EEE64970.1| hypothetical protein OsJ_19875 [Oryza sativa Japonica Group]
Length=1820

 Score =   108 bits (271),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 49/65 (75%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +3

Query  12    DTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             DT+G+E+SP+ARAQADLKFTYVV+CQIYG+QK+ + PEAADIALLMQRNEALRVAFI E 
Sbjct  1097  DTQGYEVSPDARAQADLKFTYVVSCQIYGQQKQRKAPEAADIALLMQRNEALRVAFIHEE  1156

Query  192   ETLKD  206
             +   D
Sbjct  1157  DVSSD  1161



>gb|AAO46087.1| putative callose synthase [Hordeum vulgare subsp. vulgare]
Length=1915

 Score =   108 bits (270),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 50/61 (82%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +3

Query  24    FELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLK  203
             FE SPEARAQADLKFTYVVTCQIYG QK + KPEAADIALLMQRNEALR+A+ID VE++K
Sbjct  1182  FEYSPEARAQADLKFTYVVTCQIYGVQKGEGKPEAADIALLMQRNEALRIAYIDVVESIK  1241

Query  204   D  206
             +
Sbjct  1242  N  1242



>gb|EEC79862.1| hypothetical protein OsI_21355 [Oryza sativa Indica Group]
Length=1947

 Score =   108 bits (270),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 49/65 (75%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +3

Query  12    DTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             DT+G+E+SP+ARAQADLKFTYVV+CQIYG+QK+ + PEAADIALLMQRNEALRVAFI E 
Sbjct  1224  DTQGYEVSPDARAQADLKFTYVVSCQIYGQQKQRKAPEAADIALLMQRNEALRVAFIHEE  1283

Query  192   ETLKD  206
             +   D
Sbjct  1284  DVSSD  1288



>gb|EMS56501.1| Callose synthase 9 [Triticum urartu]
Length=1944

 Score =   108 bits (269),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 50/61 (82%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +3

Query  24    FELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLK  203
             FE SPEARAQADLKFTYVVTCQIYG QK + KPEAADIALLMQRNEALR+A+ID VE++K
Sbjct  1173  FEYSPEARAQADLKFTYVVTCQIYGVQKGEGKPEAADIALLMQRNEALRIAYIDVVESVK  1232

Query  204   D  206
             +
Sbjct  1233  N  1233



>gb|EMT21982.1| Callose synthase 9 [Aegilops tauschii]
Length=2474

 Score =   108 bits (269),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 50/61 (82%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +3

Query  24    FELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLK  203
             FE SPEARAQADLKFTYVVTCQIYG QK + KPEAADIALLMQRNEALR+A+ID VE++K
Sbjct  1492  FEYSPEARAQADLKFTYVVTCQIYGVQKGEGKPEAADIALLMQRNEALRIAYIDVVESVK  1551

Query  204   D  206
             +
Sbjct  1552  N  1552


 Score = 61.6 bits (148),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 29/48 (60%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +3

Query  66    FTYVVTCQIYGKQKEDQ-KPEAADIALLMQRNEALRVAFIDEVETLKD  206
             ++ +V   I+GK K+ + KPEAADIALLMQRNEALR+A+ID VE++K+
Sbjct  1560  YSKLVKADIHGKDKKGEGKPEAADIALLMQRNEALRIAYIDVVESVKN  1607



>dbj|BAD67750.1| putative beta 1,3 glucan synthase [Oryza sativa Japonica Group]
Length=1771

 Score =   108 bits (269),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 49/65 (75%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +3

Query  12    DTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             DT+G+E+SP+ARAQADLKFTYVV+CQIYG+QK+ + PEAADIALLMQRNEALRVAFI E 
Sbjct  1048  DTQGYEVSPDARAQADLKFTYVVSCQIYGQQKQRKAPEAADIALLMQRNEALRVAFIHEE  1107

Query  192   ETLKD  206
             +   D
Sbjct  1108  DVSSD  1112



>ref|XP_006649287.1| PREDICTED: callose synthase 9-like [Oryza brachyantha]
Length=1906

 Score =   108 bits (269),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 50/61 (82%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +3

Query  24    FELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLK  203
             FELSPEARAQADLKFTYVVTCQIYG QK ++K EAADIALLMQRNEALRVA++D VE++K
Sbjct  1184  FELSPEARAQADLKFTYVVTCQIYGLQKAERKAEAADIALLMQRNEALRVAYVDIVESVK  1243

Query  204   D  206
             +
Sbjct  1244  N  1244



>ref|XP_010228114.1| PREDICTED: callose synthase 10 [Brachypodium distachyon]
Length=1924

 Score =   107 bits (267),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 48/63 (76%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +3

Query  12    DTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             DT+G+ELSP+ARAQADLKFTYVV+CQIYG+QK+ + PEAADIALL+QRNEALRVAFI E 
Sbjct  1198  DTQGYELSPDARAQADLKFTYVVSCQIYGQQKQRKAPEAADIALLLQRNEALRVAFIHEE  1257

Query  192   ETL  200
             +++
Sbjct  1258  DSV  1260



>ref|XP_003558953.1| PREDICTED: callose synthase 9 [Brachypodium distachyon]
Length=1904

 Score =   105 bits (263),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 49/61 (80%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  24    FELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLK  203
             FE SPEARA ADLKFTYVVTCQIYG QK + KPEAADIALLMQRNEALR+A+ID VE++K
Sbjct  1182  FEYSPEARAHADLKFTYVVTCQIYGIQKGEGKPEAADIALLMQRNEALRIAYIDVVESVK  1241

Query  204   D  206
             +
Sbjct  1242  N  1242



>gb|EMS54246.1| Callose synthase 10 [Triticum urartu]
Length=1734

 Score =   105 bits (263),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 47/59 (80%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +3

Query  12    DTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             DT+G++LSP+ARAQADLKFTYVV+CQIYG+QK+ + PEAADIALL+QRNEALRVAFI E
Sbjct  1008  DTQGYQLSPDARAQADLKFTYVVSCQIYGQQKQRKAPEAADIALLLQRNEALRVAFIHE  1066



>ref|XP_006655702.1| PREDICTED: callose synthase 10-like [Oryza brachyantha]
Length=1905

 Score =   105 bits (263),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 48/59 (81%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +3

Query  12    DTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             DTEG+E  P+ARAQADLKFTYVV+CQIYG+QK+ + PEAADIALLMQRNEALRVAFI E
Sbjct  1184  DTEGYERHPDARAQADLKFTYVVSCQIYGQQKQRKAPEAADIALLMQRNEALRVAFIHE  1242



>gb|KJB19540.1| hypothetical protein B456_003G109000 [Gossypium raimondii]
Length=1353

 Score =   105 bits (262),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  15   TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
            TEGFELS EARAQAD+KFTYVV+CQIYG+QK+++KPEA DIALL+QRNEALRVAFI   E
Sbjct  630  TEGFELSREARAQADIKFTYVVSCQIYGQQKQNKKPEAVDIALLLQRNEALRVAFIHAEE  689

Query  195  TLKD  206
               D
Sbjct  690  VGAD  693



>gb|KJB19539.1| hypothetical protein B456_003G109000 [Gossypium raimondii]
Length=1898

 Score =   105 bits (262),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             TEGFELS EARAQAD+KFTYVV+CQIYG+QK+++KPEA DIALL+QRNEALRVAFI   E
Sbjct  1175  TEGFELSREARAQADIKFTYVVSCQIYGQQKQNKKPEAVDIALLLQRNEALRVAFIHAEE  1234

Query  195   TLKD  206
                D
Sbjct  1235  VGAD  1238



>ref|XP_004983400.1| PREDICTED: callose synthase 10-like isoform X1 [Setaria italica]
Length=1936

 Score =   105 bits (262),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 47/65 (72%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +3

Query  12    DTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             DT+G+ELSP+ARAQAD+KFTYVV+CQIYG+QK+ +K EAADIALL+QRNEALRVAFI E 
Sbjct  1181  DTQGYELSPDARAQADIKFTYVVSCQIYGQQKQMKKQEAADIALLLQRNEALRVAFIHEE  1240

Query  192   ETLKD  206
             +++ +
Sbjct  1241  DSVSN  1245



>ref|XP_004983401.1| PREDICTED: callose synthase 10-like isoform X2 [Setaria italica]
Length=1908

 Score =   105 bits (261),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 47/65 (72%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +3

Query  12    DTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             DT+G+ELSP+ARAQAD+KFTYVV+CQIYG+QK+ +K EAADIALL+QRNEALRVAFI E 
Sbjct  1181  DTQGYELSPDARAQADIKFTYVVSCQIYGQQKQMKKQEAADIALLLQRNEALRVAFIHEE  1240

Query  192   ETLKD  206
             +++ +
Sbjct  1241  DSVSN  1245



>gb|KJB19541.1| hypothetical protein B456_003G109000 [Gossypium raimondii]
Length=1774

 Score =   105 bits (261),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             TEGFELS EARAQAD+KFTYVV+CQIYG+QK+++KPEA DIALL+QRNEALRVAFI   E
Sbjct  1175  TEGFELSREARAQADIKFTYVVSCQIYGQQKQNKKPEAVDIALLLQRNEALRVAFIHAEE  1234

Query  195   TLKD  206
                D
Sbjct  1235  VGAD  1238



>tpg|DAA46675.1| TPA: putative glycosyl transferase family protein [Zea mays]
Length=1924

 Score =   104 bits (260),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 48/63 (76%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  12    DTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             DT+G+ELSP+ARAQAD+KFTYVV+CQIYG QK+ +K EAADIALL+QRNEALRVAFI E 
Sbjct  1194  DTQGYELSPDARAQADIKFTYVVSCQIYGLQKQTKKQEAADIALLLQRNEALRVAFIHEE  1253

Query  192   ETL  200
             E +
Sbjct  1254  EII  1256



>tpg|DAA46673.1| TPA: putative glycosyl transferase family protein [Zea mays]
Length=1916

 Score =   104 bits (260),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 48/63 (76%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  12    DTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             DT+G+ELSP+ARAQAD+KFTYVV+CQIYG QK+ +K EAADIALL+QRNEALRVAFI E 
Sbjct  1186  DTQGYELSPDARAQADIKFTYVVSCQIYGLQKQTKKQEAADIALLLQRNEALRVAFIHEE  1245

Query  192   ETL  200
             E +
Sbjct  1246  EII  1248



>tpg|DAA46676.1| TPA: putative glycosyl transferase family protein, partial [Zea 
mays]
Length=1868

 Score =   104 bits (260),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 48/63 (76%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  12    DTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             DT+G+ELSP+ARAQAD+KFTYVV+CQIYG QK+ +K EAADIALL+QRNEALRVAFI E 
Sbjct  1194  DTQGYELSPDARAQADIKFTYVVSCQIYGLQKQTKKQEAADIALLLQRNEALRVAFIHEE  1253

Query  192   ETL  200
             E +
Sbjct  1254  EII  1256



>gb|KJB19542.1| hypothetical protein B456_003G109000 [Gossypium raimondii]
Length=1748

 Score =   104 bits (260),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             TEGFELS EARAQAD+KFTYVV+CQIYG+QK+++KPEA DIALL+QRNEALRVAFI   E
Sbjct  1175  TEGFELSREARAQADIKFTYVVSCQIYGQQKQNKKPEAVDIALLLQRNEALRVAFIHAEE  1234

Query  195   TLKD  206
                D
Sbjct  1235  VGAD  1238



>gb|AAQ17229.1| beta 1,3 glucan synthase [Lolium multiflorum]
Length=1906

 Score =   104 bits (260),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 49/61 (80%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  24    FELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLK  203
             FE SPEARAQADLKFTYVVTCQIYG QK + K EAADIALLMQRNEALR+A+ID VE++K
Sbjct  1184  FEYSPEARAQADLKFTYVVTCQIYGLQKGEGKQEAADIALLMQRNEALRIAYIDVVESIK  1243

Query  204   D  206
             +
Sbjct  1244  N  1244



>gb|KJB19543.1| hypothetical protein B456_003G109000 [Gossypium raimondii]
Length=1709

 Score =   104 bits (260),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             TEGFELS EARAQAD+KFTYVV+CQIYG+QK+++KPEA DIALL+QRNEALRVAFI   E
Sbjct  1175  TEGFELSREARAQADIKFTYVVSCQIYGQQKQNKKPEAVDIALLLQRNEALRVAFIHAEE  1234

Query  195   TLKD  206
                D
Sbjct  1235  VGAD  1238



>tpg|DAA46674.1| TPA: putative glycosyl transferase family protein [Zea mays]
Length=1844

 Score =   104 bits (260),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 48/63 (76%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  12    DTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             DT+G+ELSP+ARAQAD+KFTYVV+CQIYG QK+ +K EAADIALL+QRNEALRVAFI E 
Sbjct  1194  DTQGYELSPDARAQADIKFTYVVSCQIYGLQKQTKKQEAADIALLLQRNEALRVAFIHEE  1253

Query  192   ETL  200
             E +
Sbjct  1254  EII  1256



>ref|XP_008788670.1| PREDICTED: callose synthase 10 [Phoenix dactylifera]
Length=1904

 Score =   104 bits (260),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/57 (82%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  12    DTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
             +T+GFELS E+RAQADLKFTYVV+CQIYG+QK+ + PEAADIALLMQRNEALRVAFI
Sbjct  1178  NTQGFELSSESRAQADLKFTYVVSCQIYGQQKQKKAPEAADIALLMQRNEALRVAFI  1234



>gb|EMT01086.1| Callose synthase 9 [Aegilops tauschii]
Length=1293

 Score =   104 bits (259),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 49/61 (80%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   FELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLK  203
            FE SPEARAQADLKFTYVVTCQIYG QK + KPEAADIALLMQRNEALR+A+ID  E++K
Sbjct  876  FEYSPEARAQADLKFTYVVTCQIYGVQKGEGKPEAADIALLMQRNEALRIAYIDVFESVK  935

Query  204  D  206
            +
Sbjct  936  N  936



>ref|XP_007037861.1| Glucan synthase-like 8 isoform 1 [Theobroma cacao]
 gb|EOY22362.1| Glucan synthase-like 8 isoform 1 [Theobroma cacao]
Length=1900

 Score =   103 bits (257),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/61 (77%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  18    EGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVET  197
             EGFELSPEARAQAD+KFTYVV+CQIYG+QK+++K EA DIALL+QRNEALRVAFI   E 
Sbjct  1177  EGFELSPEARAQADIKFTYVVSCQIYGQQKQNKKAEAVDIALLLQRNEALRVAFIHAEEN  1236

Query  198   L  200
             +
Sbjct  1237  V  1237



>ref|XP_007037862.1| Glucan synthase-like 8 isoform 2 [Theobroma cacao]
 gb|EOY22363.1| Glucan synthase-like 8 isoform 2 [Theobroma cacao]
Length=1901

 Score =   103 bits (257),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/61 (77%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  18    EGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVET  197
             EGFELSPEARAQAD+KFTYVV+CQIYG+QK+++K EA DIALL+QRNEALRVAFI   E 
Sbjct  1177  EGFELSPEARAQADIKFTYVVSCQIYGQQKQNKKAEAVDIALLLQRNEALRVAFIHAEEN  1236

Query  198   L  200
             +
Sbjct  1237  V  1237



>ref|XP_010935011.1| PREDICTED: callose synthase 10 [Elaeis guineensis]
Length=1904

 Score =   103 bits (257),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  12    DTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
             +T+GFE+S E+RAQADLKFTYVV+CQIYG+QK+ + PEAADIALLMQRNEALRVAFI
Sbjct  1178  NTQGFEMSSESRAQADLKFTYVVSCQIYGQQKQRKAPEAADIALLMQRNEALRVAFI  1234



>gb|KJB19544.1| hypothetical protein B456_003G109000 [Gossypium raimondii]
Length=1405

 Score =   103 bits (256),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             TEGFELS EARAQAD+KFTYVV+CQIYG+QK+++KPEA DIALL+QRNEALRVAFI   E
Sbjct  1175  TEGFELSREARAQADIKFTYVVSCQIYGQQKQNKKPEAVDIALLLQRNEALRVAFIHAEE  1234

Query  195   TLKD  206
                D
Sbjct  1235  VGAD  1238



>ref|XP_007037863.1| Glucan synthase-like 8 isoform 3 [Theobroma cacao]
 gb|EOY22364.1| Glucan synthase-like 8 isoform 3 [Theobroma cacao]
Length=1860

 Score =   103 bits (256),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 47/61 (77%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  18    EGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVET  197
             EGFELSPEARAQAD+KFTYVV+CQIYG+QK+++K EA DIALL+QRNEALRVAFI   E 
Sbjct  1177  EGFELSPEARAQADIKFTYVVSCQIYGQQKQNKKAEAVDIALLLQRNEALRVAFIHAEEN  1236

Query  198   L  200
             +
Sbjct  1237  V  1237



>gb|EPS70833.1| hypothetical protein M569_03926, partial [Genlisea aurea]
Length=495

 Score =   100 bits (249),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 46/60 (77%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  18   EGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVET  197
            +GFELSP+ARAQADLKFTYVV+CQIYG+QK+ + PEAADIALL+QRNEALRVA+I   E+
Sbjct  82   QGFELSPQARAQADLKFTYVVSCQIYGQQKQRKAPEAADIALLLQRNEALRVAYIHVEES  141



>ref|XP_011072986.1| PREDICTED: callose synthase 10 [Sesamum indicum]
Length=1904

 Score =   101 bits (252),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 47/61 (77%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             T+GFELS EARAQAD+KFTYVV+CQIYG+QK+ + PEAADIALL+QRNEALRVAFI   E
Sbjct  1175  TQGFELSREARAQADIKFTYVVSCQIYGQQKQRKAPEAADIALLLQRNEALRVAFIHVEE  1234

Query  195   T  197
             +
Sbjct  1235  S  1235



>ref|XP_006837416.1| hypothetical protein AMTR_s00111p00150590 [Amborella trichopoda]
 gb|ERN00270.1| hypothetical protein AMTR_s00111p00150590 [Amborella trichopoda]
Length=1964

 Score =   101 bits (252),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +3

Query  24    FELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVET  197
             FELSPE+RAQADLKFTYVV+CQIYG+QK+ + PEAADIALL+QRNEALRVAFI   E+
Sbjct  1245  FELSPESRAQADLKFTYVVSCQIYGQQKQKRAPEAADIALLLQRNEALRVAFIHTEES  1302



>gb|EYU40120.1| hypothetical protein MIMGU_mgv1a000075mg [Erythranthe guttata]
Length=1895

 Score =   101 bits (251),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/61 (77%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             T+GFELS EARAQAD+KFTYVV+CQIYG+QK+ + PEAADIALL+QRNEALRVAFI   E
Sbjct  1166  TQGFELSREARAQADIKFTYVVSCQIYGQQKQRKAPEAADIALLLQRNEALRVAFIHVEE  1225

Query  195   T  197
             +
Sbjct  1226  S  1226



>ref|XP_009384671.1| PREDICTED: callose synthase 10 isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=1913

 Score =   100 bits (250),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
             T+G+ELSPE+RAQADLKFTYVV+CQIYG+QK+    EAADIALLMQRNEALRVAFI
Sbjct  1188  TQGYELSPESRAQADLKFTYVVSCQIYGQQKQKGAQEAADIALLMQRNEALRVAFI  1243



>ref|XP_009384664.1| PREDICTED: callose synthase 10 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=1914

 Score =   100 bits (250),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
             T+G+ELSPE+RAQADLKFTYVV+CQIYG+QK+    EAADIALLMQRNEALRVAFI
Sbjct  1189  TQGYELSPESRAQADLKFTYVVSCQIYGQQKQKGAQEAADIALLMQRNEALRVAFI  1244



>gb|KFK36562.1| hypothetical protein AALP_AA4G139500 [Arabis alpina]
Length=1897

 Score =   100 bits (249),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/62 (74%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +3

Query  21    GFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETL  200
             GFELSPEARAQADLKFTYV++CQIYG+QK+ +KPEA DIALL+QR EALRVAFI   +  
Sbjct  1176  GFELSPEARAQADLKFTYVISCQIYGQQKQQKKPEATDIALLLQRYEALRVAFIHSEDVG  1235

Query  201   KD  206
             K+
Sbjct  1236  KE  1237



>ref|XP_010101941.1| Callose synthase 10 [Morus notabilis]
 gb|EXB90589.1| Callose synthase 10 [Morus notabilis]
Length=2059

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 45/61 (74%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             ++GFELS E+RAQAD+KFTYVV+CQIYG+QK+ + PEAADI+LL+QRNEALRVAFI E E
Sbjct  1333  SQGFELSRESRAQADIKFTYVVSCQIYGQQKQRKVPEAADISLLLQRNEALRVAFIHEEE  1392

Query  195   T  197
             +
Sbjct  1393  S  1393



>gb|KDO69366.1| hypothetical protein CISIN_1g0001801mg, partial [Citrus sinensis]
Length=980

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  15   TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
            T+GF LS EARAQ+DLKFTYVV+CQIYG+QK+ + PEAADIALL+QRNEALRVAFI
Sbjct  387  TQGFALSHEARAQSDLKFTYVVSCQIYGQQKQRKAPEAADIALLLQRNEALRVAFI  442



>gb|KDO69364.1| hypothetical protein CISIN_1g0001801mg, partial [Citrus sinensis]
 gb|KDO69365.1| hypothetical protein CISIN_1g0001801mg, partial [Citrus sinensis]
Length=1113

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  15   TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
            T+GF LS EARAQ+DLKFTYVV+CQIYG+QK+ + PEAADIALL+QRNEALRVAFI
Sbjct  387  TQGFALSHEARAQSDLKFTYVVSCQIYGQQKQRKAPEAADIALLLQRNEALRVAFI  442



>ref|XP_006440015.1| hypothetical protein CICLE_v100184562mg, partial [Citrus clementina]
 gb|ESR53255.1| hypothetical protein CICLE_v100184562mg, partial [Citrus clementina]
Length=1456

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  15   TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
            T+GF LS EARAQ+DLKFTYVV+CQIYG+QK+ + PEAADIALL+QRNEALRVAFI
Sbjct  730  TQGFALSHEARAQSDLKFTYVVSCQIYGQQKQRKAPEAADIALLLQRNEALRVAFI  785



>ref|XP_006440014.1| hypothetical protein CICLE_v100184562mg, partial [Citrus clementina]
 gb|ESR53254.1| hypothetical protein CICLE_v100184562mg, partial [Citrus clementina]
Length=1458

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  15   TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
            T+GF LS EARAQ+DLKFTYVV+CQIYG+QK+ + PEAADIALL+QRNEALRVAFI
Sbjct  749  TQGFALSHEARAQSDLKFTYVVSCQIYGQQKQRKAPEAADIALLLQRNEALRVAFI  804



>ref|XP_010545980.1| PREDICTED: callose synthase 10 isoform X1 [Tarenaya hassleriana]
Length=1895

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  21    GFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
             GFELS EARAQADLKFTYVV+CQIYG+QK+ + PEAADIALL+QRNEALRVAFI
Sbjct  1173  GFELSLEARAQADLKFTYVVSCQIYGQQKQRKTPEAADIALLLQRNEALRVAFI  1226



>ref|XP_010545981.1| PREDICTED: callose synthase 10 isoform X2 [Tarenaya hassleriana]
Length=1888

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  21    GFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
             GFELS EARAQADLKFTYVV+CQIYG+QK+ + PEAADIALL+QRNEALRVAFI
Sbjct  1166  GFELSLEARAQADLKFTYVVSCQIYGQQKQRKTPEAADIALLLQRNEALRVAFI  1219



>emb|CDY33198.1| BnaC04g08410D [Brassica napus]
Length=1892

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  21    GFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
             GFE SPEARAQADLKFTYVV+CQIYG+QK+ +KPEA DIALL+QR EALRVAFI
Sbjct  1171  GFEASPEARAQADLKFTYVVSCQIYGQQKQQKKPEATDIALLLQRFEALRVAFI  1224



>ref|XP_009143552.1| PREDICTED: callose synthase 10 [Brassica rapa]
Length=1897

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  21    GFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
             GFE SPEARAQADLKFTYVV+CQIYG+QK+ +KPEA DIALL+QR EALRVAFI
Sbjct  1176  GFEASPEARAQADLKFTYVVSCQIYGQQKQQKKPEATDIALLLQRFEALRVAFI  1229



>emb|CDX75010.1| BnaA05g07560D [Brassica napus]
Length=1909

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  21    GFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
             GFE SPEARAQADLKFTYVV+CQIYG+QK+ +KPEA DIALL+QR EALRVAFI
Sbjct  1188  GFEASPEARAQADLKFTYVVSCQIYGQQKQQKKPEATDIALLLQRFEALRVAFI  1241



>gb|ABI14554.1| glucan synthase-like 1 [Helianthus annuus x Helianthus debilis 
subsp. debilis]
Length=162

 Score = 92.8 bits (229),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    AATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
            A+   +GFE S EARAQAD+KFTYVV+CQIYG+QK+ ++ EAADIALL+QRNEALRVAFI
Sbjct  30   ASLSPQGFEQSREARAQADIKFTYVVSCQIYGQQKQRKEEEAADIALLLQRNEALRVAFI  89



>ref|XP_006476953.1| PREDICTED: callose synthase 10-like [Citrus sinensis]
Length=1902

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
             T+GF LS EARAQ+DLKFTYVV+CQIYG+QK+ + PEAADIALL+QRNEALRVAFI
Sbjct  1176  TQGFALSHEARAQSDLKFTYVVSCQIYGQQKQRKAPEAADIALLLQRNEALRVAFI  1231



>ref|XP_010026813.1| PREDICTED: callose synthase 10 isoform X2 [Eucalyptus grandis]
Length=1906

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 47/61 (77%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             T+GFELS EARAQADLKFTYVV+CQIYG QK+ +  EAADIALL+QRNEALRVAFI   E
Sbjct  1179  TQGFELSHEARAQADLKFTYVVSCQIYGMQKQKKAAEAADIALLLQRNEALRVAFIHVEE  1238

Query  195   T  197
             +
Sbjct  1239  S  1239



>ref|XP_010026809.1| PREDICTED: callose synthase 10 isoform X1 [Eucalyptus grandis]
 gb|KCW83217.1| hypothetical protein EUGRSUZ_B00160 [Eucalyptus grandis]
Length=1907

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 47/61 (77%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             T+GFELS EARAQADLKFTYVV+CQIYG QK+ +  EAADIALL+QRNEALRVAFI   E
Sbjct  1180  TQGFELSHEARAQADLKFTYVVSCQIYGMQKQKKAAEAADIALLLQRNEALRVAFIHVEE  1239

Query  195   T  197
             +
Sbjct  1240  S  1240



>ref|XP_010026823.1| PREDICTED: callose synthase 10 isoform X4 [Eucalyptus grandis]
Length=1903

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 47/61 (77%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             T+GFELS EARAQADLKFTYVV+CQIYG QK+ +  EAADIALL+QRNEALRVAFI   E
Sbjct  1176  TQGFELSHEARAQADLKFTYVVSCQIYGMQKQKKAAEAADIALLLQRNEALRVAFIHVEE  1235

Query  195   T  197
             +
Sbjct  1236  S  1236



>ref|XP_010026817.1| PREDICTED: callose synthase 10 isoform X3 [Eucalyptus grandis]
Length=1904

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 47/61 (77%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             T+GFELS EARAQADLKFTYVV+CQIYG QK+ +  EAADIALL+QRNEALRVAFI   E
Sbjct  1177  TQGFELSHEARAQADLKFTYVVSCQIYGMQKQKKAAEAADIALLLQRNEALRVAFIHVEE  1236

Query  195   T  197
             +
Sbjct  1237  S  1237



>gb|KDP30983.1| hypothetical protein JCGZ_11359 [Jatropha curcas]
Length=1183

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 46/61 (75%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +3

Query  15   TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
            T+GFELS E+RAQADLKFTYVV+CQIYG+QK+ +  EAADIALL+QRNEALRVAFI   E
Sbjct  450  TQGFELSRESRAQADLKFTYVVSCQIYGQQKQRKDKEAADIALLLQRNEALRVAFIHTEE  509

Query  195  T  197
            +
Sbjct  510  S  510



>gb|KDO69367.1| hypothetical protein CISIN_1g0001801mg, partial [Citrus sinensis]
Length=835

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  15   TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
            T+GF LS EARAQ+DLKFTYVV+CQIYG+QK+ + PEAADIALL+QRNEALRVAFI
Sbjct  387  TQGFALSHEARAQSDLKFTYVVSCQIYGQQKQRKAPEAADIALLLQRNEALRVAFI  442



>emb|CBI14881.3| unnamed protein product [Vitis vinifera]
Length=1694

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
             T+GFELS EARAQ DLKFTYVV+CQIYG+QK+ +  EAADIALL+QRNEALRVAFI
Sbjct  968   TQGFELSREARAQVDLKFTYVVSCQIYGQQKQKKASEAADIALLLQRNEALRVAFI  1023



>gb|KHN31929.1| Callose synthase 10 [Glycine soja]
Length=985

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/64 (72%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +3

Query  15   TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
            T+ FE S E+RAQADLKFTYVV+CQIYG+QK+ + PEAADIALL+QRNEALRVAFI   E
Sbjct  260  TQDFESSRESRAQADLKFTYVVSCQIYGQQKQRKAPEAADIALLLQRNEALRVAFIHVDE  319

Query  195  TLKD  206
            +  D
Sbjct  320  STTD  323



>ref|XP_009359501.1| PREDICTED: callose synthase 10-like [Pyrus x bretschneideri]
Length=1896

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             ++G+ELS E+RAQADLKFTYVV+CQIYG+QK+ + PEAADI+LL+QRNEALRVA+I E
Sbjct  1171  SQGYELSRESRAQADLKFTYVVSCQIYGQQKQRKAPEAADISLLLQRNEALRVAYIHE  1228



>ref|XP_010663054.1| PREDICTED: callose synthase 10 isoform X2 [Vitis vinifera]
Length=1904

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
             T+GFELS EARAQ DLKFTYVV+CQIYG+QK+ +  EAADIALL+QRNEALRVAFI
Sbjct  1178  TQGFELSREARAQVDLKFTYVVSCQIYGQQKQKKASEAADIALLLQRNEALRVAFI  1233



>ref|XP_010663053.1| PREDICTED: callose synthase 10 isoform X1 [Vitis vinifera]
Length=1905

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
             T+GFELS EARAQ DLKFTYVV+CQIYG+QK+ +  EAADIALL+QRNEALRVAFI
Sbjct  1179  TQGFELSREARAQVDLKFTYVVSCQIYGQQKQKKASEAADIALLLQRNEALRVAFI  1234



>ref|XP_010507586.1| PREDICTED: callose synthase 10-like [Camelina sativa]
Length=1794

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  21    GFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
             GFE SPEARAQADLKFTYVV+CQIYG+QK+ +KPEA DI+LL+QR EALRVAFI
Sbjct  1124  GFEASPEARAQADLKFTYVVSCQIYGQQKQQKKPEATDISLLLQRYEALRVAFI  1177



>ref|XP_010516914.1| PREDICTED: callose synthase 10 [Camelina sativa]
Length=1898

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  21    GFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
             GFE SPEARAQADLKFTYVV+CQIYG+QK+ +KPEA DI+LL+QR EALRVAFI
Sbjct  1177  GFEASPEARAQADLKFTYVVSCQIYGQQKQQKKPEATDISLLLQRYEALRVAFI  1230



>ref|XP_010509427.1| PREDICTED: callose synthase 10-like [Camelina sativa]
Length=1898

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  21    GFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
             GFE SPEARAQADLKFTYVV+CQIYG+QK+ +KPEA DI+LL+QR EALRVAFI
Sbjct  1177  GFEASPEARAQADLKFTYVVSCQIYGQQKQQKKPEATDISLLLQRYEALRVAFI  1230



>ref|XP_002511263.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
 gb|EEF51865.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
Length=1876

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 46/61 (75%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             T+GFELS E+RAQADLKFTYVV+CQIYG+QK+ +  EAADIALL+QRNEALRVAFI   E
Sbjct  1143  TQGFELSRESRAQADLKFTYVVSCQIYGQQKQRKDKEAADIALLLQRNEALRVAFIHVEE  1202

Query  195   T  197
             +
Sbjct  1203  S  1203



>ref|XP_006581889.1| PREDICTED: callose synthase 10-like [Glycine max]
Length=1905

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 46/64 (72%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             T+ FE S E+RAQADLKFTYVV+CQIYG+QK+ + PEAADIALL+QRNEALRVAFI   E
Sbjct  1180  TQDFESSRESRAQADLKFTYVVSCQIYGQQKQRKAPEAADIALLLQRNEALRVAFIHVDE  1239

Query  195   TLKD  206
             +  D
Sbjct  1240  STTD  1243



>ref|XP_006578682.1| PREDICTED: callose synthase 10-like [Glycine max]
Length=1904

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 46/64 (72%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             ++ FE S EARAQADLKFTYVV+CQIYG+QK+ + PEAADIALL+QRNEALRVAFI   E
Sbjct  1179  SQDFESSREARAQADLKFTYVVSCQIYGQQKQRKAPEAADIALLLQRNEALRVAFIHVDE  1238

Query  195   TLKD  206
             +  D
Sbjct  1239  STTD  1242



>gb|KHN05791.1| Callose synthase 10 [Glycine soja]
Length=1912

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 46/64 (72%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             ++ FE S EARAQADLKFTYVV+CQIYG+QK+ + PEAADIALL+QRNEALRVAFI   E
Sbjct  1187  SQDFESSREARAQADLKFTYVVSCQIYGQQKQRKAPEAADIALLLQRNEALRVAFIHVDE  1246

Query  195   TLKD  206
             +  D
Sbjct  1247  STTD  1250



>ref|XP_004501831.1| PREDICTED: callose synthase 10-like [Cicer arietinum]
Length=1902

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 45/64 (70%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             ++GFE S E+RAQADLKFTYVV+CQIYG+QK+ + PEAADIALL+QRNE LRVAFI   E
Sbjct  1177  SQGFESSRESRAQADLKFTYVVSCQIYGQQKQRKAPEAADIALLLQRNEGLRVAFIHVDE  1236

Query  195   TLKD  206
             +  D
Sbjct  1237  STTD  1240



>gb|KEH34985.1| callose synthase-like protein [Medicago truncatula]
Length=1908

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 45/64 (70%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             ++GFE S E+RAQADLKFTYVV+CQIYG+QK+ + PEAADIALL+QRNE LRVAFI   E
Sbjct  1183  SQGFESSRESRAQADLKFTYVVSCQIYGQQKQRKAPEAADIALLLQRNEGLRVAFIHVDE  1242

Query  195   TLKD  206
             +  D
Sbjct  1243  STTD  1246



>gb|KEH34986.1| callose synthase-like protein [Medicago truncatula]
Length=1860

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 45/64 (70%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             ++GFE S E+RAQADLKFTYVV+CQIYG+QK+ + PEAADIALL+QRNE LRVAFI   E
Sbjct  1185  SQGFESSRESRAQADLKFTYVVSCQIYGQQKQRKAPEAADIALLLQRNEGLRVAFIHVDE  1244

Query  195   TLKD  206
             +  D
Sbjct  1245  STTD  1248



>ref|XP_008464454.1| PREDICTED: callose synthase 10 [Cucumis melo]
 ref|XP_008464455.1| PREDICTED: callose synthase 10 [Cucumis melo]
Length=1905

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
             + ++GFELS E+RAQADLKFTYVV+CQIYG+QK+ + PEA DIALL+QRNE LRVAFI
Sbjct  1177  STSQGFELSRESRAQADLKFTYVVSCQIYGQQKQRKAPEATDIALLLQRNEGLRVAFI  1234



>ref|XP_007137962.1| hypothetical protein PHAVU_009G169400g [Phaseolus vulgaris]
 gb|ESW09956.1| hypothetical protein PHAVU_009G169400g [Phaseolus vulgaris]
Length=1627

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             ++ FE SPE+RAQADLKFTYVV+CQIYG+QK+ +  EA DIALL+QRNEALRVAFI   E
Sbjct  1184  SQDFEFSPESRAQADLKFTYVVSCQIYGQQKQRKAAEATDIALLLQRNEALRVAFIHADE  1243

Query  195   TLKD  206
             ++ D
Sbjct  1244  SISD  1247



>ref|XP_004138064.1| PREDICTED: callose synthase 10-like [Cucumis sativus]
Length=1901

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
             ++GFELS E+RAQADLKFTYVV+CQIYG+QK+ + PEA DIALL+QRNE LRVAFI
Sbjct  1175  SQGFELSRESRAQADLKFTYVVSCQIYGQQKQRKAPEATDIALLLQRNEGLRVAFI  1230



>gb|KGN63502.1| hypothetical protein Csa_1G002710 [Cucumis sativus]
Length=1905

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
             ++GFELS E+RAQADLKFTYVV+CQIYG+QK+ + PEA DIALL+QRNE LRVAFI
Sbjct  1179  SQGFELSRESRAQADLKFTYVVSCQIYGQQKQRKAPEATDIALLLQRNEGLRVAFI  1234



>ref|XP_008239401.1| PREDICTED: callose synthase 10 [Prunus mume]
Length=1898

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             A  ++GFELS E+RAQ DLKFTYVV+CQIYG+QK+ + PEAADI+LL+QRNEALRVA+I 
Sbjct  1169  AFTSQGFELSRESRAQVDLKFTYVVSCQIYGQQKQRKAPEAADISLLLQRNEALRVAYIH  1228

Query  186   EVET  197
               E+
Sbjct  1229  VEES  1232



>ref|XP_006293554.1| hypothetical protein CARUB_v10022498mg [Capsella rubella]
 gb|EOA26452.1| hypothetical protein CARUB_v10022498mg [Capsella rubella]
Length=1897

 Score = 96.3 bits (238),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  21    GFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
             GFE SPEARAQADLKFTYVV+CQIYG+QK+ +KPEA DI LL+QR EALRVAFI
Sbjct  1176  GFESSPEARAQADLKFTYVVSCQIYGQQKQQKKPEATDILLLLQRYEALRVAFI  1229



>ref|XP_004236315.1| PREDICTED: callose synthase 10 [Solanum lycopersicum]
Length=1908

 Score = 96.3 bits (238),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             ++GFELS EARAQADLKFTYV++CQIYG+QK+ + PEA DI LL++RNEALRVAFI   E
Sbjct  1179  SQGFELSREARAQADLKFTYVISCQIYGQQKQRKAPEATDIGLLLRRNEALRVAFIHVEE  1238

Query  195   TLKD  206
                D
Sbjct  1239  ITGD  1242



>ref|XP_006351455.1| PREDICTED: callose synthase 10-like [Solanum tuberosum]
Length=1908

 Score = 96.3 bits (238),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             ++GFELS EARAQADLKFTYV++CQIYG+QK+ + PEA DI LL++RNEALRVAFI   E
Sbjct  1179  SQGFELSREARAQADLKFTYVISCQIYGQQKQRKAPEATDIGLLLRRNEALRVAFIHVEE  1238

Query  195   TLKD  206
                D
Sbjct  1239  IAGD  1242



>ref|XP_009333831.1| PREDICTED: callose synthase 10-like [Pyrus x bretschneideri]
Length=1900

 Score = 96.3 bits (238),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             ++G+ELS E+RAQADLKFTYVV+CQIYG+QK+ + PEAADI+LL+QRNEALRVA+I   E
Sbjct  1174  SQGYELSRESRAQADLKFTYVVSCQIYGQQKQRKAPEAADISLLLQRNEALRVAYIHVEE  1233

Query  195   T  197
             +
Sbjct  1234  S  1234



>ref|XP_002322219.1| GLUCAN SYNTHASE-LIKE 8 family protein [Populus trichocarpa]
 gb|EEF06346.1| GLUCAN SYNTHASE-LIKE 8 family protein [Populus trichocarpa]
Length=1901

 Score = 96.3 bits (238),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             + ++GFELS EARAQADLKFTYVV+CQIYG+QK+ +  EAADI+LL+QRNEALRVAFI  
Sbjct  1172  STSQGFELSHEARAQADLKFTYVVSCQIYGQQKQRKAVEAADISLLLQRNEALRVAFIHV  1231

Query  189   VET  197
              E+
Sbjct  1232  EES  1234



>ref|XP_004299187.1| PREDICTED: callose synthase 10 [Fragaria vesca subsp. vesca]
Length=1902

 Score = 95.9 bits (237),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 44/61 (72%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             ++GFE S E+RAQADLKFTYVV+CQIYG+QK+ + PEAADI+LL+QRNEALRVA+I   E
Sbjct  1176  SQGFESSTESRAQADLKFTYVVSCQIYGQQKQRKAPEAADISLLLQRNEALRVAYIHVEE  1235

Query  195   T  197
             T
Sbjct  1236  T  1236



>ref|XP_009613174.1| PREDICTED: callose synthase 10 [Nicotiana tomentosiformis]
Length=1908

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             ++GFELS EARAQADLKFTYV++CQIYG+QK+ + PEA DI LL++RNEALRVAFI   E
Sbjct  1179  SQGFELSREARAQADLKFTYVISCQIYGQQKQRKAPEATDIGLLLRRNEALRVAFIHVEE  1238

Query  195   TLKD  206
                D
Sbjct  1239  IAGD  1242



>ref|XP_010248781.1| PREDICTED: callose synthase 10 [Nelumbo nucifera]
Length=1910

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/61 (72%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             ++GFE+S  +RAQADLKFTYVV+CQIYG+QK+ + PEAADIALL+QRNEALRVAFI   E
Sbjct  1184  SQGFEISRISRAQADLKFTYVVSCQIYGQQKQKKAPEAADIALLLQRNEALRVAFIHVEE  1243

Query  195   T  197
             +
Sbjct  1244  S  1244



>ref|XP_009791092.1| PREDICTED: callose synthase 10 [Nicotiana sylvestris]
Length=1908

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             ++GFELS EARAQADLKFTYV++CQIYG+QK+ + PEA DI LL++RNEALRVAFI   E
Sbjct  1179  SQGFELSREARAQADLKFTYVISCQIYGQQKQRKAPEATDIGLLLRRNEALRVAFIHVEE  1238

Query  195   TLKD  206
                D
Sbjct  1239  IAGD  1242



>gb|AAK49453.1|AF304373_1 putative beta-1,3-glucan synthase [Nicotiana alata]
Length=272

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  15   TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
            ++GFELS EARAQADLKFTYV++CQIYG+QK+ + PEA DI LL++RNEALRVAFI   E
Sbjct  42   SQGFELSREARAQADLKFTYVISCQIYGQQKQRKAPEATDIGLLLRRNEALRVAFIHVEE  101

Query  195  TLKD  206
               D
Sbjct  102  IAGD  105



>ref|XP_010667393.1| PREDICTED: callose synthase 10 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=1900

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  21    GFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
             GF+LS EARAQADLKFTYVV+CQIYG+Q++ + PEAADI LL+QRNEALRVAFI
Sbjct  1176  GFDLSSEARAQADLKFTYVVSCQIYGQQRQRKAPEAADINLLLQRNEALRVAFI  1229



>ref|XP_010667392.1| PREDICTED: callose synthase 10 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=1901

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  21    GFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
             GF+LS EARAQADLKFTYVV+CQIYG+Q++ + PEAADI LL+QRNEALRVAFI
Sbjct  1177  GFDLSSEARAQADLKFTYVVSCQIYGQQRQRKAPEAADINLLLQRNEALRVAFI  1230



>ref|XP_006410857.1| hypothetical protein EUTSA_v10016126mg [Eutrema salsugineum]
 gb|ESQ52310.1| hypothetical protein EUTSA_v10016126mg [Eutrema salsugineum]
Length=1897

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  21    GFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
             GF  SPEARAQADLKFTYVV+CQIYG+QK+ +KPEA DIALL+QR EALRVAFI
Sbjct  1176  GFISSPEARAQADLKFTYVVSCQIYGQQKQQKKPEATDIALLLQRYEALRVAFI  1229



>ref|XP_008392970.1| PREDICTED: callose synthase 10-like [Malus domestica]
Length=1301

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             ++G+ELS E+RAQADLKFTYVV+CQIYG+QK+ + PEAADI+LL+QRNEALRVA+I   E
Sbjct  1173  SQGYELSRESRAQADLKFTYVVSCQIYGQQKQRKAPEAADISLLLQRNEALRVAYIHVEE  1232

Query  195   T  197
             +
Sbjct  1233  S  1233



>gb|AAD31571.1| putative glucan synthase [Arabidopsis thaliana]
Length=784

 Score = 92.8 bits (229),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  21   GFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
            GFE S EARAQADLKFTYVV+CQIYG+QK+ +KPEA DI LL+QR EALRVAFI
Sbjct  202  GFESSIEARAQADLKFTYVVSCQIYGQQKQQKKPEATDIGLLLQRYEALRVAFI  255



>ref|XP_011024097.1| PREDICTED: callose synthase 10 isoform X2 [Populus euphratica]
Length=1896

 Score = 93.2 bits (230),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 44/63 (70%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             + ++GFELS  ARAQADLKFTYVV+CQIYG+QK+ +  EAADI+LL+QRNEALRVAFI  
Sbjct  1168  STSQGFELSRGARAQADLKFTYVVSCQIYGQQKQRKTVEAADISLLLQRNEALRVAFIHV  1227

Query  189   VET  197
              E+
Sbjct  1228  EES  1230



>ref|XP_011024096.1| PREDICTED: callose synthase 10 isoform X1 [Populus euphratica]
Length=1897

 Score = 93.2 bits (230),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 44/63 (70%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +3

Query  9     TDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDE  188
             + ++GFELS  ARAQADLKFTYVV+CQIYG+QK+ +  EAADI+LL+QRNEALRVAFI  
Sbjct  1168  STSQGFELSRGARAQADLKFTYVVSCQIYGQQKQRKTVEAADISLLLQRNEALRVAFIHV  1227

Query  189   VET  197
              E+
Sbjct  1228  EES  1230



>ref|XP_002881474.1| hypothetical protein ARALYDRAFT_482666 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57733.1| hypothetical protein ARALYDRAFT_482666 [Arabidopsis lyrata subsp. 
lyrata]
Length=1723

 Score = 93.2 bits (230),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  21    GFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
             GFE S EARAQADLKFTYVV+CQIYG+QK+ +KPEA DI LL+QR EALRVAFI
Sbjct  1018  GFESSIEARAQADLKFTYVVSCQIYGQQKQQKKPEATDIGLLLQRYEALRVAFI  1071



>ref|NP_850271.5| glucan synthase-like 8 [Arabidopsis thaliana]
 sp|Q9SJM0.5|CALSA_ARATH RecName: Full=Callose synthase 10; AltName: Full=1,3-beta-glucan 
synthase; AltName: Full=Protein CHORUS; AltName: Full=Protein 
GLUCAN SYNTHASE-LIKE 8 [Arabidopsis thaliana]
 gb|ACV04899.1| callose synthase 10 [Arabidopsis thaliana]
 gb|AEC09306.1| glucan synthase-like 8 [Arabidopsis thaliana]
Length=1904

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  21    GFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFI  182
             GFE S EARAQADLKFTYVV+CQIYG+QK+ +KPEA DI LL+QR EALRVAFI
Sbjct  1178  GFESSIEARAQADLKFTYVVSCQIYGQQKQQKKPEATDIGLLLQRYEALRVAFI  1231



>ref|XP_008337073.1| PREDICTED: callose synthase 10 [Malus domestica]
Length=1761

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             ++G+ELS E+RAQADLKFTYVV+CQIYG+QK+ +  EAADI+LL+QRNEALRVA+I   E
Sbjct  1035  SQGYELSCESRAQADLKFTYVVSCQIYGQQKQRKAXEAADISLLLQRNEALRVAYIHVEE  1094

Query  195   T  197
             +
Sbjct  1095  S  1095



>ref|XP_002993846.1| glucan synthase like 7 [Selaginella moellendorffii]
 gb|EFJ05083.1| glucan synthase like 7 [Selaginella moellendorffii]
Length=1886

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +3

Query  18    EGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVET  197
             + + LS  ARAQ+DLKFTYVVTCQIYG+QK  +   A DI  LMQ+NEALR+A+ID VET
Sbjct  1164  QDYLLSRGARAQSDLKFTYVVTCQIYGEQKHKRDQRATDINYLMQKNEALRIAYIDVVET  1223

Query  198   LKD  206
             L++
Sbjct  1224  LRE  1226



>ref|XP_002991456.1| glucan synthase like 7 [Selaginella moellendorffii]
 gb|EFJ07568.1| glucan synthase like 7 [Selaginella moellendorffii]
Length=1896

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +3

Query  18    EGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVET  197
             + + LS  ARAQ+DLKFTYVVTCQIYG+QK  +   A DI  LMQ+NEALR+A+ID VET
Sbjct  1174  QDYLLSRGARAQSDLKFTYVVTCQIYGEQKHKRDQRATDINYLMQKNEALRIAYIDVVET  1233

Query  198   LKD  206
             L++
Sbjct  1234  LRE  1236



>ref|XP_008665818.1| PREDICTED: LOW QUALITY PROTEIN: callose synthase 9-like [Zea 
mays]
Length=1894

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +3

Query  3     AATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQ  152
             A +    FELSPEARAQADLKFTYVVTCQIYGKQK + K E ADI+LLMQ
Sbjct  1178  AGSADRHFELSPEARAQADLKFTYVVTCQIYGKQKGEGKAEXADISLLMQ  1227



>ref|XP_004170812.1| PREDICTED: callose synthase 10-like, partial [Cucumis sativus]
Length=768

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +3

Query  15   TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQR  155
            ++GFELS E+RAQADLKFTYVV+CQIYG+QK+ + PEA DIALL+QR
Sbjct  705  SQGFELSRESRAQADLKFTYVVSCQIYGQQKQRKAPEATDIALLLQR  751



>ref|XP_001773231.1| predicted protein [Physcomitrella patens]
 gb|EDQ61921.1| predicted protein [Physcomitrella patens]
Length=1933

 Score = 76.3 bits (186),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 33/49 (67%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  45    RAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             +AQA+LKF Y+V+CQIYG QK+  KP+AADI  LMQ+NE+LRVA++DEV
Sbjct  1220  KAQAELKFVYLVSCQIYGDQKKTGKPQAADILYLMQQNESLRVAYVDEV  1268



>ref|XP_001766872.1| predicted protein [Physcomitrella patens]
 gb|EDQ68274.1| predicted protein [Physcomitrella patens]
Length=1951

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  42    ARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVET  197
             A AQA+LKFTYVVTCQIYG+QK   K +AADI  LMQ++++LRVA+ID VE+
Sbjct  1236  AWAQAELKFTYVVTCQIYGEQKRKGKVQAADILYLMQKHDSLRVAYIDVVES  1287



>ref|XP_010919535.1| PREDICTED: callose synthase 12-like [Elaeis guineensis]
 ref|XP_010919541.1| PREDICTED: callose synthase 12-like [Elaeis guineensis]
 ref|XP_010919548.1| PREDICTED: callose synthase 12-like [Elaeis guineensis]
 ref|XP_010919562.1| PREDICTED: callose synthase 12-like [Elaeis guineensis]
 ref|XP_010919570.1| PREDICTED: callose synthase 12-like [Elaeis guineensis]
Length=1779

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  45    RAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
             R  A +K+TYVV CQIYG QK  + P A DI  LM+ NEALRVA++DEV T +D
Sbjct  1064  RGTALMKYTYVVACQIYGNQKAKKDPHAEDILYLMKNNEALRVAYVDEVHTGRD  1117



>gb|KCW54228.1| hypothetical protein EUGRSUZ_I00208 [Eucalyptus grandis]
Length=1836

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/61 (57%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  12    DTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             D +   LS ++ A AD+KFTYV TCQIYG QK      A DI  LM  N ALRVA+IDEV
Sbjct  1110  DKKARSLSAQSEAMADMKFTYVATCQIYGNQKRSGDRRATDILNLMVNNPALRVAYIDEV  1169

Query  192   E  194
             E
Sbjct  1170  E  1170



>ref|XP_010027661.1| PREDICTED: LOW QUALITY PROTEIN: callose synthase 5 [Eucalyptus 
grandis]
Length=1927

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/61 (57%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  12    DTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             D +   LS ++ A AD+KFTYV TCQIYG QK      A DI  LM  N ALRVA+IDEV
Sbjct  1201  DKKARSLSAQSEAMADMKFTYVATCQIYGNQKRSGDRRATDILNLMVNNPALRVAYIDEV  1260

Query  192   E  194
             E
Sbjct  1261  E  1261



>ref|XP_006447310.1| hypothetical protein CICLE_v10018223mg, partial [Citrus clementina]
 gb|ESR60550.1| hypothetical protein CICLE_v10018223mg, partial [Citrus clementina]
Length=1527

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  54   ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
            A +KFTYVV CQIYG+QK+ + P A +I  LM+ NEALRVA++DEV T +D
Sbjct  816  ALMKFTYVVACQIYGQQKDKKDPHAEEILYLMKNNEALRVAYVDEVSTGRD  866



>gb|KDO51558.1| hypothetical protein CISIN_1g000259mg [Citrus sinensis]
Length=1771

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
             A +KFTYVV CQIYG+QK+ + P A +I  LM+ NEALRVA++DEV T +D
Sbjct  1060  ALMKFTYVVACQIYGQQKDKKDPHAEEILYLMKNNEALRVAYVDEVSTGRD  1110



>ref|XP_006491624.1| PREDICTED: callose synthase 12-like [Citrus sinensis]
Length=1771

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
             A +KFTYVV CQIYG+QK+ + P A +I  LM+ NEALRVA++DEV T +D
Sbjct  1060  ALMKFTYVVACQIYGQQKDKKDPHAEEILYLMKNNEALRVAYVDEVSTGRD  1110



>ref|XP_010269904.1| PREDICTED: callose synthase 12-like [Nelumbo nucifera]
 ref|XP_010269905.1| PREDICTED: callose synthase 12-like [Nelumbo nucifera]
Length=1785

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  48    AQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
             A A +K+TYVV CQIYG QK  + P A +I  LM+ NEALRVA++DEV+T +D
Sbjct  1072  ATALMKYTYVVACQIYGSQKAKKDPHAEEILYLMKNNEALRVAYVDEVQTGRD  1124



>emb|CDP14784.1| unnamed protein product [Coffea canephora]
Length=1799

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
             A +KFTYVV CQIYG QK  + P A DI  LMQ NEALRVA++DEV   +D
Sbjct  1088  ALMKFTYVVACQIYGSQKAKKDPHADDILYLMQNNEALRVAYVDEVTVGRD  1138



>gb|KHG16154.1| Callose synthase 12 -like protein [Gossypium arboreum]
Length=1734

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +3

Query  21    GFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETL  200
             GF      +  + +K+TYV+ CQIYG QK  + P A +I  LM+ NEALRVA++DEV T 
Sbjct  1038  GFLFKGHEQVTSSMKYTYVIACQIYGAQKAKKDPRAEEILYLMKHNEALRVAYVDEVSTG  1097

Query  201   KD  206
             +D
Sbjct  1098  RD  1099



>gb|EPS66162.1| hypothetical protein M569_08614, partial [Genlisea aurea]
Length=1754

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  45    RAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
             R  A +KFTYVV CQIYG QK  + P A +I  LM+ NEALRVA++DEV + +D
Sbjct  1044  RGTALMKFTYVVACQIYGSQKAKKDPRAEEILYLMKNNEALRVAYVDEVSSGRD  1097



>ref|XP_011086366.1| PREDICTED: callose synthase 12 [Sesamum indicum]
Length=1771

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  45    RAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
             R  A +KFTYVV CQIYG QK  + P A +I  LM+ NEALRVA++DEV + +D
Sbjct  1057  RGTALMKFTYVVACQIYGSQKAKKDPHAEEILYLMKNNEALRVAYVDEVSSGRD  1110



>ref|XP_006594852.1| PREDICTED: callose synthase 12-like isoform X2 [Glycine max]
Length=1405

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +3

Query  54   ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
            A +KFTYV+ CQIYG QKE + P A +I  LM+ NEALRVA++DEV T +D
Sbjct  697  ALMKFTYVIACQIYGAQKERKDPHADEILYLMKNNEALRVAYVDEVPTGRD  747



>gb|KHN36638.1| Callose synthase 12 [Glycine soja]
Length=1567

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +3

Query  54   ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
            A +KFTYV+ CQIYG QKE + P A +I  LM+ NEALRVA++DEV T +D
Sbjct  859  ALMKFTYVIACQIYGAQKERKDPHADEILYLMKNNEALRVAYVDEVPTGRD  909



>ref|XP_003526282.2| PREDICTED: callose synthase 12-like isoform X1 [Glycine max]
Length=815

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  54   ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
            A +KFTYV+ CQIYG QKE + P A +I  LMQ NEALRVA++DE  T +D
Sbjct  106  ALMKFTYVIACQIYGTQKEKKDPHADEILYLMQNNEALRVAYVDEKTTGRD  156



>ref|XP_003541911.1| PREDICTED: callose synthase 12-like isoform X1 [Glycine max]
Length=1742

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
             A +KFTYV+ CQIYG QKE + P A +I  LM+ NEALRVA++DEV T +D
Sbjct  1034  ALMKFTYVIACQIYGAQKERKDPHADEILYLMKNNEALRVAYVDEVPTGRD  1084



>gb|KHN35252.1| Callose synthase 12 [Glycine soja]
Length=1665

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
             A +KFTYV+ CQIYG QKE + P A +I  LMQ NEALRVA++DE  T +D
Sbjct  956   ALMKFTYVIACQIYGTQKEKKDPHADEILYLMQNNEALRVAYVDEKTTGRD  1006



>gb|KHN31989.1| Callose synthase 12 [Glycine soja]
Length=1669

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
             A +KFTYV+ CQIYG QKE + P A +I  LMQ NEALRVA++DE  T +D
Sbjct  960   ALMKFTYVIACQIYGTQKEKKDPHADEILYLMQNNEALRVAYVDEKTTGRD  1010



>ref|XP_008386400.1| PREDICTED: putative callose synthase 8 isoform X1 [Malus domestica]
Length=1952

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/65 (48%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             A ++   ELS +  A AD+KFTYV+TCQ++G QK    P A DI  LM+R+ +LRVA+++
Sbjct  1224  AVESRNRELSAQLDALADMKFTYVLTCQLFGSQKASGDPHAQDIIDLMKRHPSLRVAYVE  1283

Query  186   EVETL  200
             E E +
Sbjct  1284  EKEVI  1288



>ref|XP_007149848.1| hypothetical protein PHAVU_005G103600g [Phaseolus vulgaris]
 gb|ESW21842.1| hypothetical protein PHAVU_005G103600g [Phaseolus vulgaris]
Length=1752

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             A +KFTYV++CQIYG QKE + P A +I  LM+ NEALRVA++DEV
Sbjct  1042  ASMKFTYVISCQIYGAQKERKDPRAEEILYLMKNNEALRVAYVDEV  1087



>ref|XP_010097906.1| Callose synthase 12 [Morus notabilis]
 gb|EXB72969.1| Callose synthase 12 [Morus notabilis]
Length=1774

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
             A +KFTYVV CQIYG QK  + P A +I  LM+ NEALRVA++DEV T +D
Sbjct  1064  ALMKFTYVVACQIYGTQKAKKDPHAEEILYLMKTNEALRVAYVDEVSTGRD  1114



>ref|XP_010274605.1| PREDICTED: callose synthase 12-like [Nelumbo nucifera]
Length=1781

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             A+  E           A +K+TYVV CQIYG QK  + P A +I  LM+ NEALRVA++D
Sbjct  1054  ASSGENLLFKGHEYGTALMKYTYVVACQIYGTQKAKKDPRAEEILYLMKNNEALRVAYVD  1113

Query  186   EVETLKD  206
             EV+T +D
Sbjct  1114  EVQTGRD  1120



>ref|XP_007043597.1| Glucan synthase-like 5 [Theobroma cacao]
 gb|EOX99428.1| Glucan synthase-like 5 [Theobroma cacao]
Length=1738

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +3

Query  60    LKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
             +K+TYVV CQIYG QK  + P A +I  LM+ NEALRVA++DEV T +D
Sbjct  1062  MKYTYVVACQIYGAQKAKKDPHAEEILYLMKHNEALRVAYVDEVSTTRD  1110



>ref|XP_009782977.1| PREDICTED: callose synthase 12-like [Nicotiana sylvestris]
Length=1768

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
             A +KFTYVV CQIYG QK  + P A +I  LM+ NEALRVA++DEV T +D
Sbjct  1056  ALMKFTYVVACQIYGTQKAKKDPHAEEILYLMKNNEALRVAYVDEVPTGRD  1106



>ref|XP_004505578.1| PREDICTED: callose synthase 12-like isoform X1 [Cicer arietinum]
Length=1766

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
             A +KFTYVV CQIYG QKE + P A +I  LM+ NEALRVA++DE  T +D
Sbjct  1057  ALMKFTYVVACQIYGTQKEKKDPHAEEILYLMKNNEALRVAYVDEKTTGRD  1107



>ref|XP_006357481.1| PREDICTED: callose synthase 12-like [Solanum tuberosum]
Length=1768

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
             A +KFTYVV CQIYG QK  + P A +I  LM+ NEALRVA++DEV T +D
Sbjct  1056  ALMKFTYVVACQIYGAQKAKKDPHAEEILYLMKNNEALRVAYVDEVPTGRD  1106



>ref|XP_004243352.1| PREDICTED: callose synthase 12 [Solanum lycopersicum]
 ref|XP_010323739.1| PREDICTED: callose synthase 12 [Solanum lycopersicum]
Length=1768

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
             A +KFTYVV CQIYG QK  + P A +I  LM+ NEALRVA++DEV T +D
Sbjct  1056  ALMKFTYVVACQIYGAQKAKKDPHAEEILYLMKNNEALRVAYVDEVPTGRD  1106



>gb|KJB79972.1| hypothetical protein B456_013G075600 [Gossypium raimondii]
Length=1757

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/64 (47%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = +3

Query  15    TEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVE  194
             + GF      +  + +K+TYV+ CQIYG QK  + P A +I  LM+ NEALRVA+ DEV 
Sbjct  1036  STGFLFKGHEQVTSSMKYTYVIACQIYGAQKAKKDPRAEEILYLMKHNEALRVAYADEVS  1095

Query  195   TLKD  206
             T +D
Sbjct  1096  TGRD  1099



>ref|XP_003607458.1| Callose synthase [Medicago truncatula]
 gb|AES89655.1| callose synthase-like protein [Medicago truncatula]
Length=1815

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
             A +KFTYVV CQIYG QKE + P A +I  LM+ NEALRVA++DE  T +D
Sbjct  1054  ALMKFTYVVACQIYGTQKEKKDPHAEEILYLMKNNEALRVAYVDERTTGRD  1104



>ref|XP_010038677.1| PREDICTED: callose synthase 12-like [Eucalyptus grandis]
Length=1599

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  54   ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
            A +KFTYVV CQIYG QK  + P A +I  LM+ NEALRVA++DEV T +D
Sbjct  891  AMMKFTYVVACQIYGAQKAKKDPHADEILNLMKNNEALRVAYVDEVSTKRD  941



>gb|KCW76242.1| hypothetical protein EUGRSUZ_D00621 [Eucalyptus grandis]
Length=1762

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +3

Query  30    LSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
             L     A A +KFTYV+TCQ+YG QK ++   A DI  LM++NEALRVA++DEV + +D
Sbjct  1046  LKGSENACALMKFTYVITCQVYGVQKANKDQRAKDILYLMKKNEALRVAYVDEVHSGRD  1104



>gb|KDP24129.1| hypothetical protein JCGZ_25786 [Jatropha curcas]
Length=1771

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
             A +K+TYVV CQIYG QK  + P A DI  LM+ NEALRVA++DEV T +D
Sbjct  1060  ALMKYTYVVACQIYGTQKAKKDPHAEDILDLMKNNEALRVAYVDEVNTGRD  1110



>ref|XP_010052310.1| PREDICTED: LOW QUALITY PROTEIN: callose synthase 11-like [Eucalyptus 
grandis]
Length=1780

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +3

Query  30    LSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
             L     A A +KFTYV+TCQ+YG QK ++   A DI  LM++NEALRVA++DEV + +D
Sbjct  1064  LKGSENACALMKFTYVITCQVYGVQKANKDQRAKDILYLMKKNEALRVAYVDEVHSGRD  1122



>ref|XP_001764343.1| predicted protein [Physcomitrella patens]
 gb|EDQ70897.1| predicted protein [Physcomitrella patens]
Length=1965

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +3

Query  45    RAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             +AQADLKF Y+V+CQIYG QK+    +A DI  LMQ+NE+LRVA++D V
Sbjct  1245  QAQADLKFVYLVSCQIYGDQKQKGLAQAKDILYLMQQNESLRVAYVDTV  1293



>gb|KCW47213.1| hypothetical protein EUGRSUZ_K010271, partial [Eucalyptus grandis]
Length=1182

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  54   ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
            A +KFTYVV CQIYG QK  + P A +I  LM+ NEALRVA++DEV T +D
Sbjct  474  AMMKFTYVVACQIYGAQKAKKDPHADEILNLMKNNEALRVAYVDEVSTKRD  524



>ref|XP_008811912.1| PREDICTED: callose synthase 12-like [Phoenix dactylifera]
 ref|XP_008811914.1| PREDICTED: callose synthase 12-like [Phoenix dactylifera]
Length=1779

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  45    RAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
             R  A +K+TYVV CQIYG QK  +   A DI  LM+ NEALRVA++DEV T +D
Sbjct  1064  RGTALMKYTYVVACQIYGTQKAKKDSHAEDILYLMKNNEALRVAYVDEVHTGRD  1117



>ref|XP_007146339.1| hypothetical protein PHAVU_006G032100g [Phaseolus vulgaris]
 gb|ESW18333.1| hypothetical protein PHAVU_006G032100g [Phaseolus vulgaris]
Length=1917

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 35/64 (55%), Positives = 43/64 (67%), Gaps = 4/64 (6%)
 Frame = +3

Query  27    ELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAA----DIALLMQRNEALRVAFIDEVE  194
             +L  EA+A ADLKFTYVV+CQ+YG QK+ + P       +I  LM  N ALRVA+IDE E
Sbjct  1187  KLLEEAQAMADLKFTYVVSCQVYGSQKKSKNPRDRSCYNNILNLMLTNTALRVAYIDETE  1246

Query  195   TLKD  206
               KD
Sbjct  1247  ETKD  1250



>gb|KJB77266.1| hypothetical protein B456_012G128700 [Gossypium raimondii]
Length=1274

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   LKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
            +KFTYVV CQIYG QK+ + P A +I  LM+ NEALRVA++DEV   +D
Sbjct  755  MKFTYVVACQIYGAQKDKKDPHAEEILYLMKHNEALRVAYVDEVSVGRD  803



>ref|XP_010052311.1| PREDICTED: callose synthase 11-like [Eucalyptus grandis]
 gb|KCW76243.1| hypothetical protein EUGRSUZ_D00622 [Eucalyptus grandis]
Length=1777

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
             A +KFTYVVTCQ+YG QK ++   A DI  LM++NEALRVA++DEV + +D
Sbjct  1069  ALMKFTYVVTCQVYGLQKANKDQRANDILYLMKKNEALRVAYVDEVHSGRD  1119



>ref|XP_009395035.1| PREDICTED: callose synthase 12-like [Musa acuminata subsp. malaccensis]
 ref|XP_009395036.1| PREDICTED: callose synthase 12-like [Musa acuminata subsp. malaccensis]
Length=1794

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
             A +K+TYVV CQIYG QK    P A DI  LM+ NEALRVA++DEV++ +D
Sbjct  1082  ALMKYTYVVACQIYGNQKAKNDPRANDILYLMKNNEALRVAYVDEVKSGRD  1132



>ref|XP_006376492.1| hypothetical protein POPTR_0013s134902g, partial [Populus trichocarpa]
 gb|ERP54289.1| hypothetical protein POPTR_0013s134902g, partial [Populus trichocarpa]
Length=899

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  54   ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
            A +K+TYVV CQIYG QK  + P A +I  LM+ NEALRVA++DEV T +D
Sbjct  192  ALMKYTYVVACQIYGAQKAKKDPHAEEILYLMKNNEALRVAYVDEVNTGRD  242



>gb|KEH39135.1| 1,3-beta-glucan synthase component-like protein [Medicago truncatula]
Length=1711

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
             A +KFTYV+ CQIYG QK  + P A +I  LM+ NEALRVA++DEV T +D
Sbjct  1042  ALMKFTYVIACQIYGTQKARKDPHADEILYLMKNNEALRVAYVDEVRTGRD  1092



>ref|XP_008386401.1| PREDICTED: putative callose synthase 8 isoform X2 [Malus domestica]
Length=1411

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 31/65 (48%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +3

Query  6     ATDTEGFELSPEARAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFID  185
             A ++   ELS +  A AD+KFTYV+TCQ++G QK    P A DI  LM+R+ +LRVA+++
Sbjct  1224  AVESRNRELSAQLDALADMKFTYVLTCQLFGSQKASGDPHAQDIIDLMKRHPSLRVAYVE  1283

Query  186   EVETL  200
             E E +
Sbjct  1284  EKEVI  1288



>ref|XP_002517915.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
 gb|EEF44433.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
Length=1767

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
             A +K+TYVV CQIYG QK  + P A +I  LM+ NEALRVA++DEV T +D
Sbjct  1059  ALMKYTYVVACQIYGSQKAKKDPRAEEILYLMKSNEALRVAYVDEVNTGRD  1109



>ref|XP_011037332.1| PREDICTED: callose synthase 12 [Populus euphratica]
Length=1766

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
             A +K+TYVV CQIYG QK  + P A +I  LM+ NEALRVA++DEV T +D
Sbjct  1059  ALMKYTYVVACQIYGAQKAKKDPHAEEILYLMKNNEALRVAYVDEVNTGRD  1109



>gb|KHN08524.1| Callose synthase 11 [Glycine soja]
Length=1735

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 29/48 (60%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  48    AQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
               A +KFTYVV CQ+YG+ K D+ P A +I  LMQ NEALRVA++DEV
Sbjct  1025  GSALMKFTYVVACQMYGRHKADKNPRADEILYLMQNNEALRVAYVDEV  1072



>ref|XP_006597437.1| PREDICTED: callose synthase 11-like isoform X1 [Glycine max]
Length=1799

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 29/48 (60%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  48    AQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
               A +KF+YVV CQIYG+ K D+ P A +I  LMQ NEALRVA++DEV
Sbjct  1085  GSALMKFSYVVACQIYGRHKADKNPRADEILYLMQHNEALRVAYVDEV  1132



>gb|EMT05385.1| Callose synthase 12 [Aegilops tauschii]
Length=1586

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +3

Query  54   ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETL  200
            A +K+TYVV CQIYG QK+ + P A DI  LM++NEALRVA++DEV  +
Sbjct  875  ALMKYTYVVACQIYGNQKKGKDPRAEDILSLMKKNEALRVAYVDEVHEM  923



>ref|XP_007132658.1| hypothetical protein PHAVU_011G113800g [Phaseolus vulgaris]
 gb|ESW04652.1| hypothetical protein PHAVU_011G113800g [Phaseolus vulgaris]
Length=1769

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
             A +KFTYV+ CQIYG QKE + P A +I  LM++NEALRVA++DE  + +D
Sbjct  1060  ALMKFTYVIACQIYGTQKEKKDPHADEILYLMKKNEALRVAYVDEKTSGRD  1110



>gb|ACS36253.1| glucan synthase-like 7 [Hordeum vulgare]
Length=1626

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +3

Query  54   ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
            A +K+TYVV CQIYG QK+ + P A DI  LM++NEALRVA++DEV
Sbjct  914  ALMKYTYVVACQIYGNQKKGKDPRAEDIPSLMKKNEALRVAYVDEV  959



>gb|EYU28588.1| hypothetical protein MIMGU_mgv1a000108mg [Erythranthe guttata]
Length=1770

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  45    RAQADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
             R    +KFTYVV CQIYG QK  + P A +I  LM+ NEALRVA++DEV + +D
Sbjct  1056  RGTVLMKFTYVVACQIYGSQKAKKDPHADEILYLMKINEALRVAYVDEVSSERD  1109



>ref|XP_006396582.1| hypothetical protein EUTSA_v10028360mg [Eutrema salsugineum]
 ref|XP_006396583.1| hypothetical protein EUTSA_v10028360mg [Eutrema salsugineum]
 gb|ESQ38035.1| hypothetical protein EUTSA_v10028360mg [Eutrema salsugineum]
 gb|ESQ38036.1| hypothetical protein EUTSA_v10028360mg [Eutrema salsugineum]
Length=1640

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             A +KFTYVV CQIYG QK  ++P+A +I  LM++NEALR+A++DEV
Sbjct  1068  ALMKFTYVVACQIYGSQKAKKEPQAEEILYLMKQNEALRIAYVDEV  1113



>ref|XP_010455882.1| PREDICTED: callose synthase 12-like [Camelina sativa]
Length=1780

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             A +KFTYVV CQIYG QK  ++P+A +I  LM++NEALR+A++DEV
Sbjct  1067  ALMKFTYVVACQIYGSQKAKKEPQAEEILYLMKQNEALRIAYVDEV  1112



>ref|XP_010422451.1| PREDICTED: callose synthase 12 isoform X1 [Camelina sativa]
 ref|XP_010422452.1| PREDICTED: callose synthase 12 isoform X2 [Camelina sativa]
Length=1780

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             A +KFTYVV CQIYG QK  ++P+A +I  LM++NEALR+A++DEV
Sbjct  1067  ALMKFTYVVACQIYGSQKAKKEPQAEEILYLMKQNEALRIAYVDEV  1112



>ref|NP_192264.1| callose synthase 12 [Arabidopsis thaliana]
 sp|Q9ZT82.1|CALSC_ARATH RecName: Full=Callose synthase 12; AltName: Full=1,3-beta-glucan 
synthase; AltName: Full=Protein GLUCAN SYNTHASE-LIKE 5; 
AltName: Full=Protein POWDERY MILDEW RESISTANT 4 [Arabidopsis 
thaliana]
 gb|AAD11597.1| putative glucan synthase component [Arabidopsis thaliana]
 gb|AAD15311.1| putative glucan synthase component [Arabidopsis thaliana]
 emb|CAB77840.1| putative glucan synthase component [Arabidopsis thaliana]
 gb|AEE82336.1| callose synthase 12 [Arabidopsis thaliana]
 gb|AHL38706.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1780

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             A +KFTYVV CQIYG QK  ++P+A +I  LM++NEALR+A++DEV
Sbjct  1067  ALMKFTYVVACQIYGSQKAKKEPQAEEILYLMKQNEALRIAYVDEV  1112



>ref|XP_009121761.1| PREDICTED: callose synthase 12 [Brassica rapa]
Length=1783

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             A +KFTYVV CQIYG QK  ++P+A +I  LM++NEALR+A++DEV
Sbjct  1063  ALMKFTYVVACQIYGSQKAKKEPQAEEILYLMKQNEALRIAYVDEV  1108



>emb|CDY21974.1| BnaC09g00800D [Brassica napus]
Length=1783

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             A +KFTYVV CQIYG QK  ++P+A +I  LM++NEALR+A++DEV
Sbjct  1063  ALMKFTYVVACQIYGSQKAKKEPQAEEILYLMKQNEALRIAYVDEV  1108



>emb|CDY48567.1| BnaA09g01630D [Brassica napus]
Length=1783

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             A +KFTYVV CQIYG QK  ++P+A +I  LM++NEALR+A++DEV
Sbjct  1063  ALMKFTYVVACQIYGSQKAKKEPQAEEILYLMKQNEALRIAYVDEV  1108



>gb|EMS50509.1| Callose synthase 11 [Triticum urartu]
Length=1587

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +3

Query  54   ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
            A +K+TYVV CQIYG QK+ + P A DI  LM++NEALRVA++DEV
Sbjct  875  ALMKYTYVVACQIYGNQKKGKDPRAEDILSLMKKNEALRVAYVDEV  920



>emb|CDM84125.1| unnamed protein product [Triticum aestivum]
Length=1792

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             A +K+TYVV CQIYG QK+ + P A DI  LM++NEALRVA++DEV
Sbjct  1080  ALMKYTYVVACQIYGNQKKGKDPRAEDILSLMKKNEALRVAYVDEV  1125



>dbj|BAK06274.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1792

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +3

Query  54    ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEV  191
             A +K+TYVV CQIYG QK+ + P A DI  LM++NEALRVA++DEV
Sbjct  1080  ALMKYTYVVACQIYGNQKKGKDPRAEDILSLMKKNEALRVAYVDEV  1125



>ref|XP_007198905.1| hypothetical protein PRUPE_ppa000167m2g, partial [Prunus persica]
 gb|EMJ00104.1| hypothetical protein PRUPE_ppa000167m2g, partial [Prunus persica]
Length=916

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  54   ADLKFTYVVTCQIYGKQKEDQKPEAADIALLMQRNEALRVAFIDEVETLKD  206
            A +K+TYVV CQIYG QK  + P A +I  LM+ NEALRVA++DEV T +D
Sbjct  204  ALMKYTYVVACQIYGTQKAKKDPHADEILYLMKTNEALRVAYLDEVSTGRD  254



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559716100580