BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP015A01 197 bp,:Filtered

Length=179
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|YP_173374.1|  hypothetical protein NitaMp027                        127   1e-35   Nicotiana tabacum [American tobacco]
ref|NP_085475.1|  hypothetical protein ArthMp003                        120   3e-33   Arabidopsis thaliana [mouse-ear cress]
emb|CBI20529.3|  unnamed protein product                                116   5e-32   Vitis vinifera
ref|XP_003588355.1|  Mitochondrial protein, putative                    126   9e-32   
gb|AGV54791.1|  hypothetical protein                                    114   7e-31   Phaseolus vulgaris [French bean]
ref|XP_010103118.1|  hypothetical protein L484_022991                   104   2e-27   Morus notabilis
gb|KHN28130.1|  Putative mitochondrial protein                          100   2e-23   Glycine soja [wild soybean]
gb|AFK45228.1|  unknown                                               84.0    1e-19   Medicago truncatula
gb|EYU40102.1|  hypothetical protein MIMGU_mgv1a018597mg              81.6    1e-18   Erythranthe guttata [common monkey flower]
ref|XP_002516362.1|  conserved hypothetical protein                   78.6    4e-17   
emb|CBI20434.3|  unnamed protein product                              65.1    3e-12   Vitis vinifera
gb|EYU43472.1|  hypothetical protein MIMGU_mgv1a0228661mg             60.5    3e-10   Erythranthe guttata [common monkey flower]
ref|XP_006836548.1|  hypothetical protein AMTR_s00131p00039190        58.5    2e-09   
ref|XP_003603647.1|  Mitochondrial protein, putative                  53.1    4e-07   Medicago truncatula



>ref|YP_173374.1| hypothetical protein NitaMp027 [Nicotiana tabacum]
 ref|YP_173501.1| hypothetical protein NitaMp164 [Nicotiana tabacum]
 dbj|BAD83437.1| hypothetical protein (mitochondrion) [Nicotiana tabacum]
 dbj|BAD83567.1| hypothetical protein (mitochondrion) [Nicotiana tabacum]
Length=138

 Score =   127 bits (319),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = -1

Query  179  ATKMFQFAKFEKSKERRLATELGYGFPIGDPWITDGISPWPFASESVLPSQCPGIHPMH  3
            ATKMFQFAKFEKSKERRLATELGYGFPIGDPWITDGISPWPFASESVLPSQCPGIHPMH
Sbjct  44   ATKMFQFAKFEKSKERRLATELGYGFPIGDPWITDGISPWPFASESVLPSQCPGIHPMH  102



>ref|NP_085475.1| hypothetical protein ArthMp003 [Arabidopsis thaliana]
 sp|P93276.1|M030_ARATH RecName: Full=Uncharacterized mitochondrial protein AtMg00030; 
AltName: Full=ORF107a (mitochondrion) [Arabidopsis thaliana]
 emb|CAA69780.1| unnamed protein product [Arabidopsis thaliana]
Length=107

 Score =   120 bits (301),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 55/56 (98%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  MFQFAKFEKSKERRLATELGYGFPIGDPWITDGISPWPFASESVLPSQCPGIHPMH  3
            MFQFAKF KSKERRLATELGYGFPIGDPWITDGISPWPFASESVLPSQCPGIHPMH
Sbjct  1    MFQFAKFSKSKERRLATELGYGFPIGDPWITDGISPWPFASESVLPSQCPGIHPMH  56



>emb|CBI20529.3| unnamed protein product [Vitis vinifera]
Length=80

 Score =   116 bits (291),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  MFQFAKFEKSKERRLATELGYGFPIGDPWITDGISPWPFASESVLPSQCPGIHPMH  3
            MFQFAKFEKSKERRLATELGYGF IGDPWITDGISPWPFAS+SVLPSQCPGIHPMH
Sbjct  1    MFQFAKFEKSKERRLATELGYGFLIGDPWITDGISPWPFASQSVLPSQCPGIHPMH  56



>ref|XP_003588355.1| Mitochondrial protein, putative [Medicago truncatula]
Length=1106

 Score =   126 bits (317),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = -1

Query  179   ATKMFQFAKFEKSKERRLATELGYGFPIGDPWITDGISPWPFASESVLPSQCPGIHPMH  3
             ATKMFQFAKFEKSKERRLA ELGYGFPIGDPWITDGISPWPFASESVLPSQCPGIHPMH
Sbjct  1023  ATKMFQFAKFEKSKERRLAAELGYGFPIGDPWITDGISPWPFASESVLPSQCPGIHPMH  1081



>gb|AGV54791.1| hypothetical protein [Phaseolus vulgaris]
Length=93

 Score =   114 bits (285),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/59 (95%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    MHWMDARALRRKDAFRGERPWGDTVCDPWISDRETVSKLRG*SALFGLFKLSELKHLSS  179
            MHWMDARALRRKDAF GERPWGDTVCDPWISDRETVSKLRG SALFGL KLSELKHLSS
Sbjct  1    MHWMDARALRRKDAFGGERPWGDTVCDPWISDRETVSKLRGKSALFGLLKLSELKHLSS  59



>ref|XP_010103118.1| hypothetical protein L484_022991 [Morus notabilis]
 gb|EXB94883.1| hypothetical protein L484_022991 [Morus notabilis]
Length=83

 Score =   104 bits (260),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = -1

Query  146  KSKERRLATELGYGFPIGDPWITDGISPWPFASESVLPSQCPGIHPMH  3
             SKERRLATELGYGFPIGDPWITDGISPWPFASESVLPSQCPGIHPMH
Sbjct  28   NSKERRLATELGYGFPIGDPWITDGISPWPFASESVLPSQCPGIHPMH  75



>gb|KHN28130.1| Putative mitochondrial protein [Glycine soja]
Length=443

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -1

Query  146  KSKERRLATELGYGFPIGDPWITDGISPWPFASESVLPSQCPGIHPMH  3
            KSKERRLA +LGYGFPIGDPWITDGISPWPFASE+VLPSQCP IHPMH
Sbjct  331  KSKERRLAADLGYGFPIGDPWITDGISPWPFASENVLPSQCPDIHPMH  378



>gb|AFK45228.1| unknown [Medicago truncatula]
Length=41

 Score = 84.0 bits (206),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/41 (98%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    MHWMDARALRRKDAFRGERPWGDTVCDPWISDRETVSKLRG  125
            MHWMDARALRRKDAF GERPWGDTVCDPWISDRETVSKLRG
Sbjct  1    MHWMDARALRRKDAFGGERPWGDTVCDPWISDRETVSKLRG  41



>gb|EYU40102.1| hypothetical protein MIMGU_mgv1a018597mg, partial [Erythranthe 
guttata]
Length=54

 Score = 81.6 bits (200),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    MHWMDARALRRKDAFRGERPWGDTVCDPWISDRETVSKLRG  125
            MH  DARALRRKDAFRGERPWGDTVCDPWISDRETVSKLRG
Sbjct  14   MHRTDARALRRKDAFRGERPWGDTVCDPWISDRETVSKLRG  54



>ref|XP_002516362.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45979.1| conserved hypothetical protein [Ricinus communis]
Length=78

 Score = 78.6 bits (192),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +1

Query  40   TLSEAKGHGEIPSVIHGSPIGKPYPSSVASLRSLDFSNLAN  162
             LS+AKGHGEIPSVIHGSPIGKPYPSSVASLRSLDF NLAN
Sbjct  1    MLSKAKGHGEIPSVIHGSPIGKPYPSSVASLRSLDFENLAN  41



>emb|CBI20434.3| unnamed protein product [Vitis vinifera]
Length=42

 Score = 65.1 bits (157),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = -1

Query  170  MFQFAKFEKSKERRLATELGYGFPIGDPWIT  78
            MFQFAKFEKSKERRLATELGYGF IGDPWIT
Sbjct  1    MFQFAKFEKSKERRLATELGYGFLIGDPWIT  31



>gb|EYU43472.1| hypothetical protein MIMGU_mgv1a0228661mg, partial [Erythranthe 
guttata]
Length=74

 Score = 60.5 bits (145),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  128  LATELGYGFPIGDPWITDGISPWPFASESVLPSQ  27
            L+TELGYGFPIGDP ITD IS W FASES LPS+
Sbjct  1    LSTELGYGFPIGDPCITDRISAWAFASESYLPSR  34



>ref|XP_006836548.1| hypothetical protein AMTR_s00131p00039190 [Amborella trichopoda]
 gb|ERM99401.1| hypothetical protein AMTR_s00131p00039190 [Amborella trichopoda]
Length=87

 Score = 58.5 bits (140),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  87  MDHRRYLPMAFRL*KRPSFSMPGHPSNAF  1
           MDHRRYLPMAFRL KRPSFS PGHPSNA 
Sbjct  1   MDHRRYLPMAFRLFKRPSFSKPGHPSNAL  29



>ref|XP_003603647.1| Mitochondrial protein, putative [Medicago truncatula]
 gb|AES73898.1| hypothetical protein MTR_3g110480 [Medicago truncatula]
Length=163

 Score = 53.1 bits (126),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  71   ISPWPFASESVLPSQCPGIHPMH  3
            I PWPFASESVLPSQCPGIHPMH
Sbjct  103  IGPWPFASESVLPSQCPGIHPMH  125



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555109064460