BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP012F03 352 bp,:Filtered

Length=352
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009774366.1|  PREDICTED: putative DNA-binding protein ESCA...  79.0    6e-15   Nicotiana sylvestris
ref|XP_009601583.1|  PREDICTED: putative DNA-binding protein ESCA...  78.2    1e-14   Nicotiana tomentosiformis
ref|XP_002281340.1|  PREDICTED: putative DNA-binding protein ESCA...  72.0    2e-12   Vitis vinifera
emb|CAN74881.1|  hypothetical protein VITISV_001409                   71.6    2e-12   Vitis vinifera
ref|XP_011070240.1|  PREDICTED: putative DNA-binding protein ESCA...  71.6    4e-12   Sesamum indicum [beniseed]
gb|EYU44096.1|  hypothetical protein MIMGU_mgv1a014599mg              68.9    5e-12   Erythranthe guttata [common monkey flower]
ref|XP_009783446.1|  PREDICTED: uncharacterized protein LOC104232053  70.9    8e-12   Nicotiana sylvestris
ref|XP_011082370.1|  PREDICTED: uncharacterized protein LOC105165162  67.8    9e-11   Sesamum indicum [beniseed]
ref|XP_010677253.1|  PREDICTED: uncharacterized protein LOC104892928  66.2    3e-10   Beta vulgaris subsp. vulgaris [Swiss chard]
emb|CDP13005.1|  unnamed protein product                              63.9    1e-09   Coffea canephora [robusta coffee]
ref|XP_008353577.1|  PREDICTED: putative DNA-binding protein ESCA...  58.5    3e-08   
ref|XP_002519830.1|  DNA binding protein, putative                    59.3    6e-08   Ricinus communis
ref|XP_008448696.1|  PREDICTED: uncharacterized protein LOC103490790  58.5    1e-07   Cucumis melo [Oriental melon]
ref|XP_004148734.1|  PREDICTED: uncharacterized protein LOC101204243  58.5    1e-07   Cucumis sativus [cucumbers]
ref|XP_009377075.1|  PREDICTED: putative DNA-binding protein ESCA...  57.8    3e-07   Pyrus x bretschneideri [bai li]
ref|XP_009347386.1|  PREDICTED: putative DNA-binding protein ESCA...  57.8    3e-07   Pyrus x bretschneideri [bai li]
ref|XP_006368415.1|  hypothetical protein POPTR_0001s02600g           55.8    1e-06   Populus trichocarpa [western balsam poplar]
ref|XP_011018587.1|  PREDICTED: putative DNA-binding protein ESCA...  55.5    1e-06   Populus euphratica
ref|XP_010325554.1|  PREDICTED: LOW QUALITY PROTEIN: neurogenic p...  55.5    1e-06   Solanum lycopersicum
ref|XP_008373567.1|  PREDICTED: putative DNA-binding protein ESCA...  55.1    2e-06   Malus domestica [apple tree]
ref|XP_010104314.1|  Putative DNA-binding protein ESCAROLA            54.3    3e-06   Morus notabilis
ref|XP_009616006.1|  PREDICTED: uncharacterized protein LOC104108630  52.4    2e-05   Nicotiana tomentosiformis
ref|XP_007209253.1|  hypothetical protein PRUPE_ppa007231mg           51.6    3e-05   Prunus persica
ref|XP_011028193.1|  PREDICTED: putative DNA-binding protein ESCA...  51.6    3e-05   Populus euphratica
gb|KJB51653.1|  hypothetical protein B456_008G227100                  49.3    2e-04   Gossypium raimondii
ref|XP_006436724.1|  hypothetical protein CICLE_v10031852mg           49.3    2e-04   Citrus clementina
ref|XP_004301686.1|  PREDICTED: putative DNA-binding protein ESCA...  49.3    2e-04   Fragaria vesca subsp. vesca
ref|XP_008238260.1|  PREDICTED: histone acetyltransferase KAT6A-like  49.3    2e-04   Prunus mume [ume]
ref|XP_010055329.1|  PREDICTED: hormone receptor 4                    48.9    2e-04   Eucalyptus grandis [rose gum]
ref|XP_006385642.1|  DNA-binding family protein                       48.1    4e-04   Populus trichocarpa [western balsam poplar]



>ref|XP_009774366.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Nicotiana 
sylvestris]
Length=362

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 74/98 (76%), Gaps = 5/98 (5%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKKPKYK-PSSTPLPQAQSNMLNFsaqaaeaaspsedassassddN  179
            A+ VQ+IVGSFIA+GKKPK K PSSTP P   SNMLNF A    A+ PS+DASS SSD+N
Sbjct  267  ATPVQVIVGSFIAEGKKPKSKTPSSTPPP---SNMLNFGAPHLGASLPSQDASSDSSDEN  323

Query  180  GGGTPLNRGPPTYGNANQPVPTMQMYANMGWPNSTVKM  293
            GG +PL+     YGNA QP+  M MYANMGWPN+++KM
Sbjct  324  GG-SPLSHEQGPYGNAGQPLHGMPMYANMGWPNNSMKM  360



>ref|XP_009601583.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Nicotiana 
tomentosiformis]
Length=370

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 74/98 (76%), Gaps = 5/98 (5%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKKPKYK-PSSTPLPQAQSNMLNFsaqaaeaaspsedassassddN  179
            A+ VQ+IVGSFIA+GKKPK K PSSTP     SNMLNF A   EA+ PS+DASS SSD+N
Sbjct  275  ATPVQVIVGSFIAEGKKPKSKTPSSTP---PLSNMLNFGAPHLEASLPSQDASSNSSDEN  331

Query  180  GGGTPLNRGPPTYGNANQPVPTMQMYANMGWPNSTVKM  293
            GG +PL+     YGNA QP+  M MYANMGWPN+++K+
Sbjct  332  GG-SPLSHEQGPYGNAGQPLHGMPMYANMGWPNNSMKL  368



>ref|XP_002281340.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
 emb|CBI33917.3| unnamed protein product [Vitis vinifera]
Length=353

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 64/98 (65%), Gaps = 5/98 (5%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKKPKYKPS-STPLPQAQSNMLNFsaqaaeaaspsedassassddN  179
            A+ VQ++VGSFIADGKK     S S+  P AQ  MLNF A    A+     +S +S ++ 
Sbjct  257  ATPVQVVVGSFIADGKKTNTNQSGSSSAPPAQ--MLNFGAPVVPASPSQGGSSESSDEN-  313

Query  180  GGGTPLNRGPPTYGNANQPVPTMQMYANMGWPNSTVKM  293
             GG+PLNRGP  Y N +QP+  M MYA MGWPNST+KM
Sbjct  314  -GGSPLNRGPLPYNNVSQPIHQMPMYAAMGWPNSTMKM  350



>emb|CAN74881.1| hypothetical protein VITISV_001409 [Vitis vinifera]
Length=313

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 62/98 (63%), Gaps = 5/98 (5%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKKPKYKPS-STPLPQAQSNMLNFsaqaaeaaspsedassassddN  179
            A+ VQ++VGSFIADGKK     S S+  P AQ  MLNF A    A+     +S +S    
Sbjct  217  ATPVQVVVGSFIADGKKTNTNQSGSSSAPPAQ--MLNFGAPVVPASPSQGGSSESSD--E  272

Query  180  GGGTPLNRGPPTYGNANQPVPTMQMYANMGWPNSTVKM  293
             GG+PLNRGP  Y N +QP+  M MYA MGWPNST+KM
Sbjct  273  NGGSPLNRGPLPYNNVSQPIHQMPMYAAMGWPNSTMKM  310



>ref|XP_011070240.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=400

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 64/99 (65%), Gaps = 8/99 (8%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKKPKYKPSSTPLPQAQSNMLNFsaqaaeaasp--sedassassdd  176
            AS VQ++VGSF A+GKK K  PS++P     SNMLNF        +   S  ASS S+++
Sbjct  305  ASPVQVVVGSFTAEGKKSKNAPSASP-----SNMLNFGGSVTGTGAGPPSPGASSESAEE  359

Query  177  NGGGTPLNRGPPTYGNANQPVPTMQMYANMGWPNSTVKM  293
            N G +PL+ G   Y NA QP+  MQMY+NMGWPNS +KM
Sbjct  360  NDGTSPLDHGSGPYTNAGQPMQNMQMYSNMGWPNS-IKM  397



>gb|EYU44096.1| hypothetical protein MIMGU_mgv1a014599mg [Erythranthe guttata]
Length=184

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 63/95 (66%), Gaps = 8/95 (8%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKKPKYKPSSTPLPQAQSNMLNFsaqaaeaaspsedassassddNG  182
            AS VQ++VGSFIADGKKPK  P+STP     SNMLNF    A  ASP   ASS S+++N 
Sbjct  88   ASPVQVVVGSFIADGKKPKAGPTSTP----PSNMLNF-GAPAPQASPPPGASSESAEEND  142

Query  183  GGTPLNR---GPPTYGNANQPVPTMQMYANMGWPN  278
             G+PL R   GP +     QPV ++ MYANMGWPN
Sbjct  143  DGSPLERDSSGPYSTNAGQQPVQSIPMYANMGWPN  177



>ref|XP_009783446.1| PREDICTED: uncharacterized protein LOC104232053 [Nicotiana sylvestris]
Length=432

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 67/94 (71%), Gaps = 6/94 (6%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKKPKYK-PSSTPLPQAQSNMLNFsaqaaeaaspsedassassddN  179
            A+ VQ+IVGSFIA+GKKPK K PSSTP     SNMLNF A   EA+ PS+ ASS SSD+N
Sbjct  343  ATPVQVIVGSFIAEGKKPKSKAPSSTP----PSNMLNFGAPVTEASPPSQGASSDSSDEN  398

Query  180  GGGTPLNRGPPTYGNANQPVPTMQMYANMGWPNS  281
            G  +P +  P  +GNA QP+  M M+ANMGWP S
Sbjct  399  GN-SPFHHEPGPFGNAGQPMHGMSMFANMGWPKS  431



>ref|XP_011082370.1| PREDICTED: uncharacterized protein LOC105165162 [Sesamum indicum]
Length=386

 Score = 67.8 bits (164),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 60/97 (62%), Gaps = 7/97 (7%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKKPKYKPSSTPLPQAQSNMLNFsaqaaeaaspsedassassddNG  182
            AS VQ++VGSFIADGKK K   SSTP     SNMLNF A    A+     +S +  D++ 
Sbjct  294  ASPVQVVVGSFIADGKKSKSGTSSTP----PSNMLNFGAPMTGASPSPGASSESGEDNDD  349

Query  183  GGTPLNRGPPTYGNANQPVPTMQMYANMGWPNSTVKM  293
              +PLNRG   YGNA QP   M MY+ MGW NS +KM
Sbjct  350  --SPLNRGSGPYGNAGQPGQNMPMYSTMGWANS-IKM  383



>ref|XP_010677253.1| PREDICTED: uncharacterized protein LOC104892928 [Beta vulgaris 
subsp. vulgaris]
Length=441

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKKPKYKPSSTPLPQAQSNMLNFsaqaaeaasps-edassassddN  179
            A+ VQ+IVGSFIA+GKK KY PS   +PQ  S++L+F+A    AA  S     S+   + 
Sbjct  346  ATPVQIIVGSFIANGKKTKYMPS---VPQ--SHVLSFAAPPLPAADRSPSQEVSSEGSEE  400

Query  180  GGGTPLNRGPPTYGNANQPVPTMQMYANMGWPNSTVKM  293
             G   ++R   +YGN+N PV  MQMY  MGWPNS  KM
Sbjct  401  NGSNHIDRTMGSYGNSNHPVHNMQMYTTMGWPNSASKM  438



>emb|CDP13005.1| unnamed protein product [Coffea canephora]
Length=321

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 64/98 (65%), Gaps = 8/98 (8%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKKPKYKPSSTPLPQAQSNMLNFsaqaaeaaspsedassassddNG  182
            A+ VQ++VGSFIADGKKPK   +  P P     ML+F      A+ PS+ ASS SSDDNG
Sbjct  230  ATPVQVVVGSFIADGKKPKGS-TVAPAP----GMLSFGNPVIGASPPSQGASSDSSDDNG  284

Query  183  GGTPLNRGPPTYGNANQPVPTMQMYANMGWPNSTVKMH  296
              +PLNR    Y NA Q +  + MY NMGWPNSTVKMH
Sbjct  285  --SPLNRSSGPYNNA-QTIQNIPMYTNMGWPNSTVKMH  319



>ref|XP_008353577.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=181

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 54/90 (60%), Gaps = 6/90 (7%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKK--PKYKPSSTPLPQAQSNMLNFsaqaaeaaspsedassassdd  176
            AS VQ+IVGSFIADGKK  P    S T  P A S MLNF A    A+  S+   S+ S D
Sbjct  85   ASPVQVIVGSFIADGKKSNPNLVKSGTSSPPA-SQMLNFGAPMTAASPSSQGGGSSESSD  143

Query  177  NGGGTPLN---RGPPTYGNANQPVPTMQMY  257
              G +PLN   RGP  Y NANQP+  MQMY
Sbjct  144  ENGSSPLNNSNRGPVLYSNANQPIHNMQMY  173



>ref|XP_002519830.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF42434.1| DNA binding protein, putative [Ricinus communis]
Length=376

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 58/95 (61%), Gaps = 11/95 (12%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKKP-----KYKPSSTPLPQAQSNMLNFsaqaaeaaspsedassas  167
            AS VQ+IVGSFIADGKK      K  PSS P  Q    MLNF A    ++ PS+  SS S
Sbjct  282  ASPVQVIVGSFIADGKKSNSNIHKSGPSSAPTSQ----MLNFGAPMTTSSPPSQGVSSES  337

Query  168  sddNGGGTPLNRGPPTYGNANQPVPTMQMYANMGW  272
            SD+NG  +PLNR PP Y NA QP+  M MY  + W
Sbjct  338  SDENGS-SPLNRDPPIYSNATQPLHNMNMYHQL-W  370



>ref|XP_008448696.1| PREDICTED: uncharacterized protein LOC103490790 [Cucumis melo]
Length=362

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 54/95 (57%), Gaps = 13/95 (14%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKK-----PKYKPSSTPLPQAQSNMLNFsaqaaeaaspsedassas  167
            AS VQ+IVGSF+ DGKK      K  PSST       NMLNF    A        ++++S
Sbjct  271  ASTVQVIVGSFLVDGKKLGASIQKSGPSST-----SPNMLNFGTPVAAGCPSEGASNNSS  325

Query  168  sddNGGGTPLNRGPPTYGNANQPVPTMQMYANMGW  272
               + GG+PL+RGP  Y NANQP+  MQMY  + W
Sbjct  326  D--DNGGSPLSRGPGMYTNANQPIHNMQMYQQL-W  357



>ref|XP_004148734.1| PREDICTED: uncharacterized protein LOC101204243 [Cucumis sativus]
 ref|XP_004163876.1| PREDICTED: uncharacterized LOC101204243 [Cucumis sativus]
 gb|KGN55770.1| hypothetical protein Csa_3G011720 [Cucumis sativus]
Length=362

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 54/95 (57%), Gaps = 13/95 (14%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKK-----PKYKPSSTPLPQAQSNMLNFsaqaaeaaspsedassas  167
            AS VQ+IVGSF+ DGKK      K  PSST       NMLNF    A        ++++S
Sbjct  271  ASTVQVIVGSFLVDGKKLGASIQKSGPSST-----SPNMLNFGTPVAAGCPSEGASNNSS  325

Query  168  sddNGGGTPLNRGPPTYGNANQPVPTMQMYANMGW  272
               + GG+PL+RGP  Y NANQP+  MQMY  + W
Sbjct  326  D--DNGGSPLSRGPGMYTNANQPIHNMQMYQQL-W  357



>ref|XP_009377075.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=374

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 54/90 (60%), Gaps = 6/90 (7%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKK--PKYKPSSTPLPQAQSNMLNFsaqaaeaaspsedassassdd  176
            AS VQ+IVGSFIADGKK  P    S T  P A S MLNF A    A+  S+   S+ S D
Sbjct  278  ASPVQVIVGSFIADGKKSNPNLVKSGTSSPPA-SQMLNFGAPMTAASPSSQGGGSSESSD  336

Query  177  NGGGTPLN---RGPPTYGNANQPVPTMQMY  257
              G +PLN   RGP  Y NANQP+  MQMY
Sbjct  337  ENGSSPLNNSNRGPVLYSNANQPIHNMQMY  366



>ref|XP_009347386.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=377

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 54/90 (60%), Gaps = 6/90 (7%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKK--PKYKPSSTPLPQAQSNMLNFsaqaaeaaspsedassassdd  176
            AS VQ+IVGSFIADGKK  P    S T  P A S MLNF A    A+  S+   S+ S D
Sbjct  281  ASPVQVIVGSFIADGKKSNPNLVKSGTSSPPA-SQMLNFGAPMTAASPSSQGGGSSESSD  339

Query  177  NGGGTPLN---RGPPTYGNANQPVPTMQMY  257
              G +PLN   RGP  Y NANQP+  MQMY
Sbjct  340  ENGSSPLNNSNRGPVLYSNANQPIHNMQMY  369



>ref|XP_006368415.1| hypothetical protein POPTR_0001s02600g [Populus trichocarpa]
 gb|ERP64984.1| hypothetical protein POPTR_0001s02600g [Populus trichocarpa]
Length=377

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 59/90 (66%), Gaps = 10/90 (11%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKKPKYK-----PSSTPLPQAQSNMLNFsaqaaeaaspsedassas  167
            AS VQ+I+GSFIADGKK   K     PSSTP PQ    MLNF A    A+ PS   SS S
Sbjct  284  ASAVQVILGSFIADGKKSNSKSLKSGPSSTPPPQ----MLNFGAPLTTASPPSRGGSSES  339

Query  168  sddNGGGTPLNRGPPTYGNANQPVPTMQMY  257
            SD+NGG +P+NR P  YGN +QP+  MQMY
Sbjct  340  SDENGG-SPVNRTPGIYGNPSQPIHNMQMY  368



>ref|XP_011018587.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=381

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 59/90 (66%), Gaps = 10/90 (11%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKKPKYK-----PSSTPLPQAQSNMLNFsaqaaeaaspsedassas  167
            AS VQ+I+GSFIADGKK K K     PSSTP PQ    MLNF A     + PS   SS S
Sbjct  288  ASAVQVILGSFIADGKKSKSKALKSGPSSTPPPQ----MLNFGAPLTTVSPPSRGGSSES  343

Query  168  sddNGGGTPLNRGPPTYGNANQPVPTMQMY  257
            SD+NGG +P+NR P  YGN +QP+  MQMY
Sbjct  344  SDENGG-SPVNRTPGIYGNPSQPIHNMQMY  372



>ref|XP_010325554.1| PREDICTED: LOW QUALITY PROTEIN: neurogenic protein mastermind 
[Solanum lycopersicum]
Length=418

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 56/91 (62%), Gaps = 6/91 (7%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKKPKYK-PSSTPLPQAQSNMLNFsaqaaeaaspsedassassddN  179
            A+ VQ+IVGSF+A+GKKPK K PSSTP     SNMLNF A A   + PS+  +S+ S + 
Sbjct  319  ATPVQVIVGSFLAEGKKPKSKVPSSTP----PSNMLNFGAPATGESPPSQGDASSDSSEE  374

Query  180  GGGTPLNRGPPTYGNANQPVPTMQMYANMGW  272
             G +P       YGNA QP+  M MY  + W
Sbjct  375  NGDSPFQHESGPYGNAGQPMHGMSMYXQI-W  404



>ref|XP_008373567.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=376

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 53/90 (59%), Gaps = 6/90 (7%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKKPKYK--PSSTPLPQAQSNMLNFsaqaaeaaspsedassassdd  176
            AS VQ+IVGSFIADGKK       S T  P A S MLNF A    A+  S+   S+ S D
Sbjct  280  ASPVQVIVGSFIADGKKSNSNLVKSGTSSPPA-SQMLNFGAPMTAASPSSQGGGSSESSD  338

Query  177  NGGGTPLN---RGPPTYGNANQPVPTMQMY  257
              G +PLN   RGP  Y NANQP+  MQMY
Sbjct  339  ENGSSPLNNSNRGPVLYSNANQPIHNMQMY  368



>ref|XP_010104314.1| Putative DNA-binding protein ESCAROLA [Morus notabilis]
 gb|EXB99734.1| Putative DNA-binding protein ESCAROLA [Morus notabilis]
Length=391

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 56/95 (59%), Gaps = 4/95 (4%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKKPKYKPSSTPLPQA-QSNMLNFsaqaaeaaspsedassassddN  179
            AS VQ+IVGSFI DG K     +    P A Q  MLNF    A   SPS   SS SS++N
Sbjct  298  ASPVQVIVGSFIVDGNKSNTNSAVKSAPAAPQPQMLNFGGPMAGGDSPSHGDSSESSEEN  357

Query  180  GGGTPLNRGPPTYGNANQPVPTMQMYANMGWPNST  284
            G G  LNRGP  Y NA+QP+  MQMY ++ W N T
Sbjct  358  GNGH-LNRGPGFY-NASQPIHNMQMYHHL-WGNQT  389



>ref|XP_009616006.1| PREDICTED: uncharacterized protein LOC104108630 [Nicotiana tomentosiformis]
Length=366

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 58/85 (68%), Gaps = 4/85 (5%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKKPKYKPSSTPLPQAQSNMLNFsaqaaeaaspsedassassddNG  182
            A+ VQ++VGSFIA+GKKPK K    P P   SNMLNF A   EA+SPS+ ASS SSD+N 
Sbjct  281  ATPVQVVVGSFIAEGKKPKSK---APSPTPTSNMLNFGAPVTEASSPSQGASSDSSDEN-  336

Query  183  GGTPLNRGPPTYGNANQPVPTMQMY  257
            GG+PL+     +GNA QP+  M  Y
Sbjct  337  GGSPLSHEQGPFGNAAQPMHGMPTY  361



>ref|XP_007209253.1| hypothetical protein PRUPE_ppa007231mg [Prunus persica]
 gb|EMJ10452.1| hypothetical protein PRUPE_ppa007231mg [Prunus persica]
Length=377

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 57/88 (65%), Gaps = 6/88 (7%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKKPK---YKPSSTPLPQAQSNMLNFsaqaaeaaspsedassassd  173
            AS VQ+IVGSFIADGKK      K   +  P +Q  MLNF A    A+  S+ ASS SSD
Sbjct  285  ASPVQVIVGSFIADGKKSNSNFLKSGPSSPPPSQ--MLNFGAPMTAASPSSQGASSESSD  342

Query  174  dNGGGTPLNRGPPTYGNANQPVPTMQMY  257
            +NG  +PLNRGP  Y NA+QP+  MQMY
Sbjct  343  ENGS-SPLNRGPVLYNNASQPIHNMQMY  369



>ref|XP_011028193.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=375

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 57/90 (63%), Gaps = 10/90 (11%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKKPKYKPSS-----TPLPQAQSNMLNFsaqaaeaaspsedassas  167
            AS VQ+IVGSFIADGKK     S      TP PQ    MLNFSA    A+  S+  SS S
Sbjct  282  ASPVQVIVGSFIADGKKSNSSASKSGPSSTPPPQ----MLNFSAPLTTASPTSQGGSSDS  337

Query  168  sddNGGGTPLNRGPPTYGNANQPVPTMQMY  257
            SD+NGG +P+NR P  YGN NQP+  MQMY
Sbjct  338  SDENGG-SPVNRNPGIYGNPNQPIHNMQMY  366



>gb|KJB51653.1| hypothetical protein B456_008G227100 [Gossypium raimondii]
Length=391

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 54/88 (61%), Gaps = 4/88 (5%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKKPKYKPSST-PLPQAQSNMLNFsaqaaeaaspsedassassddN  179
            AS VQ+IVGSFIADGKK     S T P     S+MLNF A     + PS+  SS SSD+N
Sbjct  296  ASPVQVIVGSFIADGKKQSQDVSKTGPSSMLTSSMLNFGAPGLTGSPPSQGGSSESSDEN  355

Query  180  GGGTPLNRGPPTYGNANQPVP--TMQMY  257
             GG+PLNRG   YGN+   +    MQMY
Sbjct  356  -GGSPLNRGSGFYGNSAPSIHNNNMQMY  382



>ref|XP_006436724.1| hypothetical protein CICLE_v10031852mg [Citrus clementina]
 ref|XP_006485573.1| PREDICTED: uncharacterized protein LOC102612198 [Citrus sinensis]
 gb|ESR49964.1| hypothetical protein CICLE_v10031852mg [Citrus clementina]
 gb|KDO51114.1| hypothetical protein CISIN_1g017146mg [Citrus sinensis]
Length=376

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 56/91 (62%), Gaps = 11/91 (12%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKKP-----KYKPSSTPLPQAQSNMLNFsaqaaeaaspsedassas  167
            AS VQ+IVGSFIA+GKK      K  PSS P P     ML+F A    ++ PS+ ASS S
Sbjct  282  ASPVQVIVGSFIAEGKKSNSNFLKSGPSSAPTPH----MLSFGAPMTTSSPPSQGASSES  337

Query  168  sddNGGGTPLNRGPPTYGN-ANQPVPTMQMY  257
            SDDN G +PLNRG   Y N A QP+  M MY
Sbjct  338  SDDN-GSSPLNRGAGLYNNAAQQPIHNMHMY  367



>ref|XP_004301686.1| PREDICTED: putative DNA-binding protein ESCAROLA [Fragaria vesca 
subsp. vesca]
Length=383

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 51/90 (57%), Gaps = 8/90 (9%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKKPKY----KPSSTPLPQAQSNMLNFsaqaaeaaspsedassass  170
            A  VQ+IVGSFIA+GKK         +S+P P   S MLNF A    A+  S+   S  S
Sbjct  288  AGPVQVIVGSFIAEGKKSSSNLLKSGTSSPPP---SQMLNFGAPMTAASPSSQGGGSTES  344

Query  171  ddNGGGTPLNRGPPT-YGNANQPVPTMQMY  257
             D  G +PLNR PP  Y N +QP+  MQMY
Sbjct  345  SDENGSSPLNRAPPVLYSNPSQPMHNMQMY  374



>ref|XP_008238260.1| PREDICTED: histone acetyltransferase KAT6A-like [Prunus mume]
Length=377

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 56/88 (64%), Gaps = 6/88 (7%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKKPK---YKPSSTPLPQAQSNMLNFsaqaaeaaspsedassassd  173
            AS VQ+IVGSFIADGKK      K   +  P +Q  MLNF A    A+  S+ ASS SSD
Sbjct  285  ASPVQVIVGSFIADGKKSNSNFLKSGPSSPPPSQ--MLNFGAPMTAASPSSQGASSESSD  342

Query  174  dNGGGTPLNRGPPTYGNANQPVPTMQMY  257
            +NG  +PLNRGP  Y N +QP+  MQMY
Sbjct  343  ENGS-SPLNRGPVLYNNPSQPIHNMQMY  369



>ref|XP_010055329.1| PREDICTED: hormone receptor 4 [Eucalyptus grandis]
 gb|KCW71797.1| hypothetical protein EUGRSUZ_E00286 [Eucalyptus grandis]
Length=419

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKKPK---YKPSSTPLPQA-QSNMLNFsaqaaeaaspsedassass  170
            A+ VQ+IVGSF+A+ KK      K  ++P PQ  QS+MLNF       + PS+ AS+ SS
Sbjct  321  ATPVQVIVGSFLANSKKASSSALKSDASPTPQGPQSHMLNFGTAGTAVSPPSDGASADSS  380

Query  171  ddNGGGTPLNRGPP-TYGNANQPVPTMQMYANMGWPNST  284
            D+N G +P+N  P   Y N +QP+  MQMY ++ W   T
Sbjct  381  DEN-GNSPINHRPTGIYNNTSQPIHNMQMYHHL-WAGQT  417



>ref|XP_006385642.1| DNA-binding family protein [Populus trichocarpa]
 gb|ERP63439.1| DNA-binding family protein [Populus trichocarpa]
Length=375

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 57/90 (63%), Gaps = 10/90 (11%)
 Frame = +3

Query  3    ASQVQLIVGSFIADGKKPKYKPSS-----TPLPQAQSNMLNFsaqaaeaaspsedassas  167
            AS VQ+IVGSFIADGKK     S      TP PQ    MLNFSA    A+ PS+  SS S
Sbjct  282  ASPVQVIVGSFIADGKKSNSSASKSGPSSTPPPQ----MLNFSAPLTTASPPSQGGSSDS  337

Query  168  sddNGGGTPLNRGPPTYGNANQPVPTMQMY  257
            SD+NGG +P+NR P  YGN NQ +  MQMY
Sbjct  338  SDENGG-SPVNRNPGIYGNPNQSIHNMQMY  366



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 569837304960