BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP015A06 276 bp,:Filtered

Length=261
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009798124.1|  PREDICTED: eukaryotic translation initiation...  91.7    3e-20   Nicotiana sylvestris
ref|XP_009607084.1|  PREDICTED: eukaryotic translation initiation...  91.3    4e-20   Nicotiana tomentosiformis
ref|XP_009765835.1|  PREDICTED: eukaryotic translation initiation...  88.6    4e-19   Nicotiana sylvestris
ref|XP_009765836.1|  PREDICTED: eukaryotic translation initiation...  88.2    4e-19   Nicotiana sylvestris
ref|XP_009630890.1|  PREDICTED: eukaryotic translation initiation...  87.4    1e-18   Nicotiana tomentosiformis
ref|XP_009630887.1|  PREDICTED: eukaryotic translation initiation...  87.0    1e-18   Nicotiana tomentosiformis
emb|CBI15806.3|  unnamed protein product                              84.7    9e-18   Vitis vinifera
ref|NP_001275197.1|  eukaryotic translation initiation factor 2 s...  80.9    2e-16   Solanum tuberosum [potatoes]
ref|XP_004242476.1|  PREDICTED: eukaryotic translation initiation...  80.9    2e-16   
ref|XP_011080644.1|  PREDICTED: eukaryotic translation initiation...  79.3    9e-16   Sesamum indicum [beniseed]
ref|XP_002265847.1|  PREDICTED: eukaryotic translation initiation...  77.8    2e-15   Vitis vinifera
ref|XP_004490723.1|  PREDICTED: eukaryotic translation initiation...  76.3    1e-14   Cicer arietinum [garbanzo]
ref|XP_010091498.1|  Eukaryotic translation initiation factor 2 s...  75.9    3e-14   Morus notabilis
emb|CDP20490.1|  unnamed protein product                              75.5    6e-14   Coffea canephora [robusta coffee]
ref|XP_004171578.1|  PREDICTED: eukaryotic translation initiation...  73.9    7e-14   
gb|EYU39824.1|  hypothetical protein MIMGU_mgv1a011686mg              73.2    1e-13   Erythranthe guttata [common monkey flower]
gb|AFK38320.1|  unknown                                               72.4    3e-13   Lotus japonicus
gb|AIX10771.1|  eukaryotic translation initiation factor              72.0    3e-13   Panax notoginseng [san-qi]
gb|EYU46028.1|  hypothetical protein MIMGU_mgv1a011687mg              72.0    4e-13   Erythranthe guttata [common monkey flower]
ref|XP_008462075.1|  PREDICTED: eukaryotic translation initiation...  71.2    6e-13   Cucumis melo [Oriental melon]
gb|KDO77370.1|  hypothetical protein CISIN_1g024241mg                 70.5    8e-13   Citrus sinensis [Valencia orange]
gb|KDO77369.1|  hypothetical protein CISIN_1g024241mg                 70.9    8e-13   Citrus sinensis [Valencia orange]
ref|XP_006468484.1|  PREDICTED: eukaryotic translation initiation...  71.2    8e-13   
ref|XP_006468485.1|  PREDICTED: eukaryotic translation initiation...  70.9    9e-13   Citrus sinensis [Valencia orange]
gb|KDO77368.1|  hypothetical protein CISIN_1g024241mg                 70.5    9e-13   Citrus sinensis [Valencia orange]
gb|KDO77372.1|  hypothetical protein CISIN_1g024241mg                 70.1    1e-12   Citrus sinensis [Valencia orange]
ref|XP_006575454.1|  PREDICTED: eukaryotic translation initiation...  70.9    1e-12   
ref|XP_009374394.1|  PREDICTED: eukaryotic translation initiation...  70.5    1e-12   Pyrus x bretschneideri [bai li]
ref|XP_004139463.1|  PREDICTED: eukaryotic translation initiation...  69.7    2e-12   
ref|XP_007142026.1|  hypothetical protein PHAVU_008G246100g           69.3    3e-12   Phaseolus vulgaris [French bean]
ref|XP_002319977.1|  Eukaryotic translation initiation factor 2 b...  69.3    3e-12   Populus trichocarpa [western balsam poplar]
gb|ABK96053.1|  unknown                                               69.3    3e-12   Populus trichocarpa [western balsam poplar]
ref|XP_006596479.1|  PREDICTED: eukaryotic translation initiation...  69.3    3e-12   
ref|XP_010094436.1|  hypothetical protein L484_018806                 67.4    4e-12   Morus notabilis
ref|XP_008349520.1|  PREDICTED: eukaryotic translation initiation...  68.9    4e-12   Malus domestica [apple tree]
ref|XP_008358917.1|  PREDICTED: eukaryotic translation initiation...  68.9    4e-12   Malus domestica [apple tree]
ref|XP_006575455.1|  PREDICTED: eukaryotic translation initiation...  68.6    6e-12   Glycine max [soybeans]
gb|ACU24646.1|  unknown                                               68.6    6e-12   Glycine max [soybeans]
gb|KCW56344.1|  hypothetical protein EUGRSUZ_I02078                   69.3    9e-12   Eucalyptus grandis [rose gum]
ref|XP_008384657.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  67.0    1e-11   Malus domestica [apple tree]
ref|XP_006448701.1|  hypothetical protein CICLE_v10016252mg           67.8    1e-11   Citrus clementina
ref|XP_006448702.1|  hypothetical protein CICLE_v10016252mg           67.8    1e-11   Citrus clementina
ref|XP_008240183.1|  PREDICTED: eukaryotic translation initiation...  67.4    1e-11   Prunus mume [ume]
ref|XP_004288314.1|  PREDICTED: eukaryotic translation initiation...  67.4    1e-11   Fragaria vesca subsp. vesca
ref|XP_011041774.1|  PREDICTED: eukaryotic translation initiation...  67.4    2e-11   Populus euphratica
ref|XP_002325635.2|  Eukaryotic translation initiation factor 2 b...  67.4    2e-11   Populus trichocarpa [western balsam poplar]
ref|XP_003544938.1|  PREDICTED: eukaryotic translation initiation...  67.0    2e-11   Glycine max [soybeans]
ref|XP_007205712.1|  hypothetical protein PRUPE_ppa009930mg           67.0    2e-11   Prunus persica
gb|ACU18955.1|  unknown                                               67.0    2e-11   Glycine max [soybeans]
ref|XP_010261335.1|  PREDICTED: eukaryotic translation initiation...  66.6    3e-11   Nelumbo nucifera [Indian lotus]
ref|XP_010665571.1|  PREDICTED: eukaryotic translation initiation...  66.6    3e-11   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_011021060.1|  PREDICTED: eukaryotic translation initiation...  66.6    3e-11   Populus euphratica
gb|AFK46684.1|  unknown                                               66.2    5e-11   Medicago truncatula
ref|XP_008363376.1|  PREDICTED: eukaryotic translation initiation...  65.9    5e-11   Malus domestica [apple tree]
ref|XP_003616046.1|  Eukaryotic translation initiation factor 2 s...  65.5    5e-11   Medicago truncatula
ref|XP_010029430.1|  PREDICTED: eukaryotic translation initiation...  65.5    7e-11   Eucalyptus grandis [rose gum]
ref|XP_007028531.1|  Eukaryotic translation initiation factor 2 s...  65.5    7e-11   Theobroma cacao [chocolate]
gb|AFK42579.1|  unknown                                               64.7    8e-11   Lotus japonicus
ref|XP_003616045.1|  Eukaryotic translation initiation factor 2 s...  65.9    1e-10   Medicago truncatula
ref|XP_009354996.1|  PREDICTED: eukaryotic translation initiation...  65.1    1e-10   Pyrus x bretschneideri [bai li]
gb|KDP42269.1|  hypothetical protein JCGZ_01593                       64.3    2e-10   Jatropha curcas
gb|AFK44754.1|  unknown                                               64.3    2e-10   Medicago truncatula
pir||T17104  translation initiation factor eIF-2 beta chain - app...  64.7    2e-10
gb|KGN63927.1|  hypothetical protein Csa_1G028050                     61.6    3e-10   Cucumis sativus [cucumbers]
gb|KDP45684.1|  hypothetical protein JCGZ_17291                       63.5    4e-10   Jatropha curcas
ref|XP_010921183.1|  PREDICTED: eukaryotic translation initiation...  63.2    6e-10   Elaeis guineensis
ref|NP_001050023.1|  Os03g0333300                                     62.8    8e-10   
ref|XP_010261490.1|  PREDICTED: eukaryotic translation initiation...  62.4    1e-09   Nelumbo nucifera [Indian lotus]
gb|ABK22171.1|  unknown                                               62.4    1e-09   Picea sitchensis
dbj|BAJ87319.1|  predicted protein                                    62.4    1e-09   Hordeum vulgare subsp. vulgare [barley]
gb|EEC75196.1|  hypothetical protein OsI_11441                        62.8    1e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_006400657.1|  hypothetical protein EUTSA_v10014385mg           62.0    2e-09   Eutrema salsugineum
sp|O24473.1|IF2B_WHEAT  RecName: Full=Eukaryotic translation init...  61.6    2e-09   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001148481.1|  eukaryotic translation initiation factor 2 b...  61.6    2e-09   Zea mays [maize]
ref|XP_002467914.1|  hypothetical protein SORBIDRAFT_01g036250        61.6    2e-09   Sorghum bicolor [broomcorn]
ref|XP_004984478.1|  PREDICTED: eukaryotic translation initiation...  61.2    3e-09   Setaria italica
ref|XP_010274681.1|  PREDICTED: eukaryotic translation initiation...  60.8    4e-09   Nelumbo nucifera [Indian lotus]
ref|XP_004984477.1|  PREDICTED: eukaryotic translation initiation...  60.8    4e-09   
sp|P55871.2|IF2B_MALDO  RecName: Full=Eukaryotic translation init...  60.5    5e-09   Malus domestica [apple tree]
ref|XP_006650040.1|  PREDICTED: eukaryotic translation initiation...  59.3    1e-08   Oryza brachyantha
gb|EEC82694.1|  hypothetical protein OsI_27355                        58.5    2e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_011041776.1|  PREDICTED: eukaryotic translation initiation...  58.5    3e-08   Populus euphratica
ref|NP_001060649.1|  Os07g0681000                                     58.5    3e-08   
ref|XP_010938034.1|  PREDICTED: eukaryotic translation initiation...  57.8    3e-08   Elaeis guineensis
ref|XP_004958710.1|  PREDICTED: eukaryotic translation initiation...  58.2    4e-08   Setaria italica
ref|XP_010938033.1|  PREDICTED: eukaryotic translation initiation...  58.2    4e-08   Elaeis guineensis
gb|ABK21497.1|  unknown                                               57.8    6e-08   Picea sitchensis
ref|XP_006288263.1|  hypothetical protein CARUB_v10001508mg           58.2    7e-08   Capsella rubella
gb|KJB46241.1|  hypothetical protein B456_007G353600                  56.2    9e-08   Gossypium raimondii
gb|KJB46240.1|  hypothetical protein B456_007G353600                  56.2    9e-08   Gossypium raimondii
gb|KJB46242.1|  hypothetical protein B456_007G353600                  55.8    1e-07   Gossypium raimondii
gb|KHG09425.1|  Eukaryotic translation initiation factor 2 subuni...  56.6    1e-07   Gossypium arboreum [tree cotton]
ref|XP_008810847.1|  PREDICTED: eukaryotic translation initiation...  57.0    1e-07   Phoenix dactylifera
ref|XP_010454404.1|  PREDICTED: eukaryotic translation initiation...  57.0    1e-07   Camelina sativa [gold-of-pleasure]
gb|KJB46239.1|  hypothetical protein B456_007G353600                  56.6    2e-07   Gossypium raimondii
ref|NP_001183769.1|  eukaryotic translation initiation factor 2 b...  56.2    2e-07   Zea mays [maize]
ref|XP_009416324.1|  PREDICTED: eukaryotic translation initiation...  56.2    2e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001132460.1|  uncharacterized protein LOC100193916             56.2    2e-07   Zea mays [maize]
ref|XP_004500380.1|  PREDICTED: eukaryotic translation initiation...  56.2    2e-07   Cicer arietinum [garbanzo]
ref|XP_009416325.1|  PREDICTED: eukaryotic translation initiation...  55.8    3e-07   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAK29672.1|AF353095_1  protein synthesis initiation factor eIF...  55.8    3e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AFD22855.1|  eukaryotic translation initiation factor 2A           55.5    4e-07   Tamarix androssowii
ref|XP_002874023.1|  protein synthesis initiation factor eIF2 beta    55.5    5e-07   Arabidopsis lyrata subsp. lyrata
ref|NP_197592.1|  translation initiation factor eIF-2 beta subunit    55.1    6e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010493208.1|  PREDICTED: eukaryotic translation initiation...  55.1    6e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010274679.1|  PREDICTED: eukaryotic translation initiation...  54.7    8e-07   Nelumbo nucifera [Indian lotus]
gb|ACG39147.1|  eukaryotic translation initiation factor 2 beta s...  54.7    8e-07   Zea mays [maize]
ref|XP_009391671.1|  PREDICTED: eukaryotic translation initiation...  54.3    1e-06   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK36776.1|  unknown                                               53.5    1e-06   Medicago truncatula
ref|XP_010420940.1|  PREDICTED: eukaryotic translation initiation...  54.3    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_006858817.1|  hypothetical protein AMTR_s00066p00171460        53.9    1e-06   
ref|XP_009386922.1|  PREDICTED: eukaryotic translation initiation...  53.9    1e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009120755.1|  PREDICTED: eukaryotic translation initiation...  53.5    2e-06   Brassica rapa
gb|ACJ85179.1|  unknown                                               53.5    2e-06   Medicago truncatula
ref|NP_974817.1|  translation initiation factor eIF-2 beta subunit    52.8    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010922773.1|  PREDICTED: eukaryotic translation initiation...  52.0    7e-06   Elaeis guineensis
ref|XP_004137563.1|  PREDICTED: uncharacterized protein LOC101214464  50.1    1e-05   
ref|XP_008788510.1|  PREDICTED: eukaryotic translation initiation...  50.8    2e-05   Phoenix dactylifera
ref|XP_010527148.1|  PREDICTED: eukaryotic translation initiation...  50.8    2e-05   Tarenaya hassleriana [spider flower]
ref|XP_003557971.1|  PREDICTED: eukaryotic translation initiation...  50.1    3e-05   Brachypodium distachyon [annual false brome]
ref|XP_004167234.1|  PREDICTED: uncharacterized protein LOC101224492  48.9    4e-05   
gb|EMS63325.1|  Eukaryotic translation initiation factor 2 subuni...  50.4    4e-05   Triticum urartu
ref|XP_010540870.1|  PREDICTED: eukaryotic translation initiation...  49.3    6e-05   Tarenaya hassleriana [spider flower]
ref|XP_011461395.1|  PREDICTED: eukaryotic translation initiation...  47.8    2e-04   Fragaria vesca subsp. vesca
ref|XP_002317891.1|  hypothetical protein POPTR_0012s04820g           43.9    8e-04   Populus trichocarpa [western balsam poplar]
ref|XP_010670045.1|  PREDICTED: eukaryotic translation initiation...  46.2    8e-04   Beta vulgaris subsp. vulgaris [Swiss chard]



>ref|XP_009798124.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like [Nicotiana sylvestris]
 ref|XP_009798125.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like [Nicotiana sylvestris]
 ref|XP_009798126.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like [Nicotiana sylvestris]
Length=268

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 1/64 (2%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MAEEE QNE+KEEVADIAPFDPTKKKKKKKVVIQDP ADDSVDSLAEKTE+L+VS+GLE 
Sbjct  1    MAEEENQNELKEEVADIAPFDPTKKKKKKKVVIQDP-ADDSVDSLAEKTENLSVSEGLEA  59

Query  250  AFSG  261
             FSG
Sbjct  60   TFSG  63



>ref|XP_009607084.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like [Nicotiana tomentosiformis]
 ref|XP_009607085.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like [Nicotiana tomentosiformis]
 ref|XP_009607086.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like [Nicotiana tomentosiformis]
Length=268

 Score = 91.3 bits (225),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 60/64 (94%), Gaps = 1/64 (2%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MAEEE QNE+KEEVADIAPFDPTKKKKKKKVVIQDP ADDS+DSLAEKTE+L+VS+GLE 
Sbjct  1    MAEEENQNELKEEVADIAPFDPTKKKKKKKVVIQDP-ADDSIDSLAEKTENLSVSEGLEA  59

Query  250  AFSG  261
             FSG
Sbjct  60   TFSG  63



>ref|XP_009765835.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X1 [Nicotiana sylvestris]
Length=268

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 59/64 (92%), Gaps = 1/64 (2%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MAEEE QNE+KEEV DIAPFDPTKKKKKKKVVIQDP ADDSVDSLAEKTE+L+VS+GL+ 
Sbjct  1    MAEEENQNELKEEVTDIAPFDPTKKKKKKKVVIQDP-ADDSVDSLAEKTENLSVSEGLDA  59

Query  250  AFSG  261
             FSG
Sbjct  60   TFSG  63



>ref|XP_009765836.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X2 [Nicotiana sylvestris]
Length=252

 Score = 88.2 bits (217),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 59/64 (92%), Gaps = 1/64 (2%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MAEEE QNE+KEEV DIAPFDPTKKKKKKKVVIQDP ADDSVDSLAEKTE+L+VS+GL+ 
Sbjct  1    MAEEENQNELKEEVTDIAPFDPTKKKKKKKVVIQDP-ADDSVDSLAEKTENLSVSEGLDA  59

Query  250  AFSG  261
             FSG
Sbjct  60   TFSG  63



>ref|XP_009630890.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X2 [Nicotiana tomentosiformis]
Length=250

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 60/68 (88%), Gaps = 5/68 (7%)
 Frame = +1

Query  70   MAEEEIQNEMK----EEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSD  237
            MAEEE Q EMK    +EVADIAPFDPTKKKKKKKVVIQDPA DD VDSLAEKTESL+VS+
Sbjct  1    MAEEEYQKEMKGELQDEVADIAPFDPTKKKKKKKVVIQDPA-DDLVDSLAEKTESLSVSE  59

Query  238  GLETAFSG  261
            GLETAFSG
Sbjct  60   GLETAFSG  67



>ref|XP_009630887.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009630888.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009630889.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X1 [Nicotiana tomentosiformis]
Length=272

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 60/68 (88%), Gaps = 5/68 (7%)
 Frame = +1

Query  70   MAEEEIQNEMK----EEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSD  237
            MAEEE Q EMK    +EVADIAPFDPTKKKKKKKVVIQDPA DD VDSLAEKTESL+VS+
Sbjct  1    MAEEEYQKEMKGELQDEVADIAPFDPTKKKKKKKVVIQDPA-DDLVDSLAEKTESLSVSE  59

Query  238  GLETAFSG  261
            GLETAFSG
Sbjct  60   GLETAFSG  67



>emb|CBI15806.3| unnamed protein product [Vitis vinifera]
Length=290

 Score = 84.7 bits (208),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 65/73 (89%), Gaps = 3/73 (4%)
 Frame = +1

Query  43   SLRQFGGAVMAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTES  222
            +LR FG ++MA+E  QNE+K+EVA++APFDPTKKKKKKKVVIQDP ADDSVD LAEKTES
Sbjct  14   NLRYFG-SIMADEN-QNEVKDEVAELAPFDPTKKKKKKKVVIQDP-ADDSVDKLAEKTES  70

Query  223  LTVSDGLETAFSG  261
            L+VS+G+E  FSG
Sbjct  71   LSVSEGVENTFSG  83



>ref|NP_001275197.1| eukaryotic translation initiation factor 2 subunit beta-like 
[Solanum tuberosum]
 ref|XP_006350889.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X2 [Solanum tuberosum]
 gb|ABB86256.1| eukaryotic translation initiation factor 2 beta subunit-like 
[Solanum tuberosum]
Length=265

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 57/64 (89%), Gaps = 4/64 (6%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MAEEE QNE+   VADIAPFDPTKKKKKKKVVIQDPA DDSVDSLAEKTE+L+VS+GLE 
Sbjct  1    MAEEENQNEL---VADIAPFDPTKKKKKKKVVIQDPA-DDSVDSLAEKTENLSVSEGLEA  56

Query  250  AFSG  261
             FSG
Sbjct  57   TFSG  60



>ref|XP_004242476.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta [Solanum lycopersicum]
Length=265

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 57/64 (89%), Gaps = 4/64 (6%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MAEEE QNE+   VADIAPFDPTKKKKKKKVVIQDPA DDSVDSLAEKTE+L+VS+GLE 
Sbjct  1    MAEEENQNEL---VADIAPFDPTKKKKKKKVVIQDPA-DDSVDSLAEKTENLSVSEGLEA  56

Query  250  AFSG  261
             FSG
Sbjct  57   TFSG  60



>ref|XP_011080644.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta [Sesamum indicum]
Length=274

 Score = 79.3 bits (194),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 57/68 (84%), Gaps = 4/68 (6%)
 Frame = +1

Query  70   MAEEEIQNEMKEEV----ADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSD  237
            MAEEE QNEMKEEV     DIAPFDPTKKKKKKK V QD   ++SVDSLAEKTESL+VSD
Sbjct  1    MAEEENQNEMKEEVKDDVGDIAPFDPTKKKKKKKPVAQDLIEEESVDSLAEKTESLSVSD  60

Query  238  GLETAFSG  261
            GLET+F+G
Sbjct  61   GLETSFTG  68



>ref|XP_002265847.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta [Vitis vinifera]
Length=269

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 58/64 (91%), Gaps = 2/64 (3%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MA+E  QNE+K+EVA++APFDPTKKKKKKKVVIQDP ADDSVD LAEKTESL+VS+G+E 
Sbjct  1    MADEN-QNEVKDEVAELAPFDPTKKKKKKKVVIQDP-ADDSVDKLAEKTESLSVSEGVEN  58

Query  250  AFSG  261
             FSG
Sbjct  59   TFSG  62



>ref|XP_004490723.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X1 [Cicer arietinum]
 ref|XP_004490724.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X2 [Cicer arietinum]
Length=269

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 57/64 (89%), Gaps = 1/64 (2%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MA+E  Q+++KEEVADIAPFDPTKKKKKKK+ I DP  D+SVD LAEKTE+L+VSDG++T
Sbjct  1    MADES-QHDLKEEVADIAPFDPTKKKKKKKITIVDPVDDESVDKLAEKTENLSVSDGIDT  59

Query  250  AFSG  261
            +FSG
Sbjct  60   SFSG  63



>ref|XP_010091498.1| Eukaryotic translation initiation factor 2 subunit beta [Morus 
notabilis]
 gb|EXB44649.1| Eukaryotic translation initiation factor 2 subunit beta [Morus 
notabilis]
Length=346

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 57/58 (98%), Gaps = 1/58 (2%)
 Frame = +1

Query  88   QNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            +NE+KEEVA+IAPFDPTKKKKKKKV+IQDP AD+SV+SLAEKTE+L+VS+G+E++FSG
Sbjct  4    ENEVKEEVAEIAPFDPTKKKKKKKVIIQDP-ADESVESLAEKTENLSVSEGIESSFSG  60



>emb|CDP20490.1| unnamed protein product [Coffea canephora]
Length=400

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 49/66 (74%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = +1

Query  64   AVMAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGL  243
            AV  E   Q E+K+E  DIAPFDPTKKKKKKKVVIQDP ADD V  LAEKTESL+VSDGL
Sbjct  130  AVQEEATAQEEVKDEAGDIAPFDPTKKKKKKKVVIQDP-ADDPVSELAEKTESLSVSDGL  188

Query  244  ETAFSG  261
            ET F+G
Sbjct  189  ETTFAG  194



>ref|XP_004171578.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like [Cucumis sativus]
 gb|KGN64891.1| hypothetical protein Csa_1G145930 [Cucumis sativus]
Length=270

 Score = 73.9 bits (180),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 56/62 (90%), Gaps = 2/62 (3%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETA-F  255
            +E+QN++ ++VADIAPFDPTKKKKKKKVV+QDP  D+SVD LAEKTESL+VSDGLE A F
Sbjct  3    DEVQNDVNDQVADIAPFDPTKKKKKKKVVLQDP-TDESVDKLAEKTESLSVSDGLEAATF  61

Query  256  SG  261
            SG
Sbjct  62   SG  63



>gb|EYU39824.1| hypothetical protein MIMGU_mgv1a011686mg [Erythranthe guttata]
Length=274

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 56/68 (82%), Gaps = 4/68 (6%)
 Frame = +1

Query  70   MAEEEIQNEMKEEV----ADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSD  237
            MAEEE QN +KEEV     DIAPFDPTKKKKKKK V QD A D+SV++L EKTESL+VS+
Sbjct  1    MAEEENQNGIKEEVKDDVGDIAPFDPTKKKKKKKPVAQDLAEDESVNNLVEKTESLSVSE  60

Query  238  GLETAFSG  261
            GLET+F+G
Sbjct  61   GLETSFAG  68



>gb|AFK38320.1| unknown [Lotus japonicus]
Length=268

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 54/62 (87%), Gaps = 1/62 (2%)
 Frame = +1

Query  76   EEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAF  255
            E+E QN+MKEEVA+ AP D TKKKKKKK+ I DPA DDSVD LAEKTE+L+VSDG+ETAF
Sbjct  2    EDESQNDMKEEVAEFAPLDMTKKKKKKKITIVDPA-DDSVDKLAEKTENLSVSDGVETAF  60

Query  256  SG  261
            +G
Sbjct  61   AG  62



>gb|AIX10771.1| eukaryotic translation initiation factor, partial [Panax notoginseng]
Length=269

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 51/60 (85%), Gaps = 1/60 (2%)
 Frame = +1

Query  82   EIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            E++ E+KE+  DIAPFDPTKKKKKKKVVIQDP  DD VD L EKTESL V+DGL+TAFSG
Sbjct  4    EVKEEVKEDAPDIAPFDPTKKKKKKKVVIQDPT-DDPVDQLVEKTESLAVTDGLDTAFSG  62



>gb|EYU46028.1| hypothetical protein MIMGU_mgv1a011687mg [Erythranthe guttata]
 gb|EYU46029.1| hypothetical protein MIMGU_mgv1a011687mg [Erythranthe guttata]
Length=274

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 57/68 (84%), Gaps = 4/68 (6%)
 Frame = +1

Query  70   MAEEEIQNEMKEE----VADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSD  237
            MA+EE +NE+KEE    V DIAPFDPTKKKKKKK V QD A ++SVD+LAEK ES++VSD
Sbjct  1    MADEENRNEVKEEIKDDVGDIAPFDPTKKKKKKKPVAQDLAEEESVDTLAEKVESVSVSD  60

Query  238  GLETAFSG  261
            GLET+F+G
Sbjct  61   GLETSFAG  68



>ref|XP_008462075.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta [Cucumis melo]
 ref|XP_008462082.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta [Cucumis melo]
Length=270

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 55/62 (89%), Gaps = 2/62 (3%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLE-TAF  255
            +E+QN++ ++VADIAPFDPTKKKKKKKVV+QDP  D+ VD LAEKTESL+VSDGLE T F
Sbjct  3    DEVQNDVTDQVADIAPFDPTKKKKKKKVVLQDP-TDEIVDKLAEKTESLSVSDGLETTTF  61

Query  256  SG  261
            SG
Sbjct  62   SG  63



>gb|KDO77370.1| hypothetical protein CISIN_1g024241mg [Citrus sinensis]
 gb|KDO77371.1| hypothetical protein CISIN_1g024241mg [Citrus sinensis]
Length=186

 Score = 70.5 bits (171),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 56/61 (92%), Gaps = 1/61 (2%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFS  258
            +E Q ++K+EVA++APFDPTKKKKKKKVVIQDP+ DDSVD LAEKTE+L+VS+GLE+ F+
Sbjct  3    DENQVDVKDEVAELAPFDPTKKKKKKKVVIQDPS-DDSVDKLAEKTETLSVSEGLESTFT  61

Query  259  G  261
            G
Sbjct  62   G  62



>gb|KDO77369.1| hypothetical protein CISIN_1g024241mg [Citrus sinensis]
Length=239

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 56/61 (92%), Gaps = 1/61 (2%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFS  258
            +E Q ++K+EVA++APFDPTKKKKKKKVVIQDP+ DDSVD LAEKTE+L+VS+GLE+ F+
Sbjct  3    DENQVDVKDEVAELAPFDPTKKKKKKKVVIQDPS-DDSVDKLAEKTETLSVSEGLESTFT  61

Query  259  G  261
            G
Sbjct  62   G  62



>ref|XP_006468484.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X1 [Citrus sinensis]
Length=298

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 58/66 (88%), Gaps = 2/66 (3%)
 Frame = +1

Query  64   AVMAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGL  243
            A M +E  Q ++K+EVA++APFDPTKKKKKKKVVIQDP+ DDSVD LAEKTE+L+VS+GL
Sbjct  27   ATMTDEN-QVDVKDEVAELAPFDPTKKKKKKKVVIQDPS-DDSVDKLAEKTETLSVSEGL  84

Query  244  ETAFSG  261
            E+ F+G
Sbjct  85   ESTFTG  90



>ref|XP_006468485.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X2 [Citrus sinensis]
 gb|KDO77367.1| hypothetical protein CISIN_1g024241mg [Citrus sinensis]
Length=270

 Score = 70.9 bits (172),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 56/61 (92%), Gaps = 1/61 (2%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFS  258
            +E Q ++K+EVA++APFDPTKKKKKKKVVIQDP+ DDSVD LAEKTE+L+VS+GLE+ F+
Sbjct  3    DENQVDVKDEVAELAPFDPTKKKKKKKVVIQDPS-DDSVDKLAEKTETLSVSEGLESTFT  61

Query  259  G  261
            G
Sbjct  62   G  62



>gb|KDO77368.1| hypothetical protein CISIN_1g024241mg [Citrus sinensis]
Length=258

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 56/61 (92%), Gaps = 1/61 (2%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFS  258
            +E Q ++K+EVA++APFDPTKKKKKKKVVIQDP+ DDSVD LAEKTE+L+VS+GLE+ F+
Sbjct  3    DENQVDVKDEVAELAPFDPTKKKKKKKVVIQDPS-DDSVDKLAEKTETLSVSEGLESTFT  61

Query  259  G  261
            G
Sbjct  62   G  62



>gb|KDO77372.1| hypothetical protein CISIN_1g024241mg [Citrus sinensis]
Length=180

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 56/61 (92%), Gaps = 1/61 (2%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFS  258
            +E Q ++K+EVA++APFDPTKKKKKKKVVIQDP+ DDSVD LAEKTE+L+VS+GLE+ F+
Sbjct  3    DENQVDVKDEVAELAPFDPTKKKKKKKVVIQDPS-DDSVDKLAEKTETLSVSEGLESTFT  61

Query  259  G  261
            G
Sbjct  62   G  62



>ref|XP_006575454.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X1 [Glycine max]
Length=280

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 56/66 (85%), Gaps = 2/66 (3%)
 Frame = +1

Query  64   AVMAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGL  243
            A+MA+E   NEMKEEV +I PFDPTKKKKKKK+ I DPA DD V+ LAEKTE+L+VS+G+
Sbjct  11   AIMADE-TPNEMKEEVPEIVPFDPTKKKKKKKITIVDPA-DDPVEKLAEKTENLSVSEGV  68

Query  244  ETAFSG  261
            ETAF+G
Sbjct  69   ETAFAG  74



>ref|XP_009374394.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like [Pyrus x bretschneideri]
Length=271

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 53/59 (90%), Gaps = 2/59 (3%)
 Frame = +1

Query  88   QNEMKEEV-ADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            QNE+K+EV ADIAPFDPTKKKKKKKVVIQD   DDSVD LAEKTE+LTVS+G E+AF+G
Sbjct  6    QNEVKDEVVADIAPFDPTKKKKKKKVVIQD-TTDDSVDKLAEKTETLTVSEGQESAFTG  63



>ref|XP_004139463.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like [Cucumis sativus]
Length=269

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 55/62 (89%), Gaps = 3/62 (5%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETA-F  255
            +E+QN++ ++VADIAPFDPTKKKKKK VV+QDP  D+SVD LAEKTESL+VSDGLE A F
Sbjct  3    DEVQNDVNDQVADIAPFDPTKKKKKK-VVLQDPT-DESVDKLAEKTESLSVSDGLEAATF  60

Query  256  SG  261
            SG
Sbjct  61   SG  62



>ref|XP_007142026.1| hypothetical protein PHAVU_008G246100g [Phaseolus vulgaris]
 gb|ESW14020.1| hypothetical protein PHAVU_008G246100g [Phaseolus vulgaris]
Length=268

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 52/61 (85%), Gaps = 1/61 (2%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFS  258
            +E QNE+KEEV +I PFDPTKKKKKKK+ I DPA DD V+ LAEKT++LTVSDG+E AF+
Sbjct  3    DEAQNELKEEVPEIVPFDPTKKKKKKKITIVDPA-DDPVEKLAEKTDNLTVSDGVEAAFT  61

Query  259  G  261
            G
Sbjct  62   G  62



>ref|XP_002319977.1| Eukaryotic translation initiation factor 2 beta subunit family 
protein [Populus trichocarpa]
 gb|EEE95900.1| Eukaryotic translation initiation factor 2 beta subunit family 
protein [Populus trichocarpa]
Length=270

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 54/56 (96%), Gaps = 1/56 (2%)
 Frame = +1

Query  94   EMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            ++K+EVA++APFDPTKKKKKKKVVIQ+  AD+SVDSLAEKTESL+VSDGLE++F+G
Sbjct  7    DLKDEVAELAPFDPTKKKKKKKVVIQE-NADESVDSLAEKTESLSVSDGLESSFTG  61



>gb|ABK96053.1| unknown [Populus trichocarpa]
Length=270

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 54/56 (96%), Gaps = 1/56 (2%)
 Frame = +1

Query  94   EMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            ++K+EVA++APFDPTKKKKK+KVVIQ+  AD+SVDSLAEKTESL+VSDGLE++F+G
Sbjct  7    DLKDEVAELAPFDPTKKKKKEKVVIQE-NADESVDSLAEKTESLSVSDGLESSFTG  61



>ref|XP_006596479.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X2 [Glycine max]
Length=273

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 56/66 (85%), Gaps = 2/66 (3%)
 Frame = +1

Query  64   AVMAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGL  243
            A+MA+E   NEMKEEV +I PFDPTKKKKKKK+ I DPA D+ V+ LAEKTE+L+VS+G+
Sbjct  4    AIMADE-TPNEMKEEVPEIVPFDPTKKKKKKKITIVDPA-DEPVEKLAEKTENLSVSEGV  61

Query  244  ETAFSG  261
            ETAF+G
Sbjct  62   ETAFTG  67



>ref|XP_010094436.1| hypothetical protein L484_018806 [Morus notabilis]
 gb|EXB56017.1| hypothetical protein L484_018806 [Morus notabilis]
Length=120

 Score = 67.4 bits (163),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +1

Query  88   QNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            +NE+K+EVA+IA FDPTKKKKKKKVV QD A DD+V++LAEKTE+L+VSDGLE  FSG
Sbjct  4    ENELKDEVAEIAQFDPTKKKKKKKVVFQD-AVDDAVENLAEKTENLSVSDGLEGTFSG  60



>ref|XP_008349520.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta [Malus domestica]
Length=252

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 52/59 (88%), Gaps = 2/59 (3%)
 Frame = +1

Query  88   QNEMKEEV-ADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            QNE+K+EV ADIAPFDPTKKKKKKKVVIQD   DDSVD LAEKTE+LTVS+G E+ F+G
Sbjct  6    QNEVKDEVVADIAPFDPTKKKKKKKVVIQD-TTDDSVDKLAEKTETLTVSEGQESTFTG  63



>ref|XP_008358917.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta [Malus domestica]
Length=271

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 52/59 (88%), Gaps = 2/59 (3%)
 Frame = +1

Query  88   QNEMKEEV-ADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            QNE+K+EV ADIAPFDPTKKKKKKKVVIQD   DDSVD LAEKTE+LTVS+G E+ F+G
Sbjct  6    QNEVKDEVVADIAPFDPTKKKKKKKVVIQD-TTDDSVDKLAEKTETLTVSEGQESTFTG  63



>ref|XP_006575455.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X2 [Glycine max]
 gb|KHN40995.1| Eukaryotic translation initiation factor 2 subunit beta [Glycine 
soja]
Length=268

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 52/61 (85%), Gaps = 1/61 (2%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFS  258
            +E  NEMKEEV +I PFDPTKKKKKKK+ I DPA DD V+ LAEKTE+L+VS+G+ETAF+
Sbjct  3    DETPNEMKEEVPEIVPFDPTKKKKKKKITIVDPA-DDPVEKLAEKTENLSVSEGVETAFA  61

Query  259  G  261
            G
Sbjct  62   G  62



>gb|ACU24646.1| unknown [Glycine max]
Length=268

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 52/61 (85%), Gaps = 1/61 (2%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFS  258
            +E  NEMKEEV +I PFDPTKKKKKKK+ I DPA DD V+ LAEKTE+L+VS+G+ETAF+
Sbjct  3    DETPNEMKEEVPEIVPFDPTKKKKKKKITIVDPA-DDPVEKLAEKTENLSVSEGVETAFA  61

Query  259  G  261
            G
Sbjct  62   G  62



>gb|KCW56344.1| hypothetical protein EUGRSUZ_I02078 [Eucalyptus grandis]
Length=354

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 45/69 (65%), Positives = 59/69 (86%), Gaps = 2/69 (3%)
 Frame = +1

Query  55   FGGAVMAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVS  234
             G A+MA++    ++KEEVA++APFDPTKKKKKKK V+QD  ADDSVD LAEKTE+L+VS
Sbjct  81   LGKAIMADDN-SVDVKEEVAELAPFDPTKKKKKKKNVVQD-LADDSVDKLAEKTETLSVS  138

Query  235  DGLETAFSG  261
            DGL+++F+G
Sbjct  139  DGLDSSFAG  147



>ref|XP_008384657.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 2 subunit beta-like [Malus domestica]
Length=170

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 2/59 (3%)
 Frame = +1

Query  88   QNEMKEEV-ADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            QNE+K+EV A+IAPFDPTKKKKKKKVVIQD   DDSVD LAEKTE+LTVS+G E+ F+G
Sbjct  6    QNEVKDEVVANIAPFDPTKKKKKKKVVIQD-TTDDSVDKLAEKTETLTVSEGQESTFTG  63



>ref|XP_006448701.1| hypothetical protein CICLE_v10016252mg [Citrus clementina]
 gb|ESR61941.1| hypothetical protein CICLE_v10016252mg [Citrus clementina]
Length=258

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 55/61 (90%), Gaps = 1/61 (2%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFS  258
            +E Q ++K+EVA++APFDPTKKKKKKKVVIQDP +DDSVD LAE TE+L+VS+GLE+ F+
Sbjct  3    DENQVDVKDEVAELAPFDPTKKKKKKKVVIQDP-SDDSVDKLAEITETLSVSEGLESTFT  61

Query  259  G  261
            G
Sbjct  62   G  62



>ref|XP_006448702.1| hypothetical protein CICLE_v10016252mg [Citrus clementina]
 ref|XP_006448703.1| hypothetical protein CICLE_v10016252mg [Citrus clementina]
 gb|ESR61942.1| hypothetical protein CICLE_v10016252mg [Citrus clementina]
 gb|ESR61943.1| hypothetical protein CICLE_v10016252mg [Citrus clementina]
Length=270

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 55/61 (90%), Gaps = 1/61 (2%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFS  258
            +E Q ++K+EVA++APFDPTKKKKKKKVVIQDP +DDSVD LAE TE+L+VS+GLE+ F+
Sbjct  3    DENQVDVKDEVAELAPFDPTKKKKKKKVVIQDP-SDDSVDKLAEITETLSVSEGLESTFT  61

Query  259  G  261
            G
Sbjct  62   G  62



>ref|XP_008240183.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta [Prunus mume]
Length=271

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 50/59 (85%), Gaps = 2/59 (3%)
 Frame = +1

Query  88   QNEMKEEVA-DIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            QNE+K+EV  DIAPFDPTKKKKKKKVVIQD   DDSVD LAEKTE+L VSDG E+ FSG
Sbjct  6    QNEVKDEVVPDIAPFDPTKKKKKKKVVIQD-NTDDSVDKLAEKTENLAVSDGQESTFSG  63



>ref|XP_004288314.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta [Fragaria vesca subsp. vesca]
 ref|XP_011466581.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta [Fragaria vesca subsp. vesca]
Length=270

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 54/60 (90%), Gaps = 3/60 (5%)
 Frame = +1

Query  88   QNEMKEEVA--DIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            QN++KEEVA  D+APFDP+KKKKKKKVVI+DPA DDSVD LAEKTESL VS+G +++F+G
Sbjct  5    QNDVKEEVALADVAPFDPSKKKKKKKVVIEDPA-DDSVDKLAEKTESLAVSEGQDSSFTG  63



>ref|XP_011041774.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X1 [Populus euphratica]
 ref|XP_011041775.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X1 [Populus euphratica]
Length=270

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 59/64 (92%), Gaps = 3/64 (5%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MA+E I  ++K+EVA++APFDPTKKKKKKKVVIQ+  +D++VDSLA+KTESL+VSDGLE+
Sbjct  1    MADESI--DVKDEVAELAPFDPTKKKKKKKVVIQE-NSDEAVDSLADKTESLSVSDGLES  57

Query  250  AFSG  261
            +F+G
Sbjct  58   SFTG  61



>ref|XP_002325635.2| Eukaryotic translation initiation factor 2 beta subunit family 
protein [Populus trichocarpa]
 gb|EEF00017.2| Eukaryotic translation initiation factor 2 beta subunit family 
protein [Populus trichocarpa]
Length=271

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 59/64 (92%), Gaps = 3/64 (5%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MA+E I  ++K+EVA++APFDPTKKKKKKKVVIQ+  AD++VDSLA+KTESL+VSDGLE+
Sbjct  1    MADEII--DVKDEVAELAPFDPTKKKKKKKVVIQE-NADEAVDSLADKTESLSVSDGLES  57

Query  250  AFSG  261
            +F+G
Sbjct  58   SFTG  61



>ref|XP_003544938.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X1 [Glycine max]
 gb|KHN30612.1| Eukaryotic translation initiation factor 2 subunit beta [Glycine 
soja]
Length=268

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 52/61 (85%), Gaps = 1/61 (2%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFS  258
            +E  NEMKEEV +I PFDPTKKKKKKK+ I DPA D+ V+ LAEKTE+L+VS+G+ETAF+
Sbjct  3    DETPNEMKEEVPEIVPFDPTKKKKKKKITIVDPA-DEPVEKLAEKTENLSVSEGVETAFT  61

Query  259  G  261
            G
Sbjct  62   G  62



>ref|XP_007205712.1| hypothetical protein PRUPE_ppa009930mg [Prunus persica]
 gb|EMJ06911.1| hypothetical protein PRUPE_ppa009930mg [Prunus persica]
Length=271

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 50/59 (85%), Gaps = 2/59 (3%)
 Frame = +1

Query  88   QNEMKEEVA-DIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            QNE+K+EV  DIAPFDPTKKKKKKKVVIQD   DDSVD LAEKTE+L VSDG E+ FSG
Sbjct  6    QNEVKDEVVPDIAPFDPTKKKKKKKVVIQD-INDDSVDKLAEKTENLAVSDGQESTFSG  63



>gb|ACU18955.1| unknown [Glycine max]
Length=268

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 52/61 (85%), Gaps = 1/61 (2%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFS  258
            +E  NEMKEEV +I PFDPTKKKKKKK+ I DPA D+ V+ LAEKTE+L+VS+G+ETAF+
Sbjct  3    DETPNEMKEEVPEIVPFDPTKKKKKKKITIVDPA-DEPVEKLAEKTENLSVSEGVETAFT  61

Query  259  G  261
            G
Sbjct  62   G  62



>ref|XP_010261335.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta isoform X1 [Nelumbo nucifera]
 ref|XP_010261413.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta isoform X1 [Nelumbo nucifera]
Length=269

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 53/61 (87%), Gaps = 1/61 (2%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFS  258
            EE   ++KE+V ++APFDPTKKKKKKKVVIQDPA D+SVD LAEKTE+L+VSDG+E  F+
Sbjct  3    EEAPVDLKEDVPELAPFDPTKKKKKKKVVIQDPA-DESVDKLAEKTENLSVSDGVENTFA  61

Query  259  G  261
            G
Sbjct  62   G  62



>ref|XP_010665571.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like [Beta vulgaris subsp. vulgaris]
Length=273

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MA E+   E+KEE+ DI PFDP+KKKKKKKVVIQD  AD+ V+ LAEKTE+L+VSDG+E 
Sbjct  1    MASEDNTTELKEEIPDIVPFDPSKKKKKKKVVIQD-IADEPVEKLAEKTENLSVSDGVEN  59

Query  250  AFSG  261
            +F+G
Sbjct  60   SFAG  63



>ref|XP_011021060.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like [Populus euphratica]
Length=270

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 53/56 (95%), Gaps = 1/56 (2%)
 Frame = +1

Query  94   EMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            ++K+EVA++APFDPTKKKKKKKVVIQ+  AD+ VDSLAEKTESL+VSDGLE++F+G
Sbjct  7    DIKDEVAELAPFDPTKKKKKKKVVIQE-NADEPVDSLAEKTESLSVSDGLESSFTG  61



>gb|AFK46684.1| unknown [Medicago truncatula]
Length=274

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFS  258
            +E  + +KEEV DIAPFDPTKKKKKKKV + DPA D+S D LAEK E+L+VSDG ++AFS
Sbjct  3    DETPSGLKEEVPDIAPFDPTKKKKKKKVTVIDPADDESADKLAEKIENLSVSDGTDSAFS  62

Query  259  G  261
            G
Sbjct  63   G  63



>ref|XP_008363376.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta [Malus domestica]
 ref|XP_008363377.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta [Malus domestica]
Length=271

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 51/59 (86%), Gaps = 2/59 (3%)
 Frame = +1

Query  88   QNEMKEEV-ADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            QNE+K+EV ADIAPFDPTKKKKKKKVVIQD   DDSV+ LAEK ESLTVS+G E+ F+G
Sbjct  6    QNEVKDEVVADIAPFDPTKKKKKKKVVIQD-TTDDSVEKLAEKAESLTVSEGQESTFAG  63



>ref|XP_003616046.1| Eukaryotic translation initiation factor 2 subunit [Medicago 
truncatula]
 gb|AES99004.1| eukaryotic translation initiation factor 2 subunit beta [Medicago 
truncatula]
Length=230

 Score = 65.5 bits (158),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFS  258
            +E  + +KEEV DIAPFDPTKKKKKKKV + DPA D+S D LAEK E+L+VSDG ++AFS
Sbjct  51   DETPSGLKEEVPDIAPFDPTKKKKKKKVTVIDPADDESADKLAEKIENLSVSDGTDSAFS  110

Query  259  G  261
            G
Sbjct  111  G  111



>ref|XP_010029430.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta [Eucalyptus grandis]
 ref|XP_010029432.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta [Eucalyptus grandis]
Length=269

 Score = 65.5 bits (158),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 52/56 (93%), Gaps = 1/56 (2%)
 Frame = +1

Query  94   EMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            ++KEEVA++APFDPTKKKKKKK V+QD  ADDSVD LAEKTE+L+VSDGL+++F+G
Sbjct  8    DVKEEVAELAPFDPTKKKKKKKNVVQD-LADDSVDKLAEKTETLSVSDGLDSSFAG  62



>ref|XP_007028531.1| Eukaryotic translation initiation factor 2 subunit beta [Theobroma 
cacao]
 gb|EOY09033.1| Eukaryotic translation initiation factor 2 subunit beta [Theobroma 
cacao]
Length=264

 Score = 65.5 bits (158),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 49/52 (94%), Gaps = 1/52 (2%)
 Frame = +1

Query  91   NEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLE  246
            +E+K+EVA+I PFDPTKKKKKKKVVIQDP ADDSVD LAEKTE+L+VSDGL+
Sbjct  4    DEVKDEVAEITPFDPTKKKKKKKVVIQDP-ADDSVDKLAEKTEALSVSDGLD  54



>gb|AFK42579.1| unknown [Lotus japonicus]
Length=195

 Score = 64.7 bits (156),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 52/61 (85%), Gaps = 1/61 (2%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFS  258
            +E Q ++KEEV +I PFDPTKKKKKKK+ I DPA DDSVD LAEKTE+L+VS+G+E+ F+
Sbjct  3    DEAQADLKEEVPEIVPFDPTKKKKKKKITIVDPA-DDSVDKLAEKTENLSVSEGVESTFT  61

Query  259  G  261
            G
Sbjct  62   G  62



>ref|XP_003616045.1| Eukaryotic translation initiation factor 2 subunit [Medicago 
truncatula]
 gb|AES99003.1| eukaryotic translation initiation factor 2 subunit beta [Medicago 
truncatula]
Length=322

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFS  258
            +E  + +KEEV DIAPFDPTKKKKKKKV + DPA D+S D LAEK E+L+VSDG ++AFS
Sbjct  51   DETPSGLKEEVPDIAPFDPTKKKKKKKVTVIDPADDESADKLAEKIENLSVSDGTDSAFS  110

Query  259  G  261
            G
Sbjct  111  G  111



>ref|XP_009354996.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta [Pyrus x bretschneideri]
 ref|XP_009355001.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta [Pyrus x bretschneideri]
Length=271

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 51/59 (86%), Gaps = 2/59 (3%)
 Frame = +1

Query  88   QNEMKEEV-ADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            QNE+K+EV ADIAPFDPTKKKKKKKVVIQD   DDSV+ L+EK ESLTVS+G E+ F+G
Sbjct  6    QNEVKDEVVADIAPFDPTKKKKKKKVVIQD-TTDDSVEKLSEKAESLTVSEGQESTFAG  63



>gb|KDP42269.1| hypothetical protein JCGZ_01593 [Jatropha curcas]
Length=269

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +1

Query  91   NEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            N +K+EVA++APFDPTKKKKKKK V QD +ADDSVD L EKTESL+VS+GLE+ F+G
Sbjct  6    NNVKDEVAELAPFDPTKKKKKKKPVAQD-SADDSVDKLTEKTESLSVSEGLESTFTG  61



>gb|AFK44754.1| unknown [Medicago truncatula]
Length=274

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFS  258
            +E  + +KEEV DIAPFDPTKKKKKKKV + DPA D+S D L EK E+L+VSDG ++AFS
Sbjct  3    DETPSGLKEEVPDIAPFDPTKKKKKKKVTVIDPADDESADKLVEKIENLSVSDGTDSAFS  62

Query  259  G  261
            G
Sbjct  63   G  63



>pir||T17104 translation initiation factor eIF-2 beta chain - apple tree  
(fragment)
 gb|AAC06384.1| translation initiation factor 2 beta, partial [Malus domestica]
Length=307

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = +1

Query  43   SLRQFGGAVMAEEEIQNEMKEEV-ADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTE  219
            +LR+    +MA++  QNE+K+EV ADIAPFDPTKKKKKK+VVIQD   DDSV  LAEK E
Sbjct  28   ALRRRRTYIMADDN-QNEVKDEVVADIAPFDPTKKKKKKEVVIQD-TTDDSVGKLAEKAE  85

Query  220  SLTVSDGLETAFSG  261
            + T S+G E+ F+G
Sbjct  86   ACTASEGQESTFAG  99



>gb|KGN63927.1| hypothetical protein Csa_1G028050 [Cucumis sativus]
Length=73

 Score = 61.6 bits (148),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 3/63 (5%)
 Frame = +1

Query  76   EEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLE-TA  252
            E+E+QN+  ++VADIA FDPTKKKKKKKVV+QD   D+ VD LAEKTESL+VSDGLE T 
Sbjct  2    EDEVQNDANDQVADIA-FDPTKKKKKKKVVLQDRT-DEIVDKLAEKTESLSVSDGLETTT  59

Query  253  FSG  261
            FSG
Sbjct  60   FSG  62



>gb|KDP45684.1| hypothetical protein JCGZ_17291 [Jatropha curcas]
Length=269

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 50/55 (91%), Gaps = 1/55 (2%)
 Frame = +1

Query  97   MKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            +K+EVA++APFDPTKKKKKKK V+QD +ADDSVD L EKTESL+VS+GLE+ F+G
Sbjct  8    VKDEVAELAPFDPTKKKKKKKPVLQD-SADDSVDKLTEKTESLSVSEGLESTFTG  61



>ref|XP_010921183.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like [Elaeis guineensis]
Length=266

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 3/64 (5%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MAEE    EMKEEV ++APFDPTKKKKKKKVVIQDPA  D VD LAEKTE+LTV++  E 
Sbjct  1    MAEEN-PAEMKEEVPEVAPFDPTKKKKKKKVVIQDPA--DDVDKLAEKTENLTVAESGEL  57

Query  250  AFSG  261
            +F G
Sbjct  58   SFVG  61



>ref|NP_001050023.1| Os03g0333300 [Oryza sativa Japonica Group]
 gb|ABF95783.1| Eukaryotic translation initiation factor 2 beta subunit, putative, 
expressed [Oryza sativa Japonica Group]
 gb|ABF95785.1| Eukaryotic translation initiation factor 2 beta subunit, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF11937.1| Os03g0333300 [Oryza sativa Japonica Group]
 dbj|BAG93351.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75193.1| hypothetical protein OsI_11432 [Oryza sativa Indica Group]
 gb|EEE59006.1| hypothetical protein OsJ_10726 [Oryza sativa Japonica Group]
Length=270

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 3/64 (5%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MA+EE Q E KEEV+++ PFDPTKKKKKKKVVIQDP+  D VD LAEKTESLTV++  E 
Sbjct  1    MADEE-QVERKEEVSELTPFDPTKKKKKKKVVIQDPS--DEVDKLAEKTESLTVAETGEP  57

Query  250  AFSG  261
            +F+G
Sbjct  58   SFTG  61



>ref|XP_010261490.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta isoform X2 [Nelumbo nucifera]
Length=265

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 44/48 (92%), Gaps = 1/48 (2%)
 Frame = +1

Query  118  IAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            +APFDPTKKKKKKKVVIQDPA D+SVD LAEKTE+L+VSDG+E  F+G
Sbjct  12   LAPFDPTKKKKKKKVVIQDPA-DESVDKLAEKTENLSVSDGVENTFAG  58



>gb|ABK22171.1| unknown [Picea sitchensis]
Length=272

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            M EEE   E+KEEV ++APFDPTKKKKKKKV++QD A D++ + + EK E+L+V+DGL++
Sbjct  1    MVEEEAPLELKEEVTELAPFDPTKKKKKKKVLVQD-AGDEATEKVTEKMENLSVTDGLDS  59

Query  250  AFSG  261
            AF+G
Sbjct  60   AFTG  63



>dbj|BAJ87319.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=270

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 51/64 (80%), Gaps = 3/64 (5%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MA+EE Q E KEE  +IAPFDPTKKKKKKKVVIQDPA  D VD LAEKTE L+V++  E 
Sbjct  1    MADEE-QMERKEEATEIAPFDPTKKKKKKKVVIQDPA--DEVDKLAEKTEGLSVTESGEP  57

Query  250  AFSG  261
            +F+G
Sbjct  58   SFAG  61



>gb|EEC75196.1| hypothetical protein OsI_11441 [Oryza sativa Indica Group]
Length=344

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 3/64 (5%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MA+EE Q E KEEV+++ PFDPTKKKKKKKVVIQDP+  D VD LAEKTESLTV++  E 
Sbjct  1    MADEE-QVERKEEVSELTPFDPTKKKKKKKVVIQDPS--DEVDKLAEKTESLTVAETGEP  57

Query  250  AFSG  261
            +F+G
Sbjct  58   SFTG  61



>ref|XP_006400657.1| hypothetical protein EUTSA_v10014385mg [Eutrema salsugineum]
 ref|XP_006400658.1| hypothetical protein EUTSA_v10014385mg [Eutrema salsugineum]
 ref|XP_006400659.1| hypothetical protein EUTSA_v10014385mg [Eutrema salsugineum]
 ref|XP_006400660.1| hypothetical protein EUTSA_v10014385mg [Eutrema salsugineum]
 gb|ESQ42110.1| hypothetical protein EUTSA_v10014385mg [Eutrema salsugineum]
 gb|ESQ42111.1| hypothetical protein EUTSA_v10014385mg [Eutrema salsugineum]
 gb|ESQ42112.1| hypothetical protein EUTSA_v10014385mg [Eutrema salsugineum]
 gb|ESQ42113.1| hypothetical protein EUTSA_v10014385mg [Eutrema salsugineum]
Length=270

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 54/67 (81%), Gaps = 6/67 (9%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVAD---IAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDG  240
            MA+E   NEMKEEV D   +APFDPTKKKKKKKVV+QDP  +DS +S AEK++SL  SDG
Sbjct  1    MADE--NNEMKEEVKDEQELAPFDPTKKKKKKKVVLQDPI-EDSTESQAEKSDSLPASDG  57

Query  241  LETAFSG  261
            LE++F+G
Sbjct  58   LESSFAG  64



>sp|O24473.1|IF2B_WHEAT RecName: Full=Eukaryotic translation initiation factor 2 subunit 
beta; Short=eIF-2-beta; AltName: Full=P38 [Triticum aestivum]
 gb|AAB65774.1| eIF-2 beta subunit [Triticum aestivum]
Length=270

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MA+EE Q E KEE  +IAPFDPTKKKKKKKVVIQDPA  D VD LAEKTE L+V++  E 
Sbjct  1    MADEE-QMERKEEATEIAPFDPTKKKKKKKVVIQDPA--DEVDKLAEKTEGLSVTESGEA  57

Query  250  AFSG  261
            +F G
Sbjct  58   SFVG  61



>ref|NP_001148481.1| eukaryotic translation initiation factor 2 beta subunit [Zea 
mays]
 gb|ACG31675.1| eukaryotic translation initiation factor 2 beta subunit [Zea 
mays]
 tpg|DAA45218.1| TPA: eukaryotic translation initiation factor 2 beta subunit 
[Zea mays]
Length=272

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 54/64 (84%), Gaps = 3/64 (5%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MA++E Q E KEEV ++APFDPTKKKKKKKVVIQ+P+  D VD+LAEKTESLTV++  E 
Sbjct  1    MADDE-QAEKKEEVPELAPFDPTKKKKKKKVVIQEPS--DEVDNLAEKTESLTVTESSEP  57

Query  250  AFSG  261
            +F+G
Sbjct  58   SFAG  61



>ref|XP_002467914.1| hypothetical protein SORBIDRAFT_01g036250 [Sorghum bicolor]
 gb|EER94912.1| hypothetical protein SORBIDRAFT_01g036250 [Sorghum bicolor]
Length=272

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 54/64 (84%), Gaps = 3/64 (5%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MA++E Q E KEEV ++APFDPTKKKKKKKVVIQ+P+  D VD+LAEKTESLTV++  E 
Sbjct  1    MADDE-QAERKEEVPELAPFDPTKKKKKKKVVIQEPS--DEVDNLAEKTESLTVAESSEP  57

Query  250  AFSG  261
            +F+G
Sbjct  58   SFAG  61



>ref|XP_004984478.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X2 [Setaria italica]
Length=272

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 53/64 (83%), Gaps = 3/64 (5%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MA++E Q E KEEVA++APFDPTKKKKKKKVVIQ+P+  D VD LAEKTESL V++  E 
Sbjct  1    MADDE-QAERKEEVAELAPFDPTKKKKKKKVVIQEPS--DEVDKLAEKTESLAVAESSEP  57

Query  250  AFSG  261
            +F+G
Sbjct  58   SFAG  61



>ref|XP_010274681.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X2 [Nelumbo nucifera]
Length=267

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = +1

Query  94   EMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            E+K++V ++APFDPTKKKKKKKVV+QDPA D+SVD LAEKTE+L+VSDG+E  F+G
Sbjct  8    ELKDDVPELAPFDPTKKKKKKKVVVQDPA-DESVDKLAEKTENLSVSDGVENTFAG  62



>ref|XP_004984477.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X1 [Setaria italica]
Length=283

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 53/64 (83%), Gaps = 3/64 (5%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MA++E Q E KEEVA++APFDPTKKKKKKKVVIQ+P+  D VD LAEKTESL V++  E 
Sbjct  1    MADDE-QAERKEEVAELAPFDPTKKKKKKKVVIQEPS--DEVDKLAEKTESLAVAESSEP  57

Query  250  AFSG  261
            +F+G
Sbjct  58   SFAG  61



>sp|P55871.2|IF2B_MALDO RecName: Full=Eukaryotic translation initiation factor 2 subunit 
beta; Short=eIF-2-beta [Malus domestica]
Length=271

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 2/59 (3%)
 Frame = +1

Query  88   QNEMKEEV-ADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            QNE+K+EV ADIAPFDPTKKKKKK+VVIQD   DDSV  LAEK E+ T S+G E+ F+G
Sbjct  6    QNEVKDEVVADIAPFDPTKKKKKKEVVIQD-TTDDSVGKLAEKAEACTASEGQESTFAG  63



>ref|XP_006650040.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like [Oryza brachyantha]
Length=270

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 52/64 (81%), Gaps = 3/64 (5%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MA+EE Q E KEE +++ PFDPTKKKKKKKVVIQDP+  D VD LAEKTESL+V++  E 
Sbjct  1    MADEE-QVERKEEASELTPFDPTKKKKKKKVVIQDPS--DEVDKLAEKTESLSVAETGEP  57

Query  250  AFSG  261
            +F+G
Sbjct  58   SFAG  61



>gb|EEC82694.1| hypothetical protein OsI_27355 [Oryza sativa Indica Group]
 gb|EEE67828.1| hypothetical protein OsJ_25601 [Oryza sativa Japonica Group]
Length=249

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 51/64 (80%), Gaps = 3/64 (5%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MA+EE   E +EEV+++ PFDPTKKKKKKKVVIQDP+  D VD LAEKTE+LTV++  E 
Sbjct  1    MADEE-HAEKREEVSELTPFDPTKKKKKKKVVIQDPS--DEVDKLAEKTENLTVTEPGEL  57

Query  250  AFSG  261
             F+G
Sbjct  58   NFTG  61



>ref|XP_011041776.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X2 [Populus euphratica]
Length=267

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 56/64 (88%), Gaps = 6/64 (9%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MA+E I  ++K+E   +APFDPTKKKKKKKVVIQ+  +D++VDSLA+KTESL+VSDGLE+
Sbjct  1    MADESI--DVKDE---LAPFDPTKKKKKKKVVIQE-NSDEAVDSLADKTESLSVSDGLES  54

Query  250  AFSG  261
            +F+G
Sbjct  55   SFTG  58



>ref|NP_001060649.1| Os07g0681000 [Oryza sativa Japonica Group]
 dbj|BAC80009.1| putative translation initiation factor eIF-2 beta chain [Oryza 
sativa Japonica Group]
 dbj|BAF22563.1| Os07g0681000 [Oryza sativa Japonica Group]
Length=268

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 51/64 (80%), Gaps = 3/64 (5%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MA+EE   E +EEV+++ PFDPTKKKKKKKVVIQDP+  D VD LAEKTE+LTV++  E 
Sbjct  1    MADEE-HAEKREEVSELTPFDPTKKKKKKKVVIQDPS--DEVDKLAEKTENLTVTEPGEL  57

Query  250  AFSG  261
             F+G
Sbjct  58   NFTG  61



>ref|XP_010938034.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X2 [Elaeis guineensis]
Length=232

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 48/61 (79%), Gaps = 2/61 (3%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFS  258
            EE   EMKEEV ++APFDPTKKKKKKKVVIQD A  + VD LAEKTE+LTV++  E +F 
Sbjct  3    EEKPAEMKEEVPEVAPFDPTKKKKKKKVVIQDSA--EEVDKLAEKTENLTVAESGELSFV  60

Query  259  G  261
            G
Sbjct  61   G  61



>ref|XP_004958710.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like [Setaria italica]
Length=268

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MA+EE   E +EEV+++APFDPTKKKKKKKV IQDP+  D VD LA+KTESL VS+  E 
Sbjct  1    MADEE-HAEKREEVSELAPFDPTKKKKKKKVSIQDPS--DEVDKLADKTESLAVSEPAEL  57

Query  250  AFSG  261
             FSG
Sbjct  58   NFSG  61



>ref|XP_010938033.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X1 [Elaeis guineensis]
Length=266

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 48/61 (79%), Gaps = 2/61 (3%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFS  258
            EE   EMKEEV ++APFDPTKKKKKKKVVIQD A  + VD LAEKTE+LTV++  E +F 
Sbjct  3    EEKPAEMKEEVPEVAPFDPTKKKKKKKVVIQDSA--EEVDKLAEKTENLTVAESGELSFV  60

Query  259  G  261
            G
Sbjct  61   G  61



>gb|ABK21497.1| unknown [Picea sitchensis]
Length=270

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 35/61 (57%), Positives = 52/61 (85%), Gaps = 1/61 (2%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFS  258
            EE   E+KEEV ++APFDPTKKKKKKK+++QD  AD++ +++ EK E+L+V+DGL++AF+
Sbjct  3    EEAPVELKEEVTELAPFDPTKKKKKKKLLVQD-TADEATETVTEKMENLSVNDGLDSAFT  61

Query  259  G  261
            G
Sbjct  62   G  62



>ref|XP_006288263.1| hypothetical protein CARUB_v10001508mg, partial [Capsella rubella]
 gb|EOA21161.1| hypothetical protein CARUB_v10001508mg, partial [Capsella rubella]
Length=314

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 3/66 (5%)
 Frame = +1

Query  64   AVMAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGL  243
            A+MA+E   NEMKEE  ++APFDPTKKKKKKKVV+QDP  D    S  EK++SL  +DGL
Sbjct  45   AIMADE--INEMKEE-QELAPFDPTKKKKKKKVVLQDPVLDAGESSQTEKSDSLPANDGL  101

Query  244  ETAFSG  261
            E++F+G
Sbjct  102  ESSFAG  107



>gb|KJB46241.1| hypothetical protein B456_007G353600 [Gossypium raimondii]
Length=201

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 47/52 (90%), Gaps = 1/52 (2%)
 Frame = +1

Query  91   NEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLE  246
            +E+K+EV +I  FDPTKKKKKKKVVIQDPA D+SVD LAEKTE+L+VS+GL+
Sbjct  4    DEVKDEVPEITSFDPTKKKKKKKVVIQDPA-DESVDKLAEKTEALSVSEGLD  54



>gb|KJB46240.1| hypothetical protein B456_007G353600 [Gossypium raimondii]
Length=196

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 47/52 (90%), Gaps = 1/52 (2%)
 Frame = +1

Query  91   NEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLE  246
            +E+K+EV +I  FDPTKKKKKKKVVIQDPA D+SVD LAEKTE+L+VS+GL+
Sbjct  4    DEVKDEVPEITSFDPTKKKKKKKVVIQDPA-DESVDKLAEKTEALSVSEGLD  54



>gb|KJB46242.1| hypothetical protein B456_007G353600 [Gossypium raimondii]
Length=178

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 47/52 (90%), Gaps = 1/52 (2%)
 Frame = +1

Query  91   NEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLE  246
            +E+K+EV +I  FDPTKKKKKKKVVIQDPA D+SVD LAEKTE+L+VS+GL+
Sbjct  4    DEVKDEVPEITSFDPTKKKKKKKVVIQDPA-DESVDKLAEKTEALSVSEGLD  54



>gb|KHG09425.1| Eukaryotic translation initiation factor 2 subunit beta [Gossypium 
arboreum]
Length=241

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 47/52 (90%), Gaps = 1/52 (2%)
 Frame = +1

Query  91   NEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLE  246
            +E+K+EV +I  FDPTKKKKKKKVVIQDPA D+SVD LAEKTE+L+VS+GL+
Sbjct  4    DEVKDEVPEITSFDPTKKKKKKKVVIQDPA-DESVDKLAEKTEALSVSEGLD  54



>ref|XP_008810847.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like [Phoenix dactylifera]
Length=266

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 2/56 (4%)
 Frame = +1

Query  94   EMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            EMKEEV ++APFDPTKKKKKKKVVIQD A  + VD LAEKTE+LTV++  E  F G
Sbjct  8    EMKEEVPEVAPFDPTKKKKKKKVVIQDSA--EEVDKLAEKTENLTVAESGEVNFVG  61



>ref|XP_010454404.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like [Camelina sativa]
Length=271

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 3/65 (5%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDG-LE  246
            MA+E   NEMKEE   +APFDPTKKKKKKKVVIQDP  D    S AEK++SL  +DG LE
Sbjct  1    MADE--NNEMKEEQEQLAPFDPTKKKKKKKVVIQDPVMDVGESSQAEKSDSLPANDGDLE  58

Query  247  TAFSG  261
            ++F+G
Sbjct  59   SSFAG  63



>gb|KJB46239.1| hypothetical protein B456_007G353600 [Gossypium raimondii]
Length=264

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 47/52 (90%), Gaps = 1/52 (2%)
 Frame = +1

Query  91   NEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLE  246
            +E+K+EV +I  FDPTKKKKKKKVVIQDPA D+SVD LAEKTE+L+VS+GL+
Sbjct  4    DEVKDEVPEITSFDPTKKKKKKKVVIQDPA-DESVDKLAEKTEALSVSEGLD  54



>ref|NP_001183769.1| eukaryotic translation initiation factor 2 beta subunit isoform 
1 [Zea mays]
 gb|ACG36751.1| eukaryotic translation initiation factor 2 beta subunit [Zea 
mays]
 gb|ACR38255.1| unknown [Zea mays]
 tpg|DAA64143.1| TPA: eukaryotic translation initiation factor 2 beta subunit 
isoform 1 [Zea mays]
 tpg|DAA64144.1| TPA: eukaryotic translation initiation factor 2 beta subunit 
isoform 2 [Zea mays]
Length=267

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 51/64 (80%), Gaps = 3/64 (5%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MA+EE  +E +EE +++APFDPTKKKKKKKVVIQ+P+  D VD LAEKTE+L V++  E 
Sbjct  1    MADEE-HSERREEASELAPFDPTKKKKKKKVVIQEPS--DEVDKLAEKTETLAVAEPAEL  57

Query  250  AFSG  261
             F+G
Sbjct  58   NFTG  61



>ref|XP_009416324.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=270

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 53/64 (83%), Gaps = 3/64 (5%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MA+E   +++KEEV+++APFDPTKKKKKKKVV+QD A  + VD LAEKTE+LTV+D  E 
Sbjct  1    MADEN-PSDVKEEVSELAPFDPTKKKKKKKVVLQDSA--EVVDKLAEKTENLTVADSGEP  57

Query  250  AFSG  261
            +F+G
Sbjct  58   SFAG  61



>ref|NP_001132460.1| uncharacterized protein LOC100193916 [Zea mays]
 ref|XP_008667232.1| PREDICTED: uncharacterized protein LOC100193916 isoform X1 [Zea 
mays]
 gb|ACF81309.1| unknown [Zea mays]
 tpg|DAA41769.1| TPA: eukaryotic translation initiation factor 2 beta subunit 
[Zea mays]
Length=267

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MA+EE   E +EE +++APFDPTKKKKKKKVVIQ+P+  D VD LAEKTESL V++  E 
Sbjct  1    MADEE-HPERREEASELAPFDPTKKKKKKKVVIQEPS--DEVDKLAEKTESLAVAEPAEL  57

Query  250  AFSG  261
             F+G
Sbjct  58   NFTG  61



>ref|XP_004500380.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X1 [Cicer arietinum]
 ref|XP_004500381.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X2 [Cicer arietinum]
Length=270

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 49/61 (80%), Gaps = 1/61 (2%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFS  258
            +E Q ++KEEV DIAPFDPTKKKKKKK +I D   DDSVD LAEKTE+L+VS+G ++  +
Sbjct  3    DEAQIDVKEEVPDIAPFDPTKKKKKKKPLIVD-LDDDSVDKLAEKTENLSVSEGFDSTLA  61

Query  259  G  261
            G
Sbjct  62   G  62



>ref|XP_009416325.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X2 [Musa acuminata subsp. malaccensis]
Length=270

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 53/64 (83%), Gaps = 3/64 (5%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MA+E   +++KEEV+++APFDPTKKKKKKKVV+QD A  + VD LAEKTE+LTV+D  E 
Sbjct  1    MADEN-PSDVKEEVSELAPFDPTKKKKKKKVVLQDSA--EVVDKLAEKTENLTVADSGEP  57

Query  250  AFSG  261
            +F+G
Sbjct  58   SFAG  61



>gb|AAK29672.1|AF353095_1 protein synthesis initiation factor eIF2 beta [Arabidopsis thaliana]
 gb|AAM65346.1| translation initiation factor eIF-2 beta chain-like protein [Arabidopsis 
thaliana]
Length=268

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  91   NEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            NE++EE   +APFDP+KKKKKKKVVIQ+P  D +  S  EK++SL V+DGLE++F+G
Sbjct  6    NEIREEQEQLAPFDPSKKKKKKKVVIQEPVEDLAESSQTEKSDSLPVNDGLESSFTG  62



>gb|AFD22855.1| eukaryotic translation initiation factor 2A [Tamarix androssowii]
Length=275

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 45/54 (83%), Gaps = 1/54 (2%)
 Frame = +1

Query  100  KEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            KEEV +IAPFDPTKKKKKKKVVIQ+P  DD+ D L EK E+L+VSD +E +F+G
Sbjct  14   KEEVPEIAPFDPTKKKKKKKVVIQEP-GDDNDDILVEKIENLSVSDAVEPSFAG  66



>ref|XP_002874023.1| protein synthesis initiation factor eIF2 beta [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH50282.1| protein synthesis initiation factor eIF2 beta [Arabidopsis lyrata 
subsp. lyrata]
Length=268

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 50/64 (78%), Gaps = 2/64 (3%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MA+E   NE++EE   +APFDP+KKKKKKKVVIQ+P  D +  S  EK++SL V+DGLE+
Sbjct  1    MADE--NNEIREEQEQLAPFDPSKKKKKKKVVIQEPIEDLAESSQIEKSDSLPVNDGLES  58

Query  250  AFSG  261
            +F+G
Sbjct  59   SFTG  62



>ref|NP_197592.1| translation initiation factor eIF-2 beta subunit [Arabidopsis 
thaliana]
 ref|NP_001078610.1| translation initiation factor eIF-2 beta subunit [Arabidopsis 
thaliana]
 sp|Q41969.3|IF2B_ARATH RecName: Full=Eukaryotic translation initiation factor 2 subunit 
beta; Short=eIF-2-beta; AltName: Full=Protein EMBRYO DEFECTIVE 
1401 [Arabidopsis thaliana]
 gb|AAM91527.1| translation initiation factor eIF-2 beta chain-like protein [Arabidopsis 
thaliana]
 gb|AAN15375.1| translation initiation factor eIF-2 beta chain-like protein [Arabidopsis 
thaliana]
 gb|AED92904.1| translation initiation factor eIF-2 beta subunit [Arabidopsis 
thaliana]
 gb|AED92906.1| translation initiation factor eIF-2 beta subunit [Arabidopsis 
thaliana]
Length=268

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  91   NEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            NE++EE   +APFDP+KKKKKKKVVIQ+P  D +  S  EK++SL V+DGLE++F+G
Sbjct  6    NEIREEQEQLAPFDPSKKKKKKKVVIQEPVEDLAESSQTEKSDSLPVNDGLESSFTG  62



>ref|XP_010493208.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta [Camelina sativa]
Length=271

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSD-GLE  246
            MA+E   NEMKEE   +APFDPTKKKKKKKVVIQDP  D    S  EK++SL  +D GLE
Sbjct  1    MADE--NNEMKEEQEQLAPFDPTKKKKKKKVVIQDPVMDVGESSQPEKSDSLPANDGGLE  58

Query  247  TAFSG  261
            ++F+G
Sbjct  59   SSFTG  63



>ref|XP_010274679.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X1 [Nelumbo nucifera]
 ref|XP_010274680.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X1 [Nelumbo nucifera]
Length=272

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 51/61 (84%), Gaps = 6/61 (10%)
 Frame = +1

Query  94   EMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLT-----VSDGLETAFS  258
            E+K++V ++APFDPTKKKKKKKVV+QDP AD+SVD LAEKTE+L+     VSDG+E  F+
Sbjct  8    ELKDDVPELAPFDPTKKKKKKKVVVQDP-ADESVDKLAEKTENLSDSSSAVSDGVENTFA  66

Query  259  G  261
            G
Sbjct  67   G  67



>gb|ACG39147.1| eukaryotic translation initiation factor 2 beta subunit [Zea 
mays]
Length=267

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MA+EE   E +EE +++APFDPTKKKKKKKVVIQ+P+  D VD +AEKTESL V++  E 
Sbjct  1    MADEE-HPERREEASELAPFDPTKKKKKKKVVIQEPS--DEVDKVAEKTESLAVAEPAEL  57

Query  250  AFSG  261
             F+G
Sbjct  58   NFTG  61



>ref|XP_009391671.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like [Musa acuminata subsp. malaccensis]
Length=270

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 48/64 (75%), Gaps = 3/64 (5%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MA+E    E KEEV ++APFDPTKKKKKKKVVIQDPA  + V+ LAEKTESLTV    E 
Sbjct  1    MAQEN-PTERKEEVPELAPFDPTKKKKKKKVVIQDPA--EEVEKLAEKTESLTVDAIGEP  57

Query  250  AFSG  261
            +F G
Sbjct  58   SFVG  61



>gb|AFK36776.1| unknown [Medicago truncatula]
Length=215

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 45/65 (69%), Gaps = 9/65 (14%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAA----DDSVDSLAEKTESLTVSDGLE  246
            +E Q ++KEEV DIAPFDPTKK        + PAA    DDSVD LAEKTE+L+VS+G +
Sbjct  3    DEAQIDVKEEVPDIAPFDPTKK-----KKKKKPAAVDLDDDSVDKLAEKTENLSVSEGFD  57

Query  247  TAFSG  261
            +  +G
Sbjct  58   SILAG  62



>ref|XP_010420940.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like [Camelina sativa]
Length=271

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSD-GLE  246
            MA+E   NEMKEE   +APFDPTKKKKKKKVVIQDP  D    S  EK++SL  +D GLE
Sbjct  1    MADE--NNEMKEEQEQLAPFDPTKKKKKKKVVIQDPVMDVGESSQPEKSDSLPANDGGLE  58

Query  247  TAFSG  261
            ++F+G
Sbjct  59   SSFAG  63



>ref|XP_006858817.1| hypothetical protein AMTR_s00066p00171460 [Amborella trichopoda]
 gb|ERN20284.1| hypothetical protein AMTR_s00066p00171460 [Amborella trichopoda]
Length=268

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = +1

Query  100  KEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            +EE+ ++APFDPTKKKKKKK  +QDP   +  D LAEKTE+L+V+DG ET+F+G
Sbjct  10   REEIPELAPFDPTKKKKKKKAAVQDPT--EEADKLAEKTENLSVADGPETSFAG  61



>ref|XP_009386922.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like [Musa acuminata subsp. malaccensis]
 ref|XP_009386923.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like [Musa acuminata subsp. malaccensis]
 ref|XP_009386924.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like [Musa acuminata subsp. malaccensis]
Length=270

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 49/64 (77%), Gaps = 3/64 (5%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MAEE  + ++KEEV ++APFD TKKKKKKKVVIQDPA  + VD L EKTESLTV D  E 
Sbjct  1    MAEENPK-DVKEEVPELAPFDSTKKKKKKKVVIQDPA--EEVDKLTEKTESLTVDDISEP  57

Query  250  AFSG  261
            +F G
Sbjct  58   SFVG  61



>ref|XP_009120755.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like [Brassica rapa]
 ref|XP_009120756.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like [Brassica rapa]
 emb|CDX92426.1| BnaA10g14650D [Brassica napus]
Length=271

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 52/66 (79%), Gaps = 5/66 (8%)
 Frame = +1

Query  70   MAEEEIQNEMKE--EVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGL  243
            MA+E   NEMKE  +  ++APFDPTKKKKKKKVVIQDP  +DS +S  EK++SL  +DGL
Sbjct  1    MADE--NNEMKEVKDEQELAPFDPTKKKKKKKVVIQDP-IEDSTESQPEKSDSLPANDGL  57

Query  244  ETAFSG  261
            E++F+G
Sbjct  58   ESSFAG  63



>gb|ACJ85179.1| unknown [Medicago truncatula]
Length=269

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 48/65 (74%), Gaps = 9/65 (14%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAA----DDSVDSLAEKTESLTVSDGLE  246
            +E Q ++KEEV DIAPFDPTKKKKK     + PAA    DDSVD LAEKTE+L+VS+G +
Sbjct  3    DEAQIDVKEEVPDIAPFDPTKKKKK-----KKPAAVDLDDDSVDKLAEKTENLSVSEGFD  57

Query  247  TAFSG  261
            +  +G
Sbjct  58   SILAG  62



>ref|NP_974817.1| translation initiation factor eIF-2 beta subunit [Arabidopsis 
thaliana]
 gb|AED92905.1| translation initiation factor eIF-2 beta subunit [Arabidopsis 
thaliana]
Length=267

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = +1

Query  91   NEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            NE++EE  ++APFDP+KKKKKKKVVIQ+P  D +  S  EK++SL V+DGLE++F+G
Sbjct  6    NEIREE-QELAPFDPSKKKKKKKVVIQEPVEDLAESSQTEKSDSLPVNDGLESSFTG  61



>ref|XP_010922773.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta [Elaeis guineensis]
Length=270

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 49/64 (77%), Gaps = 3/64 (5%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLET  249
            MAEE    ++KEEVA++APFDP KKKKKKK V+QD    + +D LAEKT+ L+VSD LET
Sbjct  1    MAEEN-PTDVKEEVAELAPFDPNKKKKKKKPVVQD--TTEVMDKLAEKTDDLSVSDDLET  57

Query  250  AFSG  261
            +F G
Sbjct  58   SFVG  61



>ref|XP_004137563.1| PREDICTED: uncharacterized protein LOC101214464 [Cucumis sativus]
Length=176

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 3/46 (7%)
 Frame = +1

Query  127  FDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLE-TAFSG  261
            FDPTKKKKKK VV+QDP  D+SVD LAEKTESL+VSDGLE T FSG
Sbjct  122  FDPTKKKKKK-VVLQDPT-DESVDKLAEKTESLSVSDGLETTTFSG  165



>ref|XP_008788510.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta [Phoenix dactylifera]
Length=270

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 35/61 (57%), Positives = 46/61 (75%), Gaps = 2/61 (3%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFS  258
            EE   ++KEEV ++APFDP +KKKKKK V+QD    + +D LAEKT+ L+VSD LET+F 
Sbjct  3    EENPTDVKEEVPELAPFDPNRKKKKKKPVVQD--TTEEMDKLAEKTDDLSVSDDLETSFV  60

Query  259  G  261
            G
Sbjct  61   G  61



>ref|XP_010527148.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like [Tarenaya hassleriana]
Length=277

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = +1

Query  55   FGGAVMAEEEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVS  234
            F  A + E  +  +      ++APFDPTKKKKKKKV IQDP  DDS +  AEK +SL V 
Sbjct  4    FSEARITENNVTLDHYSRGPEVAPFDPTKKKKKKKVAIQDPI-DDSAEPSAEKADSLAVG  62

Query  235  DGLETAFSG  261
            DGLE+ F+G
Sbjct  63   DGLESTFAG  71



>ref|XP_003557971.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta [Brachypodium distachyon]
 ref|XP_010228657.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta [Brachypodium distachyon]
Length=270

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 2/49 (4%)
 Frame = +1

Query  115  DIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            +I PFDPTKKKKKKKVVIQDP+  D VD LAEKTESL V++  E +F+G
Sbjct  15   EITPFDPTKKKKKKKVVIQDPS--DEVDKLAEKTESLAVTESGEPSFTG  61



>ref|XP_004167234.1| PREDICTED: uncharacterized protein LOC101224492 [Cucumis sativus]
Length=177

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 39/46 (85%), Gaps = 2/46 (4%)
 Frame = +1

Query  127  FDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLE-TAFSG  261
            FDPTKKKKKKKVV+QD   D+ VD LAEKTESL+VSDGLE T FSG
Sbjct  122  FDPTKKKKKKKVVLQD-RTDEIVDKLAEKTESLSVSDGLETTTFSG  166



>gb|EMS63325.1| Eukaryotic translation initiation factor 2 subunit beta [Triticum 
urartu]
Length=407

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 2/51 (4%)
 Frame = +1

Query  109  VADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            + +IAPFDPTKKKKKKKVVIQDP   D VD LAEKTE L+V++  E +F G
Sbjct  65   LLNIAPFDPTKKKKKKKVVIQDPV--DEVDKLAEKTEGLSVTESGEASFVG  113



>ref|XP_010540870.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like [Tarenaya hassleriana]
 ref|XP_010540871.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like [Tarenaya hassleriana]
Length=272

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 48/67 (72%), Gaps = 6/67 (9%)
 Frame = +1

Query  70   MAEEEIQNEMKEEVAD---IAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDG  240
            MAEE   N+MK+EV +   I  FDPTKKKKKKKVVIQD   DDS +  AEK +SL  SDG
Sbjct  1    MAEE--PNDMKDEVREEPEITAFDPTKKKKKKKVVIQD-TLDDSTELPAEKADSLPASDG  57

Query  241  LETAFSG  261
            LE+ F+G
Sbjct  58   LESTFTG  64



>ref|XP_011461395.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X2 [Fragaria vesca subsp. vesca]
 ref|XP_011461397.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like isoform X2 [Fragaria vesca subsp. vesca]
Length=268

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 40/61 (66%), Positives = 49/61 (80%), Gaps = 2/61 (3%)
 Frame = +1

Query  79   EEIQNEMKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFS  258
            EE +N +KEE+ DI PFD TKKKKKKKVV++D ++ DSVD LAEKTE+L VSD  E+ FS
Sbjct  3    EENKNAVKEELPDIVPFDRTKKKKKKKVVVRD-SSSDSVDKLAEKTENLAVSDE-ESTFS  60

Query  259  G  261
            G
Sbjct  61   G  61



>ref|XP_002317891.1| hypothetical protein POPTR_0012s04820g [Populus trichocarpa]
 gb|EEE96111.1| hypothetical protein POPTR_0012s04820g [Populus trichocarpa]
Length=54

 Score = 43.9 bits (102),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  97   MKEEVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSD  237
            +K+EVA++AP DPT KKK+++  +    A+ SV+SLAEKTES++VSD
Sbjct  7    LKDEVAELAPLDPTTKKKEEEGQVIHENANGSVESLAEKTESVSVSD  53



>ref|XP_010670045.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 
beta-like [Beta vulgaris subsp. vulgaris]
Length=267

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = +1

Query  106  EVADIAPFDPTkkkkkkkVVIQDPAADDSVDSLAEKTESLTVSDGLETAFSG  261
            +V ++APFDPTKKKKKKKV IQ+   D++V+ L++K E +TVSDG ET+F+G
Sbjct  9    DVPELAPFDPTKKKKKKKVTIQE-FNDENVEPLSDKMEKMTVSDGAETSFAG  59



Lambda      K        H        a         alpha
   0.316    0.134    0.363    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 569309995650