BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP011C06 286 bp,

Length=190
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010927690.1|  PREDICTED: actin-related protein 2/3 complex...  66.2    7e-12   Elaeis guineensis
gb|EMT13187.1|  Actin-related protein 2/3 complex subunit 4           66.6    7e-12   Aegilops tauschii
ref|XP_003562343.1|  PREDICTED: actin-related protein 2/3 complex...  66.2    9e-12   Brachypodium distachyon [annual false brome]
ref|NP_001051892.1|  Os03g0848300                                     66.2    9e-12   
gb|AAO73272.1|  putative ARP2/3 complex 20 kDa subunit, 3'-partial    66.2    9e-12   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001236629.1|  uncharacterized protein LOC100527736             66.2    9e-12   Glycine max [soybeans]
ref|XP_007034310.1|  Binding isoform 1                                66.2    1e-11   Theobroma cacao [chocolate]
gb|KHN47950.1|  Actin-related protein 2/3 complex subunit 4           66.2    1e-11   Glycine soja [wild soybean]
ref|XP_010927684.1|  PREDICTED: actin-related protein 2/3 complex...  66.2    1e-11   Elaeis guineensis
ref|XP_010023684.1|  PREDICTED: actin-related protein 2/3 complex...  65.1    2e-11   Eucalyptus grandis [rose gum]
ref|XP_010671726.1|  PREDICTED: actin-related protein 2/3 complex...  65.1    2e-11   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_004297038.1|  PREDICTED: actin-related protein 2/3 complex...  65.1    2e-11   Fragaria vesca subsp. vesca
ref|XP_009627184.1|  PREDICTED: actin-related protein 2/3 complex...  65.1    2e-11   Nicotiana tomentosiformis
gb|KCW60032.1|  hypothetical protein EUGRSUZ_H02768                   65.1    3e-11   Eucalyptus grandis [rose gum]
gb|KCW60034.1|  hypothetical protein EUGRSUZ_H02768                   64.7    3e-11   Eucalyptus grandis [rose gum]
ref|XP_010927689.1|  PREDICTED: actin-related protein 2/3 complex...  63.9    4e-11   Elaeis guineensis
ref|NP_001152567.1|  LOC100286207                                     64.3    4e-11   Zea mays [maize]
ref|XP_002466102.1|  hypothetical protein SORBIDRAFT_01g001300        64.3    4e-11   Sorghum bicolor [broomcorn]
gb|KHG18390.1|  Actin-related 2/3 complex subunit 4                   64.3    5e-11   Gossypium arboreum [tree cotton]
ref|XP_003524942.1|  PREDICTED: actin-related protein 2/3 complex...  64.3    5e-11   Glycine max [soybeans]
ref|XP_010314753.1|  PREDICTED: actin-related protein 2/3 complex...  63.9    5e-11   Solanum lycopersicum
ref|XP_010927686.1|  PREDICTED: actin-related protein 2/3 complex...  64.3    5e-11   Elaeis guineensis
ref|XP_010314754.1|  PREDICTED: actin-related protein 2/3 complex...  63.9    5e-11   Solanum lycopersicum
ref|XP_008222913.1|  PREDICTED: actin-related protein 2/3 complex...  64.3    5e-11   Prunus mume [ume]
gb|AFW66987.1|  hypothetical protein ZEAMMB73_955903                  63.9    5e-11   Zea mays [maize]
ref|XP_007223594.1|  hypothetical protein PRUPE_ppa012450mg           63.9    5e-11   Prunus persica
ref|XP_010927683.1|  PREDICTED: actin-related protein 2/3 complex...  63.9    6e-11   Elaeis guineensis
ref|XP_004139001.1|  PREDICTED: actin-related protein 2/3 complex...  63.5    6e-11   
gb|KGN61430.1|  hypothetical protein Csa_2G120960                     63.9    6e-11   Cucumis sativus [cucumbers]
ref|XP_004168434.1|  PREDICTED: actin-related protein 2/3 complex...  63.9    7e-11   
ref|XP_009420321.1|  PREDICTED: actin-related protein 2/3 complex...  63.9    7e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008456148.1|  PREDICTED: actin-related protein 2/3 complex...  63.9    7e-11   
ref|XP_006840908.1|  hypothetical protein AMTR_s00087p00094770        63.9    7e-11   Amborella trichopoda
ref|XP_004252990.1|  PREDICTED: actin-related protein 2/3 complex...  63.9    7e-11   Solanum lycopersicum
ref|XP_006349919.1|  PREDICTED: actin-related protein 2/3 complex...  63.9    7e-11   Solanum tuberosum [potatoes]
ref|XP_011101551.1|  PREDICTED: actin-related protein 2/3 complex...  63.9    7e-11   Sesamum indicum [beniseed]
ref|XP_002518059.1|  arp2/3 complex 20 kD subunit, putative           63.5    7e-11   Ricinus communis
ref|XP_004140709.1|  PREDICTED: actin-related protein 2/3 complex...  63.5    8e-11   
gb|EYU31452.1|  hypothetical protein MIMGU_mgv1a014019mg              63.5    9e-11   Erythranthe guttata [common monkey flower]
emb|CDP14670.1|  unnamed protein product                              61.6    1e-10   Coffea canephora [robusta coffee]
ref|XP_008457157.1|  PREDICTED: actin-related protein 2/3 complex...  62.8    2e-10   Cucumis melo [Oriental melon]
ref|XP_007134765.1|  hypothetical protein PHAVU_010G074000g           62.4    2e-10   Phaseolus vulgaris [French bean]
ref|XP_002273132.1|  PREDICTED: actin-related protein 2/3 complex...  62.4    2e-10   Vitis vinifera
ref|XP_006285128.1|  hypothetical protein CARUB_v10006467mg           62.4    3e-10   Capsella rubella
ref|XP_002868308.1|  hypothetical protein ARALYDRAFT_330101           62.0    3e-10   Arabidopsis lyrata subsp. lyrata
ref|NP_001031632.1|  actin related protein 2/3 complex, subunit 4     62.0    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190726.1|  actin related protein 2/3 complex, subunit 4     62.0    4e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004504349.1|  PREDICTED: actin-related protein 2/3 complex...  61.6    4e-10   Cicer arietinum [garbanzo]
gb|EPS62361.1|  hypothetical protein M569_12430                       61.6    4e-10   Genlisea aurea
ref|XP_010247235.1|  PREDICTED: actin-related protein 2/3 complex...  61.6    4e-10   Nelumbo nucifera [Indian lotus]
ref|XP_007034311.1|  Binding isoform 2                                61.6    5e-10   Theobroma cacao [chocolate]
ref|XP_010527473.1|  PREDICTED: actin-related protein 2/3 complex...  61.6    5e-10   Tarenaya hassleriana [spider flower]
gb|KDO47849.1|  hypothetical protein CISIN_1g0281362mg                60.1    5e-10   Citrus sinensis [Valencia orange]
ref|XP_010532774.1|  PREDICTED: actin-related protein 2/3 complex...  61.2    5e-10   Tarenaya hassleriana [spider flower]
ref|XP_008373187.1|  PREDICTED: actin-related protein 2/3 complex...  61.2    6e-10   Malus domestica [apple tree]
ref|XP_006420973.1|  hypothetical protein CICLE_v10006063mg           60.8    9e-10   Citrus clementina
ref|XP_006414791.1|  hypothetical protein EUTSA_v10026384mg           60.8    9e-10   Eutrema salsugineum
ref|XP_009139559.1|  PREDICTED: actin-related protein 2/3 complex...  60.5    9e-10   Brassica rapa
ref|XP_011041940.1|  PREDICTED: actin-related protein 2/3 complex...  60.5    1e-09   Populus euphratica
ref|XP_009139560.1|  PREDICTED: actin-related protein 2/3 complex...  60.5    1e-09   Brassica rapa
emb|CBI17218.3|  unnamed protein product                              60.5    1e-09   Vitis vinifera
ref|XP_006414792.1|  hypothetical protein EUTSA_v10026384mg           60.5    1e-09   Eutrema salsugineum
gb|ADE77564.1|  unknown                                               60.5    1e-09   Picea sitchensis
ref|XP_006373069.1|  hypothetical protein POPTR_0017s08430g           60.5    1e-09   Populus trichocarpa [western balsam poplar]
ref|XP_010450102.1|  PREDICTED: actin-related protein 2/3 complex...  61.2    1e-09   Camelina sativa [gold-of-pleasure]
ref|XP_001776323.1|  predicted protein                                60.1    1e-09   Physcomitrella patens
ref|XP_009374563.1|  PREDICTED: actin-related protein 2/3 complex...  59.7    2e-09   Pyrus x bretschneideri [bai li]
emb|CDY12737.1|  BnaC04g29040D                                        59.7    2e-09   Brassica napus [oilseed rape]
ref|XP_003629670.1|  Actin-related protein 2/3 complex subunit        59.3    3e-09   Medicago truncatula
gb|AFK47316.1|  unknown                                               59.3    3e-09   Medicago truncatula
emb|CDY01195.1|  BnaA04g06240D                                        58.5    5e-09   Brassica napus [oilseed rape]
ref|XP_002973276.1|  hypothetical protein SELMODRAFT_98964            53.9    2e-07   Selaginella moellendorffii
ref|XP_002986734.1|  hypothetical protein SELMODRAFT_182555           53.9    3e-07   Selaginella moellendorffii
emb|CBJ29453.1|  Actin-related protein 2/3 complex subunit ARPC4 ...  46.6    1e-04   Ectocarpus siliculosus
dbj|BAN20839.1|  arp2/3 complex 20 kd subunit                         45.4    2e-04   Riptortus pedestris
emb|CCI49737.1|  unnamed protein product                              45.4    3e-04   Albugo candida
emb|CCA23762.1|  ARP2/3 complex 20 kDa subunit putative               45.4    4e-04   Albugo laibachii Nc14
gb|KGN57508.1|  hypothetical protein Csa_3G200190                     44.7    4e-04   Cucumis sativus [cucumbers]
ref|XP_009830823.1|  hypothetical protein H257_07098                  44.7    6e-04   Aphanomyces astaci
emb|CBK20167.2|  unnamed protein product                              43.9    8e-04   Blastocystis hominis



>ref|XP_010927690.1| PREDICTED: actin-related protein 2/3 complex subunit 4 isoform 
X7 [Elaeis guineensis]
Length=139

 Score = 66.2 bits (160),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/30 (100%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MANTLRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>gb|EMT13187.1| Actin-related protein 2/3 complex subunit 4 [Aegilops tauschii]
Length=169

 Score = 66.6 bits (161),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/30 (100%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MANTLRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>ref|XP_003562343.1| PREDICTED: actin-related protein 2/3 complex subunit 4 [Brachypodium 
distachyon]
 gb|EMS58131.1| Actin-related protein 2/3 complex subunit 4 [Triticum urartu]
Length=169

 Score = 66.2 bits (160),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/30 (100%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MANTLRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>ref|NP_001051892.1| Os03g0848300 [Oryza sativa Japonica Group]
 ref|XP_004981055.1| PREDICTED: actin-related protein 2/3 complex subunit 4-like [Setaria 
italica]
 ref|XP_006650890.1| PREDICTED: actin-related protein 2/3 complex subunit 4-like [Oryza 
brachyantha]
 ref|XP_008794599.1| PREDICTED: actin-related protein 2/3 complex subunit 4 isoform 
X1 [Phoenix dactylifera]
 ref|XP_010927687.1| PREDICTED: actin-related protein 2/3 complex subunit 4 isoform 
X4 [Elaeis guineensis]
 gb|AAO37935.1| putative actin-related complex protein [Oryza sativa Japonica 
Group]
 gb|ABF99893.1| Actin-related protein 2/3 complex subunit 4, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13806.1| Os03g0848300 [Oryza sativa Japonica Group]
 gb|EAY92581.1| hypothetical protein OsI_14322 [Oryza sativa Indica Group]
 gb|EAZ29302.1| hypothetical protein OsJ_13363 [Oryza sativa Japonica Group]
 gb|ABR25446.1| actin-related protein 2/3 complex subunit 4 [Oryza sativa Indica 
Group]
Length=169

 Score = 66.2 bits (160),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/30 (100%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MANTLRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>gb|AAO73272.1| putative ARP2/3 complex 20 kDa subunit, 3'-partial [Oryza sativa 
Japonica Group]
Length=164

 Score = 66.2 bits (160),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/30 (100%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MANTLRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>ref|NP_001236629.1| uncharacterized protein LOC100527736 [Glycine max]
 gb|ACU16895.1| unknown [Glycine max]
Length=169

 Score = 66.2 bits (160),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/30 (100%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MANTLRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>ref|XP_007034310.1| Binding isoform 1 [Theobroma cacao]
 gb|EOY05236.1| Binding isoform 1 [Theobroma cacao]
Length=169

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/30 (100%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MANTLRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>gb|KHN47950.1| Actin-related protein 2/3 complex subunit 4 [Glycine soja]
Length=169

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/30 (100%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MANTLRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>ref|XP_010927684.1| PREDICTED: actin-related protein 2/3 complex subunit 4 isoform 
X2 [Elaeis guineensis]
Length=184

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/30 (100%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MANTLRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>ref|XP_010023684.1| PREDICTED: actin-related protein 2/3 complex subunit 4 [Eucalyptus 
grandis]
 gb|KCW60033.1| hypothetical protein EUGRSUZ_H02768 [Eucalyptus grandis]
Length=169

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MAN+LRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MANSLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>ref|XP_010671726.1| PREDICTED: actin-related protein 2/3 complex subunit 4 [Beta 
vulgaris subsp. vulgaris]
Length=168

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MANT+RLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MANTMRLYLTCIRNTLEAAMCLQNFPCQEV  30



>ref|XP_004297038.1| PREDICTED: actin-related protein 2/3 complex subunit 4 [Fragaria 
vesca subsp. vesca]
Length=169

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MANTLRLYLTCIRNTL+AAMCLQNFPCQEV
Sbjct  1   MANTLRLYLTCIRNTLDAAMCLQNFPCQEV  30



>ref|XP_009627184.1| PREDICTED: actin-related protein 2/3 complex subunit 4 [Nicotiana 
tomentosiformis]
 ref|XP_009771969.1| PREDICTED: actin-related protein 2/3 complex subunit 4 [Nicotiana 
sylvestris]
Length=169

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MAN+LRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MANSLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>gb|KCW60032.1| hypothetical protein EUGRSUZ_H02768 [Eucalyptus grandis]
Length=169

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MAN+LRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MANSLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>gb|KCW60034.1| hypothetical protein EUGRSUZ_H02768 [Eucalyptus grandis]
Length=166

 Score = 64.7 bits (156),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MAN+LRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MANSLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>ref|XP_010927689.1| PREDICTED: actin-related protein 2/3 complex subunit 4 isoform 
X6 [Elaeis guineensis]
Length=143

 Score = 63.9 bits (154),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/29 (100%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = -3

Query  89  ANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           ANTLRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  6   ANTLRLYLTCIRNTLEAAMCLQNFPCQEV  34



>ref|NP_001152567.1| LOC100286207 [Zea mays]
 ref|XP_008645523.1| PREDICTED: actin-related protein 2/3 complex subunit 4 [Zea mays]
 gb|ACG48263.1| actin-related protein 2/3 complex subunit 4 [Zea mays]
 gb|AFW66988.1| actin protein 2/3 complex subunit 4 [Zea mays]
 gb|AFW70953.1| actin protein 2/3 complex subunit 4 [Zea mays]
Length=173

 Score = 64.3 bits (155),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/29 (100%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = -3

Query  89  ANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           ANTLRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  6   ANTLRLYLTCIRNTLEAAMCLQNFPCQEV  34



>ref|XP_002466102.1| hypothetical protein SORBIDRAFT_01g001300 [Sorghum bicolor]
 gb|EER93100.1| hypothetical protein SORBIDRAFT_01g001300 [Sorghum bicolor]
Length=171

 Score = 64.3 bits (155),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/29 (100%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = -3

Query  89  ANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           ANTLRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  4   ANTLRLYLTCIRNTLEAAMCLQNFPCQEV  32



>gb|KHG18390.1| Actin-related 2/3 complex subunit 4 [Gossypium arboreum]
 gb|KJB27964.1| hypothetical protein B456_005G030800 [Gossypium raimondii]
 gb|KJB27965.1| hypothetical protein B456_005G030800 [Gossypium raimondii]
Length=168

 Score = 64.3 bits (155),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MA+TLRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MASTLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>ref|XP_003524942.1| PREDICTED: actin-related protein 2/3 complex subunit 4-like [Glycine 
max]
Length=169

 Score = 64.3 bits (155),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MA+TLRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MASTLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>ref|XP_010314753.1| PREDICTED: actin-related protein 2/3 complex subunit 4 isoform 
X3 [Solanum lycopersicum]
Length=144

 Score = 63.9 bits (154),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MAN LRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MANPLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>ref|XP_010927686.1| PREDICTED: actin-related protein 2/3 complex subunit 4 isoform 
X3 [Elaeis guineensis]
Length=173

 Score = 64.3 bits (155),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/29 (100%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = -3

Query  89  ANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           ANTLRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  6   ANTLRLYLTCIRNTLEAAMCLQNFPCQEV  34



>ref|XP_010314754.1| PREDICTED: actin-related protein 2/3 complex subunit 4 isoform 
X4 [Solanum lycopersicum]
Length=139

 Score = 63.9 bits (154),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MAN LRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MANPLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>ref|XP_008222913.1| PREDICTED: actin-related protein 2/3 complex subunit 4 [Prunus 
mume]
Length=169

 Score = 64.3 bits (155),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           M+NTLRLYLTCIRNTL+AAMCLQNFPCQEV
Sbjct  1   MSNTLRLYLTCIRNTLDAAMCLQNFPCQEV  30



>gb|AFW66987.1| hypothetical protein ZEAMMB73_955903 [Zea mays]
Length=146

 Score = 63.9 bits (154),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/29 (100%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = -3

Query  89  ANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           ANTLRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  6   ANTLRLYLTCIRNTLEAAMCLQNFPCQEV  34



>ref|XP_007223594.1| hypothetical protein PRUPE_ppa012450mg [Prunus persica]
 gb|EMJ24793.1| hypothetical protein PRUPE_ppa012450mg [Prunus persica]
Length=169

 Score = 63.9 bits (154),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           M+NTLRLYLTCIRNTL+AAMCLQNFPCQEV
Sbjct  1   MSNTLRLYLTCIRNTLDAAMCLQNFPCQEV  30



>ref|XP_010927683.1| PREDICTED: actin-related protein 2/3 complex subunit 4 isoform 
X1 [Elaeis guineensis]
Length=188

 Score = 63.9 bits (154),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/29 (100%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = -3

Query  89  ANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           ANTLRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  6   ANTLRLYLTCIRNTLEAAMCLQNFPCQEV  34



>ref|XP_004139001.1| PREDICTED: actin-related protein 2/3 complex subunit 4-like [Cucumis 
sativus]
Length=146

 Score = 63.5 bits (153),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MA TLRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MATTLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>gb|KGN61430.1| hypothetical protein Csa_2G120960 [Cucumis sativus]
Length=169

 Score = 63.9 bits (154),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MA TLRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MATTLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>ref|XP_004168434.1| PREDICTED: actin-related protein 2/3 complex subunit 4-like [Cucumis 
sativus]
Length=169

 Score = 63.9 bits (154),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MA TLRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MATTLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>ref|XP_009420321.1| PREDICTED: actin-related protein 2/3 complex subunit 4 [Musa 
acuminata subsp. malaccensis]
Length=169

 Score = 63.9 bits (154),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MA TLRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MATTLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>ref|XP_008456148.1| PREDICTED: actin-related protein 2/3 complex subunit 4-like [Cucumis 
melo]
 ref|XP_008456149.1| PREDICTED: actin-related protein 2/3 complex subunit 4-like [Cucumis 
melo]
 ref|XP_008456150.1| PREDICTED: actin-related protein 2/3 complex subunit 4-like [Cucumis 
melo]
 ref|XP_008456151.1| PREDICTED: actin-related protein 2/3 complex subunit 4-like [Cucumis 
melo]
 ref|XP_008456152.1| PREDICTED: actin-related protein 2/3 complex subunit 4-like [Cucumis 
melo]
 ref|XP_008456153.1| PREDICTED: actin-related protein 2/3 complex subunit 4-like [Cucumis 
melo]
 ref|XP_008456154.1| PREDICTED: actin-related protein 2/3 complex subunit 4-like [Cucumis 
melo]
 ref|XP_008456156.1| PREDICTED: actin-related protein 2/3 complex subunit 4-like [Cucumis 
melo]
Length=169

 Score = 63.9 bits (154),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MA TLRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MATTLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>ref|XP_006840908.1| hypothetical protein AMTR_s00087p00094770 [Amborella trichopoda]
 gb|ERN02583.1| hypothetical protein AMTR_s00087p00094770 [Amborella trichopoda]
Length=169

 Score = 63.9 bits (154),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MANTLR YLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MANTLRSYLTCIRNTLEAAMCLQNFPCQEV  30



>ref|XP_004252990.1| PREDICTED: actin-related protein 2/3 complex subunit 4 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010314751.1| PREDICTED: actin-related protein 2/3 complex subunit 4 isoform 
X1 [Solanum lycopersicum]
Length=169

 Score = 63.9 bits (154),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MAN LRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MANPLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>ref|XP_006349919.1| PREDICTED: actin-related protein 2/3 complex subunit 4-like isoform 
X1 [Solanum tuberosum]
Length=169

 Score = 63.9 bits (154),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MAN LRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MANPLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>ref|XP_011101551.1| PREDICTED: actin-related protein 2/3 complex subunit 4 [Sesamum 
indicum]
Length=169

 Score = 63.9 bits (154),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MAN LRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MANPLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>ref|XP_002518059.1| arp2/3 complex 20 kD subunit, putative [Ricinus communis]
 gb|EEF44192.1| arp2/3 complex 20 kD subunit, putative [Ricinus communis]
Length=169

 Score = 63.5 bits (153),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MAN LRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MANPLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>ref|XP_004140709.1| PREDICTED: actin-related protein 2/3 complex subunit 4-like [Cucumis 
sativus]
Length=151

 Score = 63.5 bits (153),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MA TLRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MATTLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>gb|EYU31452.1| hypothetical protein MIMGU_mgv1a014019mg [Erythranthe guttata]
Length=203

 Score = 63.5 bits (153),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MAN+LRLYLTCIRNTLEAA+CLQNFPCQEV
Sbjct  35  MANSLRLYLTCIRNTLEAALCLQNFPCQEV  64



>emb|CDP14670.1| unnamed protein product [Coffea canephora]
Length=76

 Score = 61.6 bits (148),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -3

Query  89  ANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           AN LRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  3   ANMLRLYLTCIRNTLEAAMCLQNFPCQEV  31



>ref|XP_008457157.1| PREDICTED: actin-related protein 2/3 complex subunit 4 isoform 
X1 [Cucumis melo]
Length=169

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MA +LRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MATSLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>ref|XP_007134765.1| hypothetical protein PHAVU_010G074000g [Phaseolus vulgaris]
 gb|ESW06759.1| hypothetical protein PHAVU_010G074000g [Phaseolus vulgaris]
Length=169

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           M +TLRLYLTCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MTSTLRLYLTCIRNTLEAAMCLQNFPCQEV  30



>ref|XP_002273132.1| PREDICTED: actin-related protein 2/3 complex subunit 4 [Vitis 
vinifera]
Length=169

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MANT RLY TCIRNTLEAAMCLQNFPCQEV
Sbjct  1   MANTSRLYFTCIRNTLEAAMCLQNFPCQEV  30



>ref|XP_006285128.1| hypothetical protein CARUB_v10006467mg [Capsella rubella]
 gb|EOA18026.1| hypothetical protein CARUB_v10006467mg [Capsella rubella]
Length=220

 Score = 62.4 bits (150),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MAN+LRLYL CI+NTLEAAMCLQNFPCQEV
Sbjct  1   MANSLRLYLACIKNTLEAAMCLQNFPCQEV  30



>ref|XP_002868308.1| hypothetical protein ARALYDRAFT_330101 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44567.1| hypothetical protein ARALYDRAFT_330101 [Arabidopsis lyrata subsp. 
lyrata]
Length=171

 Score = 62.0 bits (149),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MAN+LRLYL CI+NTLEAAMCLQNFPCQEV
Sbjct  1   MANSLRLYLACIKNTLEAAMCLQNFPCQEV  30



>ref|NP_001031632.1| actin related protein 2/3 complex, subunit 4  [Arabidopsis thaliana]
 ref|XP_010435182.1| PREDICTED: actin-related protein 2/3 complex subunit 4 [Camelina 
sativa]
 ref|XP_010440526.1| PREDICTED: actin-related protein 2/3 complex subunit 4 [Camelina 
sativa]
 ref|XP_010450101.1| PREDICTED: actin-related protein 2/3 complex subunit 4 isoform 
X1 [Camelina sativa]
 sp|F4JUL9.1|ARPC4_ARATH RecName: Full=Actin-related protein 2/3 complex subunit 4; AltName: 
Full=Actin-related protein C4; AltName: Full=Arp2/3 complex 
20 kDa subunit; Short=p20-ARC [Arabidopsis thaliana]
 gb|AEE83382.1| actin related protein 2/3 complex, subunit 4 [Arabidopsis thaliana]
Length=169

 Score = 62.0 bits (149),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MAN+LRLYL CI+NTLEAAMCLQNFPCQEV
Sbjct  1   MANSLRLYLACIKNTLEAAMCLQNFPCQEV  30



>ref|NP_001190726.1| actin related protein 2/3 complex, subunit 4  [Arabidopsis thaliana]
 gb|AEE83383.1| actin related protein 2/3 complex, subunit 4 [Arabidopsis thaliana]
Length=176

 Score = 62.0 bits (149),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MAN+LRLYL CI+NTLEAAMCLQNFPCQEV
Sbjct  1   MANSLRLYLACIKNTLEAAMCLQNFPCQEV  30



>ref|XP_004504349.1| PREDICTED: actin-related protein 2/3 complex subunit 4-like [Cicer 
arietinum]
Length=169

 Score = 61.6 bits (148),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           M +TLRLYLTCIRNTL+AAMCLQNFPCQEV
Sbjct  1   MGSTLRLYLTCIRNTLDAAMCLQNFPCQEV  30



>gb|EPS62361.1| hypothetical protein M569_12430, partial [Genlisea aurea]
Length=168

 Score = 61.6 bits (148),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = -3

Query  89  ANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           AN+LRLYLTCIR+TLEAAMCLQNFPCQEV
Sbjct  1   ANSLRLYLTCIRHTLEAAMCLQNFPCQEV  29



>ref|XP_010247235.1| PREDICTED: actin-related protein 2/3 complex subunit 4 [Nelumbo 
nucifera]
Length=169

 Score = 61.6 bits (148),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MANTLR YLTCIRNTLEAA+CLQNFPCQEV
Sbjct  1   MANTLRPYLTCIRNTLEAALCLQNFPCQEV  30



>ref|XP_007034311.1| Binding isoform 2 [Theobroma cacao]
 gb|EOY05237.1| Binding isoform 2 [Theobroma cacao]
Length=170

 Score = 61.6 bits (148),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 1/31 (3%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCL-QNFPCQEV  3
           MANTLRLYLTCIRNTLEAAMCL QNFPCQEV
Sbjct  1   MANTLRLYLTCIRNTLEAAMCLQQNFPCQEV  31



>ref|XP_010527473.1| PREDICTED: actin-related protein 2/3 complex subunit 4 [Tarenaya 
hassleriana]
 ref|XP_010527474.1| PREDICTED: actin-related protein 2/3 complex subunit 4 [Tarenaya 
hassleriana]
 ref|XP_010527475.1| PREDICTED: actin-related protein 2/3 complex subunit 4 [Tarenaya 
hassleriana]
 ref|XP_010527477.1| PREDICTED: actin-related protein 2/3 complex subunit 4 [Tarenaya 
hassleriana]
Length=169

 Score = 61.6 bits (148),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MA++LRLYL CIRNTLEAAMCLQNFPCQEV
Sbjct  1   MASSLRLYLACIRNTLEAAMCLQNFPCQEV  30



>gb|KDO47849.1| hypothetical protein CISIN_1g0281362mg, partial [Citrus sinensis]
Length=84

 Score = 60.1 bits (144),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           M+NTLRLYL CIRNTL+AA+CLQNFPCQEV
Sbjct  45  MSNTLRLYLACIRNTLDAALCLQNFPCQEV  74



>ref|XP_010532774.1| PREDICTED: actin-related protein 2/3 complex subunit 4-like [Tarenaya 
hassleriana]
Length=169

 Score = 61.2 bits (147),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MA++LRLYL CIRNTLEAAMCLQNFPCQEV
Sbjct  1   MASSLRLYLACIRNTLEAAMCLQNFPCQEV  30



>ref|XP_008373187.1| PREDICTED: actin-related protein 2/3 complex subunit 4 [Malus 
domestica]
Length=169

 Score = 61.2 bits (147),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           M+N+LRLYL CIRNTL+AAMCLQNFPCQEV
Sbjct  1   MSNSLRLYLACIRNTLDAAMCLQNFPCQEV  30



>ref|XP_006420973.1| hypothetical protein CICLE_v10006063mg [Citrus clementina]
 ref|XP_006489833.1| PREDICTED: actin-related protein 2/3 complex subunit 4-like [Citrus 
sinensis]
 gb|ESR34213.1| hypothetical protein CICLE_v10006063mg [Citrus clementina]
Length=169

 Score = 60.8 bits (146),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           M+NTLRLYL CIRNTL+AA+CLQNFPCQEV
Sbjct  1   MSNTLRLYLACIRNTLDAALCLQNFPCQEV  30



>ref|XP_006414791.1| hypothetical protein EUTSA_v10026384mg [Eutrema salsugineum]
 gb|ESQ56244.1| hypothetical protein EUTSA_v10026384mg [Eutrema salsugineum]
Length=169

 Score = 60.8 bits (146),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MAN LRLYL CI+NTLEAAMCLQNFPCQEV
Sbjct  1   MANPLRLYLACIKNTLEAAMCLQNFPCQEV  30



>ref|XP_009139559.1| PREDICTED: actin-related protein 2/3 complex subunit 4 isoform 
X1 [Brassica rapa]
Length=169

 Score = 60.5 bits (145),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MAN LRLYL CI+NTLEAAMCLQNFPCQEV
Sbjct  1   MANPLRLYLACIKNTLEAAMCLQNFPCQEV  30



>ref|XP_011041940.1| PREDICTED: actin-related protein 2/3 complex subunit 4 isoform 
X3 [Populus euphratica]
Length=139

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MA +LRLYLTCIRNTLEA++CLQNFPCQEV
Sbjct  1   MATSLRLYLTCIRNTLEASLCLQNFPCQEV  30



>ref|XP_009139560.1| PREDICTED: actin-related protein 2/3 complex subunit 4 isoform 
X2 [Brassica rapa]
Length=196

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MAN LRLYL CI+NTLEAAMCLQNFPCQEV
Sbjct  1   MANPLRLYLACIKNTLEAAMCLQNFPCQEV  30



>emb|CBI17218.3| unnamed protein product [Vitis vinifera]
Length=194

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
            ANT RLY TCIRNTLEAAMCLQNFPCQEV
Sbjct  26  FANTSRLYFTCIRNTLEAAMCLQNFPCQEV  55



>ref|XP_006414792.1| hypothetical protein EUTSA_v10026384mg [Eutrema salsugineum]
 gb|ESQ56245.1| hypothetical protein EUTSA_v10026384mg [Eutrema salsugineum]
Length=174

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MAN LRLYL CI+NTLEAAMCLQNFPCQEV
Sbjct  1   MANPLRLYLACIKNTLEAAMCLQNFPCQEV  30



>gb|ADE77564.1| unknown [Picea sitchensis]
Length=169

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MANTLR YLTCIRNTL AAMCLQNFPCQEV
Sbjct  1   MANTLRPYLTCIRNTLAAAMCLQNFPCQEV  30



>ref|XP_006373069.1| hypothetical protein POPTR_0017s08430g [Populus trichocarpa]
 ref|XP_011041938.1| PREDICTED: actin-related protein 2/3 complex subunit 4 isoform 
X1 [Populus euphratica]
 ref|XP_011041939.1| PREDICTED: actin-related protein 2/3 complex subunit 4 isoform 
X2 [Populus euphratica]
 gb|ERP50866.1| hypothetical protein POPTR_0017s08430g [Populus trichocarpa]
Length=169

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MA +LRLYLTCIRNTLEA++CLQNFPCQEV
Sbjct  1   MATSLRLYLTCIRNTLEASLCLQNFPCQEV  30



>ref|XP_010450102.1| PREDICTED: actin-related protein 2/3 complex subunit 4 isoform 
X2 [Camelina sativa]
Length=276

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MAN+LRLYL CI+NTLEAAMCLQNFPCQEV
Sbjct  1   MANSLRLYLACIKNTLEAAMCLQNFPCQEV  30



>ref|XP_001776323.1| predicted protein [Physcomitrella patens]
 gb|ABD96084.1| actin-related protein complex 4 [Physcomitrella patens]
 gb|EDQ58822.1| predicted protein [Physcomitrella patens]
Length=169

 Score = 60.1 bits (144),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MANTLR YLTCIRNTL AAMCLQNFPCQEV
Sbjct  1   MANTLRPYLTCIRNTLTAAMCLQNFPCQEV  30



>ref|XP_009374563.1| PREDICTED: actin-related protein 2/3 complex subunit 4 [Pyrus 
x bretschneideri]
Length=169

 Score = 59.7 bits (143),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           M+N+LRLYL CIRNTL+AA+CLQNFPCQEV
Sbjct  1   MSNSLRLYLACIRNTLDAALCLQNFPCQEV  30



>emb|CDY12737.1| BnaC04g29040D [Brassica napus]
Length=170

 Score = 59.7 bits (143),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  89  ANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           AN LRLYL CIRNTLEAAMCLQNFPCQEV
Sbjct  4   ANPLRLYLACIRNTLEAAMCLQNFPCQEV  32



>ref|XP_003629670.1| Actin-related protein 2/3 complex subunit [Medicago truncatula]
 gb|AET04146.1| actin-related protein 2/3 complex subunit 4 [Medicago truncatula]
Length=170

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -3

Query  89  ANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           + TLRLYLTCIRNTL+AAMCLQNFPCQEV
Sbjct  3   STTLRLYLTCIRNTLDAAMCLQNFPCQEV  31



>gb|AFK47316.1| unknown [Medicago truncatula]
Length=170

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -3

Query  89  ANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           + TLRLYLTCIRNTL+AAMCLQNFPCQEV
Sbjct  3   STTLRLYLTCIRNTLDAAMCLQNFPCQEV  31



>emb|CDY01195.1| BnaA04g06240D [Brassica napus]
Length=170

 Score = 58.5 bits (140),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  89  ANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           AN LRLYL CI+NTLEAAMCLQNFPCQEV
Sbjct  4   ANPLRLYLACIKNTLEAAMCLQNFPCQEV  32



>ref|XP_002973276.1| hypothetical protein SELMODRAFT_98964, partial [Selaginella moellendorffii]
 gb|EFJ25650.1| hypothetical protein SELMODRAFT_98964, partial [Selaginella moellendorffii]
Length=168

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  89  ANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           ANTLR YLTCIRNTL AAM LQNFPCQ+V
Sbjct  1   ANTLRPYLTCIRNTLTAAMSLQNFPCQDV  29



>ref|XP_002986734.1| hypothetical protein SELMODRAFT_182555 [Selaginella moellendorffii]
 gb|EFJ12297.1| hypothetical protein SELMODRAFT_182555 [Selaginella moellendorffii]
Length=189

 Score = 53.9 bits (128),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  89  ANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           ANTLR YLTCIRNTL AAM LQNFPCQ+V
Sbjct  22  ANTLRPYLTCIRNTLTAAMSLQNFPCQDV  50



>emb|CBJ29453.1| Actin-related protein 2/3 complex subunit ARPC4 or p20-Arc (Arp2/3 
complex 20 kDa subunit) [Ectocarpus siliculosus]
Length=170

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MANTLR YL  IR TL+AA+CL+NFP Q V
Sbjct  1   MANTLRPYLNAIRGTLDAALCLRNFPSQTV  30



>dbj|BAN20839.1| arp2/3 complex 20 kd subunit [Riptortus pedestris]
Length=168

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           M++TLR YLT +RNTL AAMCL NF  Q+V
Sbjct  1   MSSTLRPYLTAVRNTLNAAMCLDNFSSQDV  30



>emb|CCI49737.1| unnamed protein product [Albugo candida]
Length=179

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQ  9
           MANTL  YLT IRN+LE A+CL+NFP Q
Sbjct  10  MANTLATYLTSIRNSLEGALCLRNFPSQ  37



>emb|CCA23762.1| ARP2/3 complex 20 kDa subunit putative [Albugo laibachii Nc14]
Length=184

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQ  9
           MANTL  YLT IRN+LE A+CL+NFP Q
Sbjct  15  MANTLATYLTSIRNSLEGALCLRNFPSQ  42



>gb|KGN57508.1| hypothetical protein Csa_3G200190 [Cucumis sativus]
Length=144

 Score = 44.7 bits (104),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/22 (95%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -3

Query  89   ANTLRLYLTCIRNTLEAAMCLQ  24
            A TLRLYLTCIRNTLEAAMCLQ
Sbjct  107  ATTLRLYLTCIRNTLEAAMCLQ  128



>ref|XP_009830823.1| hypothetical protein H257_07098 [Aphanomyces astaci]
 gb|ETV79887.1| hypothetical protein H257_07098 [Aphanomyces astaci]
Length=170

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -3

Query  92  MANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           MANTL  YL  IR+TL+AA+CLQNFP Q V
Sbjct  1   MANTLAPYLNAIRSTLDAALCLQNFPSQVV  30



>emb|CBK20167.2| unnamed protein product [Blastocystis hominis]
Length=165

 Score = 43.9 bits (102),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = -3

Query  95  TMANTLRLYLTCIRNTLEAAMCLQNFPCQEV  3
           TMANTL+ YL CIR TL A + LQNFP + V
Sbjct  36  TMANTLKPYLDCIRTTLRATLVLQNFPSEAV  66



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 570351139820