BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP012A12 313 bp,:Filtered

Length=313
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAF61441.1|AF138265_1  papain-like cysteine proteinase isoform II  73.6    1e-22   Ipomoea batatas [batate]
gb|AAF40414.1|AF216783_1  papain-like cysteine proteinase isoform I   73.6    1e-22   Ipomoea batatas [batate]
gb|AAF61440.1|AF138264_1  papain-like cysteine proteinase isoform I   73.6    1e-22   Ipomoea batatas [batate]
gb|AAK27969.1|AF242373_1  cysteine protease                           73.6    1e-22   Ipomoea batatas [batate]
gb|AAF40415.1|AF216784_1  papain-like cysteine proteinase isoform II  73.6    1e-22   Ipomoea batatas [batate]
gb|AAF40416.1|AF216785_1  papain-like cysteine proteinase isoform...  73.6    1e-22   Ipomoea batatas [batate]
ref|XP_002512963.1|  cysteine protease, putative                      73.6    2e-21   Ricinus communis
gb|KDP41743.1|  hypothetical protein JCGZ_26761                       73.9    2e-21   Jatropha curcas
ref|XP_002302004.2|  hypothetical protein POPTR_0002s03020g           71.2    2e-21   Populus trichocarpa [western balsam poplar]
gb|KHG24064.1|  Cysteinease RD19a -like protein                       72.4    5e-21   Gossypium arboreum [tree cotton]
gb|KJB32561.1|  hypothetical protein B456_005G247000                  72.4    6e-21   Gossypium raimondii
gb|KJB79047.1|  hypothetical protein B456_013G033800                  71.2    6e-21   Gossypium raimondii
gb|AIB06024.1|  CP2                                                   72.8    6e-21   Hevea brasiliensis [jebe]
emb|CAE54306.1|  putative papain-like cysteine proteinase             71.2    6e-21   Gossypium hirsutum [American cotton]
gb|ABK96580.1|  unknown                                               72.0    7e-21   Populus trichocarpa x Populus deltoides
gb|KHG15253.1|  Cysteinease RD19a -like protein                       70.9    7e-21   Gossypium arboreum [tree cotton]
gb|ABK94801.1|  unknown                                               72.0    7e-21   Populus trichocarpa [western balsam poplar]
ref|XP_007042077.1|  Papain family cysteine protease                  71.2    8e-21   Theobroma cacao [chocolate]
gb|AAX19661.1|  cysteine proteinase                                   71.6    8e-21   Populus tomentosa [Chinese white poplar]
ref|NP_001267989.1|  cysteine protease precursor                      72.0    9e-21   Vitis vinifera
emb|CDP20652.1|  unnamed protein product                              72.0    9e-21   Coffea canephora [robusta coffee]
ref|XP_011047717.1|  PREDICTED: cysteine proteinase RD19a             71.6    1e-20   Populus euphratica
ref|XP_011028940.1|  PREDICTED: cysteine proteinase 15A-like          71.6    1e-20   Populus euphratica
gb|ABQ10201.1|  cysteine protease Cp3                                 73.6    1e-20   Actinidia deliciosa [Chinese gooseberry]
ref|XP_009373025.1|  PREDICTED: cysteine proteinase RD19a-like        71.6    2e-20   Pyrus x bretschneideri [bai li]
ref|XP_009373000.1|  PREDICTED: cysteine proteinase RD19a             71.6    2e-20   Pyrus x bretschneideri [bai li]
ref|XP_008382317.1|  PREDICTED: cysteine proteinase RD19a             71.6    2e-20   Malus domestica [apple tree]
ref|XP_002313770.1|  cysteine proteinase A494 precursor               69.3    4e-20   Populus trichocarpa [western balsam poplar]
gb|ABK92536.1|  unknown                                               69.3    4e-20   Populus trichocarpa [western balsam poplar]
ref|XP_004507484.1|  PREDICTED: cysteine proteinase RD19a-like        68.6    4e-20   Cicer arietinum [garbanzo]
ref|XP_011037175.1|  PREDICTED: cysteine proteinase RD19a-like        69.7    4e-20   Populus euphratica
ref|XP_003606998.1|  Cysteine proteinase                              68.2    4e-20   Medicago truncatula
ref|XP_007131787.1|  hypothetical protein PHAVU_011G041600g           68.2    4e-20   Phaseolus vulgaris [French bean]
ref|XP_006487337.1|  PREDICTED: cysteine proteinase RD19a-like        72.8    6e-20   Citrus sinensis [apfelsine]
ref|XP_002305451.2|  cysteine proteinase A494 precursor               68.9    6e-20   Populus trichocarpa [western balsam poplar]
gb|KDO49483.1|  hypothetical protein CISIN_1g017318mg                 72.8    6e-20   Citrus sinensis [apfelsine]
ref|XP_010271520.1|  PREDICTED: cysteine proteinase RD19a-like        70.1    7e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010066197.1|  PREDICTED: probable cysteine proteinase A494     69.3    8e-20   Eucalyptus grandis [rose gum]
ref|XP_010028631.1|  PREDICTED: cysteine proteinase RD19a-like        71.6    9e-20   Eucalyptus grandis [rose gum]
ref|XP_006423403.1|  hypothetical protein CICLE_v10028670mg           72.8    1e-19   Citrus clementina
ref|XP_003539008.1|  PREDICTED: cysteine proteinase RD19a-like        66.6    1e-19   Glycine max [soybeans]
ref|XP_004290288.1|  PREDICTED: probable cysteine proteinase A494     70.9    1e-19   Fragaria vesca subsp. vesca
ref|XP_002510469.1|  cysteine protease, putative                      69.7    1e-19   Ricinus communis
ref|XP_008236965.1|  PREDICTED: cysteine proteinase RD19a             70.9    1e-19   Prunus mume [ume]
ref|XP_007201310.1|  hypothetical protein PRUPE_ppa007454mg           70.9    1e-19   Prunus persica
gb|KHN39817.1|  Cysteine proteinase RD19a                             66.2    1e-19   Glycine soja [wild soybean]
gb|ACI04578.1|  cysteine protease-like protein                        68.2    2e-19   Robinia pseudoacacia [black locust]
ref|XP_004150061.1|  PREDICTED: cysteine proteinase RD19a-like        67.8    2e-19   Cucumis sativus [cucumbers]
ref|XP_011088458.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...  67.0    2e-19   Sesamum indicum [beniseed]
gb|EYU37835.1|  hypothetical protein MIMGU_mgv1a008237mg              67.8    2e-19   Erythranthe guttata [common monkey flower]
ref|XP_010530325.1|  PREDICTED: cysteine proteinase RD19a             72.4    3e-19   Tarenaya hassleriana [spider flower]
sp|P05993.1|PAPA5_CARPA  RecName: Full=Cysteine proteinase; AltNa...  66.6    3e-19   Carica papaya [mamon]
ref|XP_011092831.1|  PREDICTED: cysteine proteinase RD19a-like        68.9    4e-19   Sesamum indicum [beniseed]
ref|XP_011045161.1|  PREDICTED: cysteine proteinase 15A-like          68.2    4e-19   Populus euphratica
ref|XP_009376976.1|  PREDICTED: cysteine proteinase RD19a-like        70.5    4e-19   Pyrus x bretschneideri [bai li]
ref|XP_009351218.1|  PREDICTED: cysteine proteinase RD19a-like        68.2    4e-19   Pyrus x bretschneideri [bai li]
ref|XP_002280798.2|  PREDICTED: cysteine proteinase 15A               66.6    4e-19   Vitis vinifera
ref|XP_008460996.1|  PREDICTED: cysteine proteinase RD19a-like        66.6    4e-19   Cucumis melo [Oriental melon]
dbj|BAJ53178.1|  JHL18I08.12                                          72.0    4e-19   Jatropha curcas
ref|XP_003540987.1|  PREDICTED: cysteine proteinase RD19a-like        65.9    4e-19   Glycine max [soybeans]
ref|XP_002306900.1|  hypothetical protein POPTR_0005s25540g           68.2    4e-19   Populus trichocarpa [western balsam poplar]
ref|XP_009376977.1|  PREDICTED: cysteine proteinase RD19a-like        69.7    6e-19   Pyrus x bretschneideri [bai li]
ref|XP_010061009.1|  PREDICTED: cysteine proteinase RD19a-like        67.4    7e-19   Eucalyptus grandis [rose gum]
ref|XP_010268619.1|  PREDICTED: cysteine proteinase RD19a-like        67.8    8e-19   Nelumbo nucifera [Indian lotus]
gb|ABK96252.1|  unknown                                               65.5    8e-19   Populus trichocarpa x Populus deltoides
gb|ABF46642.1|  papain-like cysteine proteinase                       69.7    9e-19   Pachysandra terminalis
ref|XP_010105270.1|  Cysteine proteinase 15A                          66.6    1e-18   Morus notabilis
emb|CAE45588.1|  papain-like cysteine proteinase-like protein 1       65.5    1e-18   Lotus japonicus
dbj|BAC41322.1|  hypothetical protein                                 65.5    1e-18   Lotus japonicus
dbj|BAF98584.1|  CM0216.500.nc                                        65.5    2e-18   Lotus japonicus
gb|KHN25410.1|  Cysteine proteinase RD19a                             65.9    2e-18   Glycine soja [wild soybean]
ref|XP_009406357.1|  PREDICTED: cysteine proteinase 1-like            65.1    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002275759.1|  PREDICTED: cysteine proteinase RD19a             67.4    2e-18   Vitis vinifera
emb|CDY34441.1|  BnaC01g21920D                                        69.3    2e-18   Brassica napus [oilseed rape]
ref|XP_009146338.1|  PREDICTED: cysteine proteinase 15A-like          69.3    2e-18   Brassica rapa
ref|XP_009109502.1|  PREDICTED: cysteine proteinase RD19a-like        66.2    2e-18   Brassica rapa
gb|AAU81591.1|  cysteine proteinase                                   63.5    2e-18   Petunia x hybrida [garden petunia]
gb|AAM65162.1|  cysteine proteinase RD19A                             67.0    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009602233.1|  PREDICTED: cysteine proteinase RD19a-like        63.2    3e-18   Nicotiana tomentosiformis
gb|AAR92156.1|  putative cysteine protease 3                          66.6    3e-18   Iris x hollandica [Dutch iris]
emb|CAE45589.1|  papain-like cysteine proteinase-like protein 2       65.5    3e-18   Lotus japonicus
ref|XP_004291404.1|  PREDICTED: cysteine proteinase 15A-like          65.5    3e-18   Fragaria vesca subsp. vesca
ref|NP_568052.1|  cysteine proteinase RD19a                           67.0    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007017672.1|  Papain family cysteine protease                  66.6    3e-18   Theobroma cacao [chocolate]
dbj|BAF46302.1|  cysteine proteinase precursor                        67.8    3e-18   Ipomoea nil [qian niu]
gb|AIB06025.1|  CP3                                                   66.6    3e-18   Hevea brasiliensis [jebe]
ref|XP_008775532.1|  PREDICTED: cysteine proteinase 1-like            65.1    4e-18   Phoenix dactylifera
ref|XP_010531457.1|  PREDICTED: probable cysteine proteinase A494     68.2    4e-18   Tarenaya hassleriana [spider flower]
dbj|BAF98585.1|  CM0216.510.nc                                        65.1    4e-18   Lotus japonicus
gb|KGN43159.1|  Papain-like cysteine proteinase isoform I             65.9    4e-18   Cucumis sativus [cucumbers]
ref|XP_004148554.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...  65.9    4e-18   
ref|XP_004165230.1|  PREDICTED: cysteine proteinase RD19a-like        65.9    4e-18   
ref|XP_010910124.1|  PREDICTED: cysteine proteinase 1-like            67.8    5e-18   Elaeis guineensis
ref|XP_010446443.1|  PREDICTED: cysteine proteinase RD19a             67.8    7e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010431862.1|  PREDICTED: cysteine proteinase RD19a             67.8    7e-18   Camelina sativa [gold-of-pleasure]
ref|XP_004230928.1|  PREDICTED: cysteine proteinase RD19a             61.6    7e-18   Solanum lycopersicum
ref|XP_010437007.1|  PREDICTED: cysteine proteinase RD19a-like        67.8    7e-18   Camelina sativa [gold-of-pleasure]
gb|KFK30492.1|  hypothetical protein AALP_AA7G268600                  67.0    7e-18   Arabis alpina [alpine rockcress]
ref|XP_006283963.1|  hypothetical protein CARUB_v10005086mg           67.8    8e-18   Capsella rubella
ref|XP_006362019.1|  PREDICTED: cysteine proteinase RD19a-like        61.6    8e-18   Solanum tuberosum [potatoes]
gb|ABK93575.1|  unknown                                               65.5    9e-18   Populus trichocarpa [western balsam poplar]
ref|XP_008444769.1|  PREDICTED: cysteine proteinase RD19a-like        70.1    9e-18   Cucumis melo [Oriental melon]
ref|XP_003589348.1|  Cysteine proteinase                              62.8    1e-17   Medicago truncatula
ref|XP_010440192.1|  PREDICTED: cysteine proteinase RD19a-like        69.7    1e-17   Camelina sativa [gold-of-pleasure]
gb|AAL05851.1|AF411121_1  cysteine proteinase precursor               65.9    1e-17   Sandersonia aurantiaca [Chinese-lantern lily]
emb|CDY71205.1|  BnaCnng71840D                                        66.2    1e-17   Brassica napus [oilseed rape]
emb|CDQ51995.1|  Cysteine proteinase                                  62.8    1e-17   Fagus sylvatica
gb|AAL60581.1|AF454959_1  senescence-associated cysteine protease     66.2    1e-17   Brassica oleracea
ref|XP_006473584.1|  PREDICTED: cysteine proteinase 15A-like          63.9    1e-17   Citrus sinensis [apfelsine]
ref|XP_003523684.1|  PREDICTED: cysteine proteinase 15A-like          64.7    1e-17   Glycine max [soybeans]
gb|AAD29084.1|AF082181_1  cysteine proteinase precursor               67.8    1e-17   Solanum melongena [aubergine]
ref|XP_009392632.1|  PREDICTED: cysteine proteinase 1-like            64.7    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002868883.1|  hypothetical protein ARALYDRAFT_490677           67.8    1e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_006411706.1|  hypothetical protein EUTSA_v10025494mg           67.0    1e-17   Eutrema salsugineum
ref|NP_001241450.1|  uncharacterized protein LOC100778716 precursor   64.7    1e-17   Glycine max [soybeans]
gb|KHN45894.1|  Cysteine proteinase RD19a                             64.7    1e-17   Glycine soja [wild soybean]
ref|XP_010449835.1|  PREDICTED: cysteine proteinase 15A-like          69.7    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_008387995.1|  PREDICTED: cysteine proteinase 15A               68.6    1e-17   Malus domestica [apple tree]
gb|KDO84720.1|  hypothetical protein CISIN_1g017548mg                 63.9    1e-17   Citrus sinensis [apfelsine]
ref|XP_010434865.1|  PREDICTED: cysteine proteinase 15A-like          69.7    1e-17   Camelina sativa [gold-of-pleasure]
gb|KJB07487.1|  hypothetical protein B456_001G026600                  65.1    1e-17   Gossypium raimondii
emb|CDP07452.1|  unnamed protein product                              69.3    1e-17   Coffea canephora [robusta coffee]
gb|AAQ81938.1|  cysteine proteinase precursor                         65.9    2e-17   Ipomoea batatas [batate]
ref|XP_008448073.1|  PREDICTED: cysteine proteinase RD19a-like        63.9    2e-17   Cucumis melo [Oriental melon]
ref|XP_006828787.1|  hypothetical protein AMTR_s00001p00114210        66.6    2e-17   Amborella trichopoda
ref|XP_002280808.2|  PREDICTED: cysteine proteinase 15A               63.2    2e-17   Vitis vinifera
ref|XP_006435090.1|  hypothetical protein CICLE_v10001559mg           63.5    2e-17   Citrus clementina
gb|AJP16692.1|  cysteine protease                                     64.7    2e-17   Striga hermonthica [purple witchweed]
emb|CDY41960.1|  BnaA01g05320D                                        67.4    2e-17   Brassica napus [oilseed rape]
emb|CDY09707.1|  BnaC07g33540D                                        67.4    2e-17   Brassica napus [oilseed rape]
gb|EYU42593.1|  hypothetical protein MIMGU_mgv1a008336mg              64.3    2e-17   Erythranthe guttata [common monkey flower]
ref|XP_007223351.1|  hypothetical protein PRUPE_ppa007441mg           67.4    2e-17   Prunus persica
gb|KFK24413.1|  hypothetical protein AALP_AAs58848U000200             66.6    3e-17   Arabis alpina [alpine rockcress]
gb|AAU81589.1|  cysteine proteinase                                   64.7    3e-17   Petunia x hybrida [garden petunia]
ref|XP_010672379.1|  PREDICTED: cysteine proteinase RD19a-like        61.6    3e-17   Beta vulgaris subsp. vulgaris [field beet]
gb|AAO11786.1|  pre-pro cysteine proteinase                           60.8    3e-17   Vicia faba [broad bean]
ref|XP_009150026.1|  PREDICTED: cysteine proteinase RD19a             66.6    4e-17   Brassica rapa
gb|AAB67878.1|  pre-pro-cysteine proteinase                           60.8    4e-17   Vicia faba [broad bean]
ref|XP_007160702.1|  hypothetical protein PHAVU_001G009900g           62.4    4e-17   Phaseolus vulgaris [French bean]
gb|KHN22211.1|  Cysteine proteinase 15A                               64.7    4e-17   Glycine soja [wild soybean]
emb|CAA82995.1|  cysteine proteinase                                  60.8    4e-17   Vicia sativa [spring vetch]
ref|XP_004152668.1|  PREDICTED: cysteine proteinase RD19a-like        70.5    4e-17   Cucumis sativus [cucumbers]
dbj|BAF03553.1|  cysteine proteinase CP2                              62.0    5e-17   Phaseolus vulgaris [French bean]
gb|AGV54334.1|  cysteine proteinase RD19a-like protein                61.6    5e-17   Phaseolus vulgaris [French bean]
ref|XP_011083631.1|  PREDICTED: cysteine proteinase 15A-like          67.8    5e-17   Sesamum indicum [beniseed]
ref|XP_008221329.1|  PREDICTED: cysteine proteinase 15A-like          67.4    5e-17   Prunus mume [ume]
ref|XP_007136047.1|  hypothetical protein PHAVU_009G013600g           61.6    5e-17   Phaseolus vulgaris [French bean]
ref|NP_001266121.1|  uncharacterized protein LOC101501911 precursor   58.5    5e-17   Cicer arietinum [garbanzo]
ref|XP_006414378.1|  hypothetical protein EUTSA_v10025521mg           67.8    5e-17   Eutrema salsugineum
ref|XP_009405542.1|  PREDICTED: cysteine proteinase 1-like            62.8    5e-17   Musa acuminata subsp. malaccensis [pisang utan]
gb|AJA74415.1|  cysteine protease                                     58.5    5e-17   Cicer arietinum [garbanzo]
ref|XP_006283974.1|  hypothetical protein CARUB_v10005098mg           68.9    5e-17   Capsella rubella
ref|XP_003550405.2|  PREDICTED: cysteine proteinase 15A               59.3    6e-17   
dbj|BAD43619.1|  putative cysteine proteinase                         63.9    6e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009335626.1|  PREDICTED: cysteine proteinase 15A               66.6    6e-17   Pyrus x bretschneideri [bai li]
ref|NP_565512.1|  Papain family cysteine protease                     63.9    6e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009136751.1|  PREDICTED: cysteine proteinase RD19a-like        67.4    7e-17   Brassica rapa
dbj|BAD94010.1|  drought-inducible cysteine proteinase RD19A prec...  62.4    7e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CDX90537.1|  BnaA03g42440D                                        67.4    8e-17   Brassica napus [oilseed rape]
emb|CAB17075.1|  cysteine proteinase precursor                        62.0    9e-17   Phaseolus vulgaris [French bean]
sp|P25804.1|CYSP_PEA  RecName: Full=Cysteine proteinase 15A; AltN...  61.6    9e-17   Pisum sativum [garden pea]
gb|ACK57563.1|  cysteine protease-like protein                        64.3    9e-17   Arachis hypogaea [goober]
gb|AAL69389.1|AF462226_1  putative cysteine proteinase                60.8    1e-16   Narcissus pseudonarcissus
dbj|BAA92495.1|  cysteine protease                                    63.9    1e-16   Vigna mungo [urad dal]
ref|XP_002880378.1|  hypothetical protein ARALYDRAFT_481008           63.2    1e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_004238314.1|  PREDICTED: cysteine proteinase 15A               63.5    1e-16   
gb|KJB58164.1|  hypothetical protein B456_009G197400                  65.5    1e-16   Gossypium raimondii
ref|XP_008775280.1|  PREDICTED: cysteine proteinase 1-like            66.2    1e-16   Phoenix dactylifera
ref|XP_006341997.1|  PREDICTED: cysteine proteinase 15A-like          63.5    1e-16   Solanum tuberosum [potatoes]
emb|CDX99593.1|  BnaC04g33500D                                        64.3    1e-16   Brassica napus [oilseed rape]
ref|XP_010943608.1|  PREDICTED: cysteine proteinase 1-like            64.3    1e-16   Elaeis guineensis
ref|XP_003545051.1|  PREDICTED: cysteine proteinase 15A-like          58.5    2e-16   Glycine max [soybeans]
ref|XP_009140277.1|  PREDICTED: probable cysteine proteinase A494     64.3    2e-16   Brassica rapa
emb|CAA52403.1|  putative thiol protease                              62.8    2e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CDY15894.1|  BnaA04g12170D                                        64.3    2e-16   Brassica napus [oilseed rape]
gb|ACX54787.2|  cysteine protease                                     63.9    2e-16   Arachis diogoi
gb|ACM80348.1|  cysteine proteinase                                   61.6    2e-16   Solanum lycopersicum
gb|KJB29611.1|  hypothetical protein B456_005G110200                  60.8    2e-16   Gossypium raimondii
emb|CAA78365.1|  tobacco pre-pro-cysteine proteinase                  62.0    2e-16   Nicotiana tabacum [American tobacco]
emb|CAA78361.1|  tobacco pre-pro-cysteine proteinase                  62.0    2e-16   Nicotiana tabacum [American tobacco]
ref|XP_009611293.1|  PREDICTED: cysteine proteinase 15A-like          62.0    2e-16   Nicotiana tomentosiformis
ref|NP_567489.1|  papain family cysteine protease                     68.6    2e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CAB53397.1|  cysteine protease                                    60.8    3e-16   Medicago sativa [alfalfa]
ref|XP_002870174.1|  hypothetical protein ARALYDRAFT_915142           68.2    3e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_006404590.1|  hypothetical protein EUTSA_v10000210mg           63.9    3e-16   Eutrema salsugineum
gb|ABK24153.1|  unknown                                               60.8    4e-16   Picea sitchensis
gb|KHG15062.1|  Cysteinease RD19a -like protein                       60.8    4e-16   Gossypium arboreum [tree cotton]
gb|ABK24688.1|  unknown                                               64.7    4e-16   Picea sitchensis
gb|ABK21238.1|  unknown                                               64.7    4e-16   Picea sitchensis
gb|ACN40679.1|  unknown                                               64.7    5e-16   Picea sitchensis
gb|AAK07731.1|  CPR2-like cysteine proteinase                         62.0    5e-16   Nicotiana tabacum [American tobacco]
emb|CAA78403.1|  pre-pro-cysteine proteinase                          63.5    5e-16   Solanum lycopersicum
gb|AAB62937.1|  stress-induced cysteine proteinase                    59.7    5e-16   Lavatera thuringiaca
ref|XP_009776238.1|  PREDICTED: cysteine proteinase 15A-like          62.0    5e-16   Nicotiana sylvestris
ref|XP_006653265.1|  PREDICTED: cysteine proteinase 1-like            67.0    5e-16   
gb|KHN12668.1|  Cysteine proteinase 15A                               57.4    1e-15   Glycine soja [wild soybean]
ref|XP_002279862.1|  PREDICTED: cysteine proteinase RD19a             63.2    1e-15   Vitis vinifera
dbj|BAD10859.1|  cysteine protease                                    66.2    1e-15   Tripolium pannonicum [sea starwort]
gb|EMT16425.1|  Cysteine proteinase 1                                 65.1    1e-15   Aegilops tauschii
ref|XP_004952477.1|  PREDICTED: cysteine proteinase 1-like            65.5    2e-15   Setaria italica
ref|XP_002452058.1|  hypothetical protein SORBIDRAFT_04g017830        63.9    2e-15   Sorghum bicolor [broomcorn]
gb|AEX97108.1|  cysteine proteinase                                   65.1    2e-15   Malus domestica [apple tree]
ref|XP_003607110.1|  Cysteine proteinase                              55.1    2e-15   Medicago truncatula
gb|EYU27644.1|  hypothetical protein MIMGU_mgv1a008452mg              61.2    2e-15   Erythranthe guttata [common monkey flower]
gb|KEH30505.1|  papain family cysteine protease                       54.7    3e-15   Medicago truncatula
ref|XP_003579573.2|  PREDICTED: cysteine proteinase 1-like            63.9    3e-15   Brachypodium distachyon [annual false brome]
gb|EPS70818.1|  cysteine proteinase                                   59.7    3e-15   Genlisea aurea
gb|EMS53996.1|  Cysteine proteinase 1                                 63.9    3e-15   Triticum urartu
ref|XP_004975256.1|  PREDICTED: cysteine proteinase 1-like            66.6    4e-15   Setaria italica
gb|AAZ32411.1|  cysteine proteinase glycinain type                    62.0    5e-15   Nicotiana benthamiana
emb|CAD40319.2|  OSJNBb0054B09.3                                      65.1    5e-15   Oryza sativa Japonica Group [Japonica rice]
dbj|BAG16515.1|  putative cysteine proteinase                         62.4    6e-15   Capsicum chinense [bonnet pepper]
ref|NP_001105685.1|  cysteine proteinase 1 precursor                  63.2    6e-15   Zea mays [maize]
gb|ACF86683.1|  unknown                                               63.2    6e-15   Zea mays [maize]
ref|XP_006665032.1|  PREDICTED: cysteine proteinase 1-like            63.2    7e-15   
gb|EEE60725.1|  hypothetical protein OsJ_14236                        64.7    7e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EAY93546.1|  hypothetical protein OsI_15336                        64.7    8e-15   Oryza sativa Indica Group [Indian rice]
gb|AAB16996.1|  thiol protease isoform B                              58.2    1e-14   Glycine max [soybeans]
ref|NP_001052440.1|  Os04g0311400                                     63.5    2e-14   
emb|CDX98179.1|  BnaC07g09190D                                        55.5    2e-14   Brassica napus [oilseed rape]
emb|CAQ00101.1|  papain-like cysteine proteinase                      61.2    2e-14   Hordeum vulgare subsp. vulgare [barley]
ref|XP_003574963.1|  PREDICTED: cysteine proteinase 1-like            58.9    5e-14   Brachypodium distachyon [annual false brome]
ref|NP_001046828.1|  Os02g0469600                                     59.7    5e-14   
ref|XP_009786000.1|  PREDICTED: cysteine proteinase RD19a-like        62.0    8e-14   Nicotiana sylvestris
emb|CAA57675.1|  cysteine proteinase                                  59.3    9e-14   Zea mays [maize]
gb|EPS65881.1|  cysteine proteinase                                   59.3    9e-14   Genlisea aurea
gb|AGS43121.1|  cysteine protease 1                                   59.7    1e-13   Zea mays [maize]
emb|CAH59428.1|  cysteine protease 2                                  55.1    1e-13   Plantago major [cart-track plant]
gb|AES89347.2|  papain family cysteine protease                       55.1    2e-13   Medicago truncatula
ref|XP_003607150.1|  Cysteine proteinase                              55.1    2e-13   
tpe|CAD66657.1|  TPA: putative cysteine proteinase precursor          59.7    2e-13   Hordeum vulgare subsp. vulgare [barley]
gb|AAW21813.1|  cysteine protease                                     60.1    2e-13   Triticum aestivum [Canadian hard winter wheat]
gb|EMT10192.1|  Cysteine proteinase 1                                 60.1    2e-13   Aegilops tauschii
gb|AAB16997.1|  thiol protease isoform A                              58.5    4e-13   Glycine max [soybeans]
ref|XP_002969223.1|  hypothetical protein SELMODRAFT_91274            60.1    5e-13   Selaginella moellendorffii
ref|XP_002960585.1|  hypothetical protein SELMODRAFT_266583           59.7    6e-13   Selaginella moellendorffii
gb|EMS64962.1|  Cysteine proteinase 1                                 58.5    7e-13   Triticum urartu
ref|XP_006293095.1|  hypothetical protein CARUB_v10019394mg           55.8    2e-12   Capsella rubella
ref|XP_010504326.1|  PREDICTED: cysteine proteinase 15A-like          55.1    3e-12   Camelina sativa [gold-of-pleasure]
gb|AAB53103.1|  cysteine protease                                     61.2    3e-12   Brassica napus [oilseed rape]
gb|ADY04293.1|  cysteine protease                                     66.2    3e-12   Clarkia xantiana subsp. xantiana
gb|ADY04368.1|  cysteine protease                                     65.5    4e-12   Clarkia xantiana subsp. xantiana
gb|ADY04361.1|  cysteine protease                                     65.5    4e-12   Clarkia xantiana subsp. xantiana
gb|ADY04414.1|  cysteine protease                                     65.5    5e-12   Clarkia xantiana subsp. xantiana
gb|ADY04342.1|  cysteine protease                                     65.5    5e-12   Clarkia xantiana subsp. xantiana
gb|ADY04336.1|  cysteine protease                                     65.5    5e-12   Clarkia xantiana subsp. xantiana
gb|ADY04262.1|  cysteine protease                                     65.5    5e-12   Clarkia xantiana subsp. xantiana
gb|ADY04457.1|  cysteine protease                                     65.5    5e-12   Clarkia xantiana subsp. xantiana
ref|XP_002876278.1|  hypothetical protein ARALYDRAFT_485911           54.7    7e-12   Arabidopsis lyrata subsp. lyrata
gb|ADY04359.1|  cysteine protease                                     65.5    8e-12   Clarkia xantiana subsp. xantiana
gb|ADY04482.1|  cysteine protease                                     64.7    8e-12   Clarkia xantiana subsp. xantiana
emb|CAB41090.1|  cysteine proteinase precursor-like protein           54.7    8e-12   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567010.5|  Papain family cysteine protease                     54.7    9e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ADY04358.1|  cysteine protease                                     64.7    9e-12   Clarkia xantiana subsp. xantiana
gb|KFK34737.1|  hypothetical protein AALP_AA5G186400                  55.5    1e-11   Arabis alpina [alpine rockcress]
ref|XP_006403513.1|  hypothetical protein EUTSA_v10010475mg           53.5    1e-11   Eutrema salsugineum
gb|ADY04268.1|  cysteine protease                                     64.3    1e-11   Clarkia xantiana subsp. xantiana
gb|ADY04480.1|  cysteine protease                                     63.9    1e-11   Clarkia xantiana subsp. xantiana
gb|ADY04295.1|  cysteine protease                                     63.2    2e-11   Clarkia xantiana subsp. xantiana
dbj|BAC57957.1|  thiol protease                                       66.6    3e-11   Tripolium pannonicum [sea starwort]
gb|ADY04490.1|  cysteine protease                                     65.5    4e-11   Clarkia xantiana subsp. xantiana
ref|XP_010690815.1|  PREDICTED: cysteine proteinase RD19a             53.9    4e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009404192.1|  PREDICTED: cysteine proteinase 15A               47.8    5e-11   Musa acuminata subsp. malaccensis [pisang utan]
emb|CCA95082.1|  putative responsive to dehydration 19                65.5    5e-11   Ginkgo biloba [ginkgo]
ref|XP_003560213.1|  PREDICTED: cysteine proteinase 1                 47.0    6e-11   Brachypodium distachyon [annual false brome]
ref|XP_008802783.1|  PREDICTED: probable cysteine proteinase A494     47.4    8e-11   Phoenix dactylifera
ref|XP_010534431.1|  PREDICTED: cysteine proteinase 15A               54.7    1e-10   Tarenaya hassleriana [spider flower]
emb|CDX73424.1|  BnaC08g25790D                                        54.3    1e-10   Brassica napus [oilseed rape]
gb|KHN00877.1|  Cysteine proteinase 15A                               52.0    2e-10   Glycine soja [wild soybean]
emb|CAQ00102.1|  papain-like cysteine proteinase                      48.1    2e-10   Hordeum vulgare subsp. vulgare [barley]
gb|ABO93617.1|  papain-like cysteine proteinase                       63.9    2e-10   Vitis vinifera
ref|XP_008776953.1|  PREDICTED: cysteine proteinase-like              47.0    2e-10   Phoenix dactylifera
ref|XP_009116190.1|  PREDICTED: probable cysteine proteinase A494     54.3    3e-10   Brassica rapa
emb|CDY56961.1|  BnaA09g55030D                                        54.3    3e-10   Brassica napus [oilseed rape]
gb|EMS59778.1|  Cysteine proteinase 15A                               48.9    3e-10   Triticum urartu
emb|CCA95098.1|  putative responsive to dehydration 19                63.2    3e-10   Liriodendron tulipifera
ref|XP_008804021.1|  PREDICTED: cysteine proteinase RD19a-like        45.4    4e-10   Phoenix dactylifera
ref|NP_001059639.1|  Os07g0480900                                     45.8    4e-10   
gb|KEH43476.1|  papain family cysteine protease                       54.3    7e-10   Medicago truncatula
tpg|DAA40800.1|  TPA: putative cysteine protease family protein       44.7    9e-10   
gb|KJB73490.1|  hypothetical protein B456_011G235500                  48.9    1e-09   
gb|KHN37802.1|  Cysteine proteinase 1                                 52.4    1e-09   
ref|NP_001236888.1|  cysteine proteinase precursor                    52.4    1e-09   
gb|EYU39642.1|  hypothetical protein MIMGU_mgv1a008552mg              51.6    2e-09   
ref|XP_009117680.1|  PREDICTED: probable cysteine proteinase A494     50.4    2e-09   
ref|XP_002460693.1|  hypothetical protein SORBIDRAFT_02g033270        44.7    2e-09   
emb|CAB16316.1|  cysteine proteinase precursor                        51.2    2e-09   
ref|XP_006658557.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...  44.7    2e-09   
ref|XP_004496226.1|  PREDICTED: cysteine proteinase 15A-like          53.1    2e-09   
gb|AEQ54770.1|  cysteine proteinase CP1                               50.4    2e-09   
ref|XP_010918606.1|  PREDICTED: probable cysteine proteinase A494     45.4    2e-09   
ref|XP_001761980.1|  predicted protein                                51.2    2e-09   
gb|KHG08355.1|  Cysteinease 1                                         48.9    2e-09   
ref|XP_010243268.1|  PREDICTED: cysteine proteinase 15A               47.0    2e-09   
ref|XP_001781954.1|  predicted protein                                50.4    3e-09   
ref|XP_007143764.1|  hypothetical protein PHAVU_007G099600g           48.5    4e-09   
gb|AAD46920.1|AF167986_1  putative cysteine proteinase GmPM33         52.0    4e-09   
ref|XP_009789260.1|  PREDICTED: cysteine proteinase 15A               51.2    4e-09   
ref|XP_008362714.1|  PREDICTED: cysteine proteinase 15A               50.4    5e-09   
ref|XP_004250044.1|  PREDICTED: cysteine proteinase 15A               50.4    5e-09   
emb|CAB17077.1|  cysteine proteinase precursor                        48.1    5e-09   
ref|XP_009617441.1|  PREDICTED: cysteine proteinase 15A               50.8    6e-09   
ref|XP_011024366.1|  PREDICTED: cysteine proteinase 15A               48.9    6e-09   
emb|CDO99795.1|  unnamed protein product                              48.5    7e-09   
gb|ADE76932.1|  unknown                                               51.2    7e-09   
ref|XP_010688493.1|  PREDICTED: cysteine proteinase 15A               48.5    8e-09   
ref|XP_004959670.1|  PREDICTED: cysteine proteinase 1-like            44.3    9e-09   
ref|XP_006850211.1|  hypothetical protein AMTR_s00022p00251800        55.5    9e-09   
gb|EEC82027.1|  hypothetical protein OsI_25996                        45.1    1e-08   
ref|XP_006436511.1|  hypothetical protein CICLE_v10031865mg           47.0    1e-08   
ref|XP_010034320.1|  PREDICTED: cysteine proteinase 1                 48.9    1e-08   
gb|KDP30486.1|  hypothetical protein JCGZ_16165                       50.1    1e-08   
ref|XP_007218137.1|  hypothetical protein PRUPE_ppa007240mg           49.3    2e-08   
ref|XP_008233261.1|  PREDICTED: cysteine proteinase 15A               48.9    2e-08   
emb|CDY13816.1|  BnaA09g43180D                                        47.0    2e-08   
ref|XP_011094506.1|  PREDICTED: cysteine proteinase 15A               50.1    2e-08   
ref|XP_002533377.1|  cysteine protease, putative                      47.8    3e-08   
ref|XP_010103534.1|  putative cysteine proteinase A494                46.2    3e-08   
ref|XP_006361690.1|  PREDICTED: cysteine proteinase 15A-like          47.4    4e-08   
ref|XP_008354070.1|  PREDICTED: cysteine proteinase 15A-like          47.0    7e-08   
ref|XP_008446834.1|  PREDICTED: cysteine proteinase 15A               46.6    9e-08   
ref|XP_007010012.1|  Papain family cysteine protease                  45.1    1e-07   
ref|XP_004157559.1|  PREDICTED: cysteine proteinase 15A-like          46.6    1e-07   
ref|XP_002266821.1|  PREDICTED: cysteine proteinase 15A               48.5    1e-07   
ref|XP_004142497.1|  PREDICTED: cysteine proteinase 15A-like          46.2    1e-07   
emb|CAN80141.1|  hypothetical protein VITISV_038978                   58.5    1e-07   
ref|XP_002316398.1|  hypothetical protein POPTR_0010s23510g           48.1    1e-07   
emb|CAN71324.1|  hypothetical protein VITISV_013970                   58.5    1e-07   
gb|EPS63354.1|  hypothetical protein M569_11429                       44.3    2e-07   
ref|XP_008647122.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin 7-...  56.6    3e-07   
emb|CAN64491.1|  hypothetical protein VITISV_015725                   48.1    3e-07   
emb|CEF99324.1|  Cysteine peptidase, cysteine active site             50.8    3e-07   
emb|CAN81617.1|  hypothetical protein VITISV_001998                   56.2    5e-07   
emb|CBI31400.3|  unnamed protein product                              44.7    5e-07   
ref|XP_007510080.1|  unknown                                          50.1    7e-07   
gb|AFW72358.1|  putative cysteine protease family protein             56.6    7e-07   
emb|CAN81619.1|  hypothetical protein VITISV_002000                   55.5    9e-07   
emb|CBI23088.3|  unnamed protein product                              53.5    1e-06   
emb|CAC94443.1|  cysteine proteinase                                  52.8    1e-06   
ref|XP_003081549.1|  Cysteine proteinase Cathepsin F (ISS)            49.3    2e-06   
gb|AAO12867.1|  papain-like cysteine proteinase                       49.3    8e-06   
ref|XP_001419933.1|  predicted protein                                46.2    9e-06   
emb|CAC94444.1|  cysteine proteinase                                  50.4    1e-05   
gb|ABY75169.1|  cysteine protease                                     48.1    3e-05   
ref|XP_011469621.1|  PREDICTED: cysteine proteinase 15A-like          40.4    2e-04   
ref|XP_004519757.1|  PREDICTED: putative cysteine proteinase CG12...  40.8    3e-04   
emb|CDX82031.1|  BnaC08g35700D                                        48.1    3e-04   
ref|XP_011184040.1|  PREDICTED: putative cysteine proteinase CG12163  40.8    3e-04   
ref|XP_011203808.1|  PREDICTED: putative cysteine proteinase CG12163  40.8    3e-04   
ref|XP_003696602.1|  PREDICTED: putative cysteine proteinase CG12...  41.2    3e-04   
ref|XP_006608091.1|  PREDICTED: uncharacterized protein LOC102680728  41.2    3e-04   
ref|XP_011169692.1|  PREDICTED: putative cysteine proteinase CG12163  41.2    4e-04   
gb|AEW08440.1|  hypothetical protein 2_9845_02                        38.1    5e-04   
ref|XP_004519758.1|  PREDICTED: putative cysteine proteinase CG12...  39.7    6e-04   
gb|KFB38327.1|  AGAP002879-PB-like protein                            39.7    6e-04   
ref|XP_011496222.1|  PREDICTED: uncharacterized protein LOC105360904  39.3    7e-04   
ref|XP_011145705.1|  PREDICTED: uncharacterized protein LOC105186896  40.4    8e-04   
gb|EFN80374.1|  Putative cysteine proteinase CG12163                  40.4    8e-04   
ref|XP_011493714.1|  AAEL017153-PA                                    38.5    8e-04   
ref|XP_006567715.1|  PREDICTED: putative cysteine proteinase CG12...  39.7    0.001   
ref|XP_392381.3|  PREDICTED: putative cysteine proteinase CG12163...  39.7    0.001   



>gb|AAF61441.1|AF138265_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=366

 Score = 73.6 bits (179),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSAGYAPIR+KEKPYWIIKN
Sbjct  292  YICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKN  327


 Score = 59.7 bits (143),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTSD  224
            G   G  G YKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  330  GESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  366



>gb|AAF40414.1|AF216783_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score = 73.6 bits (179),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSAGYAPIR+KEKPYWIIKN
Sbjct  294  YICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKN  329


 Score = 59.7 bits (143),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTSD  224
            G   G  G YKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  332  GESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  368



>gb|AAF61440.1|AF138264_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score = 73.6 bits (179),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSAGYAPIR+KEKPYWIIKN
Sbjct  294  YICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKN  329


 Score = 59.7 bits (143),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTSD  224
            G   G  G YKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  332  GESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  368



>gb|AAK27969.1|AF242373_1 cysteine protease [Ipomoea batatas]
Length=366

 Score = 73.6 bits (179),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSAGYAPIR+KEKPYWIIKN
Sbjct  292  YICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKN  327


 Score = 59.7 bits (143),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTSD  224
            G   G  G YKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  330  GESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  366



>gb|AAF40415.1|AF216784_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=368

 Score = 73.6 bits (179),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSAGYAPIR+KEKPYWIIKN
Sbjct  294  YICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKN  329


 Score = 59.7 bits (143),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTSD  224
            G   G  G YKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  332  GESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  368



>gb|AAF40416.1|AF216785_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
 gb|AAF61442.1|AF138266_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
Length=366

 Score = 73.6 bits (179),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSAGYAPIR+KEKPYWIIKN
Sbjct  292  YICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKN  327


 Score = 59.3 bits (142),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTSD  224
            G   G  G YKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  330  GESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  366



>ref|XP_002512963.1| cysteine protease, putative [Ricinus communis]
 gb|EEF49466.1| cysteine protease, putative [Ricinus communis]
Length=373

 Score = 73.6 bits (179),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSAGYAPIR+KEKPYWIIKN
Sbjct  300  YICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKN  335


 Score = 55.5 bits (132),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRGRNICGVDSMVSTVAAV T +
Sbjct  338  GENWGESGYYKICRGRNICGVDSMVSTVAAVQTAS  372



>gb|KDP41743.1| hypothetical protein JCGZ_26761 [Jatropha curcas]
Length=370

 Score = 73.9 bits (180),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSAGYAPIRLKEKPYWIIKN
Sbjct  297  YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKN  332


 Score = 54.7 bits (130),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRGRN+CGVDSMVSTVAAV T +
Sbjct  335  GETWGESGYYKICRGRNVCGVDSMVSTVAAVQTSS  369



>ref|XP_002302004.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
 gb|ABK94746.1| unknown [Populus trichocarpa]
 gb|EEE81277.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
Length=367

 Score = 71.2 bits (173),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSAGYAPIR KEKP+WIIKN
Sbjct  294  YICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKN  329


 Score = 57.0 bits (136),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G+  G  G YKICRGRNICGVDSMVSTVAA++T
Sbjct  332  GQNWGENGYYKICRGRNICGVDSMVSTVAAIHT  364



>gb|KHG24064.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=374

 Score = 72.4 bits (176),  Expect(2) = 5e-21, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSAGYAPIRLK+KPYWIIKN
Sbjct  301  YICSKRLDHGVLLVGYGSAGYAPIRLKDKPYWIIKN  336


 Score = 55.1 bits (131),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRGRN+CGVDS+VSTVAAVNT
Sbjct  339  GETWGENGYYKICRGRNVCGVDSLVSTVAAVNT  371



>gb|KJB32561.1| hypothetical protein B456_005G247000 [Gossypium raimondii]
Length=374

 Score = 72.4 bits (176),  Expect(2) = 6e-21, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSAGYAPIRLK+KPYWIIKN
Sbjct  301  YICSKRLDHGVLLVGYGSAGYAPIRLKDKPYWIIKN  336


 Score = 54.7 bits (130),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRGRN+CGVDS+VSTVAAVNT
Sbjct  339  GETWGENGFYKICRGRNVCGVDSLVSTVAAVNT  371



>gb|KJB79047.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
Length=373

 Score = 71.2 bits (173),  Expect(2) = 6e-21, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSAGYAP+R+K+KPYWIIKN
Sbjct  300  YICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKN  335


 Score = 55.8 bits (133),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G Y+ICRGRNICGVDSMVSTVAAVNT
Sbjct  338  GENWGENGFYRICRGRNICGVDSMVSTVAAVNT  370



>gb|AIB06024.1| CP2 [Hevea brasiliensis]
Length=372

 Score = 72.8 bits (177),  Expect(2) = 6e-21, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSAGYAP+RLKEKPYWIIKN
Sbjct  298  YICSKRLDHGVLLVGYGSAGYAPVRLKEKPYWIIKN  333


 Score = 54.3 bits (129),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 28/36 (78%), Gaps = 1/36 (3%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAA-VNTPT  218
            G   G  G YKICRGRNICGVDSMVSTVAA V TP+
Sbjct  336  GENWGESGYYKICRGRNICGVDSMVSTVAAVVQTPS  371



>emb|CAE54306.1| putative papain-like cysteine proteinase [Gossypium hirsutum]
Length=373

 Score = 71.2 bits (173),  Expect(2) = 6e-21, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSAGYAP+R+K+KPYWIIKN
Sbjct  300  YICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKN  335


 Score = 55.8 bits (133),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G Y+ICRGRNICGVDSMVSTVAAVNT
Sbjct  338  GENWGENGFYRICRGRNICGVDSMVSTVAAVNT  370



>gb|ABK96580.1| unknown [Populus trichocarpa x Populus deltoides]
Length=367

 Score = 72.0 bits (175),  Expect(2) = 7e-21, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSAGYAPIR KEKP+WIIKN
Sbjct  294  YICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKN  329


 Score = 55.1 bits (131),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G+  G  G YKICRGRNICGVDSMVSTVAA++T
Sbjct  332  GQNWGENGYYKICRGRNICGVDSMVSTVAAIHT  364



>gb|KHG15253.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=373

 Score = 70.9 bits (172),  Expect(2) = 7e-21, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSAGYAP+R+K+KPYWIIKN
Sbjct  300  YICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKN  335


 Score = 55.8 bits (133),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G Y+ICRGRNICGVDSMVSTVAAVNT
Sbjct  338  GENWGENGFYRICRGRNICGVDSMVSTVAAVNT  370



>gb|ABK94801.1| unknown [Populus trichocarpa]
Length=367

 Score = 72.0 bits (175),  Expect(2) = 7e-21, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSAGYAPIR KEKP+WIIKN
Sbjct  294  YICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKN  329


 Score = 55.1 bits (131),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G+  G  G YKICRGRNICGVDSMVSTVAA++T
Sbjct  332  GQNWGENGYYKICRGRNICGVDSMVSTVAAIHT  364



>ref|XP_007042077.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOX97908.1| Papain family cysteine protease [Theobroma cacao]
Length=395

 Score = 71.2 bits (173),  Expect(2) = 8e-21, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSAGYAP+R+K+KPYWIIKN
Sbjct  322  YICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKN  357


 Score = 55.5 bits (132),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRGRNICGVDSMVSTVAAV+T
Sbjct  360  GESWGEDGFYKICRGRNICGVDSMVSTVAAVDT  392



>gb|AAX19661.1| cysteine proteinase [Populus tomentosa]
Length=374

 Score = 71.6 bits (174),  Expect(2) = 8e-21, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICS+R   GVLLVGYGSAGYAP+R+KEKPYWIIKN
Sbjct  301  YICSRRLDHGVLLVGYGSAGYAPVRMKEKPYWIIKN  336


 Score = 55.1 bits (131),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRGRNICGVDSMVSTVAAV T +
Sbjct  339  GESWGENGFYKICRGRNICGVDSMVSTVAAVQTSS  373



>ref|NP_001267989.1| cysteine protease precursor [Vitis vinifera]
 gb|ABX79341.1| cysteine protease [Vitis vinifera]
Length=377

 Score = 72.0 bits (175),  Expect(2) = 9e-21, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSAGYAPIR+K+KPYWIIKN
Sbjct  304  YICSKRLDHGVLLVGYGSAGYAPIRMKDKPYWIIKN  339


 Score = 54.7 bits (130),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKICRGRN+CGVDSMVSTVAAV+T ++
Sbjct  342  GENWGENGFYKICRGRNVCGVDSMVSTVAAVHTTSN  377



>emb|CDP20652.1| unnamed protein product [Coffea canephora]
Length=372

 Score = 72.0 bits (175),  Expect(2) = 9e-21, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGS+GYAPIR+KEKPYWIIKN
Sbjct  300  YICSKRLDHGVLLVGYGSSGYAPIRMKEKPYWIIKN  335


 Score = 54.7 bits (130),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRG NICGVDSMVSTVAAV+T T
Sbjct  338  GEHWGENGYYKICRGHNICGVDSMVSTVAAVHTST  372



>ref|XP_011047717.1| PREDICTED: cysteine proteinase RD19a [Populus euphratica]
Length=368

 Score = 71.6 bits (174),  Expect(2) = 1e-20, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICS+R   GVLLVGYGSAGYAP+R+KEKPYWIIKN
Sbjct  295  YICSRRLDHGVLLVGYGSAGYAPVRMKEKPYWIIKN  330


 Score = 54.7 bits (130),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRGRNICGVDSMVSTVAAV T
Sbjct  333  GESWGENGFYKICRGRNICGVDSMVSTVAAVQT  365



>ref|XP_011028940.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score = 71.6 bits (174),  Expect(2) = 1e-20, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSAGYAPIR KEKP+WIIKN
Sbjct  294  YICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKN  329


 Score = 54.7 bits (130),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRGRNICGVDSMVSTVAA++T
Sbjct  332  GENWGENGYYKICRGRNICGVDSMVSTVAAIHT  364



>gb|ABQ10201.1| cysteine protease Cp3 [Actinidia deliciosa]
Length=365

 Score = 73.6 bits (179),  Expect(2) = 1e-20, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSAGYAPIR+KEKPYWIIKN
Sbjct  292  YICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKN  327


 Score = 52.8 bits (125),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKIC+GRN+CGVDSMVSTVAAV+T ++
Sbjct  330  GESWGENGFYKICQGRNVCGVDSMVSTVAAVHTTSN  365



>ref|XP_009373025.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=371

 Score = 71.6 bits (174),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYG+AGY+PIRLKEKPYWIIKN
Sbjct  296  YICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKN  331


 Score = 53.5 bits (127),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  334  GENWGENGFYKICRGRNICGVDSMVSTVAAASVKTN  369



>ref|XP_009373000.1| PREDICTED: cysteine proteinase RD19a [Pyrus x bretschneideri]
Length=371

 Score = 71.6 bits (174),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYG+AGY+PIRLKEKPYWIIKN
Sbjct  296  YICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKN  331


 Score = 53.5 bits (127),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  334  GENWGENGFYKICRGRNICGVDSMVSTVAAASVKTN  369



>ref|XP_008382317.1| PREDICTED: cysteine proteinase RD19a [Malus domestica]
Length=371

 Score = 71.6 bits (174),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYG+AGY+PIRLKEKPYWIIKN
Sbjct  296  YICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKN  331


 Score = 53.5 bits (127),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  334  GENWGENGFYKICRGRNICGVDSMVSTVAAASVKTN  369



>ref|XP_002313770.1| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE87725.1| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score = 69.3 bits (168),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICS+R   GVLLVGYGSA YAP+R+KEKPYWIIKN
Sbjct  295  YICSRRLDHGVLLVGYGSAAYAPVRMKEKPYWIIKN  330


 Score = 55.1 bits (131),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRGRNICGVDSMVSTVAAV T
Sbjct  333  GESWGENGFYKICRGRNICGVDSMVSTVAAVQT  365



>gb|ABK92536.1| unknown [Populus trichocarpa]
Length=368

 Score = 69.3 bits (168),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICS+R   GVLLVGYGSA YAP+R+KEKPYWIIKN
Sbjct  295  YICSRRLDHGVLLVGYGSAAYAPVRMKEKPYWIIKN  330


 Score = 55.1 bits (131),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRGRNICGVDSMVSTVAAV T
Sbjct  333  GESWGENGFYKICRGRNICGVDSMVSTVAAVQT  365



>ref|XP_004507484.1| PREDICTED: cysteine proteinase RD19a-like [Cicer arietinum]
Length=363

 Score = 68.6 bits (166),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICS+R   GVLLVGYGS  YAPIR+KEKPYWIIKN
Sbjct  290  YICSRRLDHGVLLVGYGSGAYAPIRMKEKPYWIIKN  325


 Score = 55.8 bits (133),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRGRNICGVDSMVSTVAAV+T T
Sbjct  328  GENWGENGFYKICRGRNICGVDSMVSTVAAVHTTT  362



>ref|XP_011037175.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
 ref|XP_011037176.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
Length=368

 Score = 69.7 bits (169),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICS+R   GVLLVGYGSAGY+PIR+K+KPYWIIKN
Sbjct  295  YICSRRLDHGVLLVGYGSAGYSPIRMKDKPYWIIKN  330


 Score = 54.7 bits (130),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G + G  G YKICRGRN+CGVDSMVSTVAAV T +
Sbjct  333  GEKWGENGFYKICRGRNVCGVDSMVSTVAAVQTTS  367



>ref|XP_003606998.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89195.1| papain family cysteine protease [Medicago truncatula]
Length=362

 Score = 68.2 bits (165),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGS  Y+PIRLKEKPYWIIKN
Sbjct  290  YICSKRLDHGVLLVGYGSGAYSPIRLKEKPYWIIKN  325


 Score = 55.8 bits (133),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRGRNICGVDSMVSTVAAV+T T
Sbjct  328  GETWGENGYYKICRGRNICGVDSMVSTVAAVHTTT  362



>ref|XP_007131787.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
 gb|ESW03781.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
Length=361

 Score = 68.2 bits (165),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICS+R   GVLLVGYGS  YAPIR+KEKPYWIIKN
Sbjct  288  YICSRRLDHGVLLVGYGSGAYAPIRMKEKPYWIIKN  323


 Score = 55.8 bits (133),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRGRNICGVDSMVSTVAAV+T T
Sbjct  326  GENWGENGYYKICRGRNICGVDSMVSTVAAVHTTT  360



>ref|XP_006487337.1| PREDICTED: cysteine proteinase RD19a-like [Citrus sinensis]
Length=373

 Score = 72.8 bits (177),  Expect(2) = 6e-20, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICS+R   GVLLVGYGSAGYAPIRLKEKPYWIIKN
Sbjct  304  YICSRRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKN  339


 Score = 50.8 bits (120),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAV  206
            G   G  G YKICRGRN+CGVDSMVSTVAA 
Sbjct  342  GESWGENGYYKICRGRNVCGVDSMVSTVAAA  372



>ref|XP_002305451.2| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE85962.2| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score = 68.9 bits (167),  Expect(2) = 6e-20, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICS+R   GVLLVGYGSAGY+P+R+KEKP+WIIKN
Sbjct  295  YICSRRLDHGVLLVGYGSAGYSPVRMKEKPFWIIKN  330


 Score = 54.7 bits (130),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G + G  G YKICRGRN+CGVDSMVSTVAAV T +
Sbjct  333  GEKWGENGFYKICRGRNVCGVDSMVSTVAAVQTSS  367



>gb|KDO49483.1| hypothetical protein CISIN_1g017318mg [Citrus sinensis]
Length=373

 Score = 72.8 bits (177),  Expect(2) = 6e-20, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICS+R   GVLLVGYGSAGYAPIRLKEKPYWIIKN
Sbjct  304  YICSRRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKN  339


 Score = 50.8 bits (120),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAV  206
            G   G  G YKICRGRN+CGVDSMVSTVAA 
Sbjct  342  GESWGENGYYKICRGRNVCGVDSMVSTVAAA  372



>ref|XP_010271520.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=370

 Score = 70.1 bits (170),  Expect(2) = 7e-20, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGS GYAPIRLK+KPYWIIKN
Sbjct  297  YICSKRLDHGVLLVGYGSEGYAPIRLKDKPYWIIKN  332


 Score = 53.5 bits (127),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVN  209
            G   G  G YKICRGRN+CGVDSMVSTVAAVN
Sbjct  335  GEGWGENGYYKICRGRNVCGVDSMVSTVAAVN  366



>ref|XP_010066197.1| PREDICTED: probable cysteine proteinase A494 [Eucalyptus grandis]
 gb|KCW64029.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
 gb|KCW64030.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
Length=376

 Score = 69.3 bits (168),  Expect(2) = 8e-20, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSA Y+PIR+KEKPYWIIKN
Sbjct  303  YICSKRLDHGVLLVGYGSAAYSPIRMKEKPYWIIKN  338


 Score = 53.9 bits (128),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRGRNICGVDSMVSTVAA++T
Sbjct  341  GENWGENGFYKICRGRNICGVDSMVSTVAAIHT  373



>ref|XP_010028631.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW55393.1| hypothetical protein EUGRSUZ_I01305 [Eucalyptus grandis]
Length=370

 Score = 71.6 bits (174),  Expect(2) = 9e-20, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSAGYAPIR+K+KPYWIIKN
Sbjct  294  YICSKRLDHGVLLVGYGSAGYAPIRMKDKPYWIIKN  329


 Score = 51.2 bits (121),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 27/38 (71%), Gaps = 2/38 (5%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAV--NTPTS  221
            G   G  G YKICRGRNICGVDSMVSTVAA    TP S
Sbjct  332  GETWGENGYYKICRGRNICGVDSMVSTVAAAVHTTPGS  369



>ref|XP_006423403.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
 gb|ESR36643.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
Length=375

 Score = 72.8 bits (177),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICS+R   GVLLVGYGSAGYAPIRLKEKPYWIIKN
Sbjct  304  YICSRRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKN  339


 Score = 50.1 bits (118),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAV  206
            G   G  G YKICRGRN+CGVDSMVST+AA 
Sbjct  342  GESWGENGYYKICRGRNVCGVDSMVSTIAAA  372



>ref|XP_003539008.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=363

 Score = 66.6 bits (161),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICS+R   GVLLVGYGS  YAPIR+KEKP+WIIKN
Sbjct  290  YICSRRLDHGVLLVGYGSGAYAPIRMKEKPFWIIKN  325


 Score = 56.2 bits (134),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRGRNICGVDSMVSTVAAV+T T
Sbjct  328  GENWGENGYYKICRGRNICGVDSMVSTVAAVHTTT  362



>ref|XP_004290288.1| PREDICTED: probable cysteine proteinase A494 [Fragaria vesca 
subsp. vesca]
Length=372

 Score = 70.9 bits (172),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSAGY+P+R+KEKPYWIIKN
Sbjct  302  YICSKRLDHGVLLVGYGSAGYSPVRMKEKPYWIIKN  337


 Score = 52.0 bits (123),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAV  206
            G   G  G YKICRGRNICGVDSMVSTVAAV
Sbjct  340  GENWGEKGFYKICRGRNICGVDSMVSTVAAV  370



>ref|XP_002510469.1| cysteine protease, putative [Ricinus communis]
 gb|EEF52656.1| cysteine protease, putative [Ricinus communis]
Length=366

 Score = 69.7 bits (169),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GV+LVGYGSAGYAP+RLK+KP+WIIKN
Sbjct  293  YICSKRQDHGVVLVGYGSAGYAPVRLKDKPFWIIKN  328


 Score = 53.1 bits (126),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRGRN+CGVD+MVSTVAA++T
Sbjct  331  GENWGENGYYKICRGRNVCGVDAMVSTVAAIHT  363



>ref|XP_008236965.1| PREDICTED: cysteine proteinase RD19a [Prunus mume]
Length=367

 Score = 70.9 bits (172),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYG+AGY+PIR+KEKPYWIIKN
Sbjct  292  YICSKRLDHGVLLVGYGAAGYSPIRMKEKPYWIIKN  327


 Score = 52.0 bits (123),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKIC+GRNICGVDSMVSTVAA +  T+
Sbjct  330  GENWGEKGFYKICKGRNICGVDSMVSTVAAASVETN  365



>ref|XP_007201310.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
 gb|EMJ02509.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
Length=367

 Score = 70.9 bits (172),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYG+AGY+PIR+KEKPYWIIKN
Sbjct  292  YICSKRLDHGVLLVGYGAAGYSPIRMKEKPYWIIKN  327


 Score = 52.0 bits (123),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKIC+GRNICGVDSMVSTVAA +  T+
Sbjct  330  GENWGEKGFYKICKGRNICGVDSMVSTVAAASVETN  365



>gb|KHN39817.1| Cysteine proteinase RD19a [Glycine soja]
Length=332

 Score = 66.2 bits (160),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICS+R   GVLLVGYGS  YAPIR+KEKP+WIIKN
Sbjct  259  YICSRRLDHGVLLVGYGSGAYAPIRMKEKPFWIIKN  294


 Score = 56.2 bits (134),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRGRNICGVDSMVSTVAAV+T T
Sbjct  297  GENWGENGYYKICRGRNICGVDSMVSTVAAVHTTT  331



>gb|ACI04578.1| cysteine protease-like protein [Robinia pseudoacacia]
Length=335

 Score = 68.2 bits (165),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVLLVGYG AGYAPIRLKEKPYWIIKN
Sbjct  262  YICGKNLDHGVLLVGYGKAGYAPIRLKEKPYWIIKN  297


 Score = 54.3 bits (129),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRGRN+CGVDSMVSTVAAV+T
Sbjct  300  GESWGENGYYKICRGRNVCGVDSMVSTVAAVHT  332



>ref|XP_004150061.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004166953.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN61836.1| Cysteine protease [Cucumis sativus]
Length=377

 Score = 67.8 bits (164),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSK    GVLLVGYGS GYAPIRLK+KPYWIIKN
Sbjct  304  YICSKHLDHGVLLVGYGSDGYAPIRLKDKPYWIIKN  339


 Score = 54.3 bits (129),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKICRGRNICGVDSMVSTVAAV+T  +
Sbjct  342  GANWGENGYYKICRGRNICGVDSMVSTVAAVHTAAN  377



>ref|XP_011088458.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Sesamum indicum]
Length=379

 Score = 67.0 bits (162),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  4    ICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            ICSKR   GVLLVGYG AGYAPIR KEKPYWIIKN
Sbjct  308  ICSKRLDHGVLLVGYGEAGYAPIRRKEKPYWIIKN  342


 Score = 54.7 bits (130),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G + G  G YKICRGRNICGVDSMVSTVAAV+T
Sbjct  345  GEKWGEKGYYKICRGRNICGVDSMVSTVAAVST  377



>gb|EYU37835.1| hypothetical protein MIMGU_mgv1a008237mg [Erythranthe guttata]
Length=380

 Score = 67.8 bits (164),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC+KR   GVLLVGYG  GY+PIR+KEKPYWIIKN
Sbjct  307  YICTKRLDHGVLLVGYGETGYSPIRMKEKPYWIIKN  342


 Score = 54.3 bits (129),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRGRNICGVDSMVSTVAAV+T +
Sbjct  345  GPNWGEDGYYKICRGRNICGVDSMVSTVAAVSTTS  379



>ref|XP_010530325.1| PREDICTED: cysteine proteinase RD19a [Tarenaya hassleriana]
Length=370

 Score = 72.4 bits (176),  Expect(2) = 3e-19, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSAGY+PIRLKEKPYWIIKN
Sbjct  297  YICSKRQDHGVLLVGYGSAGYSPIRLKEKPYWIIKN  332


 Score = 48.9 bits (115),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G YKIC GRN+CG+D+MVS+VAAV+T T
Sbjct  335  GANWGEEGYYKICHGRNLCGMDTMVSSVAAVHTST  369



>sp|P05993.1|PAPA5_CARPA RecName: Full=Cysteine proteinase; AltName: Full=Clone PLBPC13, 
partial [Carica papaya]
 emb|CAA27609.1| pot. cysteine proteinase [Carica papaya]
Length=96

 Score = 66.6 bits (161),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICS+R   GVLLVGYGSAGYAPIRLKEKPYW+IKN
Sbjct  23   YICSRRLNHGVLLVGYGSAGYAPIRLKEKPYWVIKN  58


 Score = 54.7 bits (130),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRGRNICGVDSMVSTVAAV+T +
Sbjct  61   GENWGENGYYKICRGRNICGVDSMVSTVAAVHTTS  95



>ref|XP_011092831.1| PREDICTED: cysteine proteinase RD19a-like [Sesamum indicum]
Length=378

 Score = 68.9 bits (167),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            +ICSKR   GVLLVGYG+A YAPIRLKEKPYWIIKN
Sbjct  306  FICSKRLDHGVLLVGYGAASYAPIRLKEKPYWIIKN  341


 Score = 52.0 bits (123),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG N+CGVDSMVSTVAAV+T
Sbjct  344  GENWGENGYYKICRGHNVCGVDSMVSTVAAVST  376



>ref|XP_011045161.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score = 68.2 bits (165),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSK    GVLLVGYG+AGYAPIR KEKP+WIIKN
Sbjct  294  YICSKHQDHGVLLVGYGAAGYAPIRFKEKPFWIIKN  329


 Score = 52.8 bits (125),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVN  209
            G   G  G YKICR RNICGVDSMVSTVAA++
Sbjct  332  GENWGENGYYKICRARNICGVDSMVSTVAAIH  363



>ref|XP_009376976.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=445

 Score = 70.5 bits (171),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICS+R   GVLLVGYG+AGY+PIRLKEKPYWIIKN
Sbjct  370  YICSRRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKN  405


 Score = 50.8 bits (120),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G      G YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  408  GESWRESGFYKICRGRNICGVDSMVSTVAAASVKTN  443



>ref|XP_009351218.1| PREDICTED: cysteine proteinase RD19a-like, partial [Pyrus x bretschneideri]
Length=282

 Score = 68.2 bits (165),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYG+AGY+PIRLKEKPYWIIKN
Sbjct  207  YICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKN  242


 Score = 53.1 bits (126),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  245  GENWGENGFYKICRGRNICGVDSMVSTVAAASVKTN  280



>ref|XP_002280798.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CAN73591.1| hypothetical protein VITISV_022889 [Vitis vinifera]
 emb|CBI19785.3| unnamed protein product [Vitis vinifera]
Length=371

 Score = 66.6 bits (161),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICS     GVLLVGYGSAGY+PIR KEKPYWIIKN
Sbjct  298  YICSSTLDHGVLLVGYGSAGYSPIRFKEKPYWIIKN  333


 Score = 54.3 bits (129),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG NICGVDSMVSTVAA++T
Sbjct  336  GESWGEQGYYKICRGHNICGVDSMVSTVAAIHT  368



>ref|XP_008460996.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=377

 Score = 66.6 bits (161),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICS+    GVLLVGYGS GYAPIR+K+KPYWIIKN
Sbjct  304  YICSRHLDHGVLLVGYGSEGYAPIRMKDKPYWIIKN  339


 Score = 54.3 bits (129),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKICRGRNICGVDSMVSTVAAV+T  +
Sbjct  342  GANWGENGYYKICRGRNICGVDSMVSTVAAVHTAAN  377



>dbj|BAJ53178.1| JHL18I08.12 [Jatropha curcas]
 gb|KDP38578.1| hypothetical protein JCGZ_04503 [Jatropha curcas]
Length=368

 Score = 72.0 bits (175),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSAGYAPIRLK+KP+WIIKN
Sbjct  294  YICSKRQDHGVLLVGYGSAGYAPIRLKDKPFWIIKN  329


 Score = 48.9 bits (115),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVN  209
            G   G  G Y+ICRGRNICGVD+MVS+VAA++
Sbjct  332  GESWGENGYYRICRGRNICGVDAMVSSVAAIH  363



>ref|XP_003540987.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=365

 Score = 65.9 bits (159),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y+CS+R   GVLLVGYGS  YAPIR+KEKP+WIIKN
Sbjct  292  YVCSRRLNHGVLLVGYGSGAYAPIRMKEKPFWIIKN  327


 Score = 55.1 bits (131),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRGRNICGVDSMVSTVA+V+T T
Sbjct  330  GENWGENGYYKICRGRNICGVDSMVSTVASVHTTT  364



>ref|XP_002306900.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
 gb|ABK92924.1| unknown [Populus trichocarpa]
 gb|EEE93896.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
Length=367

 Score = 68.2 bits (165),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSK    GVLLVGYG+AGYAPIR KEKP+WIIKN
Sbjct  294  YICSKHQDHGVLLVGYGAAGYAPIRFKEKPFWIIKN  329


 Score = 52.8 bits (125),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVN  209
            G   G  G YKICR RNICGVDSMVSTVAA++
Sbjct  332  GENWGENGYYKICRARNICGVDSMVSTVAAIH  363



>ref|XP_009376977.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=447

 Score = 69.7 bits (169),  Expect(2) = 6e-19, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICS+R   GVLLVGYG+AGY+PIRLKEKPYWIIKN
Sbjct  372  YICSRRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKN  407


 Score = 50.4 bits (119),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G      G YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  410  GESWRESGFYKICRGRNICGVDSMVSTVAAASVKTN  445



>ref|XP_010061009.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW67908.1| hypothetical protein EUGRSUZ_F01612 [Eucalyptus grandis]
Length=369

 Score = 67.4 bits (163),  Expect(2) = 7e-19, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVLLVGYGSAGYAPIR KEKPYWIIKN
Sbjct  296  YICGKHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKN  331


 Score = 52.8 bits (125),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRGR+ICGVDSMVSTVAA++T
Sbjct  334  GENWGENGYYKICRGRDICGVDSMVSTVAAIHT  366



>ref|XP_010268619.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=369

 Score = 67.8 bits (164),  Expect(2) = 8e-19, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICS+R   GVLLVGYGS GY+PIR+K+KPYWIIKN
Sbjct  296  YICSRRLNHGVLLVGYGSEGYSPIRMKDKPYWIIKN  331


 Score = 52.0 bits (123),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRGR++CGVDSMVSTVAA++T
Sbjct  334  GESWGENGYYKICRGRDVCGVDSMVSTVAAIHT  366



>gb|ABK96252.1| unknown [Populus trichocarpa x Populus deltoides]
Length=156

 Score = 65.5 bits (158),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICS+R   GVLLVGYGSAGY+P+R+KEKP+WIIKN
Sbjct  84   YICSRRLDHGVLLVGYGSAGYSPVRMKEKPFWIIKN  119


 Score = 54.3 bits (129),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G + G  G YKICRGRN+CGVDSMVSTVAAV T +
Sbjct  122  GEKWGENGFYKICRGRNVCGVDSMVSTVAAVQTSS  156



>gb|ABF46642.1| papain-like cysteine proteinase [Pachysandra terminalis]
Length=374

 Score = 69.7 bits (169),  Expect(2) = 9e-19, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 1/37 (3%)
 Frame = +1

Query  1    YICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR L  GVLLVGYGSAG+APIR KEKPYWIIKN
Sbjct  300  YICSKRLLDHGVLLVGYGSAGFAPIRFKEKPYWIIKN  336


 Score = 50.1 bits (118),  Expect(2) = 9e-19, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRGRNICG+DSMVS VAA   PT
Sbjct  339  GESWGEKGYYKICRGRNICGMDSMVSAVAAA-VPT  372



>ref|XP_010105270.1| Cysteine proteinase 15A [Morus notabilis]
 gb|EXC04205.1| Cysteine proteinase 15A [Morus notabilis]
Length=372

 Score = 66.6 bits (161),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 1/37 (3%)
 Frame = +1

Query  1    YICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSK  L  GVLLVGYG+AGYAPIR K+KPYWIIKN
Sbjct  293  YICSKHMLDHGVLLVGYGTAGYAPIRFKDKPYWIIKN  329


 Score = 52.8 bits (125),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVN  209
            G   G  G YKICRGRN+CGVDSMVSTVAA++
Sbjct  332  GENWGEQGYYKICRGRNVCGVDSMVSTVAALH  363



>emb|CAE45588.1| papain-like cysteine proteinase-like protein 1 [Lotus japonicus]
Length=359

 Score = 65.5 bits (158),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y+CSK+   GVLLVGYGS  YAPIR+K+KPYWIIKN
Sbjct  288  YVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKN  323


 Score = 53.5 bits (127),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRGRNICGVDSMVSTVAA++T
Sbjct  326  GENWGENGYYKICRGRNICGVDSMVSTVAALHT  358



>dbj|BAC41322.1| hypothetical protein [Lotus japonicus]
Length=358

 Score = 65.5 bits (158),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y+CSK+   GVLLVGYGS  YAPIR+K+KPYWIIKN
Sbjct  287  YVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKN  322


 Score = 53.9 bits (128),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRGRNICGVDSMVSTVAA++T
Sbjct  325  GENWGENGYYKICRGRNICGVDSMVSTVAALHT  357



>dbj|BAF98584.1| CM0216.500.nc [Lotus japonicus]
Length=360

 Score = 65.5 bits (158),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y+CSK+   GVLLVGYGS  YAPIR+K+KPYWIIKN
Sbjct  287  YVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKN  322


 Score = 53.5 bits (127),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRGRNICGVDSMVSTVAA++T
Sbjct  325  GENWGENGYYKICRGRNICGVDSMVSTVAALHT  357



>gb|KHN25410.1| Cysteine proteinase RD19a [Glycine soja]
Length=365

 Score = 65.9 bits (159),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y+CS+R   GVLLVGYGS  YAPIR+KEKP+WIIKN
Sbjct  292  YVCSRRLNHGVLLVGYGSGAYAPIRMKEKPFWIIKN  327


 Score = 52.8 bits (125),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRGR+ICGVDSMVSTVA+V+T T
Sbjct  330  GENWGENGYYKICRGRSICGVDSMVSTVASVHTTT  364



>ref|XP_009406357.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=372

 Score = 65.1 bits (157),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +    GVLLVGYGSAGY+PIRLK+KP+WIIKN
Sbjct  298  YICGRHLDHGVLLVGYGSAGYSPIRLKQKPFWIIKN  333


 Score = 53.5 bits (127),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRGRN+CGVDSMVSTV A+NT
Sbjct  336  GETWGEKGYYKICRGRNVCGVDSMVSTVTAINT  368



>ref|XP_002275759.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI17456.3| unnamed protein product [Vitis vinifera]
Length=367

 Score = 67.4 bits (163),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICS+    GV+LVGYGSAGYAPIR KEKPYWIIKN
Sbjct  294  YICSRNLDHGVVLVGYGSAGYAPIRFKEKPYWIIKN  329


 Score = 51.2 bits (121),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRG N CGVDSMVSTVAA+ T T
Sbjct  332  GESWGEDGYYKICRGHNACGVDSMVSTVAAIQTTT  366



>emb|CDY34441.1| BnaC01g21920D [Brassica napus]
Length=368

 Score = 69.3 bits (168),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSK    GVLLVG+GS+GYAPIRLKEKPYWIIKN
Sbjct  294  YICSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKN  329


 Score = 49.3 bits (116),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 1/36 (3%)
 Frame = +3

Query  114  GRELGRGGDYKICRGR-NICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRGR NICG+D+MVSTVAAV+T T
Sbjct  332  GSTWGEDGYYKICRGRHNICGMDTMVSTVAAVHTST  367



>ref|XP_009146338.1| PREDICTED: cysteine proteinase 15A-like [Brassica rapa]
 emb|CDY32227.1| BnaA01g17570D [Brassica napus]
Length=368

 Score = 69.3 bits (168),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSK    GVLLVG+GS+GYAPIRLKEKPYWIIKN
Sbjct  294  YICSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKN  329


 Score = 49.3 bits (116),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 1/36 (3%)
 Frame = +3

Query  114  GRELGRGGDYKICRGR-NICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRGR NICG+D+MVSTVAAV+T T
Sbjct  332  GSTWGEDGYYKICRGRHNICGMDTMVSTVAAVHTST  367



>ref|XP_009109502.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
 emb|CDX90310.1| BnaA08g16740D [Brassica napus]
Length=369

 Score = 66.2 bits (160),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +R   GVLLVGYGSAGYAP R KEKPYWIIKN
Sbjct  295  YICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKN  330


 Score = 52.0 bits (123),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKICRGRN+CGVDS+VSTV A  +PT+
Sbjct  333  GETWGENGFYKICRGRNVCGVDSLVSTVTAAVSPTA  368



>gb|AAU81591.1| cysteine proteinase, partial [Petunia x hybrida]
Length=190

 Score = 63.5 bits (153),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 1/36 (3%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGS G+APIR+KEKPYWIIKN
Sbjct  119  YICSKRQDHGVLLVGYGS-GFAPIRMKEKPYWIIKN  153


 Score = 55.1 bits (131),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G + G  G YKICRGRN+CGVDSMVSTVAAV+T +
Sbjct  156  GEKWGESGYYKICRGRNVCGVDSMVSTVAAVSTSS  190



>gb|AAM65162.1| cysteine proteinase RD19A [Arabidopsis thaliana]
Length=368

 Score = 67.0 bits (162),  Expect(2) = 3e-18, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC++R   GVLLVGYG+AGYAP R KEKPYWIIKN
Sbjct  294  YICTRRLNHGVLLVGYGAAGYAPARFKEKPYWIIKN  329


 Score = 51.2 bits (121),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKIC+GRNICGVDSMVSTVAA  + T+
Sbjct  332  GETWGENGFYKICKGRNICGVDSMVSTVAATVSTTA  367



>ref|XP_009602233.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana tomentosiformis]
Length=369

 Score = 63.2 bits (152),  Expect(2) = 3e-18, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 1/36 (3%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYG+ G++PIR+KEKPYWIIKN
Sbjct  297  YICSKRLDHGVLLVGYGT-GFSPIRMKEKPYWIIKN  331


 Score = 55.1 bits (131),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G + G  G YKICRGRN+CGVDSMVSTVAAV+T +
Sbjct  334  GEKWGENGYYKICRGRNVCGVDSMVSTVAAVSTSS  368



>gb|AAR92156.1| putative cysteine protease 3 [Iris x hollandica]
Length=292

 Score = 66.6 bits (161),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVLLVGYGSAGYAPIRLKEKPYWIIKN
Sbjct  217  YICGKHLDHGVLLVGYGSAGYAPIRLKEKPYWIIKN  252


 Score = 51.6 bits (122),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRGRN+CGVDSMVSTV A++T
Sbjct  255  GETWGENGYYKICRGRNVCGVDSMVSTVTAIHT  287



>emb|CAE45589.1| papain-like cysteine proteinase-like protein 2 [Lotus japonicus]
Length=361

 Score = 65.5 bits (158),  Expect(2) = 3e-18, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y+CSK+   GVLLVGYGS  YAPIR+K+KPYWIIKN
Sbjct  288  YVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKN  323


 Score = 52.8 bits (125),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRGRN+CGVDSMVSTVAA++T
Sbjct  326  GENWGENGYYKICRGRNVCGVDSMVSTVAALHT  358



>ref|XP_004291404.1| PREDICTED: cysteine proteinase 15A-like [Fragaria vesca subsp. 
vesca]
Length=365

 Score = 65.5 bits (158),  Expect(2) = 3e-18, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 1/37 (3%)
 Frame = +1

Query  1    YICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K  L  GVLLVGYGS+GYAPIR KEKPYWIIKN
Sbjct  294  YICGKNHLDHGVLLVGYGSSGYAPIRFKEKPYWIIKN  330


 Score = 52.8 bits (125),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G+  G  G YKICRGRN+CGVDSMVSTVAA++T
Sbjct  333  GQSWGEEGYYKICRGRNVCGVDSMVSTVAAMHT  365



>ref|NP_568052.1| cysteine proteinase RD19a [Arabidopsis thaliana]
 sp|P43296.1|RD19A_ARATH RecName: Full=Cysteine proteinase RD19a; Short=RD19; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA02373.1| thiol protease [Arabidopsis thaliana]
 emb|CAB38829.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 emb|CAB80572.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AAL85009.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 gb|AAM91778.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 dbj|BAE98545.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AEE87016.1| cysteine proteinase RD19a [Arabidopsis thaliana]
Length=368

 Score = 67.0 bits (162),  Expect(2) = 3e-18, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC++R   GVLLVGYG+AGYAP R KEKPYWIIKN
Sbjct  294  YICTRRLNHGVLLVGYGAAGYAPARFKEKPYWIIKN  329


 Score = 51.2 bits (121),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKIC+GRNICGVDSMVSTVAA  + T+
Sbjct  332  GETWGENGFYKICKGRNICGVDSMVSTVAATVSTTA  367



>ref|XP_007017672.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOY14897.1| Papain family cysteine protease [Theobroma cacao]
Length=401

 Score = 66.6 bits (161),  Expect(2) = 3e-18, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +    GVLLVGYGSAGYAPIR KEKPYWIIKN
Sbjct  328  YICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKN  363


 Score = 51.2 bits (121),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRGRN+CGVDSMVS+VAA+ T
Sbjct  366  GENWGEEGYYKICRGRNVCGVDSMVSSVAALQT  398



>dbj|BAF46302.1| cysteine proteinase precursor [Ipomoea nil]
Length=369

 Score = 67.8 bits (164),  Expect(2) = 3e-18, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 33/37 (89%), Gaps = 1/37 (3%)
 Frame = +1

Query  1    YICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR L  GVLLVGYG+AGYAPIR K+KPYWI+KN
Sbjct  295  YICSKRNLDHGVLLVGYGAAGYAPIRFKDKPYWIVKN  331


 Score = 50.1 bits (118),  Expect(2) = 3e-18, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG NICG+DSMVSTV A +T
Sbjct  334  GENWGEEGYYKICRGNNICGIDSMVSTVTAAST  366



>gb|AIB06025.1| CP3 [Hevea brasiliensis]
Length=366

 Score = 66.6 bits (161),  Expect(2) = 3e-18, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSK    GVLLVGYG+AGYAPIR K+KP+WIIKN
Sbjct  293  YICSKSQDHGVLLVGYGAAGYAPIRFKDKPFWIIKN  328


 Score = 51.2 bits (121),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRGRNICG+D+MVS+VAA++T
Sbjct  331  GENWGENGYYKICRGRNICGMDAMVSSVAAIHT  363



>ref|XP_008775532.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=371

 Score = 65.1 bits (157),  Expect(2) = 4e-18, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +    GVLLVGYGSA YAPIR KEKPYWIIKN
Sbjct  300  YICGRHLDHGVLLVGYGSAAYAPIRFKEKPYWIIKN  335


 Score = 52.8 bits (125),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G + G  G YKICRGRN+CGVDSMVSTVAAV +
Sbjct  338  GEKWGENGYYKICRGRNVCGVDSMVSTVAAVRS  370



>ref|XP_010531457.1| PREDICTED: probable cysteine proteinase A494 [Tarenaya hassleriana]
Length=364

 Score = 68.2 bits (165),  Expect(2) = 4e-18, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICS+R   GVLLVGYGSAGYAP R+KEKP+WIIKN
Sbjct  293  YICSRRLNHGVLLVGYGSAGYAPARMKEKPFWIIKN  328


 Score = 49.3 bits (116),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAA  203
            G   G  G YKICRGRNICGVDS+VSTVAA
Sbjct  331  GENWGEKGFYKICRGRNICGVDSLVSTVAA  360



>dbj|BAF98585.1| CM0216.510.nc [Lotus japonicus]
Length=360

 Score = 65.1 bits (157),  Expect(2) = 4e-18, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y+CSK+   GVLLVGYGS  YAPIR+K+KPYWIIKN
Sbjct  287  YVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKN  322


 Score = 52.8 bits (125),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRGRN+CGVDSMVSTVAA++T
Sbjct  325  GENWGENGYYKICRGRNVCGVDSMVSTVAALHT  357



>gb|KGN43159.1| Papain-like cysteine proteinase isoform I [Cucumis sativus]
Length=387

 Score = 65.9 bits (159),  Expect(2) = 4e-18, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            +ICSKR   GVLLVGYGSAGYAPIR+++K YWIIKN
Sbjct  304  FICSKRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKN  339


 Score = 52.0 bits (123),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVN  209
            G   G  G YKICRGRNICGVDS+VSTVAAV+
Sbjct  342  GESWGENGYYKICRGRNICGVDSLVSTVAAVH  373



>ref|XP_004148554.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Cucumis sativus]
Length=381

 Score = 65.9 bits (159),  Expect(2) = 4e-18, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            +ICSKR   GVLLVGYGSAGYAPIR+++K YWIIKN
Sbjct  298  FICSKRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKN  333


 Score = 52.0 bits (123),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVN  209
            G   G  G YKICRGRNICGVDS+VSTVAAV+
Sbjct  336  GESWGENGYYKICRGRNICGVDSLVSTVAAVH  367



>ref|XP_004165230.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
Length=387

 Score = 65.9 bits (159),  Expect(2) = 4e-18, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            +ICSKR   GVLLVGYGSAGYAPIR+++K YWIIKN
Sbjct  304  FICSKRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKN  339


 Score = 51.6 bits (122),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVN  209
            G   G  G YKICRGRNICGVDS+VSTVAAV+
Sbjct  342  GESWGENGYYKICRGRNICGVDSLVSTVAAVH  373



>ref|XP_010910124.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=374

 Score = 67.8 bits (164),  Expect(2) = 5e-18, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVLLVGYGSAGYAPIR KEKPYWIIKN
Sbjct  303  YICGKHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKN  338


 Score = 49.7 bits (117),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKIC+GRN+CGVDSMVSTV AV +
Sbjct  341  GENWGEDGYYKICKGRNVCGVDSMVSTVTAVRS  373



>ref|XP_010446443.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score = 67.8 bits (164),  Expect(2) = 7e-18, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC++R   GVLLVGYGSAGYAP R KEKPYWIIKN
Sbjct  293  YICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKN  328


 Score = 49.3 bits (116),  Expect(2) = 7e-18, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAA  203
            G   G  G YKIC+GRNICGVDS+VSTV+A
Sbjct  331  GETWGENGFYKICKGRNICGVDSLVSTVSA  360



>ref|XP_010431862.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score = 67.8 bits (164),  Expect(2) = 7e-18, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC++R   GVLLVGYGSAGYAP R KEKPYWIIKN
Sbjct  293  YICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKN  328


 Score = 49.3 bits (116),  Expect(2) = 7e-18, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAA  203
            G   G  G YKIC+GRNICGVDS+VSTV+A
Sbjct  331  GETWGENGFYKICKGRNICGVDSLVSTVSA  360



>ref|XP_004230928.1| PREDICTED: cysteine proteinase RD19a [Solanum lycopersicum]
Length=369

 Score = 61.6 bits (148),  Expect(2) = 7e-18, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 1/36 (3%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSK+   GVLLVGYG+ G++PIR+KEKPYWIIKN
Sbjct  297  YICSKQLDHGVLLVGYGT-GFSPIRMKEKPYWIIKN  331


 Score = 55.5 bits (132),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G + G  G YKICRGRN+CGVDSMVSTVAAV+T +
Sbjct  334  GEKWGESGYYKICRGRNVCGVDSMVSTVAAVSTSS  368



>ref|XP_010437007.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=368

 Score = 67.8 bits (164),  Expect(2) = 7e-18, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC++R   GVLLVGYGSAGYAP R KEKPYWIIKN
Sbjct  294  YICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKN  329


 Score = 48.9 bits (115),  Expect(2) = 7e-18, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAA  203
            G   G  G YKIC+GRNICGVDS+VSTV+A
Sbjct  332  GETWGENGFYKICKGRNICGVDSLVSTVSA  361



>gb|KFK30492.1| hypothetical protein AALP_AA7G268600 [Arabis alpina]
Length=367

 Score = 67.0 bits (162),  Expect(2) = 7e-18, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC++R   GVLLVGYGSAGYAP R KEKPYWIIKN
Sbjct  293  YICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKN  328


 Score = 49.7 bits (117),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKIC+GRNICGVDS+VSTVAA  + T+
Sbjct  331  GETWGENGFYKICKGRNICGVDSLVSTVAATVSTTA  366



>ref|XP_006283963.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
 gb|EOA16861.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
Length=368

 Score = 67.8 bits (164),  Expect(2) = 8e-18, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC++R   GVLLVGYGSAGYAP R KEKPYWIIKN
Sbjct  294  YICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKN  329


 Score = 48.9 bits (115),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKIC+GRNICGVDS+VSTV+A  + T+
Sbjct  332  GETWGENGFYKICKGRNICGVDSLVSTVSATVSTTA  367



>ref|XP_006362019.1| PREDICTED: cysteine proteinase RD19a-like [Solanum tuberosum]
Length=368

 Score = 61.6 bits (148),  Expect(2) = 8e-18, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 1/36 (3%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSK+   GVLLVGYG+ G++PIR+KEKPYWIIKN
Sbjct  297  YICSKQLDHGVLLVGYGT-GFSPIRMKEKPYWIIKN  331


 Score = 55.1 bits (131),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G + G  G YKICRGRN+CGVDSMVSTVAAV+T +
Sbjct  334  GEKWGENGYYKICRGRNVCGVDSMVSTVAAVSTSS  368



>gb|ABK93575.1| unknown [Populus trichocarpa]
Length=157

 Score = 65.5 bits (158),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSK    GVLLVGYG+AGYAPIR KEKP+WIIKN
Sbjct  84   YICSKHQDHGVLLVGYGAAGYAPIRFKEKPFWIIKN  119


 Score = 50.8 bits (120),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICR RNICGVDSMVSTVAA++ 
Sbjct  122  GENWGENGYYKICRARNICGVDSMVSTVAAIHA  154



>ref|XP_008444769.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=373

 Score = 70.1 bits (170),  Expect(2) = 9e-18, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 1/37 (3%)
 Frame = +1

Query  1    YICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR L  GVLLVGYGSAG+APIR KEKPYWIIKN
Sbjct  300  YICSKRNLDHGVLLVGYGSAGFAPIRFKEKPYWIIKN  336


 Score = 46.2 bits (108),  Expect(2) = 9e-18, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTP  215
            G   G  G Y IC+G+N+CG +SMVS+VAA  TP
Sbjct  339  GENWGENGYYFICKGKNVCGSESMVSSVAAAATP  372



>ref|XP_003589348.1| Cysteine proteinase [Medicago truncatula]
 gb|AES59599.1| papain family cysteine protease [Medicago truncatula]
Length=364

 Score = 62.8 bits (151),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 31/37 (84%), Gaps = 1/37 (3%)
 Frame = +1

Query  1    YICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC+K  L  GVLL+G+G  GYAPIRLKEKPYWIIKN
Sbjct  293  YICAKARLDHGVLLLGFGQGGYAPIRLKEKPYWIIKN  329


 Score = 53.5 bits (127),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G+  G  G YKICRGRN+CGVDSMVSTVAA  +
Sbjct  332  GQNWGEEGYYKICRGRNVCGVDSMVSTVAAAQS  364



>ref|XP_010440192.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=365

 Score = 69.7 bits (169),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y+CSK    GVLLVG+GSAGYAPIRLKEKPYWIIKN
Sbjct  291  YVCSKSQDHGVLLVGFGSAGYAPIRLKEKPYWIIKN  326


 Score = 46.6 bits (109),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 1/36 (3%)
 Frame = +3

Query  114  GRELGRGGDYKICRG-RNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRG  N+CG+DSMVSTVAAV+T T
Sbjct  329  GSMWGEHGYYKICRGPHNVCGMDSMVSTVAAVHTTT  364



>gb|AAL05851.1|AF411121_1 cysteine proteinase precursor [Sandersonia aurantiaca]
Length=360

 Score = 65.9 bits (159),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVLLVGYGSAG+APIR KEKPYWIIKN
Sbjct  288  YICGKHLDHGVLLVGYGSAGFAPIRFKEKPYWIIKN  323


 Score = 50.1 bits (118),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRGRN+CGVDSMVS+V+A +T
Sbjct  326  GENWGENGYYKICRGRNVCGVDSMVSSVSAFHT  358



>emb|CDY71205.1| BnaCnng71840D [Brassica napus]
Length=368

 Score = 66.2 bits (160),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +R   GVLLVGYGSAGYAP R KEKPYWIIKN
Sbjct  294  YICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKN  329


 Score = 50.1 bits (118),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKICRGRN+CGVDS+VSTV A  +P +
Sbjct  332  GETWGEDGFYKICRGRNVCGVDSLVSTVTATVSPAA  367



>emb|CDQ51995.1| Cysteine proteinase, partial [Fagus sylvatica]
Length=165

 Score = 62.8 bits (151),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +    GVLLVG+GSAGYAPIRLKEKP+WIIKN
Sbjct  95   YICGRHLDHGVLLVGFGSAGYAPIRLKEKPFWIIKN  130


 Score = 53.1 bits (126),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVN  209
            G   G  G YKICRGRN+CGVDSMVSTVAA+N
Sbjct  133  GENWGENGYYKICRGRNVCGVDSMVSTVAAIN  164



>gb|AAL60581.1|AF454959_1 senescence-associated cysteine protease [Brassica oleracea]
Length=368

 Score = 66.2 bits (160),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +R   GVLLVGYGSAGYAP R KEKPYWIIKN
Sbjct  294  YICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKN  329


 Score = 50.1 bits (118),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKICRGRN+CGVDS+VSTV A  +P +
Sbjct  332  GETWGEDGFYKICRGRNVCGVDSLVSTVTATVSPAA  367



>ref|XP_006473584.1| PREDICTED: cysteine proteinase 15A-like [Citrus sinensis]
Length=369

 Score = 63.9 bits (154),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVL+VGYGS+G+APIR KEKPYWIIKN
Sbjct  296  YICGKYLDHGVLIVGYGSSGFAPIRFKEKPYWIIKN  331


 Score = 52.4 bits (124),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKIC GRN+CGVDSMVS+VAAV+T +S
Sbjct  334  GENWGENGYYKICMGRNVCGVDSMVSSVAAVHTTSS  369



>ref|XP_003523684.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=366

 Score = 64.7 bits (156),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVLLVGYGS  YAPIR KEKPYWIIKN
Sbjct  293  YICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKN  328


 Score = 51.6 bits (122),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVN  209
            G   G  G YKICRGRN+CGVDSMVSTVAA++
Sbjct  331  GESWGEEGYYKICRGRNVCGVDSMVSTVAAIH  362



>gb|AAD29084.1|AF082181_1 cysteine proteinase precursor [Solanum melongena]
Length=363

 Score = 67.8 bits (164),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  4    ICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            IC KR   GVLLVGYGSAG+APIRLKEKPYWIIKN
Sbjct  289  ICFKRQDHGVLLVGYGSAGFAPIRLKEKPYWIIKN  323


 Score = 48.1 bits (113),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG NICGVD+MVSTV A +T
Sbjct  326  GENWGEHGYYKICRGHNICGVDAMVSTVTATHT  358



>ref|XP_009392632.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=369

 Score = 64.7 bits (156),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +    GVLLVGYGSAGY+PIRLK+KP+WIIKN
Sbjct  295  YICGRHLDHGVLLVGYGSAGYSPIRLKDKPFWIIKN  330


 Score = 51.2 bits (121),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRGRNICGVDSMVS+V+A++T
Sbjct  333  GENWGEHGYYKICRGRNICGVDSMVSSVSAIHT  365



>ref|XP_002868883.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45142.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score = 67.8 bits (164),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC++R   GVLLVGYGSAGYAP R KEKPYWIIKN
Sbjct  294  YICTRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKN  329


 Score = 48.1 bits (113),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKIC+GRNICGVDS+VSTV A  + T+
Sbjct  332  GETWGENGFYKICKGRNICGVDSLVSTVTAAVSTTA  367



>ref|XP_006411706.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
 dbj|BAJ33785.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53159.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
Length=373

 Score = 67.0 bits (162),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC++R   GVLLVGYGSAGYAP R KEKPYWIIKN
Sbjct  299  YICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKN  334


 Score = 48.9 bits (115),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKIC+GRNICGVDS+VSTV+A  + T+
Sbjct  337  GESWGENGFYKICKGRNICGVDSLVSTVSATVSTTA  372



>ref|NP_001241450.1| uncharacterized protein LOC100778716 precursor [Glycine max]
 gb|ACU20049.1| unknown [Glycine max]
Length=366

 Score = 64.7 bits (156),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVLLVGYGS  YAPIR KEKPYWIIKN
Sbjct  293  YICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKN  328


 Score = 51.2 bits (121),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVN  209
            G   G  G YKICRGRN+CGVDSMVSTVAA++
Sbjct  331  GESWGEEGYYKICRGRNVCGVDSMVSTVAAIH  362



>gb|KHN45894.1| Cysteine proteinase RD19a [Glycine soja]
Length=366

 Score = 64.7 bits (156),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVLLVGYGS  YAPIR KEKPYWIIKN
Sbjct  293  YICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKN  328


 Score = 51.2 bits (121),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVN  209
            G   G  G YKICRGRN+CGVDSMVSTVAA++
Sbjct  331  GESWGEEGYYKICRGRNVCGVDSMVSTVAAIH  362



>ref|XP_010449835.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score = 69.7 bits (169),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y+CSK    GVLLVG+GSAGYAPIRLKEKPYWIIKN
Sbjct  291  YVCSKNQDHGVLLVGFGSAGYAPIRLKEKPYWIIKN  326


 Score = 45.8 bits (107),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 1/36 (3%)
 Frame = +3

Query  114  GRELGRGGDYKICRG-RNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRG  N+CG+DSMVSTVAAV+T T
Sbjct  329  GSMWGEHGYYKICRGPHNMCGMDSMVSTVAAVHTTT  364



>ref|XP_008387995.1| PREDICTED: cysteine proteinase 15A [Malus domestica]
Length=365

 Score = 68.6 bits (166),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC KR   GVLLVGYGS+G+APIRLKEKPYWI+KN
Sbjct  292  YICGKRIDHGVLLVGYGSSGFAPIRLKEKPYWILKN  327


 Score = 47.4 bits (111),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G+  G  G YKICRG N CGVDS+VSTVAA++T
Sbjct  330  GQSWGEQGYYKICRGYNSCGVDSLVSTVAALHT  362



>gb|KDO84720.1| hypothetical protein CISIN_1g017548mg [Citrus sinensis]
Length=369

 Score = 63.9 bits (154),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVL+VGYGS+G+APIR KEKPYWIIKN
Sbjct  296  YICGKYLDHGVLIVGYGSSGFAPIRFKEKPYWIIKN  331


 Score = 52.0 bits (123),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKIC GRN+CGVDSMVS+VAA++T +S
Sbjct  334  GENWGENGYYKICMGRNVCGVDSMVSSVAAIHTTSS  369



>ref|XP_010434865.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score = 69.7 bits (169),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y+CSK    GVLLVG+GSAGYAPIRLKEKPYWIIKN
Sbjct  291  YVCSKSQDHGVLLVGFGSAGYAPIRLKEKPYWIIKN  326


 Score = 46.2 bits (108),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 1/36 (3%)
 Frame = +3

Query  114  GRELGRGGDYKICRG-RNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRG  N+CG+DSMVSTVAAV+T T
Sbjct  329  GSMWGEHGYYKICRGPHNMCGMDSMVSTVAAVHTTT  364



>gb|KJB07487.1| hypothetical protein B456_001G026600 [Gossypium raimondii]
Length=377

 Score = 65.1 bits (157),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            +ICSK    GVLLVGYGSAGY+PI LK+KPYWIIKN
Sbjct  304  FICSKHLDHGVLLVGYGSAGYSPIHLKDKPYWIIKN  339


 Score = 50.4 bits (119),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRG N+CGVDS+VSTV A+NT +
Sbjct  342  GENWGENGYYKICRGSNVCGVDSLVSTVVALNTKS  376



>emb|CDP07452.1| unnamed protein product [Coffea canephora]
Length=376

 Score = 69.3 bits (168),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSK    GVLLVGYG+AGYAPIRLK+KPYWIIKN
Sbjct  305  YICSKSQDHGVLLVGYGAAGYAPIRLKDKPYWIIKN  340


 Score = 46.2 bits (108),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 1/34 (3%)
 Frame = +3

Query  114  GRELGRGGDYKICRG-RNICGVDSMVSTVAAVNT  212
            G   G  G YK CR  RN+CGVDSMVS+VAAV+T
Sbjct  343  GENWGENGYYKFCRADRNLCGVDSMVSSVAAVHT  376



>gb|AAQ81938.1| cysteine proteinase precursor [Ipomoea batatas]
Length=371

 Score = 65.9 bits (159),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 1/37 (3%)
 Frame = +1

Query  1    YICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSK+ L  GVL+VGYG+AGYAPIR K+KPYWIIKN
Sbjct  297  YICSKKNLDHGVLIVGYGAAGYAPIRFKDKPYWIIKN  333


 Score = 49.7 bits (117),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG NICGVDSMVS+V A +T
Sbjct  336  GENWGEEGYYKICRGNNICGVDSMVSSVTAAST  368



>ref|XP_008448073.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=385

 Score = 63.9 bits (154),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            +ICS R   GVLLVGYGSAGYAPIR+++K YWIIKN
Sbjct  302  FICSNRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKN  337


 Score = 52.0 bits (123),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVN  209
            G   G  G YKICRGRNICGVDS+VSTVAAV+
Sbjct  340  GENWGENGYYKICRGRNICGVDSLVSTVAAVH  371



>ref|XP_006828787.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
 gb|ERM96203.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
Length=365

 Score = 66.6 bits (161),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 1/37 (3%)
 Frame = +1

Query  1    YICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR L  GVL+VGYGSAGYAPIRLK+K YWIIKN
Sbjct  294  YICSKRNLDHGVLIVGYGSAGYAPIRLKDKAYWIIKN  330


 Score = 48.9 bits (115),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG NICGVDSMVSTVA++ +
Sbjct  333  GETWGEKGYYKICRGHNICGVDSMVSTVASIQS  365



>ref|XP_002280808.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CBI19783.3| unnamed protein product [Vitis vinifera]
Length=365

 Score = 63.2 bits (152),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            +ICS     GVLLVGYGSAGY+PIR KEKPYW++KN
Sbjct  293  FICSTSLNHGVLLVGYGSAGYSPIRFKEKPYWLLKN  328


 Score = 52.4 bits (124),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G+  G  G YKICRG NICGVDSMVSTVAA+ + T
Sbjct  331  GQNWGEHGYYKICRGHNICGVDSMVSTVAAIQSAT  365



>ref|XP_006435090.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
 gb|ESR48330.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
Length=369

 Score = 63.5 bits (153),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVL+VGYGS+G+APIR KEKPYWIIKN
Sbjct  296  YICGKYLDHGVLIVGYGSSGFAPIRFKEKPYWIIKN  331


 Score = 52.0 bits (123),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKIC GRN+CGVDSMVS+VAA++T +S
Sbjct  334  GENWGENGYYKICMGRNVCGVDSMVSSVAAIHTTSS  369



>gb|AJP16692.1| cysteine protease, partial [Striga hermonthica]
Length=148

 Score = 64.7 bits (156),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYG +GYAPIR+K+KPYWIIKN
Sbjct  81   YICSKRLDHGVLLVGYGESGYAPIRMKDKPYWIIKN  116


 Score = 50.8 bits (120),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAA  203
            G   G  G YKICRGRN+CGVDSMVSTVAA
Sbjct  119  GENWGENGYYKICRGRNVCGVDSMVSTVAA  148



>emb|CDY41960.1| BnaA01g05320D [Brassica napus]
Length=367

 Score = 67.4 bits (163),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC++R   GVLLVGYGSAGYAP R KEKPYWIIKN
Sbjct  293  YICTRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKN  328


 Score = 47.8 bits (112),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKIC+GRNICGVDS+VSTV A  + T+
Sbjct  331  GETWGENGFYKICKGRNICGVDSLVSTVTAAVSTTA  366



>emb|CDY09707.1| BnaC07g33540D [Brassica napus]
Length=366

 Score = 67.4 bits (163),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y+CSK    GVLLVG+GSAGYAP+RL+EKPYWIIKN
Sbjct  292  YVCSKNQDHGVLLVGFGSAGYAPLRLEEKPYWIIKN  327


 Score = 48.1 bits (113),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 26/34 (76%), Gaps = 1/34 (3%)
 Frame = +3

Query  114  GRELGRGGDYKICRGR-NICGVDSMVSTVAAVNT  212
            G   G  G YKICRG  NICGVD+MVSTVAAVNT
Sbjct  330  GSMWGEKGYYKICRGTPNICGVDTMVSTVAAVNT  363



>gb|EYU42593.1| hypothetical protein MIMGU_mgv1a008336mg [Erythranthe guttata]
Length=377

 Score = 64.3 bits (155),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            +IC+KR   GVLLVGYG+  +APIR+KEKPYWIIKN
Sbjct  306  FICAKRLDHGVLLVGYGAGAFAPIRMKEKPYWIIKN  341


 Score = 51.2 bits (121),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKIC+GRN+CGVDSMVSTVAAV T
Sbjct  344  GPNWGEKGYYKICQGRNLCGVDSMVSTVAAVTT  376



>ref|XP_007223351.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
 gb|EMJ24550.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
Length=367

 Score = 67.4 bits (163),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC KR   GVLLVGYGS+G+APIR KEKPYWI+KN
Sbjct  294  YICGKRIDHGVLLVGYGSSGFAPIRFKEKPYWILKN  329


 Score = 48.1 bits (113),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 21/33 (64%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G+  G  G YKICRG N CGVDS+VSTVA+++T
Sbjct  332  GQSWGEEGFYKICRGHNSCGVDSLVSTVASLHT  364



>gb|KFK24413.1| hypothetical protein AALP_AAs58848U000200 [Arabis alpina]
Length=372

 Score = 66.6 bits (161),  Expect(2) = 3e-17, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y+CSK    GVLLVG+G +GYAPIRLKEKPYWIIKN
Sbjct  298  YVCSKSQDHGVLLVGFGESGYAPIRLKEKPYWIIKN  333


 Score = 48.5 bits (114),  Expect(2) = 3e-17, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 2/36 (6%)
 Frame = +3

Query  114  GRELGRGGDYKICRGR-NICGVDSMVSTVAAVN-TP  215
            G+  G  G YKICRGR NICG+D+MVSTVAAV  TP
Sbjct  336  GKMWGEHGYYKICRGRHNICGMDTMVSTVAAVQITP  371



>gb|AAU81589.1| cysteine proteinase [Petunia x hybrida]
Length=257

 Score = 64.7 bits (156),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  4    ICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            IC KR   GVLLVGYGSAG+APIRLKEKPYWIIKN
Sbjct  183  ICFKRQDHGVLLVGYGSAGFAPIRLKEKPYWIIKN  217


 Score = 49.7 bits (117),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRGRNICGVD+MVSTV A +T
Sbjct  220  GESWGEQGYYKICRGRNICGVDAMVSTVTAAHT  252



>ref|XP_010672379.1| PREDICTED: cysteine proteinase RD19a-like [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score = 61.6 bits (148),  Expect(2) = 3e-17, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  4    ICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            +C +    GV+LVGYGSAGYAPIR KEKPYWIIKN
Sbjct  302  VCLRSLDHGVVLVGYGSAGYAPIRFKEKPYWIIKN  336


 Score = 52.8 bits (125),  Expect(2) = 3e-17, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVN  209
            G   G  G YKICRG N+CGVDSMVSTVAAVN
Sbjct  339  GPNWGDQGYYKICRGHNVCGVDSMVSTVAAVN  370



>gb|AAO11786.1| pre-pro cysteine proteinase [Vicia faba]
Length=363

 Score = 60.8 bits (146),  Expect(2) = 3e-17, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 1/37 (3%)
 Frame = +1

Query  1    YICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y+C+K  L  GVLLVG+G   YAPIRLKEKPYWI+KN
Sbjct  290  YVCAKSRLDHGVLLVGFGKGAYAPIRLKEKPYWIVKN  326


 Score = 53.5 bits (127),  Expect(2) = 3e-17, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G+  G  G YKICRGRN+CGVDSMVSTVAA  +
Sbjct  329  GQNWGEQGYYKICRGRNVCGVDSMVSTVAAAQS  361



>ref|XP_009150026.1| PREDICTED: cysteine proteinase RD19a [Brassica rapa]
Length=367

 Score = 66.6 bits (161),  Expect(2) = 4e-17, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC++R   GVLLVGYGSAGYAP R KE+PYWIIKN
Sbjct  293  YICTRRLNHGVLLVGYGSAGYAPARFKERPYWIIKN  328


 Score = 47.8 bits (112),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKIC+GRNICGVDS+VSTV A  + T+
Sbjct  331  GETWGENGFYKICKGRNICGVDSLVSTVTAAVSTTA  366



>gb|AAB67878.1| pre-pro-cysteine proteinase [Vicia faba]
Length=363

 Score = 60.8 bits (146),  Expect(2) = 4e-17, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 1/37 (3%)
 Frame = +1

Query  1    YICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y+C+K  L  GVLLVG+G   YAPIRLKEKPYWI+KN
Sbjct  290  YVCAKSRLDHGVLLVGFGKGAYAPIRLKEKPYWIVKN  326


 Score = 53.5 bits (127),  Expect(2) = 4e-17, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G+  G  G YKICRGRN+CGVDSMVSTVAA  +
Sbjct  329  GQNWGEQGYYKICRGRNVCGVDSMVSTVAAAQS  361



>ref|XP_007160702.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
 gb|ESW32696.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
Length=365

 Score = 62.4 bits (150),  Expect(2) = 4e-17, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVLLVGYG   YAPIR KEKPYWIIKN
Sbjct  292  YICGKHLDHGVLLVGYGEGAYAPIRFKEKPYWIIKN  327


 Score = 52.0 bits (123),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRGRN+CGVDSMVSTV A++  T
Sbjct  330  GENWGENGYYKICRGRNVCGVDSMVSTVGAIHAST  364



>gb|KHN22211.1| Cysteine proteinase 15A [Glycine soja]
Length=366

 Score = 64.7 bits (156),  Expect(2) = 4e-17, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVLLVGYGS  YAPIR KEKPYWIIKN
Sbjct  293  YICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKN  328


 Score = 49.7 bits (117),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVN  209
            G   G  G Y ICRGRN+CGVDSMVSTVAA++
Sbjct  331  GESWGEEGYYNICRGRNVCGVDSMVSTVAAIH  362



>emb|CAA82995.1| cysteine proteinase [Vicia sativa]
Length=358

 Score = 60.8 bits (146),  Expect(2) = 4e-17, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 1/37 (3%)
 Frame = +1

Query  1    YICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y+C+K  L  GVLLVG+G   YAPIRLKEKPYWIIKN
Sbjct  285  YVCAKARLDHGVLLVGFGKGAYAPIRLKEKPYWIIKN  321


 Score = 53.5 bits (127),  Expect(2) = 4e-17, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G+  G  G YKICRGRN+CGVDSMVSTVAA  +
Sbjct  324  GQNWGEQGYYKICRGRNVCGVDSMVSTVAAAQS  356



>ref|XP_004152668.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004167370.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN62647.1| Cysteine protease [Cucumis sativus]
Length=371

 Score = 70.5 bits (171),  Expect(2) = 4e-17, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 1/37 (3%)
 Frame = +1

Query  1    YICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR L  GVLLVGYG+AG+APIRLKEKPYWIIKN
Sbjct  300  YICSKRNLDHGVLLVGYGAAGFAPIRLKEKPYWIIKN  336


 Score = 43.9 bits (102),  Expect(2) = 4e-17, Method: Composition-based stats.
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAV  206
            G   G  G Y IC+G+NICG +SMVS+VAA+
Sbjct  339  GENWGENGYYFICKGKNICGSESMVSSVAAI  369



>dbj|BAF03553.1| cysteine proteinase CP2 [Phaseolus vulgaris]
Length=365

 Score = 62.0 bits (149),  Expect(2) = 5e-17, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVLLVGYG   YAPIR KEKPYWIIKN
Sbjct  292  YICGKHLDHGVLLVGYGEGAYAPIRFKEKPYWIIKN  327


 Score = 52.0 bits (123),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRGRN+CGVDSMVSTV A++  T
Sbjct  330  GENWGENGYYKICRGRNVCGVDSMVSTVGAIHAST  364



>gb|AGV54334.1| cysteine proteinase RD19a-like protein [Phaseolus vulgaris]
Length=366

 Score = 61.6 bits (148),  Expect(2) = 5e-17, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVLLVGYG+  YAPIR KEKP+WIIKN
Sbjct  293  YICGKHLDHGVLLVGYGAGAYAPIRFKEKPFWIIKN  328


 Score = 52.4 bits (124),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRG N+CGVDSMVSTVAA++T +
Sbjct  331  GESWGENGYYKICRGHNVCGVDSMVSTVAAIHTSS  365



>ref|XP_011083631.1| PREDICTED: cysteine proteinase 15A-like [Sesamum indicum]
Length=371

 Score = 67.8 bits (164),  Expect(2) = 5e-17, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVLLVGYG+AGYAPIRLKEKPYWIIKN
Sbjct  298  YICGKHLDHGVLLVGYGAAGYAPIRLKEKPYWIIKN  333


 Score = 46.2 bits (108),  Expect(2) = 5e-17, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 1/35 (3%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVN-TP  215
            G   G  G YKICRG N+CGV SMVSTV A + TP
Sbjct  336  GENWGENGYYKICRGHNVCGVASMVSTVTAAHVTP  370



>ref|XP_008221329.1| PREDICTED: cysteine proteinase 15A-like [Prunus mume]
Length=366

 Score = 67.4 bits (163),  Expect(2) = 5e-17, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC KR   GVLLVGYGS+G+APIR KEKPYWI+KN
Sbjct  293  YICGKRIDHGVLLVGYGSSGFAPIRFKEKPYWILKN  328


 Score = 46.6 bits (109),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G+  G  G YKICRG N CGVDS+VSTVA+++T
Sbjct  331  GQSWGEEGYYKICRGHNPCGVDSLVSTVASLHT  363



>ref|XP_007136047.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
 gb|ESW08041.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
Length=366

 Score = 61.6 bits (148),  Expect(2) = 5e-17, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVLLVGYG+  YAPIR KEKP+WIIKN
Sbjct  293  YICGKHLDHGVLLVGYGAGAYAPIRFKEKPFWIIKN  328


 Score = 52.4 bits (124),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRG N+CGVDSMVSTVAA++T +
Sbjct  331  GESWGENGYYKICRGHNVCGVDSMVSTVAAIHTSS  365



>ref|NP_001266121.1| uncharacterized protein LOC101501911 precursor [Cicer arietinum]
 emb|CAA08906.1| cysteine proteinase [Cicer arietinum]
Length=362

 Score = 58.5 bits (140),  Expect(2) = 5e-17, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 2/37 (5%)
 Frame = +1

Query  1    YICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC+K  L  GVLLVG+G+ G+APIRLKEKPYWIIKN
Sbjct  289  YICAKSRLDHGVLLVGFGN-GFAPIRLKEKPYWIIKN  324


 Score = 55.5 bits (132),  Expect(2) = 5e-17, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVN  209
            G+  G  G YKICRGRNICGVDSMVSTVAAV+
Sbjct  327  GQNWGEEGYYKICRGRNICGVDSMVSTVAAVH  358



>ref|XP_006414378.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
 gb|ESQ55831.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
Length=367

 Score = 67.8 bits (164),  Expect(2) = 5e-17, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y+CSK    GVLLVG+GS+GY+PIRLKEKPYWIIKN
Sbjct  293  YVCSKSQDHGVLLVGFGSSGYSPIRLKEKPYWIIKN  328


 Score = 46.2 bits (108),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 1/36 (3%)
 Frame = +3

Query  114  GRELGRGGDYKICRG-RNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRG  NICG+D+MVSTVAAV T T
Sbjct  331  GSMWGEHGYYKICRGSHNICGMDTMVSTVAAVQTST  366



>ref|XP_009405542.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=366

 Score = 62.8 bits (151),  Expect(2) = 5e-17, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVLLVGYGSAGYAP R KEK YWIIKN
Sbjct  296  YICGKHLNHGVLLVGYGSAGYAPARFKEKSYWIIKN  331


 Score = 51.2 bits (121),  Expect(2) = 5e-17, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAV  206
            G   G  G YKICRGRNICGVDSMVS+V A+
Sbjct  334  GENWGENGYYKICRGRNICGVDSMVSSVTAI  364



>gb|AJA74415.1| cysteine protease [Cicer arietinum]
Length=358

 Score = 58.5 bits (140),  Expect(2) = 5e-17, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 2/37 (5%)
 Frame = +1

Query  1    YICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC+K  L  GVLLVG+G+ G+APIRLKEKPYWIIKN
Sbjct  285  YICAKSRLDHGVLLVGFGN-GFAPIRLKEKPYWIIKN  320


 Score = 55.5 bits (132),  Expect(2) = 5e-17, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVN  209
            G+  G  G YKICRGRNICGVDSMVSTVAAV+
Sbjct  323  GQNWGEEGYYKICRGRNICGVDSMVSTVAAVH  354



>ref|XP_006283974.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
 gb|EOA16872.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
Length=365

 Score = 68.9 bits (167),  Expect(2) = 5e-17, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y+CSK    GVLLVG+GS+GYAPIRLKEKPYWIIKN
Sbjct  291  YVCSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKN  326


 Score = 45.1 bits (105),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 1/36 (3%)
 Frame = +3

Query  114  GRELGRGGDYKICRG-RNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRG  N+CG+D+MVSTVAAV+T T
Sbjct  329  GSMWGEHGYYKICRGPHNMCGMDTMVSTVAAVHTTT  364



>ref|XP_003550405.2| PREDICTED: cysteine proteinase 15A [Glycine max]
Length=392

 Score = 59.3 bits (142),  Expect(2) = 6e-17, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVLLVGYG   YAPIR K KPYWIIKN
Sbjct  319  YICGKHLDHGVLLVGYGEGAYAPIRFKNKPYWIIKN  354


 Score = 54.3 bits (129),  Expect(2) = 6e-17, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAV  206
            G   G  G YKICRGRN+CGVDSMVSTVAA+
Sbjct  357  GESWGENGYYKICRGRNVCGVDSMVSTVAAI  387



>dbj|BAD43619.1| putative cysteine proteinase [Arabidopsis thaliana]
Length=361

 Score = 63.9 bits (154),  Expect(2) = 6e-17, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICS+R   GVLLVGYGSAG++  RLKEKPYWIIKN
Sbjct  291  YICSRRLNHGVLLVGYGSAGFSQARLKEKPYWIIKN  326


 Score = 49.7 bits (117),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKIC+GRNICGVDS+VSTVAA  +
Sbjct  329  GESWGENGFYKICKGRNICGVDSLVSTVAATTS  361



>ref|XP_009335626.1| PREDICTED: cysteine proteinase 15A [Pyrus x bretschneideri]
Length=366

 Score = 66.6 bits (161),  Expect(2) = 6e-17, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC KR   GVLLVGYGS+G+APIR KEKPYWI+KN
Sbjct  293  YICGKRIDHGVLLVGYGSSGFAPIRFKEKPYWILKN  328


 Score = 47.0 bits (110),  Expect(2) = 6e-17, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVN  209
            G+  G  G YKICRG N CGVDS+VSTVAA++
Sbjct  331  GQSWGEQGYYKICRGYNSCGVDSLVSTVAALH  362



>ref|NP_565512.1| Papain family cysteine protease [Arabidopsis thaliana]
 sp|P43295.2|A494_ARATH RecName: Full=Probable cysteine proteinase A494; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD23687.1| cysteine proteinase [Arabidopsis thaliana]
 gb|ABJ98563.1| At2g21430 [Arabidopsis thaliana]
 gb|AEC07177.1| Papain family cysteine protease [Arabidopsis thaliana]
Length=361

 Score = 63.9 bits (154),  Expect(2) = 6e-17, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICS+R   GVLLVGYGSAG++  RLKEKPYWIIKN
Sbjct  291  YICSRRLNHGVLLVGYGSAGFSQARLKEKPYWIIKN  326


 Score = 49.7 bits (117),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKIC+GRNICGVDS+VSTVAA  +
Sbjct  329  GESWGENGFYKICKGRNICGVDSLVSTVAATTS  361



>ref|XP_009136751.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
Length=368

 Score = 67.4 bits (163),  Expect(2) = 7e-17, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y+CSK    GVLLVG+GSAGYAP+RL+EKPYWIIKN
Sbjct  294  YVCSKNQDHGVLLVGFGSAGYAPLRLEEKPYWIIKN  329


 Score = 45.8 bits (107),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 26/34 (76%), Gaps = 1/34 (3%)
 Frame = +3

Query  114  GRELGRGGDYKICRGR-NICGVDSMVSTVAAVNT  212
            G   G  G YKICRG  NICGVD+MVSTVAAV+T
Sbjct  332  GSMWGEKGYYKICRGTPNICGVDTMVSTVAAVHT  365



>dbj|BAD94010.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
Length=86

 Score = 62.4 bits (150),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC++R   GVLLVGYG+AGYAP R KEKPYWIIKN
Sbjct  12   YICTRRLNHGVLLVGYGAAGYAPARFKEKPYWIIKN  47


 Score = 50.8 bits (120),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKIC+GRNICGVDSMVSTVAA  + T+
Sbjct  50   GETWGENGFYKICKGRNICGVDSMVSTVAATVSTTA  85



>emb|CDX90537.1| BnaA03g42440D [Brassica napus]
Length=366

 Score = 67.4 bits (163),  Expect(2) = 8e-17, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y+CSK    GVLLVG+GSAGYAP+RL+EKPYWIIKN
Sbjct  292  YVCSKNQDHGVLLVGFGSAGYAPLRLEEKPYWIIKN  327


 Score = 45.8 bits (107),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 26/34 (76%), Gaps = 1/34 (3%)
 Frame = +3

Query  114  GRELGRGGDYKICRGR-NICGVDSMVSTVAAVNT  212
            G   G  G YKICRG  NICGVD+MVSTVAAV+T
Sbjct  330  GSMWGEKGYYKICRGTPNICGVDTMVSTVAAVHT  363



>emb|CAB17075.1| cysteine proteinase precursor [Phaseolus vulgaris]
Length=365

 Score = 62.0 bits (149),  Expect(2) = 9e-17, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVLLVGYG   YAPIR KEKPYWIIKN
Sbjct  292  YICGKHLDHGVLLVGYGEGAYAPIRFKEKPYWIIKN  327


 Score = 50.8 bits (120),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRGRN+CGVDSMVSTV A++  T
Sbjct  330  GENWGGNGYYKICRGRNVCGVDSMVSTVGAIHAST  364



>sp|P25804.1|CYSP_PEA RecName: Full=Cysteine proteinase 15A; AltName: Full=Turgor-responsive 
protein 15A; Flags: Precursor [Pisum sativum]
 emb|CAA38242.1| unnamed protein product [Pisum sativum]
Length=363

 Score = 61.6 bits (148),  Expect(2) = 9e-17, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 1/37 (3%)
 Frame = +1

Query  1    YICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y+C+K  L  GVLLVG+G   YAPIRLKEKPYWIIKN
Sbjct  290  YVCAKSRLDHGVLLVGFGKGAYAPIRLKEKPYWIIKN  326


 Score = 51.6 bits (122),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G+  G  G YKICRGRN+CGVDSMVSTVAA  +
Sbjct  329  GQNWGEQGYYKICRGRNVCGVDSMVSTVAAAQS  361



>gb|ACK57563.1| cysteine protease-like protein [Arachis hypogaea]
Length=364

 Score = 64.3 bits (155),  Expect(2) = 9e-17, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            +IC K    GVLLVGYG+ GYAPIR KEKPYWIIKN
Sbjct  291  FICGKHLDHGVLLVGYGAGGYAPIRFKEKPYWIIKN  326


 Score = 48.9 bits (115),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG N+CGVDSMVSTV A++T
Sbjct  329  GENWGENGYYKICRGPNMCGVDSMVSTVIAIHT  361



>gb|AAL69389.1|AF462226_1 putative cysteine proteinase [Narcissus pseudonarcissus]
Length=136

 Score = 60.8 bits (146),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVLLVGYGS+G+APIR KEKPYWIIKN
Sbjct  62   YICGKHLDHGVLLVGYGSSGWAPIRFKEKPYWIIKN  97


 Score = 52.0 bits (123),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTSD  224
            G   G  G YKIC+GRN+CGVDSMVSTV A++T   D
Sbjct  100  GENWGEKGYYKICKGRNVCGVDSMVSTVTAIHTTPKD  136



>dbj|BAA92495.1| cysteine protease [Vigna mungo]
Length=364

 Score = 63.9 bits (154),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC+KR   GV +VGYG +GYAPIR KEKPYWIIKN
Sbjct  291  YICAKRLDHGVQIVGYGESGYAPIRFKEKPYWIIKN  326


 Score = 48.9 bits (115),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVN  209
            G   G  G YKICRG+N CGVDSMVSTV A++
Sbjct  329  GESWGENGYYKICRGQNACGVDSMVSTVGAIH  360



>ref|XP_002880378.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56637.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score = 63.2 bits (152),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICS+R   GVLL+GYGS+GY+  RLKEKPYWIIKN
Sbjct  290  YICSRRLNHGVLLMGYGSSGYSQARLKEKPYWIIKN  325


 Score = 49.3 bits (116),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKIC+GRNICGVDS+VSTVAA  +
Sbjct  328  GESWGENGFYKICKGRNICGVDSLVSTVAAATS  360



>ref|XP_004238314.1| PREDICTED: cysteine proteinase 15A [Solanum lycopersicum]
Length=363

 Score = 63.5 bits (153),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  4    ICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            IC KR   GVLLVGYGS G+APIRLK KPYWIIKN
Sbjct  289  ICFKRQDHGVLLVGYGSEGFAPIRLKNKPYWIIKN  323


 Score = 48.9 bits (115),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G+  G  G YKICRG NICGVD+MVSTV A +T
Sbjct  326  GKTWGEHGYYKICRGHNICGVDAMVSTVTATHT  358



>gb|KJB58164.1| hypothetical protein B456_009G197400 [Gossypium raimondii]
Length=375

 Score = 65.5 bits (158),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVLLVGYGSAGYAP+R K KPYWIIKN
Sbjct  297  YICGKHLDHGVLLVGYGSAGYAPVRFKNKPYWIIKN  332


 Score = 47.0 bits (110),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVN  209
            G   G  G YKICRG N+CGVDSMVS+V+A++
Sbjct  335  GENWGENGYYKICRGNNVCGVDSMVSSVSALH  366



>ref|XP_008775280.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=368

 Score = 66.2 bits (160),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +    GVLLVGYGSAGYAPIR K+KPYWIIKN
Sbjct  298  YICGRHLDHGVLLVGYGSAGYAPIRFKDKPYWIIKN  333


 Score = 46.6 bits (109),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAV  206
            G   G  G YKICRG NICGV+SMVSTV A+
Sbjct  336  GENWGEDGYYKICRGHNICGVESMVSTVTAI  366



>ref|XP_006341997.1| PREDICTED: cysteine proteinase 15A-like [Solanum tuberosum]
Length=376

 Score = 63.5 bits (153),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  4    ICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            IC KR   GVLLVGYGS G+APIRLK KPYWIIKN
Sbjct  302  ICLKRQDHGVLLVGYGSEGFAPIRLKNKPYWIIKN  336


 Score = 48.9 bits (115),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G+  G  G YKICRG NICGVD+MVSTV A +T
Sbjct  339  GKTWGEHGYYKICRGHNICGVDAMVSTVTATHT  371



>emb|CDX99593.1| BnaC04g33500D [Brassica napus]
Length=343

 Score = 64.3 bits (155),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSAG++  R KEKPYWIIKN
Sbjct  274  YICSKRLNHGVLLVGYGSAGFSQARFKEKPYWIIKN  309


 Score = 48.1 bits (113),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAV  206
            G   G  G YK+C+GRN+CGVDSMVSTVAA 
Sbjct  312  GETWGENGFYKLCKGRNVCGVDSMVSTVAAA  342



>ref|XP_010943608.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=371

 Score = 64.3 bits (155),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +    GVLLVGYGSAGYAPIR K+KPYWIIKN
Sbjct  300  YICGRHLDHGVLLVGYGSAGYAPIRFKDKPYWIIKN  335


 Score = 48.1 bits (113),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG+NICGV+SMVSTV AV T
Sbjct  338  GGNWGEDGYYKICRGQNICGVESMVSTVTAVRT  370



>ref|XP_003545051.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=367

 Score = 58.5 bits (140),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVL+VGYG   YAPIR K KPYWIIKN
Sbjct  294  YICGKHLDHGVLIVGYGEGAYAPIRFKNKPYWIIKN  329


 Score = 53.9 bits (128),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAV  206
            G   G  G YKICRGRN+CGVDSMVSTVAA+
Sbjct  332  GESWGENGYYKICRGRNVCGVDSMVSTVAAI  362



>ref|XP_009140277.1| PREDICTED: probable cysteine proteinase A494 [Brassica rapa]
Length=362

 Score = 64.3 bits (155),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSAG++  R KEKPYWIIKN
Sbjct  293  YICSKRLNHGVLLVGYGSAGFSQARFKEKPYWIIKN  328


 Score = 48.1 bits (113),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAV  206
            G   G  G YK+C+GRN+CG+DSMVSTVAA 
Sbjct  331  GETWGENGFYKLCKGRNVCGIDSMVSTVAAA  361



>emb|CAA52403.1| putative thiol protease [Arabidopsis thaliana]
Length=313

 Score = 62.8 bits (151),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICS+R   GVLLVGYGSAG++  RLKEKPYWIIKN
Sbjct  243  YICSRRLNHGVLLVGYGSAGFSQARLKEKPYWIIKN  278


 Score = 49.3 bits (116),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKIC+GRNICGVDS+VSTVAA  +
Sbjct  281  GESWGENGFYKICKGRNICGVDSLVSTVAATTS  313



>emb|CDY15894.1| BnaA04g12170D [Brassica napus]
Length=362

 Score = 64.3 bits (155),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGSAG++  R KEKPYWIIKN
Sbjct  293  YICSKRLNHGVLLVGYGSAGFSQARFKEKPYWIIKN  328


 Score = 47.8 bits (112),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAV  206
            G   G  G YK+C+GRN+CG+DSMVSTVAA 
Sbjct  331  GETWGENGFYKLCKGRNVCGIDSMVSTVAAA  361



>gb|ACX54787.2| cysteine protease [Arachis diogoi]
Length=360

 Score = 63.9 bits (154),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVLLVGYG+AGYAPIR K+KP+WIIKN
Sbjct  285  YICGKNLDHGVLLVGYGAAGYAPIRFKDKPFWIIKN  320


 Score = 48.1 bits (113),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTSD  224
            G   G  G YKICRG+N+CGVDSMVS+V A    +S+
Sbjct  323  GESWGEDGYYKICRGKNVCGVDSMVSSVVATTFTSSN  359



>gb|ACM80348.1| cysteine proteinase [Solanum lycopersicum]
Length=368

 Score = 61.6 bits (148),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 1/36 (3%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSK+   GVLLVGYG+ G++PIR+KEKPYWIIKN
Sbjct  297  YICSKQLDHGVLLVGYGT-GFSPIRMKEKPYWIIKN  331


 Score = 50.4 bits (119),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G + G  G YKI RGRN+CGVDSMVSTVAAV+T +
Sbjct  334  GEKWGESGYYKIRRGRNVCGVDSMVSTVAAVSTSS  368



>gb|KJB29611.1| hypothetical protein B456_005G110200 [Gossypium raimondii]
Length=370

 Score = 60.8 bits (146),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +    GVLLVGYG+AGY+PIR K+KP+WIIKN
Sbjct  297  YICFRTLDHGVLLVGYGAAGYSPIRFKDKPFWIIKN  332


 Score = 51.2 bits (121),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRGRN+CGVDSMVS+VAA++T +
Sbjct  335  GANWGEDGYYKICRGRNVCGVDSMVSSVAALHTKS  369



>emb|CAA78365.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=365

 Score = 62.0 bits (149),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  4    ICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            IC KR   GVLLVGYGS G+APIRLKEK YWIIKN
Sbjct  291  ICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKN  325


 Score = 49.7 bits (117),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG NICGVD+MVSTV A +T
Sbjct  328  GENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  360



>emb|CAA78361.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=363

 Score = 62.0 bits (149),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  4    ICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            IC KR   GVLLVGYGS G+APIRLKEK YWIIKN
Sbjct  289  ICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKN  323


 Score = 49.7 bits (117),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG NICGVD+MVSTV A +T
Sbjct  326  GENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  358



>ref|XP_009611293.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana tomentosiformis]
 emb|CAB44983.1| putative preprocysteine proteinase [Nicotiana tabacum]
Length=363

 Score = 62.0 bits (149),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  4    ICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            IC KR   GVLLVGYGS G+APIRLKEK YWIIKN
Sbjct  289  ICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKN  323


 Score = 49.7 bits (117),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG NICGVD+MVSTV A +T
Sbjct  326  GENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  358



>ref|NP_567489.1| papain family cysteine protease [Arabidopsis thaliana]
 emb|CAB10398.1| cysteine proteinase like protein [Arabidopsis thaliana]
 emb|CAB78661.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AAK62611.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM91059.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM96982.1| cysteine proteinase [Arabidopsis thaliana]
 gb|AAN31875.1| putative cysteine proteinase [Arabidopsis thaliana]
 dbj|BAE98514.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AEE83713.1| papain family cysteine protease [Arabidopsis thaliana]
Length=373

 Score = 68.6 bits (166),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y+CSK    GVLLVG+GS+GYAPIRLKEKPYWIIKN
Sbjct  299  YVCSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKN  334


 Score = 43.1 bits (100),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 1/34 (3%)
 Frame = +3

Query  114  GRELGRGGDYKICRG-RNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG  N+CG+D+MVSTVAAV+T
Sbjct  337  GAMWGEHGYYKICRGPHNMCGMDTMVSTVAAVHT  370



>emb|CAB53397.1| cysteine protease [Medicago sativa]
Length=209

 Score = 60.8 bits (146),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 1/37 (3%)
 Frame = +1

Query  1    YICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            +IC+K  L  GVLLVG+GS GYAPIRLKEKPYWIIKN
Sbjct  138  HICAKARLDHGVLLVGFGSGGYAPIRLKEKPYWIIKN  174


 Score = 50.8 bits (120),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G+  G  G YKICRGRN+CGVDSMVSTVAA  +
Sbjct  177  GQNWGEEGYYKICRGRNVCGVDSMVSTVAAAQS  209



>ref|XP_002870174.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46433.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
Length=373

 Score = 68.2 bits (165),  Expect(2) = 3e-16, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y+CSK    GVLLVG+GS+GYAPIRLKEKPYWIIKN
Sbjct  299  YVCSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKN  334


 Score = 43.5 bits (101),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 1/34 (3%)
 Frame = +3

Query  114  GRELGRGGDYKICRG-RNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG  N+CG+D+MVSTVAAV+T
Sbjct  337  GAMWGEHGYYKICRGPHNMCGMDTMVSTVAAVHT  370



>ref|XP_006404590.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
 gb|ESQ46043.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
Length=363

 Score = 63.9 bits (154),  Expect(2) = 3e-16, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICS+R   GVLLVGYGSAG+A  RLK+KPYWIIKN
Sbjct  294  YICSRRLNHGVLLVGYGSAGFAQARLKKKPYWIIKN  329


 Score = 47.0 bits (110),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVA  200
            G   G  G YK+CRGRNICGVDS+VSTVA
Sbjct  332  GETWGENGYYKLCRGRNICGVDSLVSTVA  360



>gb|ABK24153.1| unknown [Picea sitchensis]
Length=394

 Score = 60.8 bits (146),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 1/37 (3%)
 Frame = +1

Query  1    YICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y+C+K+ L  GVLLVGYG+AGYAP RLK KP+WIIKN
Sbjct  318  YVCNKQNLDHGVLLVGYGAAGYAPGRLKNKPFWIIKN  354


 Score = 50.1 bits (118),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTSD  224
            G + G  G YK+CRG N+CG+++MVSTVAA N  T D
Sbjct  357  GPDWGEDGYYKLCRGHNVCGINTMVSTVAAANIQTDD  393



>gb|KHG15062.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=370

 Score = 60.8 bits (146),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +    GVLLVGYG+AGY+PIR K+KP+WIIKN
Sbjct  297  YICFRTLDHGVLLVGYGAAGYSPIRFKDKPFWIIKN  332


 Score = 50.1 bits (118),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G Y+ICRGRN+CGVDSMVS+VAA++T +
Sbjct  335  GANWGEDGYYRICRGRNVCGVDSMVSSVAALHTKS  369



>gb|ABK24688.1| unknown [Picea sitchensis]
 gb|ACN39791.1| unknown [Picea sitchensis]
 gb|ACN40241.1| unknown [Picea sitchensis]
Length=366

 Score = 64.7 bits (156),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 1/37 (3%)
 Frame = +1

Query  1    YICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y+CSKR L  GVLLVGYG+A +APIR+K+KPYW+IKN
Sbjct  297  YVCSKRNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKN  333


 Score = 46.2 bits (108),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAV  206
            G   G  G YK+CRG N+CG+++MVSTVAA+
Sbjct  336  GPNWGENGYYKLCRGHNVCGINNMVSTVAAI  366



>gb|ABK21238.1| unknown [Picea sitchensis]
 gb|ABR16087.1| unknown [Picea sitchensis]
 gb|ABR17330.1| unknown [Picea sitchensis]
 gb|ABR17545.1| unknown [Picea sitchensis]
 gb|ACN40765.1| unknown [Picea sitchensis]
Length=366

 Score = 64.7 bits (156),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 1/37 (3%)
 Frame = +1

Query  1    YICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y+CSKR L  GVLLVGYG+A +APIR+K+KPYW+IKN
Sbjct  297  YVCSKRNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKN  333


 Score = 46.2 bits (108),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAV  206
            G   G  G YK+CRG N+CG+++MVSTVAA+
Sbjct  336  GPNWGENGYYKLCRGHNVCGINNMVSTVAAI  366



>gb|ACN40679.1| unknown [Picea sitchensis]
Length=366

 Score = 64.7 bits (156),  Expect(2) = 5e-16, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 1/37 (3%)
 Frame = +1

Query  1    YICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y+CSKR L  GVLLVGYG+A +APIR+K+KPYW+IKN
Sbjct  297  YVCSKRNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKN  333


 Score = 45.8 bits (107),  Expect(2) = 5e-16, Method: Composition-based stats.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAV  206
            G   G  G YK+CRG N+CG+++MVSTVAA+
Sbjct  336  GPNWGENGYYKLCRGHNVCGINNMVSTVAAI  366



>gb|AAK07731.1| CPR2-like cysteine proteinase [Nicotiana tabacum]
Length=363

 Score = 62.0 bits (149),  Expect(2) = 5e-16, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  4    ICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            IC KR   GVLLVGYGS G+APIRLKEK YWIIKN
Sbjct  289  ICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKN  323


 Score = 48.5 bits (114),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG NICGVD+MVSTV A +T
Sbjct  326  GENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  358



>emb|CAA78403.1| pre-pro-cysteine proteinase [Solanum lycopersicum]
Length=361

 Score = 63.5 bits (153),  Expect(2) = 5e-16, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  4    ICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            IC KR   GVLLVGYGS G+APIRLK KPYWIIKN
Sbjct  287  ICFKRQDHGVLLVGYGSEGFAPIRLKNKPYWIIKN  321


 Score = 47.0 bits (110),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G+  G  G YKICRG +ICGVD+MVSTV A +T
Sbjct  324  GKTWGEHGYYKICRGHHICGVDAMVSTVTATHT  356



>gb|AAB62937.1| stress-induced cysteine proteinase [Lavatera thuringiaca]
Length=175

 Score = 59.7 bits (143),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +    GVLLVGYG+AGYAP+R KEKP+WIIKN
Sbjct  102  YICFRSLDHGVLLVGYGAAGYAPVRFKEKPFWIIKN  137


 Score = 50.8 bits (120),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRGRN+CGVDSMVS+VAA+ T +
Sbjct  140  GANWGEDGYYKICRGRNVCGVDSMVSSVAALQTKS  174



>ref|XP_009776238.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana sylvestris]
Length=365

 Score = 62.0 bits (149),  Expect(2) = 5e-16, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  4    ICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            IC KR   GVLLVGYGS G+APIRLKEK YWIIKN
Sbjct  291  ICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKN  325


 Score = 48.5 bits (114),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG NICGVD+MVSTV A +T
Sbjct  328  GENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  360



>ref|XP_006653265.1| PREDICTED: cysteine proteinase 1-like, partial [Oryza brachyantha]
Length=366

 Score = 67.0 bits (162),  Expect(2) = 5e-16, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVLLVGYGSAGYAPIR KEKPYWIIKN
Sbjct  289  YICGKHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKN  324


 Score = 43.1 bits (100),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 3/36 (8%)
 Frame = +3

Query  114  GRELGRGGDYKICRG---RNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG   +N CGVDSMVSTV A++T
Sbjct  327  GENWGENGYYKICRGPHVQNKCGVDSMVSTVTAIHT  362



>gb|KHN12668.1| Cysteine proteinase 15A [Glycine soja]
Length=156

 Score = 57.4 bits (137),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVLLVGYG   YAPIR K KPYWIIKN
Sbjct  83   YICGKHLDHGVLLVGYGEGAYAPIRFKNKPYWIIKN  118


 Score = 52.4 bits (124),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 1/36 (3%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKICRGRN+CGVDSMVSTVAA+  P+S
Sbjct  121  GESWGENGYYKICRGRNVCGVDSMVSTVAAI-YPSS  155



>ref|XP_002279862.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI19784.3| unnamed protein product [Vitis vinifera]
Length=368

 Score = 63.2 bits (152),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            ++CS     GVLLVGYGSAGY+PIR KEKPYWI+KN
Sbjct  294  FLCSGELDHGVLLVGYGSAGYSPIRFKEKPYWILKN  329


 Score = 46.2 bits (108),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +3

Query  126  GRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G  G Y+ICRG+N+CGVDSMVS+V A    TS
Sbjct  336  GEHGYYRICRGQNMCGVDSMVSSVVAAIQTTS  367



>dbj|BAD10859.1| cysteine protease [Aster tripolium]
Length=363

 Score = 66.2 bits (160),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 1/37 (3%)
 Frame = +1

Query  1    YICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSK  +  GVLLVGYGSAGYAP+R KEKPYWIIKN
Sbjct  292  YICSKTKMDHGVLLVGYGSAGYAPLRFKEKPYWIIKN  328


 Score = 42.7 bits (99),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G + G  G YK+C G N CG+D+MVS V + NT
Sbjct  331  GEDWGEDGYYKLCSGYNACGMDTMVSAVVSTNT  363



>gb|EMT16425.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=379

 Score = 65.1 bits (157),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +    GVLLVGYGSAGYAP+R KEKPYWIIKN
Sbjct  302  YICGRHLDHGVLLVGYGSAGYAPLRFKEKPYWIIKN  337


 Score = 43.9 bits (102),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 3/36 (8%)
 Frame = +3

Query  114  GRELGRGGDYKICRG---RNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG   +N CGVDSMVSTV A++T
Sbjct  340  GENWGESGYYKICRGPHVKNKCGVDSMVSTVTAIHT  375



>ref|XP_004952477.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=374

 Score = 65.5 bits (158),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +    GVLLVGYG+AG+APIRLKEKPYWIIKN
Sbjct  297  YICGRHLDHGVLLVGYGAAGFAPIRLKEKPYWIIKN  332


 Score = 43.5 bits (101),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 3/36 (8%)
 Frame = +3

Query  114  GRELGRGGDYKICRG---RNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG   RN CGVDSMVSTV+A++ 
Sbjct  335  GENWGENGYYKICRGSNVRNKCGVDSMVSTVSAIHA  370



>ref|XP_002452058.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
 gb|EES05034.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
Length=371

 Score = 63.9 bits (154),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +    GVLLVGYG+AG+APIRLK+KPYWIIKN
Sbjct  295  YICGRTLDHGVLLVGYGAAGFAPIRLKDKPYWIIKN  330


 Score = 45.1 bits (105),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 25/36 (69%), Gaps = 3/36 (8%)
 Frame = +3

Query  114  GRELGRGGDYKICRG---RNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG   RN CGVDSMVSTV+AV T
Sbjct  333  GENWGENGYYKICRGSNVRNKCGVDSMVSTVSAVRT  368



>gb|AEX97108.1| cysteine proteinase, partial [Malus domestica]
Length=128

 Score = 65.1 bits (157),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 1/37 (3%)
 Frame = +1

Query  1    YICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR L  GVLLVGYGSAG+APIR KEKPYWIIKN
Sbjct  19   YICSKRNLDHGVLLVGYGSAGFAPIRFKEKPYWIIKN  55


 Score = 43.5 bits (101),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 25/35 (71%), Gaps = 2/35 (6%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G+  G  G Y IC+GRNICG +SMVS+VAA  TP 
Sbjct  58   GQNWGENGYYLICKGRNICGSESMVSSVAA--TPN  90



>ref|XP_003607110.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89307.1| papain family cysteine protease [Medicago truncatula]
Length=331

 Score = 55.1 bits (131),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRGRNICGVDSMVSTVAA +T T
Sbjct  296  GETWGENGYYKICRGRNICGVDSMVSTVAAAHTTT  330


 Score = 53.5 bits (127),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC++R   GVLLVGYGS   A ++ KEKPYWI+KN
Sbjct  258  YICTRRLDLGVLLVGYGSGAGADMKEKEKPYWIVKN  293



>gb|EYU27644.1| hypothetical protein MIMGU_mgv1a008452mg [Erythranthe guttata]
Length=373

 Score = 61.2 bits (147),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 1/37 (3%)
 Frame = +1

Query  1    YICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y+C KR L  GVLLVGYG+AGY+ IRLK KPYWI+KN
Sbjct  299  YVCGKRNLDHGVLLVGYGAAGYSTIRLKNKPYWIVKN  335


 Score = 47.0 bits (110),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKIC+G N+CGV+SMVS+V A++T ++
Sbjct  338  GESWGEEGYYKICKGHNVCGVESMVSSVNAIHTTSA  373



>gb|KEH30505.1| papain family cysteine protease [Medicago truncatula]
Length=330

 Score = 54.7 bits (130),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRGRNICGVDSMVSTVAA +T T
Sbjct  295  GETWGENGYYKICRGRNICGVDSMVSTVAAAHTNT  329


 Score = 53.1 bits (126),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC++R   GVLLVGYGS   A ++ KEKPYWI+KN
Sbjct  257  YICTRRLDLGVLLVGYGSGAGADMKEKEKPYWIVKN  292



>ref|XP_003579573.2| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=399

 Score = 63.9 bits (154),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            +IC +    GVLLVGYGSAGYAP+R KEKPYWIIKN
Sbjct  322  FICGRHLDHGVLLVGYGSAGYAPLRFKEKPYWIIKN  357


 Score = 43.9 bits (102),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 26/40 (65%), Gaps = 3/40 (8%)
 Frame = +3

Query  114  GRELGRGGDYKICRG---RNICGVDSMVSTVAAVNTPTSD  224
            G   G  G YKICRG   +N CGVDSMVSTV A++T   +
Sbjct  360  GENWGESGYYKICRGAHVKNKCGVDSMVSTVTAIHTSNKE  399



>gb|EPS70818.1| cysteine proteinase, partial [Genlisea aurea]
Length=355

 Score = 59.7 bits (143),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 1/36 (3%)
 Frame = +1

Query  4    ICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            +C K  L  GVL+VGYGS+GYAPIRLK KPYWI+KN
Sbjct  285  VCGKSNLDHGVLMVGYGSSGYAPIRLKNKPYWIVKN  320


 Score = 48.1 bits (113),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNT  212
            G+  G  G YKICRG NICGV+SMVSTV A+++
Sbjct  323  GKNWGEKGYYKICRGSNICGVESMVSTVTAIHS  355



>gb|EMS53996.1| Cysteine proteinase 1 [Triticum urartu]
Length=405

 Score = 63.9 bits (154),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +    GVLLVGYGSAGYAP+R KEKPYWIIKN
Sbjct  328  YICGRHLDHGVLLVGYGSAGYAPLRFKEKPYWIIKN  363


 Score = 43.9 bits (102),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 3/36 (8%)
 Frame = +3

Query  114  GRELGRGGDYKICRG---RNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG   +N CGVDSMVSTV A++T
Sbjct  366  GENWGESGYYKICRGPHVKNKCGVDSMVSTVTAIHT  401



>ref|XP_004975256.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=388

 Score = 66.6 bits (161),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +    GVLLVGYGSAGYAPIR KEKPYWIIKN
Sbjct  311  YICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKN  346


 Score = 40.8 bits (94),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 24/35 (69%), Gaps = 3/35 (9%)
 Frame = +3

Query  114  GRELGRGGDYKICRG---RNICGVDSMVSTVAAVN  209
            G   G  G YK+CRG   +N CGVDSMVSTV A++
Sbjct  349  GENWGENGYYKLCRGPFVKNKCGVDSMVSTVTAIH  383



>gb|AAZ32411.1| cysteine proteinase glycinain type [Nicotiana benthamiana]
Length=355

 Score = 62.0 bits (149),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  4    ICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            IC KR   GVLLVGYGS G+APIRLKEK YWIIKN
Sbjct  291  ICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKN  325


 Score = 45.4 bits (106),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 20/28 (71%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTV  197
            G   G  G YKICRG NICGVD+MVSTV
Sbjct  328  GENWGEHGYYKICRGHNICGVDAMVSTV  355



>emb|CAD40319.2| OSJNBb0054B09.3 [Oryza sativa Japonica Group]
 emb|CAH66180.1| OSIGBa0130O15.4 [Oryza sativa Indica Group]
 emb|CAH66205.1| OSIGBa0148D14.11 [Oryza sativa Indica Group]
Length=381

 Score = 65.1 bits (157),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            +IC +    GVLLVGYGSAGYAPIR KEKPYWIIKN
Sbjct  303  FICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKN  338


 Score = 41.6 bits (96),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 3/36 (8%)
 Frame = +3

Query  114  GRELGRGGDYKICRG---RNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG   +N CGVDSMVS+V A++T
Sbjct  341  GENWGEKGYYKICRGPHDKNKCGVDSMVSSVTAIHT  376



>dbj|BAG16515.1| putative cysteine proteinase [Capsicum chinense]
Length=367

 Score = 62.4 bits (150),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  4    ICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            +C K    GVLLVGYGSAG+APIRLK KPYWIIKN
Sbjct  292  VCFKHQDHGVLLVGYGSAGFAPIRLKAKPYWIIKN  326


 Score = 44.7 bits (104),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 1/34 (3%)
 Frame = +3

Query  114  GRELGRGGDYKICRGR-NICGVDSMVSTVAAVNT  212
            G   G  G YKICRG+ NICGVD+MVSTV A +T
Sbjct  329  GEHWGEHGYYKICRGQHNICGVDAMVSTVTAAHT  362



>ref|NP_001105685.1| cysteine proteinase 1 precursor [Zea mays]
 sp|Q10716.1|CYSP1_MAIZE RecName: Full=Cysteine proteinase 1; Flags: Precursor [Zea mays]
 dbj|BAA08244.1| cysteine proteinase [Zea mays]
Length=371

 Score = 63.2 bits (152),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +    GVLLVGYG++G+APIRLK+KPYWIIKN
Sbjct  295  YICGRHLDHGVLLVGYGASGFAPIRLKDKPYWIIKN  330


 Score = 43.9 bits (102),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 3/36 (8%)
 Frame = +3

Query  114  GRELGRGGDYKICRG---RNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG   RN CGVDSMVSTV+AV+ 
Sbjct  333  GENWGENGYYKICRGSNVRNKCGVDSMVSTVSAVHA  368



>gb|ACF86683.1| unknown [Zea mays]
 gb|AFW71402.1| cysteine protease1 [Zea mays]
Length=371

 Score = 63.2 bits (152),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +    GVLLVGYG++G+APIRLK+KPYWIIKN
Sbjct  295  YICGRHLDHGVLLVGYGASGFAPIRLKDKPYWIIKN  330


 Score = 43.9 bits (102),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 3/36 (8%)
 Frame = +3

Query  114  GRELGRGGDYKICRG---RNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG   RN CGVDSMVSTV+AV+ 
Sbjct  333  GENWGENGYYKICRGSNVRNKCGVDSMVSTVSAVHA  368



>ref|XP_006665032.1| PREDICTED: cysteine proteinase 1-like [Oryza brachyantha]
Length=191

 Score = 63.2 bits (152),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVLLVGYGS+G+APIRLK+KPYWIIKN
Sbjct  115  YICGKHLDHGVLLVGYGSSGFAPIRLKDKPYWIIKN  150


 Score = 43.5 bits (101),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 3/36 (8%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNI---CGVDSMVSTVAAVNT  212
            G   G  G YKICRG N+   CGVDSMVSTV A++T
Sbjct  153  GENWGEHGYYKICRGSNVRDKCGVDSMVSTVTAIHT  188



>gb|EEE60725.1| hypothetical protein OsJ_14236 [Oryza sativa Japonica Group]
Length=364

 Score = 64.7 bits (156),  Expect(2) = 7e-15, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            +IC +    GVLLVGYGSAGYAPIR KEKPYWIIKN
Sbjct  286  FICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKN  321


 Score = 41.6 bits (96),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 3/36 (8%)
 Frame = +3

Query  114  GRELGRGGDYKICRG---RNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG   +N CGVDSMVS+V A++T
Sbjct  324  GENWGEKGYYKICRGPHDKNKCGVDSMVSSVTAIHT  359



>gb|EAY93546.1| hypothetical protein OsI_15336 [Oryza sativa Indica Group]
Length=348

 Score = 64.7 bits (156),  Expect(2) = 8e-15, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            +IC +    GVLLVGYGSAGYAPIR KEKPYWIIKN
Sbjct  270  FICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKN  305


 Score = 41.6 bits (96),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 3/36 (8%)
 Frame = +3

Query  114  GRELGRGGDYKICRG---RNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG   +N CGVDSMVS+V A++T
Sbjct  308  GENWGEKGYYKICRGPHDKNKCGVDSMVSSVTAIHT  343



>gb|AAB16996.1| thiol protease isoform B, partial [Glycine max]
Length=319

 Score = 58.2 bits (139),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVLLVGYG   YAPIR K KPYWIIKN
Sbjct  246  YICGKHLDHGVLLVGYGEGAYAPIRFKNKPYWIIKN  281


 Score = 47.8 bits (112),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 21/31 (68%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAV  206
            G   G  G  +ICRGRN+CGVDSMVSTVAA+
Sbjct  284  GESWGENGYDEICRGRNVCGVDSMVSTVAAI  314



>ref|NP_001052440.1| Os04g0311400 [Oryza sativa Japonica Group]
 dbj|BAF14354.1| Os04g0311400, partial [Oryza sativa Japonica Group]
Length=384

 Score = 63.5 bits (153),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            +IC +    GVLLVGYGSAGYAPIR KEKPYWIIKN
Sbjct  306  FICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKN  341


 Score = 41.6 bits (96),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 3/36 (8%)
 Frame = +3

Query  114  GRELGRGGDYKICRG---RNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG   +N CGVDSMVS+V A++T
Sbjct  344  GENWGEKGYYKICRGPHDKNKCGVDSMVSSVTAIHT  379



>emb|CDX98179.1| BnaC07g09190D [Brassica napus]
Length=72

 Score = 55.5 bits (132),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  13   KRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            +R   GVLLVGYGSAGYAP R KEKPYWIIKN
Sbjct  2    RRLNHGVLLVGYGSAGYAPARFKEKPYWIIKN  33


 Score = 49.7 bits (117),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKICRGRN+CGVDS+VSTV A  +P +
Sbjct  36   GETWGEDGFYKICRGRNVCGVDSLVSTVTATVSPAA  71



>emb|CAQ00101.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=381

 Score = 61.2 bits (147),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC  R L  V LVGYGSAGYAP+R KEKPYWIIKN
Sbjct  305  YICG-RHLDHVFLVGYGSAGYAPLRFKEKPYWIIKN  339


 Score = 43.9 bits (102),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 3/36 (8%)
 Frame = +3

Query  114  GRELGRGGDYKICRG---RNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG   +N CGVDSMVSTV A++T
Sbjct  342  GENWGESGYYKICRGPHVKNKCGVDSMVSTVTAIHT  377



>ref|XP_003574963.1| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=377

 Score = 58.9 bits (141),  Expect(2) = 5e-14, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +    GVLLVGYG++G+AP RLK KPYW+IKN
Sbjct  300  YICGRSLDHGVLLVGYGASGFAPSRLKNKPYWVIKN  335


 Score = 44.7 bits (104),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 25/36 (69%), Gaps = 3/36 (8%)
 Frame = +3

Query  114  GRELGRGGDYKICRG---RNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG   RN CGVDSMVSTVAA +T
Sbjct  338  GENWGEKGYYKICRGSNVRNKCGVDSMVSTVAAAHT  373



>ref|NP_001046828.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAD19579.1| putative cysteine proteinase 1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF08742.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAG92750.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93804.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94031.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83204.1| hypothetical protein OsI_28465 [Oryza sativa Indica Group]
 gb|EEE56967.1| hypothetical protein OsJ_06681 [Oryza sativa Japonica Group]
Length=373

 Score = 59.7 bits (143),  Expect(2) = 5e-14, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +    GVLLVGYG++G+APIRLK+K YWIIKN
Sbjct  297  YICGRHLDHGVLLVGYGASGFAPIRLKDKAYWIIKN  332


 Score = 43.9 bits (102),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 3/36 (8%)
 Frame = +3

Query  114  GRELGRGGDYKICRG---RNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG   RN CGVDSMVSTV+A++T
Sbjct  335  GENWGEHGYYKICRGSNVRNKCGVDSMVSTVSAIHT  370



>ref|XP_009786000.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana sylvestris]
Length=370

 Score = 62.0 bits (149),  Expect(2) = 8e-14, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 1/36 (3%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSK+   GVLLVGYG+ G++PIR+KEKPYWIIKN
Sbjct  298  YICSKKLDHGVLLVGYGT-GFSPIRMKEKPYWIIKN  332


 Score = 41.2 bits (95),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSM  185
            G + G  G YKICRGRN+CGVDSM
Sbjct  335  GEKWGENGYYKICRGRNVCGVDSM  358



>emb|CAA57675.1| cysteine proteinase [Zea mays]
Length=145

 Score = 59.3 bits (142),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +    GVLLVGYG++G+AP+RLK+KPYWIIKN
Sbjct  69   YICGRHLDHGVLLVGYGASGFAPMRLKDKPYWIIKN  104


 Score = 43.5 bits (101),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 3/36 (8%)
 Frame = +3

Query  114  GRELGRGGDYKICRG---RNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG   RN CGVDSMVSTV+AV+ 
Sbjct  107  GENWGENGYYKICRGSNVRNKCGVDSMVSTVSAVHA  142



>gb|EPS65881.1| cysteine proteinase, partial [Genlisea aurea]
Length=335

 Score = 59.3 bits (142),  Expect(2) = 9e-14, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 1/36 (3%)
 Frame = +1

Query  4    ICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            IC K  L  G+L+VGYG++GYAPIRLKEKPYWI+KN
Sbjct  268  ICMKTRLDHGILIVGYGASGYAPIRLKEKPYWIVKN  303


 Score = 43.5 bits (101),  Expect(2) = 9e-14, Method: Composition-based stats.
 Identities = 18/30 (60%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAA  203
            G   G  G YKIC+G N+CGV+S+VSTV A
Sbjct  306  GENWGEQGYYKICKGHNVCGVESLVSTVTA  335



>gb|AGS43121.1| cysteine protease 1, partial [Zea mays]
Length=90

 Score = 59.7 bits (143),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +    GVLLVGYG++G+APIRLK+KPYWIIKN
Sbjct  14   YICGRHLDHGVLLVGYGASGFAPIRLKDKPYWIIKN  49


 Score = 43.1 bits (100),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 3/36 (8%)
 Frame = +3

Query  114  GRELGRGGDYKICRG---RNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG   RN CGVDSMVSTV+AV+ 
Sbjct  52   GENWGENGYYKICRGSNVRNKCGVDSMVSTVSAVHA  87



>emb|CAH59428.1| cysteine protease 2 [Plantago major]
Length=245

 Score = 55.1 bits (131),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVL+VGYG+ GYAP+RLK KPYWIIKN
Sbjct  173  YICGKSLDHGVLIVGYGT-GYAPVRLKNKPYWIIKN  207


 Score = 47.4 bits (111),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPTS  221
            G   G  G YKICRGRN+CGV+SMVS+V A +  T+
Sbjct  210  GESWGESGYYKICRGRNVCGVESMVSSVTAAHFTTT  245



>gb|AES89347.2| papain family cysteine protease [Medicago truncatula]
Length=327

 Score = 55.1 bits (131),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRGRNICGVDSMVSTVAA  T T
Sbjct  292  GETWGENGYYKICRGRNICGVDSMVSTVAAAQTTT  326


 Score = 47.0 bits (110),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 4/36 (11%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y C++R   GVLLVGYGS  Y     KEKPYWI+K+
Sbjct  258  YTCTRRLDHGVLLVGYGSGAYT----KEKPYWIVKS  289



>ref|XP_003607150.1| Cysteine proteinase [Medicago truncatula]
Length=326

 Score = 55.1 bits (131),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAAVNTPT  218
            G   G  G YKICRGRNICGVDSMVSTVAA  T T
Sbjct  291  GETWGENGYYKICRGRNICGVDSMVSTVAAAQTTT  325


 Score = 47.0 bits (110),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 4/36 (11%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            Y C++R   GVLLVGYGS  Y     KEKPYWI+K+
Sbjct  257  YTCTRRLDHGVLLVGYGSGAYT----KEKPYWIVKS  288



>tpe|CAD66657.1| TPA: putative cysteine proteinase precursor [Hordeum vulgare 
subsp. vulgare]
 dbj|BAJ94057.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score = 59.7 bits (143),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +    GVLLVGYG++G+AP R KEKPYWIIKN
Sbjct  300  YICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKN  335


 Score = 42.0 bits (97),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 3/36 (8%)
 Frame = +3

Query  114  GRELGRGGDYKICRG---RNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG   RN CGVDSMVSTV+A ++
Sbjct  338  GENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATHS  373



>gb|AAW21813.1| cysteine protease [Triticum aestivum]
Length=377

 Score = 60.1 bits (144),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +    GVLLVGYG++G+AP R KEKPYWIIKN
Sbjct  300  YICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKN  335


 Score = 41.6 bits (96),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 24/36 (67%), Gaps = 3/36 (8%)
 Frame = +3

Query  114  GRELGRGGDYKICRG---RNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG   RN CGVDSMVSTV+A + 
Sbjct  338  GENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATHA  373



>gb|EMT10192.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=369

 Score = 60.1 bits (144),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +    GVLLVGYG++G+AP R KEKPYWIIKN
Sbjct  292  YICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKN  327


 Score = 41.6 bits (96),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 24/36 (67%), Gaps = 3/36 (8%)
 Frame = +3

Query  114  GRELGRGGDYKICRG---RNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG   RN CGVDSMVSTV+A + 
Sbjct  330  GENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATHA  365



>gb|AAB16997.1| thiol protease isoform A, partial [Glycine max]
Length=318

 Score = 58.5 bits (140),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC K    GVLLVGYG   YAPIR K KPYWIIKN
Sbjct  244  YICGKHLDHGVLLVGYGEGRYAPIRFKNKPYWIIKN  279


 Score = 42.4 bits (98),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 24/32 (75%), Gaps = 1/32 (3%)
 Frame = +3

Query  114  GRELGRGGDY-KICRGRNICGVDSMVSTVAAV  206
            G   G    Y +ICRGRN+CGVD+MVSTVAA+
Sbjct  282  GESWGENDGYDEICRGRNVCGVDAMVSTVAAI  313



>ref|XP_002969223.1| hypothetical protein SELMODRAFT_91274 [Selaginella moellendorffii]
 gb|EFJ29311.1| hypothetical protein SELMODRAFT_91274 [Selaginella moellendorffii]
Length=367

 Score = 60.1 bits (144),  Expect(2) = 5e-13, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +1

Query  4    ICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            ICSK  +  GVLLVGYG+ GYAPIR  EKPYWIIKN
Sbjct  301  ICSKHHIDHGVLLVGYGAKGYAPIRFTEKPYWIIKN  336


 Score = 40.0 bits (92),  Expect(2) = 5e-13, Method: Composition-based stats.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVA  200
            G   G  G YKICRG  +CG+++MVSTVA
Sbjct  339  GATWGEQGYYKICRGHGMCGMNTMVSTVA  367



>ref|XP_002960585.1| hypothetical protein SELMODRAFT_266583 [Selaginella moellendorffii]
 gb|EFJ38124.1| hypothetical protein SELMODRAFT_266583 [Selaginella moellendorffii]
Length=330

 Score = 59.7 bits (143),  Expect(2) = 6e-13, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +1

Query  4    ICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            ICSK  +  GVLLVGYG+ GYAPIR  EKPYWIIKN
Sbjct  264  ICSKHHIDHGVLLVGYGAKGYAPIRFTEKPYWIIKN  299


 Score = 40.0 bits (92),  Expect(2) = 6e-13, Method: Composition-based stats.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVA  200
            G   G  G YKICRG  +CG+++MVSTVA
Sbjct  302  GATWGEQGYYKICRGHGMCGMNTMVSTVA  330



>gb|EMS64962.1| Cysteine proteinase 1 [Triticum urartu]
Length=302

 Score = 58.5 bits (140),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +    GVLLVGYG++G+AP R KEKPYWIIKN
Sbjct  225  YICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKN  260


 Score = 41.2 bits (95),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 24/36 (67%), Gaps = 3/36 (8%)
 Frame = +3

Query  114  GRELGRGGDYKICRG---RNICGVDSMVSTVAAVNT  212
            G   G  G YKICRG   RN CGVDSMVSTV+A + 
Sbjct  263  GENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATHA  298



>ref|XP_006293095.1| hypothetical protein CARUB_v10019394mg [Capsella rubella]
 gb|EOA25993.1| hypothetical protein CARUB_v10019394mg [Capsella rubella]
Length=367

 Score = 55.8 bits (133),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +1

Query  4    ICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            ICSKR +  GVLLVGYGS G++ +RL  KPYWIIKN
Sbjct  296  ICSKRKINHGVLLVGYGSKGFSILRLSNKPYWIIKN  331


 Score = 42.7 bits (99),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 17/29 (59%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVA  200
            G++ G  G YK+CRG +ICG++SMVS VA
Sbjct  334  GKKWGEDGYYKLCRGHDICGINSMVSAVA  362



>ref|XP_010504326.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=363

 Score = 55.1 bits (131),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +1

Query  4    ICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            ICSKR +  GVLLVGYGS G++ +RL  KPYWIIKN
Sbjct  292  ICSKRKINHGVLLVGYGSKGFSILRLSNKPYWIIKN  327


 Score = 42.7 bits (99),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 17/29 (59%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVA  200
            G++ G  G YK+CRG +ICG++SMVS VA
Sbjct  330  GKKWGEDGYYKLCRGHDICGINSMVSAVA  358



>gb|AAB53103.1| cysteine protease, partial [Brassica napus]
Length=85

 Score = 61.2 bits (147),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YIC +R   GVLLVGYGSAGYAP R KEKPYWIIKN
Sbjct  23   YICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKN  58


 Score = 36.6 bits (83),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMV  188
            G   G  G YKICRGRN+CGVD  V
Sbjct  61   GETWGENGFYKICRGRNVCGVDMSV  85



>gb|ADY04293.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04297.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 66.2 bits (160),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGS+GY+P+RLKEKPYWIIKN
Sbjct  87   YICSKRLDHGVLLVGYGSSGYSPVRLKEKPYWIIKN  122


 Score = 31.6 bits (70),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICG  173
            G + G  G YKICRGRNICG
Sbjct  125  GDKWGEEGFYKICRGRNICG  144



>gb|ADY04368.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04375.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04376.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04390.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04477.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04479.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 65.5 bits (158),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGS+GY+P+R+KEKPYWIIKN
Sbjct  87   YICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKN  122


 Score = 32.0 bits (71),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICG  173
            G + G  G YKICRGRNICG
Sbjct  125  GNKWGEEGFYKICRGRNICG  144



>gb|ADY04361.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 65.5 bits (158),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGS+GY+P+R+KEKPYWIIKN
Sbjct  87   YICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKN  122


 Score = 31.6 bits (70),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICG  173
            G + G  G YKICRGRNICG
Sbjct  125  GDKWGEEGFYKICRGRNICG  144



>gb|ADY04414.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 65.5 bits (158),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGS+GY+P+R+KEKPYWIIKN
Sbjct  87   YICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKN  122


 Score = 31.6 bits (70),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICG  173
            G + G  G YKICRGRNICG
Sbjct  125  GDKWGEEGFYKICRGRNICG  144



>gb|ADY04342.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 65.5 bits (158),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGS+GY+P+R+KEKPYWIIKN
Sbjct  87   YICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKN  122


 Score = 31.6 bits (70),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICG  173
            G + G  G YKICRGRNICG
Sbjct  125  GDKWGEEGFYKICRGRNICG  144



>gb|ADY04336.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04343.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 65.5 bits (158),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGS+GY+P+R+KEKPYWIIKN
Sbjct  87   YICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKN  122


 Score = 31.6 bits (70),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICG  173
            G + G  G YKICRGRNICG
Sbjct  125  GDKWGEEGFYKICRGRNICG  144



>gb|ADY04262.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04263.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04264.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04265.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04266.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04267.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04269.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04270.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04271.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04272.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04273.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04274.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04275.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04276.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04277.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04278.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04279.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04280.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04281.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04282.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04283.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04284.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04285.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04286.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04287.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04288.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04289.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04290.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04291.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04292.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04294.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04296.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04298.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04299.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04300.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04301.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04302.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04303.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04304.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04305.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04306.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04307.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04308.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04309.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04310.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04311.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04312.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04313.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04314.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04315.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04316.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04317.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04318.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04319.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04320.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04321.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04322.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04323.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04324.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04325.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04326.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04327.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04328.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04329.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04330.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04331.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04332.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04333.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04334.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04335.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04337.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04338.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04339.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04340.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04341.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04344.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04345.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04346.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04347.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04348.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04349.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04350.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04351.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04352.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04353.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04354.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04355.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04356.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04357.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04360.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04362.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04363.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04364.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04365.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04366.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04367.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04369.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04370.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04371.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04372.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04373.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04374.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04377.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04378.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04379.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04380.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04381.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04382.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04383.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04384.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04385.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04386.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04387.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04388.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04389.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04391.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04392.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04393.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04394.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04395.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04396.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04397.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04398.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04399.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04400.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04401.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04402.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04403.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04404.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04405.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04406.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04407.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04408.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04409.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04410.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04411.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04412.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04413.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04415.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04416.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04417.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04418.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04419.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04420.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04421.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04422.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04423.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04424.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04425.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04426.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04427.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04428.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04429.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04430.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04431.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04432.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04433.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04434.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04435.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04436.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04437.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04438.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04439.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04440.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04441.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04442.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04443.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04444.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04445.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04446.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04447.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04448.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04449.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04450.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04451.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04452.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04453.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04454.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04455.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04456.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04458.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04459.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04460.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04461.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04462.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04463.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04464.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04465.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04466.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04467.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04468.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04469.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04470.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04471.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04472.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04473.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04474.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04475.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04476.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04478.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04481.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04483.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04484.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04485.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04486.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04487.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04488.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04489.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04491.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04493.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04501.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04502.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04503.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04504.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04505.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04506.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04507.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04508.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04509.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04510.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04511.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04512.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04513.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04514.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04515.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04516.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04517.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04518.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 65.5 bits (158),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGS+GY+P+R+KEKPYWIIKN
Sbjct  87   YICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKN  122


 Score = 31.6 bits (70),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICG  173
            G + G  G YKICRGRNICG
Sbjct  125  GDKWGEEGFYKICRGRNICG  144



>gb|ADY04457.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 65.5 bits (158),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGS+GY+P+R+KEKPYWIIKN
Sbjct  87   YICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKN  122


 Score = 31.6 bits (70),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICG  173
            G + G  G YKICRGRNICG
Sbjct  125  GDKWGEEGFYKICRGRNICG  144



>ref|XP_002876278.1| hypothetical protein ARALYDRAFT_485911 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52537.1| hypothetical protein ARALYDRAFT_485911 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score = 54.7 bits (130),  Expect(2) = 7e-12, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +1

Query  4    ICSKRPLK-GVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            ICSKR +  GVLLVGYGS G++ +RL  KPYWIIKN
Sbjct  297  ICSKRKVNHGVLLVGYGSKGFSILRLSNKPYWIIKN  332


 Score = 41.6 bits (96),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICGVDSMVSTVAA  203
            G++ G  G YK+CRG +ICG++SMVS VA 
Sbjct  335  GKKWGENGYYKLCRGHDICGINSMVSAVAT  364



>gb|ADY04359.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 65.5 bits (158),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    YICSKRPLKGVLLVGYGSAGYAPIRLKEKPYWIIKN  108
            YICSKR   GVLLVGYGS+GY+P+R+KEKPYWIIKN
Sbjct  87   YICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKN  122


 Score = 30.8 bits (68),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = +3

Query  114  GRELGRGGDYKICRGRNICG  173
            G   G  G YKICRGRNICG
Sbjct  125  GDRWGEEGFYKICRGRNICG  144



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556888308225