BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP012F08 273 bp,:Filtered

Length=273
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAK27969.1|AF242373_1  cysteine protease                             120   2e-30   Ipomoea batatas [batate]
gb|AAF40415.1|AF216784_1  papain-like cysteine proteinase isoform II    119   5e-30   Ipomoea batatas [batate]
gb|AAF61440.1|AF138264_1  papain-like cysteine proteinase isoform I     119   6e-30   Ipomoea batatas [batate]
gb|AAF40414.1|AF216783_1  papain-like cysteine proteinase isoform I     119   6e-30   Ipomoea batatas [batate]
gb|AAF61441.1|AF138265_1  papain-like cysteine proteinase isoform II    119   6e-30   Ipomoea batatas [batate]
gb|AAF40416.1|AF216785_1  papain-like cysteine proteinase isoform...    118   2e-29   Ipomoea batatas [batate]
gb|ACI04578.1|  cysteine protease-like protein                          114   5e-28   Robinia pseudoacacia [black locust]
gb|KDP41743.1|  hypothetical protein JCGZ_26761                         114   7e-28   Jatropha curcas
ref|XP_002512963.1|  cysteine protease, putative                        113   1e-27   Ricinus communis
gb|AIB06024.1|  CP2                                                     112   2e-27   Hevea brasiliensis [jebe]
emb|CDP20652.1|  unnamed protein product                                112   2e-27   Coffea canephora [robusta coffee]
ref|XP_007042077.1|  Papain family cysteine protease                    112   2e-27   Theobroma cacao [chocolate]
ref|XP_010271520.1|  PREDICTED: cysteine proteinase RD19a-like          112   3e-27   Nelumbo nucifera [Indian lotus]
gb|KHG24064.1|  Cysteinease RD19a -like protein                         112   3e-27   Gossypium arboreum [tree cotton]
gb|AAX19661.1|  cysteine proteinase                                     112   4e-27   Populus tomentosa [Chinese white poplar]
ref|XP_003606998.1|  Cysteine proteinase                                111   5e-27   Medicago truncatula
ref|XP_011047717.1|  PREDICTED: cysteine proteinase RD19a               111   5e-27   Populus euphratica
ref|XP_011088458.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    111   5e-27   Sesamum indicum [beniseed]
gb|KJB32561.1|  hypothetical protein B456_005G247000                    110   1e-26   Gossypium raimondii
gb|KJB79047.1|  hypothetical protein B456_013G033800                    110   1e-26   Gossypium raimondii
ref|XP_004230928.1|  PREDICTED: cysteine proteinase RD19a               110   1e-26   Solanum lycopersicum
gb|ABQ10201.1|  cysteine protease Cp3                                   110   1e-26   Actinidia deliciosa [Chinese gooseberry]
ref|XP_009373025.1|  PREDICTED: cysteine proteinase RD19a-like          110   1e-26   Pyrus x bretschneideri [bai li]
ref|XP_006362019.1|  PREDICTED: cysteine proteinase RD19a-like          110   1e-26   Solanum tuberosum [potatoes]
emb|CAE54306.1|  putative papain-like cysteine proteinase               110   2e-26   Gossypium hirsutum [American cotton]
sp|P05993.1|PAPA5_CARPA  RecName: Full=Cysteine proteinase; AltNa...    104   2e-26   Carica papaya [mamon]
gb|KDO49483.1|  hypothetical protein CISIN_1g017318mg                   110   2e-26   Citrus sinensis [apfelsine]
ref|XP_006487337.1|  PREDICTED: cysteine proteinase RD19a-like          109   2e-26   Citrus sinensis [apfelsine]
ref|XP_002280798.2|  PREDICTED: cysteine proteinase 15A                 109   2e-26   Vitis vinifera
ref|XP_003539008.1|  PREDICTED: cysteine proteinase RD19a-like          109   2e-26   Glycine max [soybeans]
ref|XP_002313770.1|  cysteine proteinase A494 precursor                 109   2e-26   Populus trichocarpa [western balsam poplar]
gb|ABK92536.1|  unknown                                                 109   2e-26   Populus trichocarpa [western balsam poplar]
ref|XP_011028940.1|  PREDICTED: cysteine proteinase 15A-like            109   2e-26   Populus euphratica
ref|XP_004507484.1|  PREDICTED: cysteine proteinase RD19a-like          109   2e-26   Cicer arietinum [garbanzo]
ref|XP_009602233.1|  PREDICTED: cysteine proteinase RD19a-like          109   2e-26   Nicotiana tomentosiformis
gb|EYU37835.1|  hypothetical protein MIMGU_mgv1a008237mg                109   2e-26   Erythranthe guttata [common monkey flower]
ref|XP_002275759.1|  PREDICTED: cysteine proteinase RD19a               109   2e-26   Vitis vinifera
gb|KHG15253.1|  Cysteinease RD19a -like protein                         109   2e-26   Gossypium arboreum [tree cotton]
ref|XP_009406357.1|  PREDICTED: cysteine proteinase 1-like              109   3e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003523684.1|  PREDICTED: cysteine proteinase 15A-like            109   3e-26   Glycine max [soybeans]
ref|NP_001267989.1|  cysteine protease precursor                        109   3e-26   Vitis vinifera
ref|XP_010061009.1|  PREDICTED: cysteine proteinase RD19a-like          109   3e-26   Eucalyptus grandis [rose gum]
ref|XP_004150061.1|  PREDICTED: cysteine proteinase RD19a-like          109   3e-26   Cucumis sativus [cucumbers]
ref|XP_011092831.1|  PREDICTED: cysteine proteinase RD19a-like          109   3e-26   Sesamum indicum [beniseed]
ref|XP_006423403.1|  hypothetical protein CICLE_v10028670mg             109   3e-26   Citrus clementina
ref|XP_010268619.1|  PREDICTED: cysteine proteinase RD19a-like          108   4e-26   Nelumbo nucifera [Indian lotus]
ref|XP_009373000.1|  PREDICTED: cysteine proteinase RD19a               108   4e-26   Pyrus x bretschneideri [bai li]
ref|XP_004291404.1|  PREDICTED: cysteine proteinase 15A-like            108   4e-26   Fragaria vesca subsp. vesca
gb|AAR92156.1|  putative cysteine protease 3                            108   4e-26   Iris x hollandica [Dutch iris]
gb|KHN39817.1|  Cysteine proteinase RD19a                               108   4e-26   Glycine soja [wild soybean]
gb|ABK94801.1|  unknown                                                 108   4e-26   Populus trichocarpa [western balsam poplar]
ref|XP_008382317.1|  PREDICTED: cysteine proteinase RD19a               108   5e-26   Malus domestica [apple tree]
ref|XP_002510469.1|  cysteine protease, putative                        108   5e-26   Ricinus communis
ref|NP_001241450.1|  uncharacterized protein LOC100778716 precursor     108   5e-26   Glycine max [soybeans]
gb|ABK96580.1|  unknown                                                 108   5e-26   Populus trichocarpa x Populus deltoides
ref|XP_003540987.1|  PREDICTED: cysteine proteinase RD19a-like          108   6e-26   Glycine max [soybeans]
ref|NP_001266121.1|  uncharacterized protein LOC101501911 precursor     108   6e-26   Cicer arietinum [garbanzo]
gb|KHN45894.1|  Cysteine proteinase RD19a                               108   6e-26   Glycine soja [wild soybean]
ref|XP_007017672.1|  Papain family cysteine protease                    108   6e-26   Theobroma cacao [chocolate]
ref|XP_008460996.1|  PREDICTED: cysteine proteinase RD19a-like          108   7e-26   Cucumis melo [Oriental melon]
ref|XP_011037175.1|  PREDICTED: cysteine proteinase RD19a-like          108   7e-26   Populus euphratica
gb|AJA74415.1|  cysteine protease                                       108   7e-26   Cicer arietinum [garbanzo]
ref|XP_003589348.1|  Cysteine proteinase                                108   8e-26   Medicago truncatula
ref|XP_002302004.2|  hypothetical protein POPTR_0002s03020g             107   1e-25   Populus trichocarpa [western balsam poplar]
ref|XP_007136047.1|  hypothetical protein PHAVU_009G013600g             107   1e-25   Phaseolus vulgaris [French bean]
gb|AGV54334.1|  cysteine proteinase RD19a-like protein                  107   1e-25   Phaseolus vulgaris [French bean]
dbj|BAJ53178.1|  JHL18I08.12                                            107   1e-25   Jatropha curcas
ref|XP_010105270.1|  Cysteine proteinase 15A                            107   1e-25   Morus notabilis
gb|AAU81591.1|  cysteine proteinase                                     104   1e-25   Petunia x hybrida [garden petunia]
ref|XP_002305451.2|  cysteine proteinase A494 precursor                 107   1e-25   Populus trichocarpa [western balsam poplar]
ref|XP_011045161.1|  PREDICTED: cysteine proteinase 15A-like            107   1e-25   Populus euphratica
ref|XP_010028631.1|  PREDICTED: cysteine proteinase RD19a-like          107   2e-25   Eucalyptus grandis [rose gum]
ref|XP_009376976.1|  PREDICTED: cysteine proteinase RD19a-like          107   2e-25   Pyrus x bretschneideri [bai li]
emb|CDQ51995.1|  Cysteine proteinase                                    103   2e-25   Fagus sylvatica
ref|XP_004148554.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    107   2e-25   
gb|KGN43159.1|  Papain-like cysteine proteinase isoform I               107   2e-25   Cucumis sativus [cucumbers]
ref|XP_004165230.1|  PREDICTED: cysteine proteinase RD19a-like          107   2e-25   
ref|XP_009146338.1|  PREDICTED: cysteine proteinase 15A-like            107   2e-25   Brassica rapa
dbj|BAC41322.1|  hypothetical protein                                   107   2e-25   Lotus japonicus
ref|XP_007131787.1|  hypothetical protein PHAVU_011G041600g             106   2e-25   Phaseolus vulgaris [French bean]
emb|CDY34441.1|  BnaC01g21920D                                          106   2e-25   Brassica napus [oilseed rape]
ref|XP_010066197.1|  PREDICTED: probable cysteine proteinase A494       106   3e-25   Eucalyptus grandis [rose gum]
ref|XP_009392632.1|  PREDICTED: cysteine proteinase 1-like              106   3e-25   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN22211.1|  Cysteine proteinase 15A                                 106   3e-25   Glycine soja [wild soybean]
emb|CAE45588.1|  papain-like cysteine proteinase-like protein 1         106   3e-25   Lotus japonicus
ref|XP_008775532.1|  PREDICTED: cysteine proteinase 1-like              106   3e-25   Phoenix dactylifera
gb|AIB06025.1|  CP3                                                     106   3e-25   Hevea brasiliensis [jebe]
gb|KHN25410.1|  Cysteine proteinase RD19a                               106   3e-25   Glycine soja [wild soybean]
ref|XP_009376977.1|  PREDICTED: cysteine proteinase RD19a-like          107   3e-25   Pyrus x bretschneideri [bai li]
ref|XP_006473584.1|  PREDICTED: cysteine proteinase 15A-like            106   3e-25   Citrus sinensis [apfelsine]
gb|ACM80348.1|  cysteine proteinase                                     106   3e-25   Solanum lycopersicum
ref|XP_008236965.1|  PREDICTED: cysteine proteinase RD19a               106   4e-25   Prunus mume [ume]
ref|XP_008448073.1|  PREDICTED: cysteine proteinase RD19a-like          106   4e-25   Cucumis melo [Oriental melon]
ref|XP_003550405.2|  PREDICTED: cysteine proteinase 15A                 106   4e-25   
ref|XP_007201310.1|  hypothetical protein PRUPE_ppa007454mg             106   4e-25   Prunus persica
ref|XP_010672379.1|  PREDICTED: cysteine proteinase RD19a-like          106   4e-25   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAF98584.1|  CM0216.500.nc                                          105   4e-25   Lotus japonicus
ref|XP_004290288.1|  PREDICTED: probable cysteine proteinase A494       106   4e-25   Fragaria vesca subsp. vesca
gb|KDO84720.1|  hypothetical protein CISIN_1g017548mg                   105   5e-25   Citrus sinensis [apfelsine]
ref|XP_002306900.1|  hypothetical protein POPTR_0005s25540g             105   5e-25   Populus trichocarpa [western balsam poplar]
gb|ABF46642.1|  papain-like cysteine proteinase                         105   6e-25   Pachysandra terminalis
ref|XP_007160702.1|  hypothetical protein PHAVU_001G009900g             105   6e-25   Phaseolus vulgaris [French bean]
ref|XP_006435090.1|  hypothetical protein CICLE_v10001559mg             105   6e-25   Citrus clementina
emb|CAE45589.1|  papain-like cysteine proteinase-like protein 2         105   6e-25   Lotus japonicus
emb|CAA82995.1|  cysteine proteinase                                    105   7e-25   Vicia sativa [spring vetch]
sp|P25804.1|CYSP_PEA  RecName: Full=Cysteine proteinase 15A; AltN...    105   7e-25   Pisum sativum [garden pea]
gb|KJB07487.1|  hypothetical protein B456_001G026600                    105   7e-25   Gossypium raimondii
dbj|BAF03553.1|  cysteine proteinase CP2                                105   7e-25   Phaseolus vulgaris [French bean]
gb|AAD29084.1|AF082181_1  cysteine proteinase precursor                 105   7e-25   Solanum melongena [aubergine]
gb|AAO11786.1|  pre-pro cysteine proteinase                             105   8e-25   Vicia faba [broad bean]
ref|XP_010910124.1|  PREDICTED: cysteine proteinase 1-like              105   8e-25   Elaeis guineensis
dbj|BAF98585.1|  CM0216.510.nc                                          105   9e-25   Lotus japonicus
gb|AAB67878.1|  pre-pro-cysteine proteinase                             105   9e-25   Vicia faba [broad bean]
gb|ABK96252.1|  unknown                                                 101   1e-24   Populus trichocarpa x Populus deltoides
ref|XP_002280808.2|  PREDICTED: cysteine proteinase 15A                 105   1e-24   Vitis vinifera
gb|ACK57563.1|  cysteine protease-like protein                          105   1e-24   Arachis hypogaea [goober]
ref|XP_009109502.1|  PREDICTED: cysteine proteinase RD19a-like          104   1e-24   Brassica rapa
gb|AAL05851.1|AF411121_1  cysteine proteinase precursor                 104   2e-24   Sandersonia aurantiaca [Chinese-lantern lily]
gb|AAM65162.1|  cysteine proteinase RD19A                               104   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009351218.1|  PREDICTED: cysteine proteinase RD19a-like          103   2e-24   Pyrus x bretschneideri [bai li]
gb|AAU81589.1|  cysteine proteinase                                     103   2e-24   Petunia x hybrida [garden petunia]
ref|XP_003545051.1|  PREDICTED: cysteine proteinase 15A-like            104   2e-24   Glycine max [soybeans]
gb|EYU42593.1|  hypothetical protein MIMGU_mgv1a008336mg                104   2e-24   Erythranthe guttata [common monkey flower]
ref|NP_568052.1|  cysteine proteinase RD19a                             103   2e-24   Arabidopsis thaliana [mouse-ear cress]
gb|ABK93575.1|  unknown                                                 100   3e-24   Populus trichocarpa [western balsam poplar]
ref|XP_010530325.1|  PREDICTED: cysteine proteinase RD19a               103   3e-24   Tarenaya hassleriana [spider flower]
ref|XP_010440192.1|  PREDICTED: cysteine proteinase RD19a-like          103   3e-24   Camelina sativa [gold-of-pleasure]
emb|CAB53397.1|  cysteine protease                                      101   3e-24   Medicago sativa [alfalfa]
gb|AAL69389.1|AF462226_1  putative cysteine proteinase                99.8    3e-24   Narcissus pseudonarcissus
ref|XP_009611293.1|  PREDICTED: cysteine proteinase 15A-like            103   4e-24   Nicotiana tomentosiformis
gb|AJP16692.1|  cysteine protease                                       100   4e-24   Striga hermonthica [purple witchweed]
dbj|BAA92495.1|  cysteine protease                                      103   4e-24   Vigna mungo [urad dal]
ref|XP_010434865.1|  PREDICTED: cysteine proteinase 15A-like            103   4e-24   Camelina sativa [gold-of-pleasure]
gb|AAK07731.1|  CPR2-like cysteine proteinase                           103   4e-24   Nicotiana tabacum [American tobacco]
ref|XP_004238314.1|  PREDICTED: cysteine proteinase 15A                 103   4e-24   
emb|CAA78361.1|  tobacco pre-pro-cysteine proteinase                    103   5e-24   Nicotiana tabacum [American tobacco]
emb|CAA78365.1|  tobacco pre-pro-cysteine proteinase                    102   5e-24   Nicotiana tabacum [American tobacco]
ref|XP_010449835.1|  PREDICTED: cysteine proteinase 15A-like            102   5e-24   Camelina sativa [gold-of-pleasure]
ref|XP_006341997.1|  PREDICTED: cysteine proteinase 15A-like            102   6e-24   Solanum tuberosum [potatoes]
gb|AAQ81938.1|  cysteine proteinase precursor                           102   6e-24   Ipomoea batatas [batate]
dbj|BAD94010.1|  drought-inducible cysteine proteinase RD19A prec...  97.4    6e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283974.1|  hypothetical protein CARUB_v10005098mg             102   7e-24   Capsella rubella
emb|CAB17075.1|  cysteine proteinase precursor                          102   7e-24   Phaseolus vulgaris [French bean]
gb|KJB29611.1|  hypothetical protein B456_005G110200                    102   7e-24   Gossypium raimondii
emb|CDY71205.1|  BnaCnng71840D                                          102   7e-24   Brassica napus [oilseed rape]
gb|AAL60581.1|AF454959_1  senescence-associated cysteine protease       102   7e-24   Brassica oleracea
ref|XP_008387995.1|  PREDICTED: cysteine proteinase 15A                 102   7e-24   Malus domestica [apple tree]
emb|CDY09707.1|  BnaC07g33540D                                          102   8e-24   Brassica napus [oilseed rape]
dbj|BAF46302.1|  cysteine proteinase precursor                          102   8e-24   Ipomoea nil [qian niu]
emb|CDX98179.1|  BnaC07g09190D                                        96.7    9e-24   Brassica napus [oilseed rape]
gb|KFK24413.1|  hypothetical protein AALP_AAs58848U000200               102   1e-23   Arabis alpina [alpine rockcress]
ref|XP_006411706.1|  hypothetical protein EUTSA_v10025494mg             102   1e-23   Eutrema salsugineum
gb|KHN12668.1|  Cysteine proteinase 15A                               99.0    1e-23   Glycine soja [wild soybean]
ref|XP_009776238.1|  PREDICTED: cysteine proteinase 15A-like            102   1e-23   Nicotiana sylvestris
ref|XP_006414378.1|  hypothetical protein EUTSA_v10025521mg             102   1e-23   Eutrema salsugineum
gb|KHG15062.1|  Cysteinease RD19a -like protein                         102   1e-23   Gossypium arboreum [tree cotton]
ref|XP_010531457.1|  PREDICTED: probable cysteine proteinase A494       101   1e-23   Tarenaya hassleriana [spider flower]
gb|ACX54787.2|  cysteine protease                                       101   1e-23   Arachis diogoi
ref|XP_008775280.1|  PREDICTED: cysteine proteinase 1-like              101   1e-23   Phoenix dactylifera
emb|CDP07452.1|  unnamed protein product                                101   2e-23   Coffea canephora [robusta coffee]
ref|XP_006283963.1|  hypothetical protein CARUB_v10005086mg             101   2e-23   Capsella rubella
ref|XP_011083631.1|  PREDICTED: cysteine proteinase 15A-like            101   2e-23   Sesamum indicum [beniseed]
ref|XP_008221329.1|  PREDICTED: cysteine proteinase 15A-like            101   2e-23   Prunus mume [ume]
emb|CAA78403.1|  pre-pro-cysteine proteinase                            100   2e-23   Solanum lycopersicum
gb|KJB58164.1|  hypothetical protein B456_009G197400                    101   3e-23   Gossypium raimondii
gb|AAB62937.1|  stress-induced cysteine proteinase                    98.2    3e-23   Lavatera thuringiaca
ref|XP_002868883.1|  hypothetical protein ARALYDRAFT_490677             100   3e-23   Arabidopsis lyrata subsp. lyrata
ref|XP_009405542.1|  PREDICTED: cysteine proteinase 1-like              100   3e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010437007.1|  PREDICTED: cysteine proteinase RD19a-like          100   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010943608.1|  PREDICTED: cysteine proteinase 1-like              100   4e-23   Elaeis guineensis
ref|XP_010446443.1|  PREDICTED: cysteine proteinase RD19a               100   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010431862.1|  PREDICTED: cysteine proteinase RD19a               100   4e-23   Camelina sativa [gold-of-pleasure]
ref|NP_567489.1|  papain family cysteine protease                       100   4e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009136751.1|  PREDICTED: cysteine proteinase RD19a-like          100   4e-23   Brassica rapa
emb|CDX90537.1|  BnaA03g42440D                                          100   5e-23   Brassica napus [oilseed rape]
gb|EPS70818.1|  cysteine proteinase                                     100   5e-23   Genlisea aurea
ref|XP_008444769.1|  PREDICTED: cysteine proteinase RD19a-like          100   5e-23   Cucumis melo [Oriental melon]
ref|XP_002870174.1|  hypothetical protein ARALYDRAFT_915142             100   6e-23   Arabidopsis lyrata subsp. lyrata
ref|XP_007223351.1|  hypothetical protein PRUPE_ppa007441mg             100   6e-23   Prunus persica
ref|XP_002880378.1|  hypothetical protein ARALYDRAFT_481008           99.8    8e-23   Arabidopsis lyrata subsp. lyrata
ref|XP_002452058.1|  hypothetical protein SORBIDRAFT_04g017830        99.8    8e-23   Sorghum bicolor [broomcorn]
ref|XP_003579573.2|  PREDICTED: cysteine proteinase 1-like            99.8    8e-23   Brachypodium distachyon [annual false brome]
ref|XP_003607110.1|  Cysteine proteinase                              99.4    9e-23   Medicago truncatula
dbj|BAG16515.1|  putative cysteine proteinase                         99.4    1e-22   Capsicum chinense [bonnet pepper]
emb|CAQ00101.1|  papain-like cysteine proteinase                      99.4    1e-22   Hordeum vulgare subsp. vulgare [barley]
emb|CAH59428.1|  cysteine protease 2                                  98.2    1e-22   Plantago major [cart-track plant]
gb|ABK24153.1|  unknown                                               99.4    1e-22   Picea sitchensis
ref|XP_004952477.1|  PREDICTED: cysteine proteinase 1-like            99.0    1e-22   Setaria italica
ref|XP_009335626.1|  PREDICTED: cysteine proteinase 15A               99.0    1e-22   Pyrus x bretschneideri [bai li]
ref|XP_004152668.1|  PREDICTED: cysteine proteinase RD19a-like        99.0    1e-22   Cucumis sativus [cucumbers]
gb|KFK30492.1|  hypothetical protein AALP_AA7G268600                  99.0    2e-22   Arabis alpina [alpine rockcress]
gb|EMT16425.1|  Cysteine proteinase 1                                 99.0    2e-22   Aegilops tauschii
gb|KEH30505.1|  papain family cysteine protease                       98.6    2e-22   Medicago truncatula
ref|XP_006653265.1|  PREDICTED: cysteine proteinase 1-like            98.6    2e-22   
ref|XP_006828787.1|  hypothetical protein AMTR_s00001p00114210        98.6    2e-22   Amborella trichopoda
ref|NP_001105685.1|  cysteine proteinase 1 precursor                  98.6    2e-22   Zea mays [maize]
dbj|BAD43619.1|  putative cysteine proteinase                         98.6    2e-22   Arabidopsis thaliana [mouse-ear cress]
gb|EPS65881.1|  cysteine proteinase                                   98.2    2e-22   Genlisea aurea
gb|ACF86683.1|  unknown                                               98.2    2e-22   Zea mays [maize]
ref|NP_565512.1|  Papain family cysteine protease                     98.2    3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006404590.1|  hypothetical protein EUTSA_v10000210mg           97.8    4e-22   Eutrema salsugineum
gb|AAZ32411.1|  cysteine proteinase glycinain type                    97.4    5e-22   Nicotiana benthamiana
gb|EMS53996.1|  Cysteine proteinase 1                                 97.8    5e-22   Triticum urartu
emb|CAD40319.2|  OSJNBb0054B09.3                                      97.4    5e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AEX97108.1|  cysteine proteinase                                   93.6    6e-22   Malus domestica [apple tree]
emb|CDY41960.1|  BnaA01g05320D                                        97.4    6e-22   Brassica napus [oilseed rape]
gb|EEE60725.1|  hypothetical protein OsJ_14236                        97.1    7e-22   Oryza sativa Japonica Group [Japonica rice]
gb|EAY93546.1|  hypothetical protein OsI_15336                        96.7    8e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_004975256.1|  PREDICTED: cysteine proteinase 1-like            97.1    8e-22   Setaria italica
gb|EYU27644.1|  hypothetical protein MIMGU_mgv1a008452mg              96.3    1e-21   Erythranthe guttata [common monkey flower]
ref|XP_006665032.1|  PREDICTED: cysteine proteinase 1-like            94.4    1e-21   
ref|XP_009150026.1|  PREDICTED: cysteine proteinase RD19a             96.3    1e-21   Brassica rapa
gb|AES89347.2|  papain family cysteine protease                       95.9    2e-21   Medicago truncatula
ref|XP_002279862.1|  PREDICTED: cysteine proteinase RD19a             95.9    2e-21   Vitis vinifera
ref|XP_003607150.1|  Cysteine proteinase                              95.9    2e-21   
gb|AGS43121.1|  cysteine protease 1                                   91.3    2e-21   Zea mays [maize]
emb|CDX99593.1|  BnaC04g33500D                                        95.9    2e-21   Brassica napus [oilseed rape]
emb|CDY15894.1|  BnaA04g12170D                                        95.5    2e-21   Brassica napus [oilseed rape]
ref|XP_003574963.1|  PREDICTED: cysteine proteinase 1-like            95.9    2e-21   Brachypodium distachyon [annual false brome]
ref|XP_009786000.1|  PREDICTED: cysteine proteinase RD19a-like        95.5    2e-21   Nicotiana sylvestris
ref|XP_009140277.1|  PREDICTED: probable cysteine proteinase A494     95.5    2e-21   Brassica rapa
ref|NP_001046828.1|  Os02g0469600                                     95.5    3e-21   
gb|ABK21238.1|  unknown                                               95.1    3e-21   Picea sitchensis
gb|ABK24688.1|  unknown                                               95.1    3e-21   Picea sitchensis
gb|AAB16996.1|  thiol protease isoform B                              94.7    3e-21   Glycine max [soybeans]
gb|ACN40679.1|  unknown                                               95.1    3e-21   Picea sitchensis
emb|CAA52403.1|  putative thiol protease                              94.7    4e-21   Arabidopsis thaliana [mouse-ear cress]
emb|CAA57675.1|  cysteine proteinase                                  92.0    4e-21   Zea mays [maize]
dbj|BAD10859.1|  cysteine protease                                    94.4    6e-21   Tripolium pannonicum [sea starwort]
ref|NP_001052440.1|  Os04g0311400                                     93.2    2e-20   
gb|EMT10192.1|  Cysteine proteinase 1                                 92.8    2e-20   Aegilops tauschii
gb|AAB16997.1|  thiol protease isoform A                              92.4    2e-20   Glycine max [soybeans]
tpe|CAD66657.1|  TPA: putative cysteine proteinase precursor          92.8    3e-20   Hordeum vulgare subsp. vulgare [barley]
ref|XP_002969223.1|  hypothetical protein SELMODRAFT_91274            92.0    5e-20   Selaginella moellendorffii
gb|AAW21813.1|  cysteine protease                                     92.0    5e-20   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002960585.1|  hypothetical protein SELMODRAFT_266583           91.3    6e-20   Selaginella moellendorffii
gb|EMS64962.1|  Cysteine proteinase 1                                 91.3    6e-20   Triticum urartu
emb|CAQ00102.1|  papain-like cysteine proteinase                      87.8    2e-18   Hordeum vulgare subsp. vulgare [barley]
dbj|BAC57957.1|  thiol protease                                       85.9    2e-18   Tripolium pannonicum [sea starwort]
gb|EMS59778.1|  Cysteine proteinase 15A                               85.9    2e-18   Triticum urartu
ref|NP_001059639.1|  Os07g0480900                                     87.0    3e-18   
ref|XP_003560213.1|  PREDICTED: cysteine proteinase 1                 86.7    5e-18   Brachypodium distachyon [annual false brome]
ref|XP_002460693.1|  hypothetical protein SORBIDRAFT_02g033270        86.3    6e-18   Sorghum bicolor [broomcorn]
gb|AAB53103.1|  cysteine protease                                     82.0    6e-18   Brassica napus [oilseed rape]
ref|XP_010690815.1|  PREDICTED: cysteine proteinase RD19a             86.3    8e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009404192.1|  PREDICTED: cysteine proteinase 15A               85.5    9e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006658557.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...  84.3    2e-17   Oryza brachyantha
ref|XP_006293095.1|  hypothetical protein CARUB_v10019394mg           84.0    3e-17   Capsella rubella
ref|XP_008776953.1|  PREDICTED: cysteine proteinase-like              81.3    5e-17   Phoenix dactylifera
ref|XP_002876278.1|  hypothetical protein ARALYDRAFT_485911           83.6    5e-17   Arabidopsis lyrata subsp. lyrata
tpg|DAA40800.1|  TPA: putative cysteine protease family protein       84.0    5e-17   Zea mays [maize]
ref|XP_010504326.1|  PREDICTED: cysteine proteinase 15A-like          83.2    6e-17   Camelina sativa [gold-of-pleasure]
ref|XP_008804021.1|  PREDICTED: cysteine proteinase RD19a-like        81.6    9e-17   Phoenix dactylifera
gb|KFK34737.1|  hypothetical protein AALP_AA5G186400                  83.2    9e-17   Arabis alpina [alpine rockcress]
ref|XP_004959670.1|  PREDICTED: cysteine proteinase 1-like            83.2    9e-17   Setaria italica
ref|XP_006403513.1|  hypothetical protein EUTSA_v10010475mg           81.6    3e-16   Eutrema salsugineum
ref|XP_009117680.1|  PREDICTED: probable cysteine proteinase A494     81.6    3e-16   Brassica rapa
ref|XP_001761980.1|  predicted protein                                81.6    3e-16   Physcomitrella patens
ref|XP_001781954.1|  predicted protein                                81.3    4e-16   Physcomitrella patens
ref|XP_008802783.1|  PREDICTED: probable cysteine proteinase A494     81.6    4e-16   Phoenix dactylifera
gb|KEH43476.1|  papain family cysteine protease                       81.6    4e-16   Medicago truncatula
ref|XP_008354070.1|  PREDICTED: cysteine proteinase 15A-like          80.1    5e-16   Malus domestica [apple tree]
emb|CAB41090.1|  cysteine proteinase precursor-like protein           80.5    6e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567010.5|  Papain family cysteine protease                     80.5    8e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008362714.1|  PREDICTED: cysteine proteinase 15A               80.5    8e-16   Malus domestica [apple tree]
gb|EEC82027.1|  hypothetical protein OsI_25996                        82.0    9e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_010534431.1|  PREDICTED: cysteine proteinase 15A               80.5    1e-15   Tarenaya hassleriana [spider flower]
gb|ADY04293.1|  cysteine protease                                     77.4    1e-15   Clarkia xantiana subsp. xantiana
gb|ADY04361.1|  cysteine protease                                     77.0    2e-15   Clarkia xantiana subsp. xantiana
ref|XP_007218137.1|  hypothetical protein PRUPE_ppa007240mg           79.7    2e-15   Prunus persica
ref|XP_008233261.1|  PREDICTED: cysteine proteinase 15A               79.7    2e-15   Prunus mume [ume]
gb|ADY04414.1|  cysteine protease                                     77.0    2e-15   Clarkia xantiana subsp. xantiana
gb|ADY04336.1|  cysteine protease                                     77.0    2e-15   Clarkia xantiana subsp. xantiana
gb|ADY04358.1|  cysteine protease                                     77.0    2e-15   Clarkia xantiana subsp. xantiana
gb|ADY04342.1|  cysteine protease                                     77.0    2e-15   Clarkia xantiana subsp. xantiana
gb|ADY04457.1|  cysteine protease                                     77.0    2e-15   Clarkia xantiana subsp. xantiana
gb|ADY04262.1|  cysteine protease                                     77.0    2e-15   Clarkia xantiana subsp. xantiana
ref|XP_010918606.1|  PREDICTED: probable cysteine proteinase A494     79.3    2e-15   Elaeis guineensis
emb|CAB16316.1|  cysteine proteinase precursor                        79.3    2e-15   Vicia sativa [spring vetch]
gb|ADY04359.1|  cysteine protease                                     76.6    3e-15   
gb|KHN00877.1|  Cysteine proteinase 15A                               78.6    3e-15   
gb|KJB73490.1|  hypothetical protein B456_011G235500                  79.3    3e-15   
gb|AEQ54770.1|  cysteine proteinase CP1                               79.3    3e-15   
gb|ADY04482.1|  cysteine protease                                     76.3    3e-15   
gb|KHG08355.1|  Cysteinease 1                                         78.6    4e-15   
ref|XP_009116190.1|  PREDICTED: probable cysteine proteinase A494     78.2    5e-15   
gb|ADY04368.1|  cysteine protease                                     75.9    5e-15   
emb|CDX73424.1|  BnaC08g25790D                                        78.2    5e-15   
emb|CDY56961.1|  BnaA09g55030D                                        78.2    5e-15   
ref|XP_010243268.1|  PREDICTED: cysteine proteinase 15A               78.2    6e-15   
gb|ADY04268.1|  cysteine protease                                     75.9    6e-15   
gb|ADY04480.1|  cysteine protease                                     75.9    6e-15   
gb|ABY75169.1|  cysteine protease                                     73.2    7e-15   
ref|XP_007143764.1|  hypothetical protein PHAVU_007G099600g           78.6    8e-15   
ref|XP_004496226.1|  PREDICTED: cysteine proteinase 15A-like          77.8    9e-15   
emb|CAB17077.1|  cysteine proteinase precursor                        77.4    1e-14   
emb|CDY13816.1|  BnaA09g43180D                                        76.3    1e-14   
gb|ADY04295.1|  cysteine protease                                     74.7    1e-14   
ref|XP_008446834.1|  PREDICTED: cysteine proteinase 15A               77.4    1e-14   
emb|CDO99795.1|  unnamed protein product                              77.4    1e-14   
ref|XP_004157559.1|  PREDICTED: cysteine proteinase 15A-like          77.4    2e-14   
ref|XP_004142497.1|  PREDICTED: cysteine proteinase 15A-like          77.4    2e-14   
ref|XP_009789260.1|  PREDICTED: cysteine proteinase 15A               77.0    2e-14   
gb|KHN37802.1|  Cysteine proteinase 1                                 76.3    2e-14   
gb|AAD46920.1|AF167986_1  putative cysteine proteinase GmPM33         76.3    3e-14   
ref|NP_001236888.1|  cysteine proteinase precursor                    76.3    3e-14   
ref|XP_009617441.1|  PREDICTED: cysteine proteinase 15A               76.3    3e-14   
gb|KDP30486.1|  hypothetical protein JCGZ_16165                       75.9    5e-14   
ref|XP_010103534.1|  putative cysteine proteinase A494                75.9    5e-14   
gb|EYU39642.1|  hypothetical protein MIMGU_mgv1a008552mg              75.1    8e-14   
gb|ADE76932.1|  unknown                                               75.5    8e-14   
emb|CBI31400.3|  unnamed protein product                              73.6    1e-13   
ref|XP_004250044.1|  PREDICTED: cysteine proteinase 15A               74.7    1e-13   
ref|XP_006850211.1|  hypothetical protein AMTR_s00022p00251800        74.3    1e-13   
gb|AEW08440.1|  hypothetical protein 2_9845_02                        70.1    1e-13   
ref|XP_006436511.1|  hypothetical protein CICLE_v10031865mg           74.3    2e-13   
ref|XP_011094506.1|  PREDICTED: cysteine proteinase 15A               73.9    2e-13   
emb|CCA95098.1|  putative responsive to dehydration 19                70.1    7e-13   
ref|XP_010034320.1|  PREDICTED: cysteine proteinase 1                 72.4    7e-13   
ref|XP_010688493.1|  PREDICTED: cysteine proteinase 15A               72.4    8e-13   
ref|XP_011024366.1|  PREDICTED: cysteine proteinase 15A               72.0    1e-12   
ref|XP_006361690.1|  PREDICTED: cysteine proteinase 15A-like          72.0    1e-12   
ref|XP_011469621.1|  PREDICTED: cysteine proteinase 15A-like          70.1    1e-12   
emb|CEF99324.1|  Cysteine peptidase, cysteine active site             71.6    2e-12   
ref|XP_008647122.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin 7-...  70.5    2e-12   
gb|EPS63354.1|  hypothetical protein M569_11429                       70.9    2e-12   
emb|CAN64491.1|  hypothetical protein VITISV_015725                   70.1    3e-12   
ref|XP_002266821.1|  PREDICTED: cysteine proteinase 15A               70.9    3e-12   
ref|XP_007510080.1|  unknown                                          70.9    4e-12   
ref|XP_002316398.1|  hypothetical protein POPTR_0010s23510g           69.7    5e-12   
ref|XP_002533377.1|  cysteine protease, putative                      70.1    5e-12   
ref|XP_007010012.1|  Papain family cysteine protease                  69.3    1e-11   
ref|XP_001419933.1|  predicted protein                                67.8    1e-11   
ref|XP_003081549.1|  Cysteine proteinase Cathepsin F (ISS)            67.8    2e-11   
gb|ABO93617.1|  papain-like cysteine proteinase                       65.5    4e-11   
ref|XP_011496222.1|  PREDICTED: uncharacterized protein LOC105360904  68.6    5e-11   
ref|XP_011052455.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  68.6    5e-11   
gb|EGI66903.1|  Putative cysteine proteinase                          68.6    5e-11   
ref|XP_006608091.1|  PREDICTED: uncharacterized protein LOC102680728  68.2    6e-11   
ref|XP_003696602.1|  PREDICTED: putative cysteine proteinase CG12...  68.2    6e-11   
ref|XP_003707276.1|  PREDICTED: uncharacterized protein LOC100880620  68.2    6e-11   
gb|ADY04490.1|  cysteine protease                                     64.3    8e-11   
ref|XP_011169692.1|  PREDICTED: putative cysteine proteinase CG12163  67.8    1e-10   
emb|CBY11269.1|  unnamed protein product                              66.6    1e-10   
ref|XP_001607324.1|  PREDICTED: uncharacterized protein LOC100123649  67.4    1e-10   
ref|NP_505215.2|  Protein TAG-196                                     66.2    2e-10   
ref|XP_003115597.1|  CRE-TAG-196 protein                              66.2    2e-10   
gb|KIH48456.1|  cysteine proteinase family protein                    61.6    2e-10   
gb|AFM37363.1|  cathepsin F1                                          66.2    2e-10   
ref|XP_002988513.1|  hypothetical protein SELMODRAFT_128220           62.8    2e-10   
gb|EYC18288.1|  hypothetical protein Y032_0028g1777                   62.4    2e-10   
ref|XP_392381.3|  PREDICTED: putative cysteine proteinase CG12163...  66.6    2e-10   
ref|XP_011145705.1|  PREDICTED: uncharacterized protein LOC105186896  66.6    3e-10   
gb|EFN80374.1|  Putative cysteine proteinase CG12163                  66.6    3e-10   
ref|XP_006567715.1|  PREDICTED: putative cysteine proteinase CG12...  66.6    3e-10   
ref|XP_003492760.1|  PREDICTED: hypothetical protein LOC100745708     66.6    3e-10   
dbj|BAI44279.1|  cysteine proteinase inhibitor precursor              66.6    3e-10   
gb|KFB38327.1|  AGAP002879-PB-like protein                            66.2    4e-10   
dbj|BAD94378.1|  hypothetical protein                                 60.5    4e-10   
ref|XP_003436277.1|  AGAP002879-PB                                    66.2    4e-10   
ref|XP_002979143.1|  hypothetical protein SELMODRAFT_110288           63.2    4e-10   
emb|CBY31096.1|  unnamed protein product                              64.7    5e-10   
ref|XP_005184486.1|  PREDICTED: putative cysteine proteinase CG12...  65.5    5e-10   
ref|XP_312034.5|  AGAP002879-PA                                       65.9    5e-10   
ref|XP_002635317.1|  C. briggsae CBR-TAG-196 protein                  64.7    6e-10   
ref|XP_005184487.1|  PREDICTED: putative cysteine proteinase CG12...  65.5    6e-10   
ref|XP_011184040.1|  PREDICTED: putative cysteine proteinase CG12163  65.5    6e-10   
ref|XP_011203808.1|  PREDICTED: putative cysteine proteinase CG12163  65.1    7e-10   
ref|XP_004519757.1|  PREDICTED: putative cysteine proteinase CG12...  65.1    8e-10   
gb|KHN72698.1|  Putative cysteine proteinase                          61.2    9e-10   
ref|XP_011493714.1|  AAEL017153-PA                                    65.1    9e-10   
gb|ERG79645.1|  cysteine proteinase                                   60.5    1e-09   
ref|XP_003057227.1|  predicted protein                                63.5    1e-09   
ref|XP_001844355.1|  conserved hypothetical protein                   64.7    1e-09   
gb|AFW72358.1|  putative cysteine protease family protein             64.3    1e-09   
gb|ETN61472.1|  hypothetical protein AND_006867                       64.7    1e-09   
ref|XP_003148243.1|  hypothetical protein LOAG_12683                  60.8    2e-09   
gb|EFO15826.2|  hypothetical protein LOAG_12683                       60.8    2e-09   
ref|XP_003436276.1|  AGAP002879-PC                                    63.5    3e-09   
ref|XP_009111689.1|  PREDICTED: thiol protease aleurain-like          62.4    3e-09   
gb|AAO12867.1|  papain-like cysteine proteinase                       58.2    3e-09   
ref|XP_008550537.1|  PREDICTED: uncharacterized protein LOC103573287  63.5    3e-09   
gb|KDR17524.1|  Putative cysteine proteinase                          63.5    3e-09   
gb|EZA58965.1|  Putative cysteine proteinase                          63.5    3e-09   
ref|XP_011331416.1|  PREDICTED: uncharacterized protein LOC105275911  63.5    3e-09   
emb|CDJ88889.1|  Proteinase inhibitor I25 and Proteinase inhibito...  62.8    3e-09   
emb|CDJ92562.1|  Proteinase inhibitor I25 and Proteinase inhibito...  62.8    3e-09   
gb|EHJ64782.1|  cysteine proteinase inhibitor precursor               60.1    3e-09   
ref|XP_011309436.1|  PREDICTED: uncharacterized protein LOC105270293  63.2    4e-09   
ref|XP_006827472.1|  hypothetical protein AMTR_s00009p00129100        62.0    4e-09   
ref|XP_009035142.1|  hypothetical protein AURANDRAFT_22962            62.4    4e-09   
ref|XP_001894882.1|  cathepsin F-like cysteine proteinase             59.3    5e-09   
gb|EGT34543.1|  hypothetical protein CAEBREN_26318                    62.0    6e-09   
gb|AAT07059.1|  cathepsin F-like cysteine proteinase                  62.0    6e-09   
gb|AFQ01139.1|  cathepsin F-like protease                             62.0    6e-09   
gb|EFN65613.1|  Putative cysteine proteinase CG12163                  62.4    6e-09   
gb|ABE72973.1|  cathepsin L                                           60.5    6e-09   
ref|XP_009131925.1|  PREDICTED: thiol protease aleurain-like          61.2    6e-09   
gb|EGT34572.1|  hypothetical protein CAEBREN_13324                    62.0    6e-09   
gb|AEE62591.1|  unknown                                               61.2    7e-09   
ref|XP_011260522.1|  PREDICTED: uncharacterized protein LOC105253881  62.4    7e-09   
gb|ENN81994.1|  hypothetical protein YQE_01705                        61.2    8e-09   
emb|CCA95082.1|  putative responsive to dehydration 19                58.5    8e-09   
ref|XP_002000409.1|  GI10216                                          61.6    9e-09   
ref|XP_001994049.1|  GH22731                                          61.6    9e-09   
ref|XP_002096026.1|  GE25302                                          61.6    1e-08   
ref|XP_003151185.1|  hypothetical protein LOAG_15647                  57.4    1e-08   
ref|XP_003375070.1|  viral cathepsin                                  61.2    1e-08   
gb|ACR08662.1|  cathepsin F                                           58.9    1e-08   
ref|XP_003284553.1|  hypothetical protein DICPUDRAFT_96752            60.5    1e-08   
gb|AJF94882.1|  C1 family cathepsin F10                               61.6    1e-08   
ref|XP_002056575.1|  GJ11017                                          61.2    1e-08   
ref|NP_730901.1|  CG12163, isoform A                                  61.2    1e-08   
ref|XP_002017233.1|  GL22196                                          61.2    1e-08   
ref|XP_009034680.1|  hypothetical protein AURANDRAFT_22129            60.1    1e-08   
ref|XP_002038380.1|  GM10654                                          61.2    1e-08   
ref|XP_001978897.1|  GG11133                                          61.2    1e-08   
ref|XP_002137768.1|  GA27408, isoform A                               61.2    2e-08   
ref|XP_005184488.1|  PREDICTED: putative cysteine proteinase CG12...  60.5    2e-08   
ref|XP_011434325.1|  PREDICTED: uncharacterized protein LOC105333...  60.8    2e-08   
gb|EJW79799.1|  cysteine protease 6                                   58.9    2e-08   
ref|XP_011434326.1|  PREDICTED: uncharacterized protein LOC105333...  60.8    2e-08   
emb|CDP90584.1|  Protein BM-TAG-196                                   60.5    2e-08   
ref|XP_001955780.1|  GF16067                                          60.8    2e-08   
gb|EKC42097.1|  Cathepsin F                                           60.8    2e-08   
ref|XP_002682087.1|  predicted protein                                60.1    2e-08   
ref|XP_635417.1|  cysteine proteinase 1                               59.7    2e-08   
gb|AAP33049.1|  cysteine proteinase 1                                 59.7    2e-08   
emb|CAA26255.1|  cysteine proteinase I precursor                      59.7    2e-08   
ref|NP_649521.1|  CG12163, isoform B                                  60.1    2e-08   
ref|XP_003736743.1|  GA27408, isoform B                               60.1    2e-08   
emb|CDX88753.1|  BnaA03g08960D                                        59.7    3e-08   
gb|ABJ89814.1|  cysteine protease preprotein                          59.3    3e-08   
gb|ABC69432.1|  cysteine protease                                     59.3    3e-08   
gb|ABC48936.1|  cathepsin F like protease                             60.1    3e-08   
ref|XP_006007112.1|  PREDICTED: cathepsin F-like                      59.7    3e-08   
gb|ABC69433.1|  cysteine protease                                     59.3    3e-08   
ref|XP_010666300.1|  PREDICTED: thiol protease aleurain-like          59.3    3e-08   
ref|XP_003378245.1|  cathepsin F                                      59.3    3e-08   
ref|NP_001156454.1|  cathepsin F isoform 2 precursor                  59.7    4e-08   
ref|XP_003386471.1|  PREDICTED: cysteine proteinase 1-like            59.3    4e-08   
emb|CDY19784.1|  BnaA09g04370D                                        57.8    4e-08   
ref|XP_009047014.1|  hypothetical protein LOTGIDRAFT_172186           58.2    4e-08   
ref|XP_006038953.1|  PREDICTED: cathepsin W-like                      58.9    4e-08   
gb|AAY81948.1|  cysteine protease 11                                  58.9    4e-08   
ref|XP_008177856.1|  PREDICTED: cathepsin W-like                      56.2    4e-08   
ref|XP_006258352.1|  PREDICTED: cathepsin W-like                      58.5    4e-08   
gb|AHJ86278.1|  cysteine protease                                     59.3    4e-08   
gb|KHN12281.1|  Thiol protease aleurain-like                          58.5    5e-08   
ref|XP_004519758.1|  PREDICTED: putative cysteine proteinase CG12...  59.7    5e-08   
ref|XP_002427787.1|  Cathepsin F precursor, putative                  58.9    5e-08   
ref|XP_008195656.1|  PREDICTED: uncharacterized protein LOC662417...  59.7    6e-08   
ref|XP_008195657.1|  PREDICTED: uncharacterized protein LOC662417...  59.7    6e-08   
ref|XP_003578189.1|  PREDICTED: thiol protease aleurain               58.5    6e-08   
ref|XP_004351999.1|  cysteine protease                                58.5    7e-08   
ref|XP_004596903.1|  PREDICTED: cathepsin W                           58.5    7e-08   
gb|KHN06070.1|  Thiol protease aleurain-like                          58.2    7e-08   
gb|ENN81374.1|  hypothetical protein YQE_02191                        59.7    7e-08   
emb|CBY20597.1|  unnamed protein product                              58.2    7e-08   
ref|XP_003533785.1|  PREDICTED: cysteine proteinase                   58.2    7e-08   
ref|XP_005305646.1|  PREDICTED: cathepsin W-like                      58.2    8e-08   
gb|AII16490.1|  cathepsin F                                           57.8    8e-08   
ref|XP_010261858.1|  PREDICTED: thiol protease aleurain-like          58.2    8e-08   
ref|XP_009359733.1|  PREDICTED: thiol protease aleurain-like          58.2    9e-08   
gb|ELT97360.1|  hypothetical protein CAPTEDRAFT_147978                57.4    9e-08   
dbj|BAA84280.1|  Cysteine proteinase                                  56.6    9e-08   
gb|AAF21470.1|U85983_1  cysteine proteinase                           57.0    1e-07   
ref|XP_009029595.1|  hypothetical protein HELRODRAFT_157956           57.8    1e-07   
gb|ABC69431.1|  cysteine protease                                     57.8    1e-07   
gb|AAO60047.1|  midgut cysteine proteinase 4                          57.8    1e-07   
gb|ABC69430.1|  cysteine protease                                     57.8    1e-07   
gb|ABK91811.1|  cathepsin F precursor                                 57.8    1e-07   
gb|ABC69429.1|  cysteine protease                                     57.8    1e-07   
emb|CEF63690.1|  Cathepsin F                                          57.8    1e-07   
gb|AAF40479.1|  cystein protease                                      57.4    1e-07   
gb|ABK91805.1|  cysteine proteinase 7 precursor                       57.4    1e-07   
emb|CBK24241.2|  unnamed protein product                              58.2    1e-07   
gb|EHJ68876.1|  hypothetical protein KGM_22410                        56.6    1e-07   
dbj|GAM21447.1|  hypothetical protein SAMD00019534_046220             57.4    1e-07   
ref|XP_003747496.1|  PREDICTED: cathepsin L-like                      57.4    1e-07   
ref|XP_008479905.1|  PREDICTED: cathepsin L-like                      57.4    1e-07   
ref|XP_009162112.1|  hypothetical protein T265_12432                  58.2    1e-07   
ref|XP_010047474.1|  PREDICTED: thiol protease aleurain-like          57.4    2e-07   
emb|CDJ81168.1|  Proteinase inhibitor I29 and Peptidase C1A domai...  57.4    2e-07   
ref|XP_006980634.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      57.8    2e-07   
ref|XP_002073772.1|  GK14287                                          58.2    2e-07   
ref|XP_008337854.1|  PREDICTED: thiol protease aleurain-like          57.4    2e-07   
dbj|GAM23991.1|  hypothetical protein SAMD00019534_071660             57.4    2e-07   
ref|XP_002505924.1|  cysteine endopeptidase                           56.6    2e-07   
ref|XP_006121731.1|  PREDICTED: cathepsin W-like                      55.5    2e-07   
gb|AAB82455.1|  lymphopain                                            57.4    2e-07   
ref|NP_034115.2|  cathepsin W preproprotein                           57.4    2e-07   
gb|ACG50796.1|  cathepsin B1                                          57.0    2e-07   
ref|XP_005351748.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      57.8    2e-07   
gb|KCW79401.1|  hypothetical protein EUGRSUZ_C00809                   57.0    2e-07   
ref|XP_003378244.1|  cathepsin F                                      57.0    2e-07   
ref|NP_001133678.1|  Cathepsin F precursor                            57.8    2e-07   
ref|NP_001275826.1|  cysteine protease Cp precursor                   57.0    2e-07   
ref|XP_006268168.1|  PREDICTED: cathepsin F-like                      57.4    2e-07   
gb|KHJ99379.1|  papain family cysteine protease                       54.3    2e-07   



>gb|AAK27969.1|AF242373_1 cysteine protease [Ipomoea batatas]
Length=366

 Score =   120 bits (301),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTSD  168
            GYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  311  GYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  366



>gb|AAF40415.1|AF216784_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=368

 Score =   119 bits (299),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTSD  168
            GYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  313  GYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  368



>gb|AAF61440.1|AF138264_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   119 bits (299),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTSD  168
            GYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  313  GYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  368



>gb|AAF40414.1|AF216783_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   119 bits (299),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTSD  168
            GYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  313  GYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  368



>gb|AAF61441.1|AF138265_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=366

 Score =   119 bits (298),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTSD  168
            GYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  311  GYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  366



>gb|AAF40416.1|AF216785_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
 gb|AAF61442.1|AF138266_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
Length=366

 Score =   118 bits (295),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTSD  168
            GYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  311  GYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  366



>gb|ACI04578.1| cysteine protease-like protein [Robinia pseudoacacia]
Length=335

 Score =   114 bits (284),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 49/52 (94%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAPIRLKEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAAV+T
Sbjct  281  GYAPIRLKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVHT  332



>gb|KDP41743.1| hypothetical protein JCGZ_26761 [Jatropha curcas]
Length=370

 Score =   114 bits (284),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
            GYAPIRLKEKPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTVAAV T +
Sbjct  316  GYAPIRLKEKPYWIIKNSWGETWGESGYYKICRGRNVCGVDSMVSTVAAVQTSS  369



>ref|XP_002512963.1| cysteine protease, putative [Ricinus communis]
 gb|EEF49466.1| cysteine protease, putative [Ricinus communis]
Length=373

 Score =   113 bits (282),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
            GYAPIR+KEKPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAAV T +
Sbjct  319  GYAPIRMKEKPYWIIKNSWGENWGESGYYKICRGRNICGVDSMVSTVAAVQTAS  372



>gb|AIB06024.1| CP2 [Hevea brasiliensis]
Length=372

 Score =   112 bits (280),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 49/55 (89%), Positives = 52/55 (95%), Gaps = 1/55 (2%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAA-VNTPT  162
            GYAP+RLKEKPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA V TP+
Sbjct  317  GYAPVRLKEKPYWIIKNSWGENWGESGYYKICRGRNICGVDSMVSTVAAVVQTPS  371



>emb|CDP20652.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   112 bits (280),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
            GYAPIR+KEKPYWIIKNSWGE WGE GYYKICRG NICGVDSMVSTVAAV+T T
Sbjct  319  GYAPIRMKEKPYWIIKNSWGEHWGENGYYKICRGHNICGVDSMVSTVAAVHTST  372



>ref|XP_007042077.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOX97908.1| Papain family cysteine protease [Theobroma cacao]
Length=395

 Score =   112 bits (280),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 46/52 (88%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAP+R+K+KPYWIIKNSWGESWGE G+YKICRGRNICGVDSMVSTVAAV+T
Sbjct  341  GYAPVRMKDKPYWIIKNSWGESWGEDGFYKICRGRNICGVDSMVSTVAAVDT  392



>ref|XP_010271520.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=370

 Score =   112 bits (279),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 47/51 (92%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVN  153
            GYAPIRLK+KPYWIIKNSWGE WGE GYYKICRGRN+CGVDSMVSTVAAVN
Sbjct  316  GYAPIRLKDKPYWIIKNSWGEGWGENGYYKICRGRNVCGVDSMVSTVAAVN  366



>gb|KHG24064.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=374

 Score =   112 bits (279),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 47/52 (90%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAPIRLK+KPYWIIKNSWGE+WGE GYYKICRGRN+CGVDS+VSTVAAVNT
Sbjct  320  GYAPIRLKDKPYWIIKNSWGETWGENGYYKICRGRNVCGVDSLVSTVAAVNT  371



>gb|AAX19661.1| cysteine proteinase [Populus tomentosa]
Length=374

 Score =   112 bits (279),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
            GYAP+R+KEKPYWIIKNSWGESWGE G+YKICRGRNICGVDSMVSTVAAV T +
Sbjct  320  GYAPVRMKEKPYWIIKNSWGESWGENGFYKICRGRNICGVDSMVSTVAAVQTSS  373



>ref|XP_003606998.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89195.1| papain family cysteine protease [Medicago truncatula]
Length=362

 Score =   111 bits (277),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
             Y+PIRLKEKPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAAV+T T
Sbjct  309  AYSPIRLKEKPYWIIKNSWGETWGENGYYKICRGRNICGVDSMVSTVAAVHTTT  362



>ref|XP_011047717.1| PREDICTED: cysteine proteinase RD19a [Populus euphratica]
Length=368

 Score =   111 bits (277),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 47/52 (90%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAP+R+KEKPYWIIKNSWGESWGE G+YKICRGRNICGVDSMVSTVAAV T
Sbjct  314  GYAPVRMKEKPYWIIKNSWGESWGENGFYKICRGRNICGVDSMVSTVAAVQT  365



>ref|XP_011088458.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Sesamum indicum]
Length=379

 Score =   111 bits (278),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 48/52 (92%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAPIR KEKPYWIIKNSWGE WGE GYYKICRGRNICGVDSMVSTVAAV+T
Sbjct  326  GYAPIRRKEKPYWIIKNSWGEKWGEKGYYKICRGRNICGVDSMVSTVAAVST  377



>gb|KJB32561.1| hypothetical protein B456_005G247000 [Gossypium raimondii]
Length=374

 Score =   110 bits (275),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 46/52 (88%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAPIRLK+KPYWIIKNSWGE+WGE G+YKICRGRN+CGVDS+VSTVAAVNT
Sbjct  320  GYAPIRLKDKPYWIIKNSWGETWGENGFYKICRGRNVCGVDSLVSTVAAVNT  371



>gb|KJB79047.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
Length=373

 Score =   110 bits (275),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAP+R+K+KPYWIIKNSWGE+WGE G+Y+ICRGRNICGVDSMVSTVAAVNT
Sbjct  319  GYAPVRMKDKPYWIIKNSWGENWGENGFYRICRGRNICGVDSMVSTVAAVNT  370



>ref|XP_004230928.1| PREDICTED: cysteine proteinase RD19a [Solanum lycopersicum]
Length=369

 Score =   110 bits (275),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
            G++PIR+KEKPYWIIKNSWGE WGE GYYKICRGRN+CGVDSMVSTVAAV+T +
Sbjct  315  GFSPIRMKEKPYWIIKNSWGEKWGESGYYKICRGRNVCGVDSMVSTVAAVSTSS  368



>gb|ABQ10201.1| cysteine protease Cp3 [Actinidia deliciosa]
Length=365

 Score =   110 bits (274),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 46/55 (84%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            GYAPIR+KEKPYWIIKNSWGESWGE G+YKIC+GRN+CGVDSMVSTVAAV+T ++
Sbjct  311  GYAPIRMKEKPYWIIKNSWGESWGENGFYKICQGRNVCGVDSMVSTVAAVHTTSN  365



>ref|XP_009373025.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=371

 Score =   110 bits (274),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            GY+PIRLKEKPYWIIKNSWGE+WGE G+YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  315  GYSPIRLKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAASVKTN  369



>ref|XP_006362019.1| PREDICTED: cysteine proteinase RD19a-like [Solanum tuberosum]
Length=368

 Score =   110 bits (274),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
            G++PIR+KEKPYWIIKNSWGE WGE GYYKICRGRN+CGVDSMVSTVAAV+T +
Sbjct  315  GFSPIRMKEKPYWIIKNSWGEKWGENGYYKICRGRNVCGVDSMVSTVAAVSTSS  368



>emb|CAE54306.1| putative papain-like cysteine proteinase [Gossypium hirsutum]
Length=373

 Score =   110 bits (274),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAP+R+K+KPYWIIKNSWGE+WGE G+Y+ICRGRNICGVDSMVSTVAAVNT
Sbjct  319  GYAPVRMKDKPYWIIKNSWGENWGENGFYRICRGRNICGVDSMVSTVAAVNT  370



>sp|P05993.1|PAPA5_CARPA RecName: Full=Cysteine proteinase; AltName: Full=Clone PLBPC13, 
partial [Carica papaya]
 emb|CAA27609.1| pot. cysteine proteinase [Carica papaya]
Length=96

 Score =   104 bits (259),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            GYAPIRLKEKPYW+IKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAAV+T + 
Sbjct  42   GYAPIRLKEKPYWVIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHTTSQ  96



>gb|KDO49483.1| hypothetical protein CISIN_1g017318mg [Citrus sinensis]
Length=373

 Score =   110 bits (274),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAA  147
            GYAPIRLKEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAA
Sbjct  323  GYAPIRLKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAA  371



>ref|XP_006487337.1| PREDICTED: cysteine proteinase RD19a-like [Citrus sinensis]
Length=373

 Score =   109 bits (273),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAA  147
            GYAPIRLKEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAA
Sbjct  323  GYAPIRLKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAA  371



>ref|XP_002280798.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CAN73591.1| hypothetical protein VITISV_022889 [Vitis vinifera]
 emb|CBI19785.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   109 bits (273),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GY+PIR KEKPYWIIKNSWGESWGE GYYKICRG NICGVDSMVSTVAA++T
Sbjct  317  GYSPIRFKEKPYWIIKNSWGESWGEQGYYKICRGHNICGVDSMVSTVAAIHT  368



>ref|XP_003539008.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=363

 Score =   109 bits (273),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
             YAPIR+KEKP+WIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAAV+T T
Sbjct  309  AYAPIRMKEKPFWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHTTT  362



>ref|XP_002313770.1| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE87725.1| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   109 bits (273),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
             YAP+R+KEKPYWIIKNSWGESWGE G+YKICRGRNICGVDSMVSTVAAV T
Sbjct  314  AYAPVRMKEKPYWIIKNSWGESWGENGFYKICRGRNICGVDSMVSTVAAVQT  365



>gb|ABK92536.1| unknown [Populus trichocarpa]
Length=368

 Score =   109 bits (273),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
             YAP+R+KEKPYWIIKNSWGESWGE G+YKICRGRNICGVDSMVSTVAAV T
Sbjct  314  AYAPVRMKEKPYWIIKNSWGESWGENGFYKICRGRNICGVDSMVSTVAAVQT  365



>ref|XP_011028940.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score =   109 bits (273),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 46/52 (88%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAPIR KEKP+WIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA++T
Sbjct  313  GYAPIRFKEKPFWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAIHT  364



>ref|XP_004507484.1| PREDICTED: cysteine proteinase RD19a-like [Cicer arietinum]
Length=363

 Score =   109 bits (273),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
             YAPIR+KEKPYWIIKNSWGE+WGE G+YKICRGRNICGVDSMVSTVAAV+T T
Sbjct  309  AYAPIRMKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAVHTTT  362



>ref|XP_009602233.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana tomentosiformis]
Length=369

 Score =   109 bits (273),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
            G++PIR+KEKPYWIIKNSWGE WGE GYYKICRGRN+CGVDSMVSTVAAV+T +
Sbjct  315  GFSPIRMKEKPYWIIKNSWGEKWGENGYYKICRGRNVCGVDSMVSTVAAVSTSS  368



>gb|EYU37835.1| hypothetical protein MIMGU_mgv1a008237mg [Erythranthe guttata]
Length=380

 Score =   109 bits (273),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
            GY+PIR+KEKPYWIIKNSWG +WGE GYYKICRGRNICGVDSMVSTVAAV+T +
Sbjct  326  GYSPIRMKEKPYWIIKNSWGPNWGEDGYYKICRGRNICGVDSMVSTVAAVSTTS  379



>ref|XP_002275759.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI17456.3| unnamed protein product [Vitis vinifera]
Length=367

 Score =   109 bits (272),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
            GYAPIR KEKPYWIIKNSWGESWGE GYYKICRG N CGVDSMVSTVAA+ T T
Sbjct  313  GYAPIRFKEKPYWIIKNSWGESWGEDGYYKICRGHNACGVDSMVSTVAAIQTTT  366



>gb|KHG15253.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=373

 Score =   109 bits (273),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAP+R+K+KPYWIIKNSWGE+WGE G+Y+ICRGRNICGVDSMVSTVAAVNT
Sbjct  319  GYAPVRMKDKPYWIIKNSWGENWGENGFYRICRGRNICGVDSMVSTVAAVNT  370



>ref|XP_009406357.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=372

 Score =   109 bits (272),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 44/52 (85%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GY+PIRLK+KP+WIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTV A+NT
Sbjct  317  GYSPIRLKQKPFWIIKNSWGETWGEKGYYKICRGRNVCGVDSMVSTVTAINT  368



>ref|XP_003523684.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=366

 Score =   109 bits (272),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 45/51 (88%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVN  153
             YAPIR KEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAA++
Sbjct  312  AYAPIRFKEKPYWIIKNSWGESWGEEGYYKICRGRNVCGVDSMVSTVAAIH  362



>ref|NP_001267989.1| cysteine protease precursor [Vitis vinifera]
 gb|ABX79341.1| cysteine protease [Vitis vinifera]
Length=377

 Score =   109 bits (272),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 45/55 (82%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            GYAPIR+K+KPYWIIKNSWGE+WGE G+YKICRGRN+CGVDSMVSTVAAV+T ++
Sbjct  323  GYAPIRMKDKPYWIIKNSWGENWGENGFYKICRGRNVCGVDSMVSTVAAVHTTSN  377



>ref|XP_010061009.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW67908.1| hypothetical protein EUGRSUZ_F01612 [Eucalyptus grandis]
Length=369

 Score =   109 bits (272),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 46/52 (88%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAPIR KEKPYWIIKNSWGE+WGE GYYKICRGR+ICGVDSMVSTVAA++T
Sbjct  315  GYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGRDICGVDSMVSTVAAIHT  366



>ref|XP_004150061.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004166953.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN61836.1| Cysteine protease [Cucumis sativus]
Length=377

 Score =   109 bits (272),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 47/52 (90%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAPIRLK+KPYWIIKNSWG +WGE GYYKICRGRNICGVDSMVSTVAAV+T
Sbjct  323  GYAPIRLKDKPYWIIKNSWGANWGENGYYKICRGRNICGVDSMVSTVAAVHT  374



>ref|XP_011092831.1| PREDICTED: cysteine proteinase RD19a-like [Sesamum indicum]
Length=378

 Score =   109 bits (272),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 46/51 (90%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    YAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            YAPIRLKEKPYWIIKNSWGE+WGE GYYKICRG N+CGVDSMVSTVAAV+T
Sbjct  326  YAPIRLKEKPYWIIKNSWGENWGENGYYKICRGHNVCGVDSMVSTVAAVST  376



>ref|XP_006423403.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
 gb|ESR36643.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
Length=375

 Score =   109 bits (272),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAA  147
            GYAPIRLKEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVST+AA
Sbjct  323  GYAPIRLKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTIAA  371



>ref|XP_010268619.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=369

 Score =   108 bits (271),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 44/52 (85%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GY+PIR+K+KPYWIIKNSWGESWGE GYYKICRGR++CGVDSMVSTVAA++T
Sbjct  315  GYSPIRMKDKPYWIIKNSWGESWGENGYYKICRGRDVCGVDSMVSTVAAIHT  366



>ref|XP_009373000.1| PREDICTED: cysteine proteinase RD19a [Pyrus x bretschneideri]
Length=371

 Score =   108 bits (271),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            GY+PIRLKEKPYWIIKNSWGE+WGE G+YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  315  GYSPIRLKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAASVKTN  369



>ref|XP_004291404.1| PREDICTED: cysteine proteinase 15A-like [Fragaria vesca subsp. 
vesca]
Length=365

 Score =   108 bits (271),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 46/52 (88%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAPIR KEKPYWIIKNSWG+SWGE GYYKICRGRN+CGVDSMVSTVAA++T
Sbjct  314  GYAPIRFKEKPYWIIKNSWGQSWGEEGYYKICRGRNVCGVDSMVSTVAAMHT  365



>gb|AAR92156.1| putative cysteine protease 3 [Iris x hollandica]
Length=292

 Score =   108 bits (269),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 46/52 (88%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAPIRLKEKPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTV A++T
Sbjct  236  GYAPIRLKEKPYWIIKNSWGETWGENGYYKICRGRNVCGVDSMVSTVTAIHT  287



>gb|KHN39817.1| Cysteine proteinase RD19a [Glycine soja]
Length=332

 Score =   108 bits (270),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
             YAPIR+KEKP+WIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAAV+T T
Sbjct  278  AYAPIRMKEKPFWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHTTT  331



>gb|ABK94801.1| unknown [Populus trichocarpa]
Length=367

 Score =   108 bits (271),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 45/52 (87%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAPIR KEKP+WIIKNSWG++WGE GYYKICRGRNICGVDSMVSTVAA++T
Sbjct  313  GYAPIRFKEKPFWIIKNSWGQNWGENGYYKICRGRNICGVDSMVSTVAAIHT  364



>ref|XP_008382317.1| PREDICTED: cysteine proteinase RD19a [Malus domestica]
Length=371

 Score =   108 bits (270),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            GY+PIRLKEKPYWIIKNSWGE+WGE G+YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  315  GYSPIRLKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAASVKTN  369



>ref|XP_002510469.1| cysteine protease, putative [Ricinus communis]
 gb|EEF52656.1| cysteine protease, putative [Ricinus communis]
Length=366

 Score =   108 bits (270),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 43/52 (83%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAP+RLK+KP+WIIKNSWGE+WGE GYYKICRGRN+CGVD+MVSTVAA++T
Sbjct  312  GYAPVRLKDKPFWIIKNSWGENWGENGYYKICRGRNVCGVDAMVSTVAAIHT  363



>ref|NP_001241450.1| uncharacterized protein LOC100778716 precursor [Glycine max]
 gb|ACU20049.1| unknown [Glycine max]
Length=366

 Score =   108 bits (270),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 45/51 (88%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVN  153
             YAPIR KEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAA++
Sbjct  312  AYAPIRFKEKPYWIIKNSWGESWGEEGYYKICRGRNVCGVDSMVSTVAAIH  362



>gb|ABK96580.1| unknown [Populus trichocarpa x Populus deltoides]
Length=367

 Score =   108 bits (270),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 45/52 (87%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAPIR KEKP+WIIKNSWG++WGE GYYKICRGRNICGVDSMVSTVAA++T
Sbjct  313  GYAPIRFKEKPFWIIKNSWGQNWGENGYYKICRGRNICGVDSMVSTVAAIHT  364



>ref|XP_003540987.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=365

 Score =   108 bits (270),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
             YAPIR+KEKP+WIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVA+V+T T
Sbjct  311  AYAPIRMKEKPFWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVASVHTTT  364



>ref|NP_001266121.1| uncharacterized protein LOC101501911 precursor [Cicer arietinum]
 emb|CAA08906.1| cysteine proteinase [Cicer arietinum]
Length=362

 Score =   108 bits (270),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 46/51 (90%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVN  153
            G+APIRLKEKPYWIIKNSWG++WGE GYYKICRGRNICGVDSMVSTVAAV+
Sbjct  308  GFAPIRLKEKPYWIIKNSWGQNWGEEGYYKICRGRNICGVDSMVSTVAAVH  358



>gb|KHN45894.1| Cysteine proteinase RD19a [Glycine soja]
Length=366

 Score =   108 bits (270),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 45/51 (88%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVN  153
             YAPIR KEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAA++
Sbjct  312  AYAPIRFKEKPYWIIKNSWGESWGEEGYYKICRGRNVCGVDSMVSTVAAIH  362



>ref|XP_007017672.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOY14897.1| Papain family cysteine protease [Theobroma cacao]
Length=401

 Score =   108 bits (270),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
            GYAPIR KEKPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVS+VAA+ T +
Sbjct  347  GYAPIRFKEKPYWIIKNSWGENWGEEGYYKICRGRNVCGVDSMVSSVAALQTKS  400



>ref|XP_008460996.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=377

 Score =   108 bits (269),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 46/52 (88%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAPIR+K+KPYWIIKNSWG +WGE GYYKICRGRNICGVDSMVSTVAAV+T
Sbjct  323  GYAPIRMKDKPYWIIKNSWGANWGENGYYKICRGRNICGVDSMVSTVAAVHT  374



>ref|XP_011037175.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
 ref|XP_011037176.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
Length=368

 Score =   108 bits (269),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
            GY+PIR+K+KPYWIIKNSWGE WGE G+YKICRGRN+CGVDSMVSTVAAV T +
Sbjct  314  GYSPIRMKDKPYWIIKNSWGEKWGENGFYKICRGRNVCGVDSMVSTVAAVQTTS  367



>gb|AJA74415.1| cysteine protease [Cicer arietinum]
Length=358

 Score =   108 bits (269),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 46/51 (90%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVN  153
            G+APIRLKEKPYWIIKNSWG++WGE GYYKICRGRNICGVDSMVSTVAAV+
Sbjct  304  GFAPIRLKEKPYWIIKNSWGQNWGEEGYYKICRGRNICGVDSMVSTVAAVH  354



>ref|XP_003589348.1| Cysteine proteinase [Medicago truncatula]
 gb|AES59599.1| papain family cysteine protease [Medicago truncatula]
Length=364

 Score =   108 bits (269),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 45/52 (87%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAPIRLKEKPYWIIKNSWG++WGE GYYKICRGRN+CGVDSMVSTVAA  +
Sbjct  313  GYAPIRLKEKPYWIIKNSWGQNWGEEGYYKICRGRNVCGVDSMVSTVAAAQS  364



>ref|XP_002302004.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
 gb|ABK94746.1| unknown [Populus trichocarpa]
 gb|EEE81277.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
Length=367

 Score =   107 bits (268),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 45/52 (87%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAPIR KEKP+WIIKNSWG++WGE GYYKICRGRNICGVDSMVSTVAA++T
Sbjct  313  GYAPIRFKEKPFWIIKNSWGQNWGENGYYKICRGRNICGVDSMVSTVAAIHT  364



>ref|XP_007136047.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
 gb|ESW08041.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
Length=366

 Score =   107 bits (268),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
             YAPIR KEKP+WIIKNSWGESWGE GYYKICRG N+CGVDSMVSTVAA++T +
Sbjct  312  AYAPIRFKEKPFWIIKNSWGESWGENGYYKICRGHNVCGVDSMVSTVAAIHTSS  365



>gb|AGV54334.1| cysteine proteinase RD19a-like protein [Phaseolus vulgaris]
Length=366

 Score =   107 bits (268),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
             YAPIR KEKP+WIIKNSWGESWGE GYYKICRG N+CGVDSMVSTVAA++T +
Sbjct  312  AYAPIRFKEKPFWIIKNSWGESWGENGYYKICRGHNVCGVDSMVSTVAAIHTSS  365



>dbj|BAJ53178.1| JHL18I08.12 [Jatropha curcas]
 gb|KDP38578.1| hypothetical protein JCGZ_04503 [Jatropha curcas]
Length=368

 Score =   107 bits (268),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 45/55 (82%), Positives = 52/55 (95%), Gaps = 1/55 (2%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            GYAPIRLK+KP+WIIKNSWGESWGE GYY+ICRGRNICGVD+MVS+VAA++ P S
Sbjct  313  GYAPIRLKDKPFWIIKNSWGESWGENGYYRICRGRNICGVDAMVSSVAAIH-PNS  366



>ref|XP_010105270.1| Cysteine proteinase 15A [Morus notabilis]
 gb|EXC04205.1| Cysteine proteinase 15A [Morus notabilis]
Length=372

 Score =   107 bits (268),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 44/51 (86%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVN  153
            GYAPIR K+KPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTVAA++
Sbjct  313  GYAPIRFKDKPYWIIKNSWGENWGEQGYYKICRGRNVCGVDSMVSTVAALH  363



>gb|AAU81591.1| cysteine proteinase, partial [Petunia x hybrida]
Length=190

 Score =   104 bits (260),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
            G+APIR+KEKPYWIIKNSWGE WGE GYYKICRGRN+CGVDSMVSTVAAV+T +
Sbjct  137  GFAPIRMKEKPYWIIKNSWGEKWGESGYYKICRGRNVCGVDSMVSTVAAVSTSS  190



>ref|XP_002305451.2| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE85962.2| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   107 bits (267),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
            GY+P+R+KEKP+WIIKNSWGE WGE G+YKICRGRN+CGVDSMVSTVAAV T +
Sbjct  314  GYSPVRMKEKPFWIIKNSWGEKWGENGFYKICRGRNVCGVDSMVSTVAAVQTSS  367



>ref|XP_011045161.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score =   107 bits (267),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 44/51 (86%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVN  153
            GYAPIR KEKP+WIIKNSWGE+WGE GYYKICR RNICGVDSMVSTVAA++
Sbjct  313  GYAPIRFKEKPFWIIKNSWGENWGENGYYKICRARNICGVDSMVSTVAAIH  363



>ref|XP_010028631.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW55393.1| hypothetical protein EUGRSUZ_I01305 [Eucalyptus grandis]
Length=370

 Score =   107 bits (267),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/57 (84%), Positives = 51/57 (89%), Gaps = 2/57 (4%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAV--NTPTS  165
            GYAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA    TP S
Sbjct  313  GYAPIRMKDKPYWIIKNSWGETWGENGYYKICRGRNICGVDSMVSTVAAAVHTTPGS  369



>ref|XP_009376976.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=445

 Score =   107 bits (268),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            GY+PIRLKEKPYWIIKNSWGESW E G+YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  389  GYSPIRLKEKPYWIIKNSWGESWRESGFYKICRGRNICGVDSMVSTVAAASVKTN  443



>emb|CDQ51995.1| Cysteine proteinase, partial [Fagus sylvatica]
Length=165

 Score =   103 bits (258),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVN  153
            GYAPIRLKEKP+WIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTVAA+N
Sbjct  114  GYAPIRLKEKPFWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVAAIN  164



>ref|XP_004148554.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Cucumis sativus]
Length=381

 Score =   107 bits (266),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 44/51 (86%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVN  153
            GYAPIR+++K YWIIKNSWGESWGE GYYKICRGRNICGVDS+VSTVAAV+
Sbjct  317  GYAPIRMRDKDYWIIKNSWGESWGENGYYKICRGRNICGVDSLVSTVAAVH  367



>gb|KGN43159.1| Papain-like cysteine proteinase isoform I [Cucumis sativus]
Length=387

 Score =   107 bits (266),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 44/51 (86%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVN  153
            GYAPIR+++K YWIIKNSWGESWGE GYYKICRGRNICGVDS+VSTVAAV+
Sbjct  323  GYAPIRMRDKDYWIIKNSWGESWGENGYYKICRGRNICGVDSLVSTVAAVH  373



>ref|XP_004165230.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
Length=387

 Score =   107 bits (266),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 44/51 (86%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVN  153
            GYAPIR+++K YWIIKNSWGESWGE GYYKICRGRNICGVDS+VSTVAAV+
Sbjct  323  GYAPIRMRDKDYWIIKNSWGESWGENGYYKICRGRNICGVDSLVSTVAAVH  373



>ref|XP_009146338.1| PREDICTED: cysteine proteinase 15A-like [Brassica rapa]
 emb|CDY32227.1| BnaA01g17570D [Brassica napus]
Length=368

 Score =   107 bits (266),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 47/55 (85%), Positives = 51/55 (93%), Gaps = 1/55 (2%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGR-NICGVDSMVSTVAAVNTPT  162
            GYAPIRLKEKPYWIIKNSWG +WGE GYYKICRGR NICG+D+MVSTVAAV+T T
Sbjct  313  GYAPIRLKEKPYWIIKNSWGSTWGEDGYYKICRGRHNICGMDTMVSTVAAVHTST  367



>dbj|BAC41322.1| hypothetical protein [Lotus japonicus]
Length=358

 Score =   107 bits (266),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 45/51 (88%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    YAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA++T
Sbjct  307  YAPIRMKQKPYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAALHT  357



>ref|XP_007131787.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
 gb|ESW03781.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
Length=361

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
             YAPIR+KEKPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAAV+T T
Sbjct  307  AYAPIRMKEKPYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHTTT  360



>emb|CDY34441.1| BnaC01g21920D [Brassica napus]
Length=368

 Score =   106 bits (265),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 47/55 (85%), Positives = 51/55 (93%), Gaps = 1/55 (2%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGR-NICGVDSMVSTVAAVNTPT  162
            GYAPIRLKEKPYWIIKNSWG +WGE GYYKICRGR NICG+D+MVSTVAAV+T T
Sbjct  313  GYAPIRLKEKPYWIIKNSWGSTWGEDGYYKICRGRHNICGMDTMVSTVAAVHTST  367



>ref|XP_010066197.1| PREDICTED: probable cysteine proteinase A494 [Eucalyptus grandis]
 gb|KCW64029.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
 gb|KCW64030.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
Length=376

 Score =   106 bits (265),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 44/52 (85%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
             Y+PIR+KEKPYWIIKNSWGE+WGE G+YKICRGRNICGVDSMVSTVAA++T
Sbjct  322  AYSPIRMKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAIHT  373



>ref|XP_009392632.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=369

 Score =   106 bits (265),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 43/52 (83%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GY+PIRLK+KP+WIIKNSWGE+WGE GYYKICRGRNICGVDSMVS+V+A++T
Sbjct  314  GYSPIRLKDKPFWIIKNSWGENWGEHGYYKICRGRNICGVDSMVSSVSAIHT  365



>gb|KHN22211.1| Cysteine proteinase 15A [Glycine soja]
Length=366

 Score =   106 bits (265),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 44/51 (86%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVN  153
             YAPIR KEKPYWIIKNSWGESWGE GYY ICRGRN+CGVDSMVSTVAA++
Sbjct  312  AYAPIRFKEKPYWIIKNSWGESWGEEGYYNICRGRNVCGVDSMVSTVAAIH  362



>emb|CAE45588.1| papain-like cysteine proteinase-like protein 1 [Lotus japonicus]
Length=359

 Score =   106 bits (265),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 45/51 (88%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    YAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA++T
Sbjct  308  YAPIRMKQKPYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAALHT  358



>ref|XP_008775532.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=371

 Score =   106 bits (265),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
             YAPIR KEKPYWIIKNSWGE WGE GYYKICRGRN+CGVDSMVSTVAAV +
Sbjct  319  AYAPIRFKEKPYWIIKNSWGEKWGENGYYKICRGRNVCGVDSMVSTVAAVRS  370



>gb|AIB06025.1| CP3 [Hevea brasiliensis]
Length=366

 Score =   106 bits (264),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 42/52 (81%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAPIR K+KP+WIIKNSWGE+WGE GYYKICRGRNICG+D+MVS+VAA++T
Sbjct  312  GYAPIRFKDKPFWIIKNSWGENWGENGYYKICRGRNICGMDAMVSSVAAIHT  363



>gb|KHN25410.1| Cysteine proteinase RD19a [Glycine soja]
Length=365

 Score =   106 bits (264),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
             YAPIR+KEKP+WIIKNSWGE+WGE GYYKICRGR+ICGVDSMVSTVA+V+T T
Sbjct  311  AYAPIRMKEKPFWIIKNSWGENWGENGYYKICRGRSICGVDSMVSTVASVHTTT  364



>ref|XP_009376977.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=447

 Score =   107 bits (266),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            GY+PIRLKEKPYWIIKNSWGESW E G+YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  391  GYSPIRLKEKPYWIIKNSWGESWRESGFYKICRGRNICGVDSMVSTVAAASVKTN  445



>ref|XP_006473584.1| PREDICTED: cysteine proteinase 15A-like [Citrus sinensis]
Length=369

 Score =   106 bits (264),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 45/55 (82%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            G+APIR KEKPYWIIKNSWGE+WGE GYYKIC GRN+CGVDSMVS+VAAV+T +S
Sbjct  315  GFAPIRFKEKPYWIIKNSWGENWGENGYYKICMGRNVCGVDSMVSSVAAVHTTSS  369



>gb|ACM80348.1| cysteine proteinase [Solanum lycopersicum]
Length=368

 Score =   106 bits (264),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
            G++PIR+KEKPYWIIKNSWGE WGE GYYKI RGRN+CGVDSMVSTVAAV+T +
Sbjct  315  GFSPIRMKEKPYWIIKNSWGEKWGESGYYKIRRGRNVCGVDSMVSTVAAVSTSS  368



>ref|XP_008236965.1| PREDICTED: cysteine proteinase RD19a [Prunus mume]
Length=367

 Score =   106 bits (264),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 44/55 (80%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            GY+PIR+KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDSMVSTVAA +  T+
Sbjct  311  GYSPIRMKEKPYWIIKNSWGENWGEKGFYKICKGRNICGVDSMVSTVAAASVETN  365



>ref|XP_008448073.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=385

 Score =   106 bits (264),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 43/51 (84%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVN  153
            GYAPIR+++K YWIIKNSWGE+WGE GYYKICRGRNICGVDS+VSTVAAV+
Sbjct  321  GYAPIRMRDKDYWIIKNSWGENWGENGYYKICRGRNICGVDSLVSTVAAVH  371



>ref|XP_003550405.2| PREDICTED: cysteine proteinase 15A [Glycine max]
Length=392

 Score =   106 bits (264),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAV  150
             YAPIR K KPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAA+
Sbjct  338  AYAPIRFKNKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAI  387



>ref|XP_007201310.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
 gb|EMJ02509.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
Length=367

 Score =   106 bits (264),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 44/55 (80%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            GY+PIR+KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDSMVSTVAA +  T+
Sbjct  311  GYSPIRMKEKPYWIIKNSWGENWGEKGFYKICKGRNICGVDSMVSTVAAASVETN  365



>ref|XP_010672379.1| PREDICTED: cysteine proteinase RD19a-like [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score =   106 bits (264),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 44/51 (86%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVN  153
            GYAPIR KEKPYWIIKNSWG +WG+ GYYKICRG N+CGVDSMVSTVAAVN
Sbjct  320  GYAPIRFKEKPYWIIKNSWGPNWGDQGYYKICRGHNVCGVDSMVSTVAAVN  370



>dbj|BAF98584.1| CM0216.500.nc [Lotus japonicus]
Length=360

 Score =   105 bits (263),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 45/51 (88%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    YAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA++T
Sbjct  307  YAPIRMKQKPYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAALHT  357



>ref|XP_004290288.1| PREDICTED: probable cysteine proteinase A494 [Fragaria vesca 
subsp. vesca]
Length=372

 Score =   106 bits (264),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAV  150
            GY+P+R+KEKPYWIIKNSWGE+WGE G+YKICRGRNICGVDSMVSTVAAV
Sbjct  321  GYSPVRMKEKPYWIIKNSWGENWGEKGFYKICRGRNICGVDSMVSTVAAV  370



>gb|KDO84720.1| hypothetical protein CISIN_1g017548mg [Citrus sinensis]
Length=369

 Score =   105 bits (263),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 44/55 (80%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            G+APIR KEKPYWIIKNSWGE+WGE GYYKIC GRN+CGVDSMVS+VAA++T +S
Sbjct  315  GFAPIRFKEKPYWIIKNSWGENWGENGYYKICMGRNVCGVDSMVSSVAAIHTTSS  369



>ref|XP_002306900.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
 gb|ABK92924.1| unknown [Populus trichocarpa]
 gb|EEE93896.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
Length=367

 Score =   105 bits (263),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 44/51 (86%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVN  153
            GYAPIR KEKP+WIIKNSWGE+WGE GYYKICR RNICGVDSMVSTVAA++
Sbjct  313  GYAPIRFKEKPFWIIKNSWGENWGENGYYKICRARNICGVDSMVSTVAAIH  363



>gb|ABF46642.1| papain-like cysteine proteinase [Pachysandra terminalis]
Length=374

 Score =   105 bits (263),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 48/54 (89%), Gaps = 1/54 (2%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
            G+APIR KEKPYWIIKNSWGESWGE GYYKICRGRNICG+DSMVS VAA   PT
Sbjct  320  GFAPIRFKEKPYWIIKNSWGESWGEKGYYKICRGRNICGMDSMVSAVAAA-VPT  372



>ref|XP_007160702.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
 gb|ESW32696.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
Length=365

 Score =   105 bits (262),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
             YAPIR KEKPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTV A++  T
Sbjct  311  AYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVGAIHAST  364



>ref|XP_006435090.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
 gb|ESR48330.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
Length=369

 Score =   105 bits (262),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 44/55 (80%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            G+APIR KEKPYWIIKNSWGE+WGE GYYKIC GRN+CGVDSMVS+VAA++T +S
Sbjct  315  GFAPIRFKEKPYWIIKNSWGENWGENGYYKICMGRNVCGVDSMVSSVAAIHTTSS  369



>emb|CAE45589.1| papain-like cysteine proteinase-like protein 2 [Lotus japonicus]
Length=361

 Score =   105 bits (262),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 44/51 (86%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    YAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTVAA++T
Sbjct  308  YAPIRMKQKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVAALHT  358



>emb|CAA82995.1| cysteine proteinase [Vicia sativa]
Length=358

 Score =   105 bits (262),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
             YAPIRLKEKPYWIIKNSWG++WGE GYYKICRGRN+CGVDSMVSTVAA  +
Sbjct  305  AYAPIRLKEKPYWIIKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTVAAAQS  356



>sp|P25804.1|CYSP_PEA RecName: Full=Cysteine proteinase 15A; AltName: Full=Turgor-responsive 
protein 15A; Flags: Precursor [Pisum sativum]
 emb|CAA38242.1| unnamed protein product [Pisum sativum]
Length=363

 Score =   105 bits (262),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
             YAPIRLKEKPYWIIKNSWG++WGE GYYKICRGRN+CGVDSMVSTVAA  +
Sbjct  310  AYAPIRLKEKPYWIIKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTVAAAQS  361



>gb|KJB07487.1| hypothetical protein B456_001G026600 [Gossypium raimondii]
Length=377

 Score =   105 bits (262),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
            GY+PI LK+KPYWIIKNSWGE+WGE GYYKICRG N+CGVDS+VSTV A+NT +
Sbjct  323  GYSPIHLKDKPYWIIKNSWGENWGENGYYKICRGSNVCGVDSLVSTVVALNTKS  376



>dbj|BAF03553.1| cysteine proteinase CP2 [Phaseolus vulgaris]
Length=365

 Score =   105 bits (262),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
             YAPIR KEKPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTV A++  T
Sbjct  311  AYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVGAIHAST  364



>gb|AAD29084.1|AF082181_1 cysteine proteinase precursor [Solanum melongena]
Length=363

 Score =   105 bits (262),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            G+APIRLKEKPYWIIKNSWGE+WGE GYYKICRG NICGVD+MVSTV A +T
Sbjct  307  GFAPIRLKEKPYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTATHT  358



>gb|AAO11786.1| pre-pro cysteine proteinase [Vicia faba]
Length=363

 Score =   105 bits (262),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
             YAPIRLKEKPYWI+KNSWG++WGE GYYKICRGRN+CGVDSMVSTVAA  +
Sbjct  310  AYAPIRLKEKPYWIVKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTVAAAQS  361



>ref|XP_010910124.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=374

 Score =   105 bits (262),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAPIR KEKPYWIIKNSWGE+WGE GYYKIC+GRN+CGVDSMVSTV AV +
Sbjct  322  GYAPIRFKEKPYWIIKNSWGENWGEDGYYKICKGRNVCGVDSMVSTVTAVRS  373



>dbj|BAF98585.1| CM0216.510.nc [Lotus japonicus]
Length=360

 Score =   105 bits (261),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 44/51 (86%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    YAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTVAA++T
Sbjct  307  YAPIRMKQKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVAALHT  357



>gb|AAB67878.1| pre-pro-cysteine proteinase [Vicia faba]
Length=363

 Score =   105 bits (261),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
             YAPIRLKEKPYWI+KNSWG++WGE GYYKICRGRN+CGVDSMVSTVAA  +
Sbjct  310  AYAPIRLKEKPYWIVKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTVAAAQS  361



>gb|ABK96252.1| unknown [Populus trichocarpa x Populus deltoides]
Length=156

 Score =   101 bits (252),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
            GY+P+R+KEKP+WIIKNSWGE WGE G+YKICRGRN+CGVDSMVSTVAAV T +
Sbjct  103  GYSPVRMKEKPFWIIKNSWGEKWGENGFYKICRGRNVCGVDSMVSTVAAVQTSS  156



>ref|XP_002280808.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CBI19783.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   105 bits (261),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
            GY+PIR KEKPYW++KNSWG++WGE GYYKICRG NICGVDSMVSTVAA+ + T
Sbjct  312  GYSPIRFKEKPYWLLKNSWGQNWGEHGYYKICRGHNICGVDSMVSTVAAIQSAT  365



>gb|ACK57563.1| cysteine protease-like protein [Arachis hypogaea]
Length=364

 Score =   105 bits (261),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAPIR KEKPYWIIKNSWGE+WGE GYYKICRG N+CGVDSMVSTV A++T
Sbjct  310  GYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGPNMCGVDSMVSTVIAIHT  361



>ref|XP_009109502.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
 emb|CDX90310.1| BnaA08g16740D [Brassica napus]
Length=369

 Score =   104 bits (260),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            GYAP R KEKPYWIIKNSWGE+WGE G+YKICRGRN+CGVDS+VSTV A  +PT+
Sbjct  314  GYAPARFKEKPYWIIKNSWGETWGENGFYKICRGRNVCGVDSLVSTVTAAVSPTA  368



>gb|AAL05851.1|AF411121_1 cysteine proteinase precursor [Sandersonia aurantiaca]
Length=360

 Score =   104 bits (259),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            G+APIR KEKPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVS+V+A +T
Sbjct  307  GFAPIRFKEKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSSVSAFHT  358



>gb|AAM65162.1| cysteine proteinase RD19A [Arabidopsis thaliana]
Length=368

 Score =   104 bits (259),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            GYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDSMVSTVAA  + T+
Sbjct  313  GYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSMVSTVAATVSTTA  367



>ref|XP_009351218.1| PREDICTED: cysteine proteinase RD19a-like, partial [Pyrus x bretschneideri]
Length=282

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            GY+PIRLKEKPYWIIKNSWGE+WGE G+YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  226  GYSPIRLKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAASVKTN  280



>gb|AAU81589.1| cysteine proteinase [Petunia x hybrida]
Length=257

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            G+APIRLKEKPYWIIKNSWGESWGE GYYKICRGRNICGVD+MVSTV A +T
Sbjct  201  GFAPIRLKEKPYWIIKNSWGESWGEQGYYKICRGRNICGVDAMVSTVTAAHT  252



>ref|XP_003545051.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=367

 Score =   104 bits (259),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAV  150
             YAPIR K KPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAA+
Sbjct  313  AYAPIRFKNKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAI  362



>gb|EYU42593.1| hypothetical protein MIMGU_mgv1a008336mg [Erythranthe guttata]
Length=377

 Score =   104 bits (259),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
             +APIR+KEKPYWIIKNSWG +WGE GYYKIC+GRN+CGVDSMVSTVAAV T
Sbjct  325  AFAPIRMKEKPYWIIKNSWGPNWGEKGYYKICQGRNLCGVDSMVSTVAAVTT  376



>ref|NP_568052.1| cysteine proteinase RD19a [Arabidopsis thaliana]
 sp|P43296.1|RD19A_ARATH RecName: Full=Cysteine proteinase RD19a; Short=RD19; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA02373.1| thiol protease [Arabidopsis thaliana]
 emb|CAB38829.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 emb|CAB80572.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AAL85009.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 gb|AAM91778.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 dbj|BAE98545.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AEE87016.1| cysteine proteinase RD19a [Arabidopsis thaliana]
Length=368

 Score =   103 bits (258),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            GYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDSMVSTVAA  + T+
Sbjct  313  GYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSMVSTVAATVSTTA  367



>gb|ABK93575.1| unknown [Populus trichocarpa]
Length=157

 Score =   100 bits (249),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAPIR KEKP+WIIKNSWGE+WGE GYYKICR RNICGVDSMVSTVAA++ 
Sbjct  103  GYAPIRFKEKPFWIIKNSWGENWGENGYYKICRARNICGVDSMVSTVAAIHA  154



>ref|XP_010530325.1| PREDICTED: cysteine proteinase RD19a [Tarenaya hassleriana]
Length=370

 Score =   103 bits (258),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
            GY+PIRLKEKPYWIIKNSWG +WGE GYYKIC GRN+CG+D+MVS+VAAV+T T
Sbjct  316  GYSPIRLKEKPYWIIKNSWGANWGEEGYYKICHGRNLCGMDTMVSSVAAVHTST  369



>ref|XP_010440192.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=365

 Score =   103 bits (257),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 1/55 (2%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG-RNICGVDSMVSTVAAVNTPT  162
            GYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  N+CG+DSMVSTVAAV+T T
Sbjct  310  GYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGPHNVCGMDSMVSTVAAVHTTT  364



>emb|CAB53397.1| cysteine protease [Medicago sativa]
Length=209

 Score =   101 bits (252),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAPIRLKEKPYWIIKNSWG++WGE GYYKICRGRN+CGVDSMVSTVAA  +
Sbjct  158  GYAPIRLKEKPYWIIKNSWGQNWGEEGYYKICRGRNVCGVDSMVSTVAAAQS  209



>gb|AAL69389.1|AF462226_1 putative cysteine proteinase [Narcissus pseudonarcissus]
Length=136

 Score = 99.8 bits (247),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTSD  168
            G+APIR KEKPYWIIKNSWGE+WGE GYYKIC+GRN+CGVDSMVSTV A++T   D
Sbjct  81   GWAPIRFKEKPYWIIKNSWGENWGEKGYYKICKGRNVCGVDSMVSTVTAIHTTPKD  136



>ref|XP_009611293.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana tomentosiformis]
 emb|CAB44983.1| putative preprocysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   103 bits (257),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG NICGVD+MVSTV A +T
Sbjct  307  GFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  358



>gb|AJP16692.1| cysteine protease, partial [Striga hermonthica]
Length=148

 Score =   100 bits (248),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAA  147
            GYAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTVAA
Sbjct  100  GYAPIRMKDKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVAA  148



>dbj|BAA92495.1| cysteine protease [Vigna mungo]
Length=364

 Score =   103 bits (256),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 44/51 (86%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVN  153
            GYAPIR KEKPYWIIKNSWGESWGE GYYKICRG+N CGVDSMVSTV A++
Sbjct  310  GYAPIRFKEKPYWIIKNSWGESWGENGYYKICRGQNACGVDSMVSTVGAIH  360



>ref|XP_010434865.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score =   103 bits (256),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 1/55 (2%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG-RNICGVDSMVSTVAAVNTPT  162
            GYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  N+CG+DSMVSTVAAV+T T
Sbjct  310  GYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGPHNMCGMDSMVSTVAAVHTTT  364



>gb|AAK07731.1| CPR2-like cysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   103 bits (256),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG NICGVD+MVSTV A +T
Sbjct  307  GFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  358



>ref|XP_004238314.1| PREDICTED: cysteine proteinase 15A [Solanum lycopersicum]
Length=363

 Score =   103 bits (256),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            G+APIRLK KPYWIIKNSWG++WGE GYYKICRG NICGVD+MVSTV A +T
Sbjct  307  GFAPIRLKNKPYWIIKNSWGKTWGEHGYYKICRGHNICGVDAMVSTVTATHT  358



>emb|CAA78361.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   103 bits (256),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG NICGVD+MVSTV A +T
Sbjct  307  GFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  358



>emb|CAA78365.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=365

 Score =   102 bits (255),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG NICGVD+MVSTV A +T
Sbjct  309  GFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  360



>ref|XP_010449835.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score =   102 bits (255),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 1/55 (2%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG-RNICGVDSMVSTVAAVNTPT  162
            GYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  N+CG+DSMVSTVAAV+T T
Sbjct  310  GYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGPHNMCGMDSMVSTVAAVHTTT  364



>ref|XP_006341997.1| PREDICTED: cysteine proteinase 15A-like [Solanum tuberosum]
Length=376

 Score =   102 bits (255),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            G+APIRLK KPYWIIKNSWG++WGE GYYKICRG NICGVD+MVSTV A +T
Sbjct  320  GFAPIRLKNKPYWIIKNSWGKTWGEHGYYKICRGHNICGVDAMVSTVTATHT  371



>gb|AAQ81938.1| cysteine proteinase precursor [Ipomoea batatas]
Length=371

 Score =   102 bits (255),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAPIR K+KPYWIIKNSWGE+WGE GYYKICRG NICGVDSMVS+V A +T
Sbjct  317  GYAPIRFKDKPYWIIKNSWGENWGEEGYYKICRGNNICGVDSMVSSVTAAST  368



>dbj|BAD94010.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
Length=86

 Score = 97.4 bits (241),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTSD  168
            GYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDSMVSTVAA  + T+ 
Sbjct  31   GYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSMVSTVAATVSTTAH  86



>ref|XP_006283974.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
 gb|EOA16872.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
Length=365

 Score =   102 bits (255),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 1/55 (2%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG-RNICGVDSMVSTVAAVNTPT  162
            GYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  N+CG+D+MVSTVAAV+T T
Sbjct  310  GYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGPHNMCGMDTMVSTVAAVHTTT  364



>emb|CAB17075.1| cysteine proteinase precursor [Phaseolus vulgaris]
Length=365

 Score =   102 bits (255),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
             YAPIR KEKPYWIIKNSWGE+WG  GYYKICRGRN+CGVDSMVSTV A++  T
Sbjct  311  AYAPIRFKEKPYWIIKNSWGENWGGNGYYKICRGRNVCGVDSMVSTVGAIHAST  364



>gb|KJB29611.1| hypothetical protein B456_005G110200 [Gossypium raimondii]
Length=370

 Score =   102 bits (255),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
            GY+PIR K+KP+WIIKNSWG +WGE GYYKICRGRN+CGVDSMVS+VAA++T +
Sbjct  316  GYSPIRFKDKPFWIIKNSWGANWGEDGYYKICRGRNVCGVDSMVSSVAALHTKS  369



>emb|CDY71205.1| BnaCnng71840D [Brassica napus]
Length=368

 Score =   102 bits (255),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 42/55 (76%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            GYAP R KEKPYWIIKNSWGE+WGE G+YKICRGRN+CGVDS+VSTV A  +P +
Sbjct  313  GYAPARFKEKPYWIIKNSWGETWGEDGFYKICRGRNVCGVDSLVSTVTATVSPAA  367



>gb|AAL60581.1|AF454959_1 senescence-associated cysteine protease [Brassica oleracea]
Length=368

 Score =   102 bits (255),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 42/55 (76%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            GYAP R KEKPYWIIKNSWGE+WGE G+YKICRGRN+CGVDS+VSTV A  +P +
Sbjct  313  GYAPARFKEKPYWIIKNSWGETWGEDGFYKICRGRNVCGVDSLVSTVTATVSPAA  367



>ref|XP_008387995.1| PREDICTED: cysteine proteinase 15A [Malus domestica]
Length=365

 Score =   102 bits (254),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            G+APIRLKEKPYWI+KNSWG+SWGE GYYKICRG N CGVDS+VSTVAA++T
Sbjct  311  GFAPIRLKEKPYWILKNSWGQSWGEQGYYKICRGYNSCGVDSLVSTVAALHT  362



>emb|CDY09707.1| BnaC07g33540D [Brassica napus]
Length=366

 Score =   102 bits (254),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 45/53 (85%), Positives = 48/53 (91%), Gaps = 1/53 (2%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGR-NICGVDSMVSTVAAVNT  156
            GYAP+RL+EKPYWIIKNSWG  WGE GYYKICRG  NICGVD+MVSTVAAVNT
Sbjct  311  GYAPLRLEEKPYWIIKNSWGSMWGEKGYYKICRGTPNICGVDTMVSTVAAVNT  363



>dbj|BAF46302.1| cysteine proteinase precursor [Ipomoea nil]
Length=369

 Score =   102 bits (254),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAPIR K+KPYWI+KNSWGE+WGE GYYKICRG NICG+DSMVSTV A +T
Sbjct  315  GYAPIRFKDKPYWIVKNSWGENWGEEGYYKICRGNNICGIDSMVSTVTAAST  366



>emb|CDX98179.1| BnaC07g09190D [Brassica napus]
Length=72

 Score = 96.7 bits (239),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTSD  168
            GYAP R KEKPYWIIKNSWGE+WGE G+YKICRGRN+CGVDS+VSTV A  +P + 
Sbjct  17   GYAPARFKEKPYWIIKNSWGETWGEDGFYKICRGRNVCGVDSLVSTVTATVSPAAH  72



>gb|KFK24413.1| hypothetical protein AALP_AAs58848U000200 [Arabis alpina]
Length=372

 Score =   102 bits (254),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/55 (85%), Positives = 50/55 (91%), Gaps = 2/55 (4%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGR-NICGVDSMVSTVAAVN-TP  159
            GYAPIRLKEKPYWIIKNSWG+ WGE GYYKICRGR NICG+D+MVSTVAAV  TP
Sbjct  317  GYAPIRLKEKPYWIIKNSWGKMWGEHGYYKICRGRHNICGMDTMVSTVAAVQITP  371



>ref|XP_006411706.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
 dbj|BAJ33785.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53159.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
Length=373

 Score =   102 bits (253),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            GYAP R KEKPYWIIKNSWGESWGE G+YKIC+GRNICGVDS+VSTV+A  + T+
Sbjct  318  GYAPARFKEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSLVSTVSATVSTTA  372



>gb|KHN12668.1| Cysteine proteinase 15A [Glycine soja]
Length=156

 Score = 99.0 bits (245),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAV  150
             YAPIR K KPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAA+
Sbjct  102  AYAPIRFKNKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAI  151



>ref|XP_009776238.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana sylvestris]
Length=365

 Score =   102 bits (253),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG NICGVD+MVSTV A +T
Sbjct  309  GFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  360



>ref|XP_006414378.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
 gb|ESQ55831.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
Length=367

 Score =   102 bits (253),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 45/55 (82%), Positives = 48/55 (87%), Gaps = 1/55 (2%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG-RNICGVDSMVSTVAAVNTPT  162
            GY+PIRLKEKPYWIIKNSWG  WGE GYYKICRG  NICG+D+MVSTVAAV T T
Sbjct  312  GYSPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGSHNICGMDTMVSTVAAVQTST  366



>gb|KHG15062.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=370

 Score =   102 bits (253),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
            GY+PIR K+KP+WIIKNSWG +WGE GYY+ICRGRN+CGVDSMVS+VAA++T +
Sbjct  316  GYSPIRFKDKPFWIIKNSWGANWGEDGYYRICRGRNVCGVDSMVSSVAALHTKS  369



>ref|XP_010531457.1| PREDICTED: probable cysteine proteinase A494 [Tarenaya hassleriana]
Length=364

 Score =   101 bits (252),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 42/49 (86%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAA  147
            GYAP R+KEKP+WIIKNSWGE+WGE G+YKICRGRNICGVDS+VSTVAA
Sbjct  312  GYAPARMKEKPFWIIKNSWGENWGEKGFYKICRGRNICGVDSLVSTVAA  360



>gb|ACX54787.2| cysteine protease [Arachis diogoi]
Length=360

 Score =   101 bits (252),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 42/56 (75%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTSD  168
            GYAPIR K+KP+WIIKNSWGESWGE GYYKICRG+N+CGVDSMVS+V A    +S+
Sbjct  304  GYAPIRFKDKPFWIIKNSWGESWGEDGYYKICRGKNVCGVDSMVSSVVATTFTSSN  359



>ref|XP_008775280.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=368

 Score =   101 bits (252),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAV  150
            GYAPIR K+KPYWIIKNSWGE+WGE GYYKICRG NICGV+SMVSTV A+
Sbjct  317  GYAPIRFKDKPYWIIKNSWGENWGEDGYYKICRGHNICGVESMVSTVTAI  366



>emb|CDP07452.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   101 bits (252),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/53 (83%), Positives = 49/53 (92%), Gaps = 1/53 (2%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG-RNICGVDSMVSTVAAVNT  156
            GYAPIRLK+KPYWIIKNSWGE+WGE GYYK CR  RN+CGVDSMVS+VAAV+T
Sbjct  324  GYAPIRLKDKPYWIIKNSWGENWGENGYYKFCRADRNLCGVDSMVSSVAAVHT  376



>ref|XP_006283963.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
 gb|EOA16861.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
Length=368

 Score =   101 bits (251),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            GYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTV+A  + T+
Sbjct  313  GYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVSATVSTTA  367



>ref|XP_011083631.1| PREDICTED: cysteine proteinase 15A-like [Sesamum indicum]
Length=371

 Score =   101 bits (251),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 48/54 (89%), Gaps = 1/54 (2%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVN-TP  159
            GYAPIRLKEKPYWIIKNSWGE+WGE GYYKICRG N+CGV SMVSTV A + TP
Sbjct  317  GYAPIRLKEKPYWIIKNSWGENWGENGYYKICRGHNVCGVASMVSTVTAAHVTP  370



>ref|XP_008221329.1| PREDICTED: cysteine proteinase 15A-like [Prunus mume]
Length=366

 Score =   101 bits (251),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 41/52 (79%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            G+APIR KEKPYWI+KNSWG+SWGE GYYKICRG N CGVDS+VSTVA+++T
Sbjct  312  GFAPIRFKEKPYWILKNSWGQSWGEEGYYKICRGHNPCGVDSLVSTVASLHT  363



>emb|CAA78403.1| pre-pro-cysteine proteinase [Solanum lycopersicum]
Length=361

 Score =   100 bits (250),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            G+APIRLK KPYWIIKNSWG++WGE GYYKICRG +ICGVD+MVSTV A +T
Sbjct  305  GFAPIRLKNKPYWIIKNSWGKTWGEHGYYKICRGHHICGVDAMVSTVTATHT  356



>gb|KJB58164.1| hypothetical protein B456_009G197400 [Gossypium raimondii]
Length=375

 Score =   101 bits (251),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 40/51 (78%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVN  153
            GYAP+R K KPYWIIKNSWGE+WGE GYYKICRG N+CGVDSMVS+V+A++
Sbjct  316  GYAPVRFKNKPYWIIKNSWGENWGENGYYKICRGNNVCGVDSMVSSVSALH  366



>gb|AAB62937.1| stress-induced cysteine proteinase [Lavatera thuringiaca]
Length=175

 Score = 98.2 bits (243),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            GYAP+R KEKP+WIIKNSWG +WGE GYYKICRGRN+CGVDSMVS+VAA+ T + 
Sbjct  121  GYAPVRFKEKPFWIIKNSWGANWGEDGYYKICRGRNVCGVDSMVSSVAALQTKSQ  175



>ref|XP_002868883.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45142.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score =   100 bits (250),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 42/55 (76%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            GYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTV A  + T+
Sbjct  313  GYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVTAAVSTTA  367



>ref|XP_009405542.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=366

 Score =   100 bits (250),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAV  150
            GYAP R KEK YWIIKNSWGE+WGE GYYKICRGRNICGVDSMVS+V A+
Sbjct  315  GYAPARFKEKSYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSSVTAI  364



>ref|XP_010437007.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=368

 Score =   100 bits (249),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 41/49 (84%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAA  147
            GYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTV+A
Sbjct  313  GYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVSA  361



>ref|XP_010943608.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=371

 Score =   100 bits (249),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAPIR K+KPYWIIKNSWG +WGE GYYKICRG+NICGV+SMVSTV AV T
Sbjct  319  GYAPIRFKDKPYWIIKNSWGGNWGEDGYYKICRGQNICGVESMVSTVTAVRT  370



>ref|XP_010446443.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score =   100 bits (249),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 41/49 (84%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAA  147
            GYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTV+A
Sbjct  312  GYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVSA  360



>ref|XP_010431862.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score =   100 bits (249),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 41/49 (84%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAA  147
            GYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTV+A
Sbjct  312  GYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVSA  360



>ref|NP_567489.1| papain family cysteine protease [Arabidopsis thaliana]
 emb|CAB10398.1| cysteine proteinase like protein [Arabidopsis thaliana]
 emb|CAB78661.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AAK62611.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM91059.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM96982.1| cysteine proteinase [Arabidopsis thaliana]
 gb|AAN31875.1| putative cysteine proteinase [Arabidopsis thaliana]
 dbj|BAE98514.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AEE83713.1| papain family cysteine protease [Arabidopsis thaliana]
Length=373

 Score =   100 bits (249),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 44/53 (83%), Positives = 48/53 (91%), Gaps = 1/53 (2%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG-RNICGVDSMVSTVAAVNT  156
            GYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  N+CG+D+MVSTVAAV+T
Sbjct  318  GYAPIRLKEKPYWIIKNSWGAMWGEHGYYKICRGPHNMCGMDTMVSTVAAVHT  370



>ref|XP_009136751.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
Length=368

 Score =   100 bits (249),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 44/53 (83%), Positives = 48/53 (91%), Gaps = 1/53 (2%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGR-NICGVDSMVSTVAAVNT  156
            GYAP+RL+EKPYWIIKNSWG  WGE GYYKICRG  NICGVD+MVSTVAAV+T
Sbjct  313  GYAPLRLEEKPYWIIKNSWGSMWGEKGYYKICRGTPNICGVDTMVSTVAAVHT  365



>emb|CDX90537.1| BnaA03g42440D [Brassica napus]
Length=366

 Score =   100 bits (249),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 44/53 (83%), Positives = 48/53 (91%), Gaps = 1/53 (2%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGR-NICGVDSMVSTVAAVNT  156
            GYAP+RL+EKPYWIIKNSWG  WGE GYYKICRG  NICGVD+MVSTVAAV+T
Sbjct  311  GYAPLRLEEKPYWIIKNSWGSMWGEKGYYKICRGTPNICGVDTMVSTVAAVHT  363



>gb|EPS70818.1| cysteine proteinase, partial [Genlisea aurea]
Length=355

 Score =   100 bits (248),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 41/52 (79%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAPIRLK KPYWI+KNSWG++WGE GYYKICRG NICGV+SMVSTV A+++
Sbjct  304  GYAPIRLKNKPYWIVKNSWGKNWGEKGYYKICRGSNICGVESMVSTVTAIHS  355



>ref|XP_008444769.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=373

 Score =   100 bits (248),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 40/53 (75%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTP  159
            G+APIR KEKPYWIIKNSWGE+WGE GYY IC+G+N+CG +SMVS+VAA  TP
Sbjct  320  GFAPIRFKEKPYWIIKNSWGENWGENGYYFICKGKNVCGSESMVSSVAAAATP  372



>ref|XP_002870174.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46433.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
Length=373

 Score =   100 bits (248),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 44/53 (83%), Positives = 48/53 (91%), Gaps = 1/53 (2%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG-RNICGVDSMVSTVAAVNT  156
            GYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  N+CG+D+MVSTVAAV+T
Sbjct  318  GYAPIRLKEKPYWIIKNSWGAMWGEHGYYKICRGPHNMCGMDTMVSTVAAVHT  370



>ref|XP_007223351.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
 gb|EMJ24550.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
Length=367

 Score =   100 bits (248),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 40/52 (77%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            G+APIR KEKPYWI+KNSWG+SWGE G+YKICRG N CGVDS+VSTVA+++T
Sbjct  313  GFAPIRFKEKPYWILKNSWGQSWGEEGFYKICRGHNSCGVDSLVSTVASLHT  364



>ref|XP_002880378.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56637.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score = 99.8 bits (247),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GY+  RLKEKPYWIIKNSWGESWGE G+YKIC+GRNICGVDS+VSTVAA  +
Sbjct  309  GYSQARLKEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSLVSTVAAATS  360



>ref|XP_002452058.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
 gb|EES05034.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
Length=371

 Score = 99.8 bits (247),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 3/55 (5%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG---RNICGVDSMVSTVAAVNT  156
            G+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV+AV T
Sbjct  314  GFAPIRLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSAVRT  368



>ref|XP_003579573.2| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=399

 Score = 99.8 bits (247),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 43/59 (73%), Positives = 49/59 (83%), Gaps = 3/59 (5%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG---RNICGVDSMVSTVAAVNTPTSD  168
            GYAP+R KEKPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVSTV A++T   +
Sbjct  341  GYAPLRFKEKPYWIIKNSWGENWGESGYYKICRGAHVKNKCGVDSMVSTVTAIHTSNKE  399



>ref|XP_003607110.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89307.1| papain family cysteine protease [Medicago truncatula]
Length=331

 Score = 99.4 bits (246),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  7    APIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
            A ++ KEKPYWI+KNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA +T T
Sbjct  279  ADMKEKEKPYWIVKNSWGETWGENGYYKICRGRNICGVDSMVSTVAAAHTTT  330



>dbj|BAG16515.1| putative cysteine proteinase [Capsicum chinense]
Length=367

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 43/53 (81%), Positives = 47/53 (89%), Gaps = 1/53 (2%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGR-NICGVDSMVSTVAAVNT  156
            G+APIRLK KPYWIIKNSWGE WGE GYYKICRG+ NICGVD+MVSTV A +T
Sbjct  310  GFAPIRLKAKPYWIIKNSWGEHWGEHGYYKICRGQHNICGVDAMVSTVTAAHT  362



>emb|CAQ00101.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=381

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 3/55 (5%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG---RNICGVDSMVSTVAAVNT  156
            GYAP+R KEKPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVSTV A++T
Sbjct  323  GYAPLRFKEKPYWIIKNSWGENWGESGYYKICRGPHVKNKCGVDSMVSTVTAIHT  377



>emb|CAH59428.1| cysteine protease 2 [Plantago major]
Length=245

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            GYAP+RLK KPYWIIKNSWGESWGE GYYKICRGRN+CGV+SMVS+V A +  T+
Sbjct  191  GYAPVRLKNKPYWIIKNSWGESWGESGYYKICRGRNVCGVESMVSSVTAAHFTTT  245



>gb|ABK24153.1| unknown [Picea sitchensis]
Length=394

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 40/56 (71%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTSD  168
            GYAP RLK KP+WIIKNSWG  WGE GYYK+CRG N+CG+++MVSTVAA N  T D
Sbjct  338  GYAPGRLKNKPFWIIKNSWGPDWGEDGYYKLCRGHNVCGINTMVSTVAAANIQTDD  393



>ref|XP_004952477.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=374

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 49/54 (91%), Gaps = 3/54 (6%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG---RNICGVDSMVSTVAAVN  153
            G+APIRLKEKPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV+A++
Sbjct  316  GFAPIRLKEKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSAIH  369



>ref|XP_009335626.1| PREDICTED: cysteine proteinase 15A [Pyrus x bretschneideri]
Length=366

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 41/51 (80%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVN  153
            G+APIR KEKPYWI+KNSWG+SWGE GYYKICRG N CGVDS+VSTVAA++
Sbjct  312  GFAPIRFKEKPYWILKNSWGQSWGEQGYYKICRGYNSCGVDSLVSTVAALH  362



>ref|XP_004152668.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004167370.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN62647.1| Cysteine protease [Cucumis sativus]
Length=371

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAV  150
            G+APIRLKEKPYWIIKNSWGE+WGE GYY IC+G+NICG +SMVS+VAA+
Sbjct  320  GFAPIRLKEKPYWIIKNSWGENWGENGYYFICKGKNICGSESMVSSVAAI  369



>gb|KFK30492.1| hypothetical protein AALP_AA7G268600 [Arabis alpina]
Length=367

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            GYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTVAA  + T+
Sbjct  312  GYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVAATVSTTA  366



>gb|EMT16425.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=379

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 3/55 (5%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG---RNICGVDSMVSTVAAVNT  156
            GYAP+R KEKPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVSTV A++T
Sbjct  321  GYAPLRFKEKPYWIIKNSWGENWGESGYYKICRGPHVKNKCGVDSMVSTVTAIHT  375



>gb|KEH30505.1| papain family cysteine protease [Medicago truncatula]
Length=330

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  7    APIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
            A ++ KEKPYWI+KNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA +T T
Sbjct  278  ADMKEKEKPYWIVKNSWGETWGENGYYKICRGRNICGVDSMVSTVAAAHTNT  329



>ref|XP_006653265.1| PREDICTED: cysteine proteinase 1-like, partial [Oryza brachyantha]
Length=366

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 3/55 (5%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG---RNICGVDSMVSTVAAVNT  156
            GYAPIR KEKPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVSTV A++T
Sbjct  308  GYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGPHVQNKCGVDSMVSTVTAIHT  362



>ref|XP_006828787.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
 gb|ERM96203.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
Length=365

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAPIRLK+K YWIIKNSWGE+WGE GYYKICRG NICGVDSMVSTVA++ +
Sbjct  314  GYAPIRLKDKAYWIIKNSWGETWGEKGYYKICRGHNICGVDSMVSTVASIQS  365



>ref|NP_001105685.1| cysteine proteinase 1 precursor [Zea mays]
 sp|Q10716.1|CYSP1_MAIZE RecName: Full=Cysteine proteinase 1; Flags: Precursor [Zea mays]
 dbj|BAA08244.1| cysteine proteinase [Zea mays]
Length=371

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 49/54 (91%), Gaps = 3/54 (6%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG---RNICGVDSMVSTVAAVN  153
            G+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV+AV+
Sbjct  314  GFAPIRLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSAVH  367



>dbj|BAD43619.1| putative cysteine proteinase [Arabidopsis thaliana]
Length=361

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            G++  RLKEKPYWIIKNSWGESWGE G+YKIC+GRNICGVDS+VSTVAA  +
Sbjct  310  GFSQARLKEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSLVSTVAATTS  361



>gb|EPS65881.1| cysteine proteinase, partial [Genlisea aurea]
Length=335

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 40/49 (82%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAA  147
            GYAPIRLKEKPYWI+KNSWGE+WGE GYYKIC+G N+CGV+S+VSTV A
Sbjct  287  GYAPIRLKEKPYWIVKNSWGENWGEQGYYKICKGHNVCGVESLVSTVTA  335



>gb|ACF86683.1| unknown [Zea mays]
 gb|AFW71402.1| cysteine protease1 [Zea mays]
Length=371

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 49/54 (91%), Gaps = 3/54 (6%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG---RNICGVDSMVSTVAAVN  153
            G+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV+AV+
Sbjct  314  GFAPIRLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSAVH  367



>ref|NP_565512.1| Papain family cysteine protease [Arabidopsis thaliana]
 sp|P43295.2|A494_ARATH RecName: Full=Probable cysteine proteinase A494; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD23687.1| cysteine proteinase [Arabidopsis thaliana]
 gb|ABJ98563.1| At2g21430 [Arabidopsis thaliana]
 gb|AEC07177.1| Papain family cysteine protease [Arabidopsis thaliana]
Length=361

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            G++  RLKEKPYWIIKNSWGESWGE G+YKIC+GRNICGVDS+VSTVAA  +
Sbjct  310  GFSQARLKEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSLVSTVAATTS  361



>ref|XP_006404590.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
 gb|ESQ46043.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
Length=363

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVA  144
            G+A  RLK+KPYWIIKNSWGE+WGE GYYK+CRGRNICGVDS+VSTVA
Sbjct  313  GFAQARLKKKPYWIIKNSWGETWGENGYYKLCRGRNICGVDSLVSTVA  360



>gb|AAZ32411.1| cysteine proteinase glycinain type [Nicotiana benthamiana]
Length=355

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTV  141
            G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG NICGVD+MVSTV
Sbjct  309  GFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTV  355



>gb|EMS53996.1| Cysteine proteinase 1 [Triticum urartu]
Length=405

 Score = 97.8 bits (242),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 3/55 (5%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG---RNICGVDSMVSTVAAVNT  156
            GYAP+R KEKPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVSTV A++T
Sbjct  347  GYAPLRFKEKPYWIIKNSWGENWGESGYYKICRGPHVKNKCGVDSMVSTVTAIHT  401



>emb|CAD40319.2| OSJNBb0054B09.3 [Oryza sativa Japonica Group]
 emb|CAH66180.1| OSIGBa0130O15.4 [Oryza sativa Indica Group]
 emb|CAH66205.1| OSIGBa0148D14.11 [Oryza sativa Indica Group]
Length=381

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 3/55 (5%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG---RNICGVDSMVSTVAAVNT  156
            GYAPIR KEKPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVS+V A++T
Sbjct  322  GYAPIRFKEKPYWIIKNSWGENWGEKGYYKICRGPHDKNKCGVDSMVSSVTAIHT  376



>gb|AEX97108.1| cysteine proteinase, partial [Malus domestica]
Length=128

 Score = 93.6 bits (231),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTSD*QAR  180
            G+APIR KEKPYWIIKNSWG++WGE GYY IC+GRNICG +SMVS+VAA           
Sbjct  39   GFAPIRFKEKPYWIIKNSWGQNWGENGYYLICKGRNICGSESMVSSVAATPNRAIVCTII  98

Query  181  TRSVKYSVRYCLFA  222
             R +  +++ CL++
Sbjct  99   LRQLTVALQICLYS  112



>emb|CDY41960.1| BnaA01g05320D [Brassica napus]
Length=367

 Score = 97.4 bits (241),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            GYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTV A  + T+
Sbjct  312  GYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVTAAVSTTA  366



>gb|EEE60725.1| hypothetical protein OsJ_14236 [Oryza sativa Japonica Group]
Length=364

 Score = 97.1 bits (240),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 3/55 (5%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG---RNICGVDSMVSTVAAVNT  156
            GYAPIR KEKPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVS+V A++T
Sbjct  305  GYAPIRFKEKPYWIIKNSWGENWGEKGYYKICRGPHDKNKCGVDSMVSSVTAIHT  359



>gb|EAY93546.1| hypothetical protein OsI_15336 [Oryza sativa Indica Group]
Length=348

 Score = 96.7 bits (239),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 3/55 (5%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG---RNICGVDSMVSTVAAVNT  156
            GYAPIR KEKPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVS+V A++T
Sbjct  289  GYAPIRFKEKPYWIIKNSWGENWGEKGYYKICRGPHDKNKCGVDSMVSSVTAIHT  343



>ref|XP_004975256.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=388

 Score = 97.1 bits (240),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 47/54 (87%), Gaps = 3/54 (6%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG---RNICGVDSMVSTVAAVN  153
            GYAPIR KEKPYWIIKNSWGE+WGE GYYK+CRG   +N CGVDSMVSTV A++
Sbjct  330  GYAPIRFKEKPYWIIKNSWGENWGENGYYKLCRGPFVKNKCGVDSMVSTVTAIH  383



>gb|EYU27644.1| hypothetical protein MIMGU_mgv1a008452mg [Erythranthe guttata]
Length=373

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            GY+ IRLK KPYWI+KNSWGESWGE GYYKIC+G N+CGV+SMVS+V A++T ++
Sbjct  319  GYSTIRLKNKPYWIVKNSWGESWGEEGYYKICKGHNVCGVESMVSSVNAIHTTSA  373



>ref|XP_006665032.1| PREDICTED: cysteine proteinase 1-like [Oryza brachyantha]
Length=191

 Score = 94.4 bits (233),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 3/55 (5%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNI---CGVDSMVSTVAAVNT  156
            G+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG N+   CGVDSMVSTV A++T
Sbjct  134  GFAPIRLKDKPYWIIKNSWGENWGEHGYYKICRGSNVRDKCGVDSMVSTVTAIHT  188



>ref|XP_009150026.1| PREDICTED: cysteine proteinase RD19a [Brassica rapa]
Length=367

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            GYAP R KE+PYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTV A  + T+
Sbjct  312  GYAPARFKERPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVTAAVSTTA  366



>gb|AES89347.2| papain family cysteine protease [Medicago truncatula]
Length=327

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  22   KEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
            KEKPYWI+K+SWGE+WGE GYYKICRGRNICGVDSMVSTVAA  T T
Sbjct  280  KEKPYWIVKSSWGETWGENGYYKICRGRNICGVDSMVSTVAAAQTTT  326



>ref|XP_002279862.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI19784.3| unnamed protein product [Vitis vinifera]
Length=368

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPTS  165
            GY+PIR KEKPYWI+KNSW + WGE GYY+ICRG+N+CGVDSMVS+V A    TS
Sbjct  313  GYSPIRFKEKPYWILKNSWSKYWGEHGYYRICRGQNMCGVDSMVSSVVAAIQTTS  367



>ref|XP_003607150.1| Cysteine proteinase [Medicago truncatula]
Length=326

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  22   KEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTPT  162
            KEKPYWI+K+SWGE+WGE GYYKICRGRNICGVDSMVSTVAA  T T
Sbjct  279  KEKPYWIVKSSWGETWGENGYYKICRGRNICGVDSMVSTVAAAQTTT  325



>gb|AGS43121.1| cysteine protease 1, partial [Zea mays]
Length=90

 Score = 91.3 bits (225),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 3/55 (5%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG---RNICGVDSMVSTVAAVNT  156
            G+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV+AV+ 
Sbjct  33   GFAPIRLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSAVHA  87



>emb|CDX99593.1| BnaC04g33500D [Brassica napus]
Length=343

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 38/49 (78%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAA  147
            G++  R KEKPYWIIKNSWGE+WGE G+YK+C+GRN+CGVDSMVSTVAA
Sbjct  293  GFSQARFKEKPYWIIKNSWGETWGENGFYKLCKGRNVCGVDSMVSTVAA  341



>emb|CDY15894.1| BnaA04g12170D [Brassica napus]
Length=362

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 37/49 (76%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAA  147
            G++  R KEKPYWIIKNSWGE+WGE G+YK+C+GRN+CG+DSMVSTVAA
Sbjct  312  GFSQARFKEKPYWIIKNSWGETWGENGFYKLCKGRNVCGIDSMVSTVAA  360



>ref|XP_003574963.1| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=377

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/55 (78%), Positives = 47/55 (85%), Gaps = 3/55 (5%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG---RNICGVDSMVSTVAAVNT  156
            G+AP RLK KPYW+IKNSWGE+WGE GYYKICRG   RN CGVDSMVSTVAA +T
Sbjct  319  GFAPSRLKNKPYWVIKNSWGENWGEKGYYKICRGSNVRNKCGVDSMVSTVAAAHT  373



>ref|XP_009786000.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana sylvestris]
Length=370

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 37/43 (86%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSM  129
            G++PIR+KEKPYWIIKNSWGE WGE GYYKICRGRN+CGVDSM
Sbjct  316  GFSPIRMKEKPYWIIKNSWGEKWGENGYYKICRGRNVCGVDSM  358



>ref|XP_009140277.1| PREDICTED: probable cysteine proteinase A494 [Brassica rapa]
Length=362

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 37/49 (76%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAA  147
            G++  R KEKPYWIIKNSWGE+WGE G+YK+C+GRN+CG+DSMVSTVAA
Sbjct  312  GFSQARFKEKPYWIIKNSWGETWGENGFYKLCKGRNVCGIDSMVSTVAA  360



>ref|NP_001046828.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAD19579.1| putative cysteine proteinase 1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF08742.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAG92750.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93804.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94031.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83204.1| hypothetical protein OsI_28465 [Oryza sativa Indica Group]
 gb|EEE56967.1| hypothetical protein OsJ_06681 [Oryza sativa Japonica Group]
Length=373

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 3/55 (5%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG---RNICGVDSMVSTVAAVNT  156
            G+APIRLK+K YWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV+A++T
Sbjct  316  GFAPIRLKDKAYWIIKNSWGENWGEHGYYKICRGSNVRNKCGVDSMVSTVSAIHT  370



>gb|ABK21238.1| unknown [Picea sitchensis]
 gb|ABR16087.1| unknown [Picea sitchensis]
 gb|ABR17330.1| unknown [Picea sitchensis]
 gb|ABR17545.1| unknown [Picea sitchensis]
 gb|ACN40765.1| unknown [Picea sitchensis]
Length=366

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAV  150
             +APIR+K+KPYW+IKNSWG +WGE GYYK+CRG N+CG+++MVSTVAA+
Sbjct  317  AFAPIRMKDKPYWVIKNSWGPNWGENGYYKLCRGHNVCGINNMVSTVAAI  366



>gb|ABK24688.1| unknown [Picea sitchensis]
 gb|ACN39791.1| unknown [Picea sitchensis]
 gb|ACN40241.1| unknown [Picea sitchensis]
Length=366

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAV  150
             +APIR+K+KPYW+IKNSWG +WGE GYYK+CRG N+CG+++MVSTVAA+
Sbjct  317  AFAPIRMKDKPYWVIKNSWGPNWGENGYYKLCRGHNVCGINNMVSTVAAI  366



>gb|AAB16996.1| thiol protease isoform B, partial [Glycine max]
Length=319

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAV  150
             YAPIR K KPYWIIKNSWGESWGE GY +ICRGRN+CGVDSMVSTVAA+
Sbjct  265  AYAPIRFKNKPYWIIKNSWGESWGENGYDEICRGRNVCGVDSMVSTVAAI  314



>gb|ACN40679.1| unknown [Picea sitchensis]
Length=366

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAV  150
             +APIR+K+KPYW+IKNSWG +WGE GYYK+CRG N+CG+++MVSTVAA+
Sbjct  317  AFAPIRMKDKPYWVIKNSWGPNWGENGYYKLCRGHNVCGINNMVSTVAAI  366



>emb|CAA52403.1| putative thiol protease [Arabidopsis thaliana]
Length=313

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            G++  RLKEKPYWIIKNSWGESWGE G+YKIC+GRNICGVDS+VSTVAA  +
Sbjct  262  GFSQARLKEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSLVSTVAATTS  313



>emb|CAA57675.1| cysteine proteinase [Zea mays]
Length=145

 Score = 92.0 bits (227),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 3/55 (5%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG---RNICGVDSMVSTVAAVNT  156
            G+AP+RLK+KPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV+AV+ 
Sbjct  88   GFAPMRLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSAVHA  142



>dbj|BAD10859.1| cysteine protease [Aster tripolium]
Length=363

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAP+R KEKPYWIIKNSWGE WGE GYYK+C G N CG+D+MVS V + NT
Sbjct  312  GYAPLRFKEKPYWIIKNSWGEDWGEDGYYKLCSGYNACGMDTMVSAVVSTNT  363



>ref|NP_001052440.1| Os04g0311400 [Oryza sativa Japonica Group]
 dbj|BAF14354.1| Os04g0311400, partial [Oryza sativa Japonica Group]
Length=384

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 3/55 (5%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG---RNICGVDSMVSTVAAVNT  156
            GYAPIR KEKPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVS+V A++T
Sbjct  325  GYAPIRFKEKPYWIIKNSWGENWGEKGYYKICRGPHDKNKCGVDSMVSSVTAIHT  379



>gb|EMT10192.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=369

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 46/54 (85%), Gaps = 3/54 (6%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG---RNICGVDSMVSTVAAVN  153
            G+AP R KEKPYWIIKNSWGE+WG+ GYYKICRG   RN CGVDSMVSTV+A +
Sbjct  311  GFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATH  364



>gb|AAB16997.1| thiol protease isoform A, partial [Glycine max]
Length=318

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/50 (82%), Positives = 45/50 (90%), Gaps = 1/50 (2%)
 Frame = +1

Query  4    YAPIRLKEKPYWIIKNSWGESWGEG-GYYKICRGRNICGVDSMVSTVAAV  150
            YAPIR K KPYWIIKNSWGESWGE  GY +ICRGRN+CGVD+MVSTVAA+
Sbjct  264  YAPIRFKNKPYWIIKNSWGESWGENDGYDEICRGRNVCGVDAMVSTVAAI  313



>tpe|CAD66657.1| TPA: putative cysteine proteinase precursor [Hordeum vulgare 
subsp. vulgare]
 dbj|BAJ94057.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 41/55 (75%), Positives = 47/55 (85%), Gaps = 3/55 (5%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG---RNICGVDSMVSTVAAVNT  156
            G+AP R KEKPYWIIKNSWGE+WG+ GYYKICRG   RN CGVDSMVSTV+A ++
Sbjct  319  GFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATHS  373



>ref|XP_002969223.1| hypothetical protein SELMODRAFT_91274 [Selaginella moellendorffii]
 gb|EFJ29311.1| hypothetical protein SELMODRAFT_91274 [Selaginella moellendorffii]
Length=367

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVA  144
            GYAPIR  EKPYWIIKNSWG +WGE GYYKICRG  +CG+++MVSTVA
Sbjct  320  GYAPIRFTEKPYWIIKNSWGATWGEQGYYKICRGHGMCGMNTMVSTVA  367



>gb|AAW21813.1| cysteine protease [Triticum aestivum]
Length=377

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 46/54 (85%), Gaps = 3/54 (6%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG---RNICGVDSMVSTVAAVN  153
            G+AP R KEKPYWIIKNSWGE+WG+ GYYKICRG   RN CGVDSMVSTV+A +
Sbjct  319  GFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATH  372



>ref|XP_002960585.1| hypothetical protein SELMODRAFT_266583 [Selaginella moellendorffii]
 gb|EFJ38124.1| hypothetical protein SELMODRAFT_266583 [Selaginella moellendorffii]
Length=330

 Score = 91.3 bits (225),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVA  144
            GYAPIR  EKPYWIIKNSWG +WGE GYYKICRG  +CG+++MVSTVA
Sbjct  283  GYAPIRFTEKPYWIIKNSWGATWGEQGYYKICRGHGMCGMNTMVSTVA  330



>gb|EMS64962.1| Cysteine proteinase 1 [Triticum urartu]
Length=302

 Score = 91.3 bits (225),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 46/54 (85%), Gaps = 3/54 (6%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG---RNICGVDSMVSTVAAVN  153
            G+AP R KEKPYWIIKNSWGE+WG+ GYYKICRG   RN CGVDSMVSTV+A +
Sbjct  244  GFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATH  297



>emb|CAQ00102.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=368

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVA  144
            G++ +RL  +PYW+IKNSWG  WGEGGYYK+CRGRN+CGVDSMVS VA
Sbjct  318  GFSALRLGYRPYWLIKNSWGAQWGEGGYYKLCRGRNVCGVDSMVSAVA  365



>dbj|BAC57957.1| thiol protease [Aster tripolium]
Length=188

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNT  156
            GYAP RLKEKPYWIIKNSWG  WGE GYYKIC G N+CG+D+MVS V + + 
Sbjct  137  GYAPSRLKEKPYWIIKNSWGPDWGEDGYYKICSGHNLCGMDTMVSAVVSTSA  188



>gb|EMS59778.1| Cysteine proteinase 15A [Triticum urartu]
Length=195

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVA  144
            G++ +RL  +PYW+IKNSWG+ WGEGGYYK+CRGRN+CGVDSMVS VA
Sbjct  145  GFSALRLGYRPYWLIKNSWGQQWGEGGYYKLCRGRNVCGVDSMVSAVA  192



>ref|NP_001059639.1| Os07g0480900 [Oryza sativa Japonica Group]
 dbj|BAC45132.1| putative cysteine proteinase [Oryza sativa Japonica Group]
 dbj|BAF21553.1| Os07g0480900 [Oryza sativa Japonica Group]
 dbj|BAG88694.1| unnamed protein product [Oryza sativa Japonica Group]
Length=376

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTP  159
            G+A +RL  +PYWIIKNSWG++WGE GYY++CRGRN+CGVD+MVS VA    P
Sbjct  323  GFAALRLGHRPYWIIKNSWGKAWGEQGYYRLCRGRNVCGVDTMVSAVAVAPPP  375



>ref|XP_003560213.1| PREDICTED: cysteine proteinase 1 [Brachypodium distachyon]
Length=373

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 3/51 (6%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRG---RNICGVDSMVSTVA  144
            G AP+RL  +PYWIIKNSWG+ WGEGGYY++CRG   RN+CGVDSMVS VA
Sbjct  320  GLAPLRLGYRPYWIIKNSWGKEWGEGGYYRLCRGARNRNVCGVDSMVSAVA  370



>ref|XP_002460693.1| hypothetical protein SORBIDRAFT_02g033270 [Sorghum bicolor]
 gb|EER97214.1| hypothetical protein SORBIDRAFT_02g033270 [Sorghum bicolor]
Length=373

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 36/53 (68%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTP  159
            G+A +RL  +PYWIIKNSWGE WGE GYY++CRG N+CGVDSMVS VA    P
Sbjct  321  GFAALRLGYRPYWIIKNSWGERWGEQGYYRLCRGSNVCGVDSMVSAVAVAPVP  373



>gb|AAB53103.1| cysteine protease, partial [Brassica napus]
Length=85

 Score = 82.0 bits (201),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMV  132
            GYAP R KEKPYWIIKNSWGE+WGE G+YKICRGRN+CGVD  V
Sbjct  42   GYAPARFKEKPYWIIKNSWGETWGENGFYKICRGRNVCGVDMSV  85



>ref|XP_010690815.1| PREDICTED: cysteine proteinase RD19a [Beta vulgaris subsp. vulgaris]
Length=403

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 46/53 (87%), Gaps = 2/53 (4%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVNTP  159
            GY+ +R +EKPYWIIKNSWGE WGE GYY++CRG ++CGV+++VSTVA  +TP
Sbjct  352  GYSDMRKEEKPYWIIKNSWGEYWGENGYYRLCRGYDLCGVNTLVSTVA--DTP  402



>ref|XP_009404192.1| PREDICTED: cysteine proteinase 15A [Musa acuminata subsp. malaccensis]
Length=361

 Score = 85.5 bits (210),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAVN  153
            GY+ +RL  +PYWIIKNSWG+ WGE GYY++CRG NICG+DSMVS VAA +
Sbjct  311  GYSILRLGYRPYWIIKNSWGKQWGEQGYYRLCRGHNICGIDSMVSAVAAAS  361



>ref|XP_006658557.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase 15A-like 
[Oryza brachyantha]
Length=346

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVA  144
            G++ +RL  +PYWIIKNSWG++WGE GYY++CRGRN+CGVDSMVS VA
Sbjct  295  GFSALRLGYRPYWIIKNSWGKAWGEQGYYRLCRGRNVCGVDSMVSAVA  342



>ref|XP_006293095.1| hypothetical protein CARUB_v10019394mg [Capsella rubella]
 gb|EOA25993.1| hypothetical protein CARUB_v10019394mg [Capsella rubella]
Length=367

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVA  144
            G++ +RL  KPYWIIKNSWG+ WGE GYYK+CRG +ICG++SMVS VA
Sbjct  315  GFSILRLSNKPYWIIKNSWGKKWGEDGYYKLCRGHDICGINSMVSAVA  362



>ref|XP_008776953.1| PREDICTED: cysteine proteinase-like [Phoenix dactylifera]
Length=144

 Score = 81.3 bits (199),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVAAV  150
            G++ +RL  +PYWIIKNSWG+ WGE GYY++CRG NICG+DSMVS VAA 
Sbjct  89   GFSILRLGYRPYWIIKNSWGKQWGENGYYRLCRGHNICGIDSMVSAVAAT  138



>ref|XP_002876278.1| hypothetical protein ARALYDRAFT_485911 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52537.1| hypothetical protein ARALYDRAFT_485911 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    GYAPIRLKEKPYWIIKNSWGESWGEGGYYKICRGRNICGVDSMVSTVA  144
            G++ +RL  KPYWIIKNSWG+ WGE GYYK+CRG +ICG++SMVS VA
Sbjct  316  GFSILRLSNKPYWIIKNSWGKKWGENGYYKLCRGHDICGINSMVSAVA  363



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561713539050