BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP011B04 343 bp,:Filtered

Length=343
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAK27969.1|AF242373_1  cysteine protease                             140   3e-37   Ipomoea batatas [batate]
gb|AAF40415.1|AF216784_1  papain-like cysteine proteinase isoform II    139   6e-37   Ipomoea batatas [batate]
gb|AAF61440.1|AF138264_1  papain-like cysteine proteinase isoform I     139   7e-37   Ipomoea batatas [batate]
gb|AAF40414.1|AF216783_1  papain-like cysteine proteinase isoform I     139   7e-37   Ipomoea batatas [batate]
gb|AAF61441.1|AF138265_1  papain-like cysteine proteinase isoform II    139   9e-37   Ipomoea batatas [batate]
gb|AAF40416.1|AF216785_1  papain-like cysteine proteinase isoform...    137   2e-36   Ipomoea batatas [batate]
gb|KDP41743.1|  hypothetical protein JCGZ_26761                         133   1e-34   Jatropha curcas
ref|XP_007042077.1|  Papain family cysteine protease                    133   2e-34   Theobroma cacao [chocolate]
ref|XP_002512963.1|  cysteine protease, putative                        132   2e-34   Ricinus communis
gb|AIB06024.1|  CP2                                                     132   3e-34   Hevea brasiliensis [jebe]
ref|XP_011088458.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    131   5e-34   Sesamum indicum [beniseed]
gb|KHG24064.1|  Cysteinease RD19a -like protein                         131   5e-34   Gossypium arboreum [tree cotton]
ref|XP_009406357.1|  PREDICTED: cysteine proteinase 1-like              131   6e-34   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAX19661.1|  cysteine proteinase                                     131   6e-34   Populus tomentosa [Chinese white poplar]
emb|CDP20652.1|  unnamed protein product                                131   7e-34   Coffea canephora [robusta coffee]
ref|XP_011047717.1|  PREDICTED: cysteine proteinase RD19a               130   8e-34   Populus euphratica
ref|XP_002280798.2|  PREDICTED: cysteine proteinase 15A                 130   1e-33   Vitis vinifera
gb|KJB79047.1|  hypothetical protein B456_013G033800                    130   2e-33   Gossypium raimondii
gb|KJB32561.1|  hypothetical protein B456_005G247000                    130   2e-33   Gossypium raimondii
gb|ABQ10201.1|  cysteine protease Cp3                                   130   2e-33   Actinidia deliciosa [Chinese gooseberry]
gb|KDO49483.1|  hypothetical protein CISIN_1g017318mg                   130   2e-33   Citrus sinensis [apfelsine]
ref|XP_006487337.1|  PREDICTED: cysteine proteinase RD19a-like          130   2e-33   Citrus sinensis [apfelsine]
emb|CAE54306.1|  putative papain-like cysteine proteinase               129   2e-33   Gossypium hirsutum [American cotton]
ref|XP_010271520.1|  PREDICTED: cysteine proteinase RD19a-like          129   3e-33   Nelumbo nucifera [Indian lotus]
ref|XP_011028940.1|  PREDICTED: cysteine proteinase 15A-like            129   3e-33   Populus euphratica
sp|P05993.1|PAPA5_CARPA  RecName: Full=Cysteine proteinase; AltNa...    122   3e-33   Carica papaya [mamon]
gb|KHG15253.1|  Cysteinease RD19a -like protein                         129   4e-33   Gossypium arboreum [tree cotton]
ref|XP_002313770.1|  cysteine proteinase A494 precursor                 129   4e-33   Populus trichocarpa [western balsam poplar]
gb|ABK92536.1|  unknown                                                 129   4e-33   Populus trichocarpa [western balsam poplar]
ref|XP_007131787.1|  hypothetical protein PHAVU_011G041600g             129   4e-33   Phaseolus vulgaris [French bean]
ref|XP_003606998.1|  Cysteine proteinase                                129   4e-33   Medicago truncatula
ref|NP_001267989.1|  cysteine protease precursor                        129   6e-33   Vitis vinifera
gb|ABK94801.1|  unknown                                                 128   6e-33   Populus trichocarpa [western balsam poplar]
ref|XP_006423403.1|  hypothetical protein CICLE_v10028670mg             128   6e-33   Citrus clementina
ref|XP_009373025.1|  PREDICTED: cysteine proteinase RD19a-like          128   7e-33   Pyrus x bretschneideri [bai li]
ref|XP_010061009.1|  PREDICTED: cysteine proteinase RD19a-like          128   7e-33   Eucalyptus grandis [rose gum]
ref|XP_007017672.1|  Papain family cysteine protease                    129   7e-33   Theobroma cacao [chocolate]
gb|ABK96580.1|  unknown                                                 128   8e-33   Populus trichocarpa x Populus deltoides
ref|XP_003523684.1|  PREDICTED: cysteine proteinase 15A-like            128   8e-33   Glycine max [soybeans]
ref|XP_004291404.1|  PREDICTED: cysteine proteinase 15A-like            128   9e-33   Fragaria vesca subsp. vesca
ref|NP_001241450.1|  uncharacterized protein LOC100778716 precursor     128   9e-33   Glycine max [soybeans]
dbj|BAJ53178.1|  JHL18I08.12                                            128   1e-32   Jatropha curcas
ref|XP_011037175.1|  PREDICTED: cysteine proteinase RD19a-like          128   1e-32   Populus euphratica
ref|XP_004290288.1|  PREDICTED: probable cysteine proteinase A494       127   1e-32   Fragaria vesca subsp. vesca
ref|XP_004507484.1|  PREDICTED: cysteine proteinase RD19a-like          127   1e-32   Cicer arietinum [garbanzo]
ref|XP_002275759.1|  PREDICTED: cysteine proteinase RD19a               127   1e-32   Vitis vinifera
ref|XP_010105270.1|  Cysteine proteinase 15A                            127   1e-32   Morus notabilis
ref|XP_003539008.1|  PREDICTED: cysteine proteinase RD19a-like          127   1e-32   Glycine max [soybeans]
ref|XP_011092831.1|  PREDICTED: cysteine proteinase RD19a-like          127   1e-32   Sesamum indicum [beniseed]
gb|KHN45894.1|  Cysteine proteinase RD19a                               127   2e-32   Glycine soja [wild soybean]
ref|XP_002302004.2|  hypothetical protein POPTR_0002s03020g             127   2e-32   Populus trichocarpa [western balsam poplar]
gb|ABF46642.1|  papain-like cysteine proteinase                         127   2e-32   Pachysandra terminalis
ref|XP_004148554.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    127   2e-32   
ref|XP_008236965.1|  PREDICTED: cysteine proteinase RD19a               127   2e-32   Prunus mume [ume]
gb|KGN43159.1|  Papain-like cysteine proteinase isoform I               127   2e-32   Cucumis sativus [cucumbers]
ref|XP_004165230.1|  PREDICTED: cysteine proteinase RD19a-like          127   2e-32   
ref|XP_002305451.2|  cysteine proteinase A494 precursor                 127   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_002510469.1|  cysteine protease, putative                        127   2e-32   Ricinus communis
ref|XP_009373000.1|  PREDICTED: cysteine proteinase RD19a               127   2e-32   Pyrus x bretschneideri [bai li]
ref|XP_010268619.1|  PREDICTED: cysteine proteinase RD19a-like          127   2e-32   Nelumbo nucifera [Indian lotus]
ref|XP_007201310.1|  hypothetical protein PRUPE_ppa007454mg             127   2e-32   Prunus persica
ref|XP_008382317.1|  PREDICTED: cysteine proteinase RD19a               127   3e-32   Malus domestica [apple tree]
gb|ACI04578.1|  cysteine protease-like protein                          126   3e-32   Robinia pseudoacacia [black locust]
ref|XP_010028631.1|  PREDICTED: cysteine proteinase RD19a-like          126   4e-32   Eucalyptus grandis [rose gum]
ref|XP_010066197.1|  PREDICTED: probable cysteine proteinase A494       126   4e-32   Eucalyptus grandis [rose gum]
ref|XP_009392632.1|  PREDICTED: cysteine proteinase 1-like              126   4e-32   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAD29084.1|AF082181_1  cysteine proteinase precursor                 126   5e-32   Solanum melongena [aubergine]
ref|XP_003540987.1|  PREDICTED: cysteine proteinase RD19a-like          126   5e-32   Glycine max [soybeans]
ref|XP_011045161.1|  PREDICTED: cysteine proteinase 15A-like            126   5e-32   Populus euphratica
gb|KHN22211.1|  Cysteine proteinase 15A                                 125   5e-32   Glycine soja [wild soybean]
gb|EYU37835.1|  hypothetical protein MIMGU_mgv1a008237mg                126   6e-32   Erythranthe guttata [common monkey flower]
emb|CDQ51995.1|  Cysteine proteinase                                    121   6e-32   Fagus sylvatica
ref|XP_008775532.1|  PREDICTED: cysteine proteinase 1-like              125   6e-32   Phoenix dactylifera
ref|XP_008448073.1|  PREDICTED: cysteine proteinase RD19a-like          126   6e-32   Cucumis melo [Oriental melon]
ref|XP_004150061.1|  PREDICTED: cysteine proteinase RD19a-like          125   8e-32   Cucumis sativus [cucumbers]
gb|AIB06025.1|  CP3                                                     125   8e-32   Hevea brasiliensis [jebe]
gb|AAR92156.1|  putative cysteine protease 3                            124   8e-32   Iris x hollandica [Dutch iris]
ref|XP_010672379.1|  PREDICTED: cysteine proteinase RD19a-like          125   9e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009376976.1|  PREDICTED: cysteine proteinase RD19a-like          126   9e-32   Pyrus x bretschneideri [bai li]
ref|XP_008460996.1|  PREDICTED: cysteine proteinase RD19a-like          125   1e-31   Cucumis melo [Oriental melon]
gb|KJB07487.1|  hypothetical protein B456_001G026600                    125   1e-31   Gossypium raimondii
ref|XP_010910124.1|  PREDICTED: cysteine proteinase 1-like              125   1e-31   Elaeis guineensis
ref|XP_007136047.1|  hypothetical protein PHAVU_009G013600g             125   1e-31   Phaseolus vulgaris [French bean]
ref|XP_002280808.2|  PREDICTED: cysteine proteinase 15A                 125   1e-31   Vitis vinifera
gb|AGV54334.1|  cysteine proteinase RD19a-like protein                  125   1e-31   Phaseolus vulgaris [French bean]
gb|AAU81589.1|  cysteine proteinase                                     122   1e-31   Petunia x hybrida [garden petunia]
gb|AAL69389.1|AF462226_1  putative cysteine proteinase                  119   1e-31   Narcissus pseudonarcissus
ref|XP_010530325.1|  PREDICTED: cysteine proteinase RD19a               124   2e-31   Tarenaya hassleriana [spider flower]
gb|ABK96252.1|  unknown                                                 120   2e-31   Populus trichocarpa x Populus deltoides
ref|XP_009146338.1|  PREDICTED: cysteine proteinase 15A-like            124   2e-31   Brassica rapa
ref|XP_009376977.1|  PREDICTED: cysteine proteinase RD19a-like          125   2e-31   Pyrus x bretschneideri [bai li]
emb|CDY34441.1|  BnaC01g21920D                                          124   2e-31   Brassica napus [oilseed rape]
dbj|BAC41322.1|  hypothetical protein                                   124   2e-31   Lotus japonicus
ref|XP_002306900.1|  hypothetical protein POPTR_0005s25540g             124   2e-31   Populus trichocarpa [western balsam poplar]
gb|KHN25410.1|  Cysteine proteinase RD19a                               124   3e-31   Glycine soja [wild soybean]
gb|AAL05851.1|AF411121_1  cysteine proteinase precursor                 124   3e-31   Sandersonia aurantiaca [Chinese-lantern lily]
ref|XP_006473584.1|  PREDICTED: cysteine proteinase 15A-like            124   4e-31   Citrus sinensis [apfelsine]
emb|CAE45588.1|  papain-like cysteine proteinase-like protein 1         123   4e-31   Lotus japonicus
gb|KHN39817.1|  Cysteine proteinase RD19a                               123   4e-31   Glycine soja [wild soybean]
emb|CDY09707.1|  BnaC07g33540D                                          123   4e-31   Brassica napus [oilseed rape]
gb|KDO84720.1|  hypothetical protein CISIN_1g017548mg                   123   5e-31   Citrus sinensis [apfelsine]
ref|XP_010531457.1|  PREDICTED: probable cysteine proteinase A494       123   6e-31   Tarenaya hassleriana [spider flower]
dbj|BAF98584.1|  CM0216.500.nc                                          123   6e-31   Lotus japonicus
gb|EYU42593.1|  hypothetical protein MIMGU_mgv1a008336mg                123   7e-31   Erythranthe guttata [common monkey flower]
ref|XP_006435090.1|  hypothetical protein CICLE_v10001559mg             122   7e-31   Citrus clementina
ref|XP_003589348.1|  Cysteine proteinase                                122   8e-31   Medicago truncatula
gb|ABK93575.1|  unknown                                                 118   8e-31   Populus trichocarpa [western balsam poplar]
emb|CAE45589.1|  papain-like cysteine proteinase-like protein 2         122   9e-31   Lotus japonicus
ref|XP_010440192.1|  PREDICTED: cysteine proteinase RD19a-like          122   9e-31   Camelina sativa [gold-of-pleasure]
ref|XP_009351218.1|  PREDICTED: cysteine proteinase RD19a-like          121   9e-31   Pyrus x bretschneideri [bai li]
ref|XP_004230928.1|  PREDICTED: cysteine proteinase RD19a               122   1e-30   Solanum lycopersicum
ref|XP_006362019.1|  PREDICTED: cysteine proteinase RD19a-like          122   1e-30   Solanum tuberosum [potatoes]
gb|AAM65162.1|  cysteine proteinase RD19A                               122   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006828787.1|  hypothetical protein AMTR_s00001p00114210          122   1e-30   Amborella trichopoda
ref|XP_010434865.1|  PREDICTED: cysteine proteinase 15A-like            122   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_003550405.2|  PREDICTED: cysteine proteinase 15A                 122   1e-30   
emb|CDX98179.1|  BnaC07g09190D                                          115   1e-30   Brassica napus [oilseed rape]
ref|NP_568052.1|  cysteine proteinase RD19a                             122   2e-30   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF98585.1|  CM0216.510.nc                                          122   2e-30   Lotus japonicus
ref|XP_008387995.1|  PREDICTED: cysteine proteinase 15A                 122   2e-30   Malus domestica [apple tree]
ref|XP_010449835.1|  PREDICTED: cysteine proteinase 15A-like            122   2e-30   Camelina sativa [gold-of-pleasure]
gb|ACK57563.1|  cysteine protease-like protein                          122   2e-30   Arachis hypogaea [goober]
ref|XP_004238314.1|  PREDICTED: cysteine proteinase 15A                 122   2e-30   
ref|XP_008775280.1|  PREDICTED: cysteine proteinase 1-like              122   2e-30   Phoenix dactylifera
sp|P25804.1|CYSP_PEA  RecName: Full=Cysteine proteinase 15A; AltN...    121   2e-30   Pisum sativum [garden pea]
ref|XP_007160702.1|  hypothetical protein PHAVU_001G009900g             121   2e-30   Phaseolus vulgaris [French bean]
ref|XP_006341997.1|  PREDICTED: cysteine proteinase 15A-like            121   3e-30   Solanum tuberosum [potatoes]
emb|CAA82995.1|  cysteine proteinase                                    121   3e-30   Vicia sativa [spring vetch]
dbj|BAD94010.1|  drought-inducible cysteine proteinase RD19A prec...    114   3e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009602233.1|  PREDICTED: cysteine proteinase RD19a-like          121   3e-30   Nicotiana tomentosiformis
dbj|BAF46302.1|  cysteine proteinase precursor                          121   3e-30   Ipomoea nil [qian niu]
ref|XP_009136751.1|  PREDICTED: cysteine proteinase RD19a-like          121   3e-30   Brassica rapa
emb|CAB53397.1|  cysteine protease                                      118   3e-30   Medicago sativa [alfalfa]
emb|CDX90537.1|  BnaA03g42440D                                          121   3e-30   Brassica napus [oilseed rape]
ref|XP_009611293.1|  PREDICTED: cysteine proteinase 15A-like            121   3e-30   Nicotiana tomentosiformis
gb|AAK07731.1|  CPR2-like cysteine proteinase                           121   3e-30   Nicotiana tabacum [American tobacco]
dbj|BAF03553.1|  cysteine proteinase CP2                                121   3e-30   Phaseolus vulgaris [French bean]
ref|XP_008221329.1|  PREDICTED: cysteine proteinase 15A-like            121   3e-30   Prunus mume [ume]
gb|AAO11786.1|  pre-pro cysteine proteinase                             121   3e-30   Vicia faba [broad bean]
gb|AAB67878.1|  pre-pro-cysteine proteinase                             120   4e-30   Vicia faba [broad bean]
emb|CAA78361.1|  tobacco pre-pro-cysteine proteinase                    120   4e-30   Nicotiana tabacum [American tobacco]
emb|CAA78365.1|  tobacco pre-pro-cysteine proteinase                    120   4e-30   Nicotiana tabacum [American tobacco]
gb|AAQ81938.1|  cysteine proteinase precursor                           120   5e-30   Ipomoea batatas [batate]
gb|KJB29611.1|  hypothetical protein B456_005G110200                    120   5e-30   Gossypium raimondii
emb|CDP07452.1|  unnamed protein product                                120   5e-30   Coffea canephora [robusta coffee]
ref|NP_001266121.1|  uncharacterized protein LOC101501911 precursor     120   5e-30   Cicer arietinum [garbanzo]
gb|AAU81591.1|  cysteine proteinase                                     117   5e-30   Petunia x hybrida [garden petunia]
ref|XP_006283974.1|  hypothetical protein CARUB_v10005098mg             120   5e-30   Capsella rubella
ref|XP_006283963.1|  hypothetical protein CARUB_v10005086mg             120   6e-30   Capsella rubella
gb|KHG15062.1|  Cysteinease RD19a -like protein                         120   6e-30   Gossypium arboreum [tree cotton]
ref|XP_009405542.1|  PREDICTED: cysteine proteinase 1-like              120   6e-30   Musa acuminata subsp. malaccensis [pisang utan]
gb|AJA74415.1|  cysteine protease                                       120   7e-30   Cicer arietinum [garbanzo]
gb|ACX54787.2|  cysteine protease                                       120   7e-30   Arachis diogoi
gb|AJP16692.1|  cysteine protease                                       115   7e-30   Striga hermonthica [purple witchweed]
gb|KJB58164.1|  hypothetical protein B456_009G197400                    120   7e-30   Gossypium raimondii
gb|EPS70818.1|  cysteine proteinase                                     120   8e-30   Genlisea aurea
ref|XP_006414378.1|  hypothetical protein EUTSA_v10025521mg             120   8e-30   Eutrema salsugineum
ref|XP_009109502.1|  PREDICTED: cysteine proteinase RD19a-like          120   8e-30   Brassica rapa
ref|XP_007223351.1|  hypothetical protein PRUPE_ppa007441mg             120   9e-30   Prunus persica
ref|XP_010943608.1|  PREDICTED: cysteine proteinase 1-like              120   9e-30   Elaeis guineensis
ref|XP_009776238.1|  PREDICTED: cysteine proteinase 15A-like            120   9e-30   Nicotiana sylvestris
gb|AAB62937.1|  stress-induced cysteine proteinase                      115   1e-29   Lavatera thuringiaca
emb|CAA78403.1|  pre-pro-cysteine proteinase                            119   1e-29   Solanum lycopersicum
ref|XP_010437007.1|  PREDICTED: cysteine proteinase RD19a-like          119   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010431862.1|  PREDICTED: cysteine proteinase RD19a               119   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_008444769.1|  PREDICTED: cysteine proteinase RD19a-like          119   1e-29   Cucumis melo [Oriental melon]
ref|XP_011083631.1|  PREDICTED: cysteine proteinase 15A-like            119   1e-29   Sesamum indicum [beniseed]
dbj|BAG16515.1|  putative cysteine proteinase                           119   2e-29   Capsicum chinense [bonnet pepper]
emb|CAD40319.2|  OSJNBb0054B09.3                                        119   2e-29   Oryza sativa Japonica Group [Japonica rice]
gb|EEE60725.1|  hypothetical protein OsJ_14236                          119   2e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003579573.2|  PREDICTED: cysteine proteinase 1-like              119   3e-29   Brachypodium distachyon [annual false brome]
gb|AAL60581.1|AF454959_1  senescence-associated cysteine protease       118   3e-29   Brassica oleracea
gb|ACM80348.1|  cysteine proteinase                                     118   3e-29   Solanum lycopersicum
emb|CDY71205.1|  BnaCnng71840D                                          118   3e-29   Brassica napus [oilseed rape]
gb|KHN12668.1|  Cysteine proteinase 15A                                 114   3e-29   Glycine soja [wild soybean]
gb|EAY93546.1|  hypothetical protein OsI_15336                          118   3e-29   Oryza sativa Indica Group [Indian rice]
emb|CAB17075.1|  cysteine proteinase precursor                          118   3e-29   Phaseolus vulgaris [French bean]
ref|XP_009335626.1|  PREDICTED: cysteine proteinase 15A                 118   3e-29   Pyrus x bretschneideri [bai li]
ref|NP_567489.1|  papain family cysteine protease                       118   4e-29   Arabidopsis thaliana [mouse-ear cress]
gb|KFK24413.1|  hypothetical protein AALP_AAs58848U000200               118   4e-29   Arabis alpina [alpine rockcress]
gb|EMT16425.1|  Cysteine proteinase 1                                   118   5e-29   Aegilops tauschii
gb|ABK24153.1|  unknown                                                 118   5e-29   Picea sitchensis
ref|XP_002452058.1|  hypothetical protein SORBIDRAFT_04g017830          117   5e-29   Sorghum bicolor [broomcorn]
ref|XP_002870174.1|  hypothetical protein ARALYDRAFT_915142             117   6e-29   Arabidopsis lyrata subsp. lyrata
ref|XP_006411706.1|  hypothetical protein EUTSA_v10025494mg             117   7e-29   Eutrema salsugineum
dbj|BAD43619.1|  putative cysteine proteinase                           117   7e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006653265.1|  PREDICTED: cysteine proteinase 1-like              117   7e-29   
ref|XP_004152668.1|  PREDICTED: cysteine proteinase RD19a-like          117   8e-29   Cucumis sativus [cucumbers]
gb|KFK30492.1|  hypothetical protein AALP_AA7G268600                    117   8e-29   Arabis alpina [alpine rockcress]
ref|XP_004952477.1|  PREDICTED: cysteine proteinase 1-like              117   8e-29   Setaria italica
ref|NP_565512.1|  Papain family cysteine protease                       117   9e-29   Arabidopsis thaliana [mouse-ear cress]
gb|EMS53996.1|  Cysteine proteinase 1                                   117   9e-29   Triticum urartu
ref|XP_002279862.1|  PREDICTED: cysteine proteinase RD19a               117   1e-28   Vitis vinifera
ref|XP_006404590.1|  hypothetical protein EUTSA_v10000210mg             117   1e-28   Eutrema salsugineum
ref|XP_002880378.1|  hypothetical protein ARALYDRAFT_481008             116   2e-28   Arabidopsis lyrata subsp. lyrata
dbj|BAA92495.1|  cysteine protease                                      116   2e-28   Vigna mungo [urad dal]
ref|XP_002868883.1|  hypothetical protein ARALYDRAFT_490677             116   2e-28   Arabidopsis lyrata subsp. lyrata
ref|XP_004975256.1|  PREDICTED: cysteine proteinase 1-like              116   2e-28   Setaria italica
emb|CDY41960.1|  BnaA01g05320D                                          115   3e-28   Brassica napus [oilseed rape]
gb|AAZ32411.1|  cysteine proteinase glycinain type                      115   3e-28   Nicotiana benthamiana
ref|XP_010446443.1|  PREDICTED: cysteine proteinase RD19a               115   4e-28   Camelina sativa [gold-of-pleasure]
ref|XP_006665032.1|  PREDICTED: cysteine proteinase 1-like              112   4e-28   
ref|NP_001105685.1|  cysteine proteinase 1 precursor                    115   4e-28   Zea mays [maize]
gb|ACF86683.1|  unknown                                                 115   5e-28   Zea mays [maize]
gb|EYU27644.1|  hypothetical protein MIMGU_mgv1a008452mg                115   5e-28   Erythranthe guttata [common monkey flower]
ref|XP_003574963.1|  PREDICTED: cysteine proteinase 1-like              115   6e-28   Brachypodium distachyon [annual false brome]
ref|XP_009150026.1|  PREDICTED: cysteine proteinase RD19a               115   6e-28   Brassica rapa
ref|XP_003545051.1|  PREDICTED: cysteine proteinase 15A-like            114   6e-28   Glycine max [soybeans]
emb|CAQ00101.1|  papain-like cysteine proteinase                        115   6e-28   Hordeum vulgare subsp. vulgare [barley]
emb|CDX99593.1|  BnaC04g33500D                                          114   6e-28   Brassica napus [oilseed rape]
ref|XP_009140277.1|  PREDICTED: probable cysteine proteinase A494       114   7e-28   Brassica rapa
emb|CDY15894.1|  BnaA04g12170D                                          114   7e-28   Brassica napus [oilseed rape]
dbj|BAD10859.1|  cysteine protease                                      114   1e-27   Tripolium pannonicum [sea starwort]
ref|NP_001052440.1|  Os04g0311400                                       114   1e-27   
emb|CAA52403.1|  putative thiol protease                                113   1e-27   Arabidopsis thaliana [mouse-ear cress]
gb|ABK21238.1|  unknown                                                 114   2e-27   Picea sitchensis
gb|ABK24688.1|  unknown                                                 114   2e-27   Picea sitchensis
gb|ACN40679.1|  unknown                                                 113   2e-27   Picea sitchensis
gb|AGS43121.1|  cysteine protease 1                                     107   2e-27   Zea mays [maize]
gb|AEX97108.1|  cysteine proteinase                                     107   4e-27   Malus domestica [apple tree]
emb|CAA57675.1|  cysteine proteinase                                    108   5e-27   Zea mays [maize]
ref|NP_001046828.1|  Os02g0469600                                       112   5e-27   
gb|EMT10192.1|  Cysteine proteinase 1                                   112   7e-27   Aegilops tauschii
tpe|CAD66657.1|  TPA: putative cysteine proteinase precursor            112   8e-27   Hordeum vulgare subsp. vulgare [barley]
ref|XP_003607110.1|  Cysteine proteinase                                111   8e-27   Medicago truncatula
gb|KEH30505.1|  papain family cysteine protease                         110   1e-26   Medicago truncatula
gb|AAW21813.1|  cysteine protease                                       111   1e-26   Triticum aestivum [Canadian hard winter wheat]
gb|AAB16996.1|  thiol protease isoform B                                110   2e-26   Glycine max [soybeans]
gb|EPS65881.1|  cysteine proteinase                                     110   2e-26   Genlisea aurea
emb|CAH59428.1|  cysteine protease 2                                    108   4e-26   Plantago major [cart-track plant]
ref|XP_002969223.1|  hypothetical protein SELMODRAFT_91274              109   7e-26   Selaginella moellendorffii
gb|EMS64962.1|  Cysteine proteinase 1                                   107   1e-25   Triticum urartu
ref|XP_009786000.1|  PREDICTED: cysteine proteinase RD19a-like          108   2e-25   Nicotiana sylvestris
dbj|BAC57957.1|  thiol protease                                         104   4e-25   Tripolium pannonicum [sea starwort]
ref|XP_010690815.1|  PREDICTED: cysteine proteinase RD19a               106   7e-25   Beta vulgaris subsp. vulgaris [field beet]
gb|AAB53103.1|  cysteine protease                                       100   1e-24   Brassica napus [oilseed rape]
gb|AES89347.2|  papain family cysteine protease                         105   1e-24   Medicago truncatula
ref|XP_003607150.1|  Cysteine proteinase                                105   2e-24   
gb|AAB16997.1|  thiol protease isoform A                                104   2e-24   Glycine max [soybeans]
ref|XP_002960585.1|  hypothetical protein SELMODRAFT_266583             103   5e-24   Selaginella moellendorffii
ref|NP_001059639.1|  Os07g0480900                                       102   1e-23   
ref|XP_009404192.1|  PREDICTED: cysteine proteinase 15A                 102   2e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002460693.1|  hypothetical protein SORBIDRAFT_02g033270          102   2e-23   Sorghum bicolor [broomcorn]
ref|XP_006293095.1|  hypothetical protein CARUB_v10019394mg             101   5e-23   Capsella rubella
ref|XP_006658557.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    100   9e-23   Oryza brachyantha
ref|XP_004959670.1|  PREDICTED: cysteine proteinase 1-like              100   1e-22   Setaria italica
tpg|DAA40800.1|  TPA: putative cysteine protease family protein         100   1e-22   Zea mays [maize]
ref|XP_010504326.1|  PREDICTED: cysteine proteinase 15A-like          99.8    1e-22   Camelina sativa [gold-of-pleasure]
gb|KFK34737.1|  hypothetical protein AALP_AA5G186400                  99.8    2e-22   Arabis alpina [alpine rockcress]
gb|EMS59778.1|  Cysteine proteinase 15A                               97.4    2e-22   Triticum urartu
gb|ADY04293.1|  cysteine protease                                     95.9    2e-22   Clarkia xantiana subsp. xantiana
emb|CAQ00102.1|  papain-like cysteine proteinase                      99.4    2e-22   Hordeum vulgare subsp. vulgare [barley]
ref|XP_008776953.1|  PREDICTED: cysteine proteinase-like              95.5    3e-22   Phoenix dactylifera
gb|ADY04361.1|  cysteine protease                                     95.5    4e-22   Clarkia xantiana subsp. xantiana
gb|ADY04414.1|  cysteine protease                                     95.5    4e-22   Clarkia xantiana subsp. xantiana
gb|ADY04336.1|  cysteine protease                                     95.5    4e-22   Clarkia xantiana subsp. xantiana
gb|ADY04342.1|  cysteine protease                                     95.5    4e-22   Clarkia xantiana subsp. xantiana
gb|ADY04262.1|  cysteine protease                                     95.5    4e-22   Clarkia xantiana subsp. xantiana
ref|XP_003560213.1|  PREDICTED: cysteine proteinase 1                 98.6    4e-22   Brachypodium distachyon [annual false brome]
gb|ADY04457.1|  cysteine protease                                     95.1    4e-22   Clarkia xantiana subsp. xantiana
gb|ADY04359.1|  cysteine protease                                     95.1    5e-22   Clarkia xantiana subsp. xantiana
ref|XP_008804021.1|  PREDICTED: cysteine proteinase RD19a-like        96.7    6e-22   Phoenix dactylifera
gb|ADY04482.1|  cysteine protease                                     94.7    7e-22   Clarkia xantiana subsp. xantiana
gb|ADY04358.1|  cysteine protease                                     94.7    8e-22   Clarkia xantiana subsp. xantiana
gb|ADY04368.1|  cysteine protease                                     94.4    1e-21   Clarkia xantiana subsp. xantiana
gb|ADY04268.1|  cysteine protease                                     94.4    1e-21   Clarkia xantiana subsp. xantiana
gb|ADY04480.1|  cysteine protease                                     94.0    1e-21   Clarkia xantiana subsp. xantiana
ref|XP_008354070.1|  PREDICTED: cysteine proteinase 15A-like          96.7    1e-21   Malus domestica [apple tree]
ref|XP_008362714.1|  PREDICTED: cysteine proteinase 15A               97.1    1e-21   Malus domestica [apple tree]
ref|XP_010534431.1|  PREDICTED: cysteine proteinase 15A               97.1    2e-21   Tarenaya hassleriana [spider flower]
emb|CAB41090.1|  cysteine proteinase precursor-like protein           97.1    2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567010.5|  Papain family cysteine protease                     96.7    2e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AEQ54770.1|  cysteine proteinase CP1                               97.1    2e-21   Coffea canephora [robusta coffee]
ref|XP_002876278.1|  hypothetical protein ARALYDRAFT_485911           96.7    2e-21   Arabidopsis lyrata subsp. lyrata
gb|EEC82027.1|  hypothetical protein OsI_25996                        99.0    2e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_008802783.1|  PREDICTED: probable cysteine proteinase A494     96.7    2e-21   Phoenix dactylifera
ref|XP_001781954.1|  predicted protein                                96.3    3e-21   Physcomitrella patens
gb|ADY04295.1|  cysteine protease                                     93.2    3e-21   Clarkia xantiana subsp. xantiana
gb|KEH43476.1|  papain family cysteine protease                       96.3    3e-21   Medicago truncatula
ref|XP_006403513.1|  hypothetical protein EUTSA_v10010475mg           95.5    5e-21   
gb|KJB73490.1|  hypothetical protein B456_011G235500                  95.5    6e-21   
ref|XP_009116190.1|  PREDICTED: probable cysteine proteinase A494     95.1    7e-21   
gb|KHG08355.1|  Cysteinease 1                                         95.1    8e-21   
ref|XP_007218137.1|  hypothetical protein PRUPE_ppa007240mg           95.1    8e-21   
emb|CAB16316.1|  cysteine proteinase precursor                        95.1    8e-21   
ref|XP_009117680.1|  PREDICTED: probable cysteine proteinase A494     95.1    8e-21   
ref|XP_008233261.1|  PREDICTED: cysteine proteinase 15A               95.1    8e-21   
emb|CDO99795.1|  unnamed protein product                              95.1    8e-21   
ref|XP_010243268.1|  PREDICTED: cysteine proteinase 15A               94.7    1e-20   
ref|XP_004496226.1|  PREDICTED: cysteine proteinase 15A-like          94.7    1e-20   
ref|XP_010918606.1|  PREDICTED: probable cysteine proteinase A494     94.4    1e-20   
gb|KHN00877.1|  Cysteine proteinase 15A                               94.0    1e-20   
ref|XP_001761980.1|  predicted protein                                94.4    1e-20   
ref|XP_009789260.1|  PREDICTED: cysteine proteinase 15A               94.4    1e-20   
gb|EYU39642.1|  hypothetical protein MIMGU_mgv1a008552mg              93.6    3e-20   
ref|XP_009617441.1|  PREDICTED: cysteine proteinase 15A               93.6    3e-20   
gb|KDP30486.1|  hypothetical protein JCGZ_16165                       92.8    6e-20   
ref|XP_004157559.1|  PREDICTED: cysteine proteinase 15A-like          92.8    7e-20   
ref|XP_004142497.1|  PREDICTED: cysteine proteinase 15A-like          92.8    7e-20   
ref|XP_008446834.1|  PREDICTED: cysteine proteinase 15A               92.4    8e-20   
gb|KHN37802.1|  Cysteine proteinase 1                                 92.0    8e-20   
ref|NP_001236888.1|  cysteine proteinase precursor                    92.0    1e-19   
gb|AAD46920.1|AF167986_1  putative cysteine proteinase GmPM33         91.7    1e-19   
emb|CDY56961.1|  BnaA09g55030D                                        91.3    2e-19   
emb|CDX73424.1|  BnaC08g25790D                                        91.3    2e-19   
ref|XP_004250044.1|  PREDICTED: cysteine proteinase 15A               91.3    2e-19   
ref|XP_007143764.1|  hypothetical protein PHAVU_007G099600g           91.7    3e-19   
ref|XP_006850211.1|  hypothetical protein AMTR_s00022p00251800        90.5    3e-19   
emb|CCA95098.1|  putative responsive to dehydration 19                87.8    3e-19   
ref|XP_011094506.1|  PREDICTED: cysteine proteinase 15A               90.5    4e-19   
emb|CAB17077.1|  cysteine proteinase precursor                        90.5    4e-19   
gb|ADE76932.1|  unknown                                               90.5    4e-19   
ref|XP_006436511.1|  hypothetical protein CICLE_v10031865mg           90.1    5e-19   
emb|CBI31400.3|  unnamed protein product                              89.0    6e-19   
emb|CDY13816.1|  BnaA09g43180D                                        88.6    9e-19   
ref|XP_011024366.1|  PREDICTED: cysteine proteinase 15A               89.4    1e-18   
ref|XP_006361690.1|  PREDICTED: cysteine proteinase 15A-like          88.6    2e-18   
ref|XP_010034320.1|  PREDICTED: cysteine proteinase 1                 88.2    2e-18   
ref|XP_010103534.1|  putative cysteine proteinase A494                87.8    3e-18   
ref|XP_007510080.1|  unknown                                          89.0    5e-18   
ref|XP_010688493.1|  PREDICTED: cysteine proteinase 15A               87.4    5e-18   
ref|XP_002316398.1|  hypothetical protein POPTR_0010s23510g           86.7    6e-18   
gb|AEW08440.1|  hypothetical protein 2_9845_02                        81.3    1e-17   
ref|XP_002533377.1|  cysteine protease, putative                      86.3    1e-17   
emb|CAN64491.1|  hypothetical protein VITISV_015725                   85.5    1e-17   
ref|XP_002266821.1|  PREDICTED: cysteine proteinase 15A               86.3    1e-17   
gb|ABO93617.1|  papain-like cysteine proteinase                       83.6    2e-17   
gb|ADY04490.1|  cysteine protease                                     82.8    2e-17   
emb|CEF99324.1|  Cysteine peptidase, cysteine active site             85.5    3e-17   
gb|EPS63354.1|  hypothetical protein M569_11429                       84.7    3e-17   
ref|XP_007010012.1|  Papain family cysteine protease                  84.7    5e-17   
ref|XP_008647122.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin 7-...  81.6    3e-16   
ref|XP_003081549.1|  Cysteine proteinase Cathepsin F (ISS)            81.6    3e-16   
ref|XP_011469621.1|  PREDICTED: cysteine proteinase 15A-like          80.9    4e-16   
ref|XP_001419933.1|  predicted protein                                80.9    5e-16   
gb|EGI66903.1|  Putative cysteine proteinase                          83.2    8e-16   
ref|XP_011052455.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  83.2    9e-16   
ref|XP_011169692.1|  PREDICTED: putative cysteine proteinase CG12163  83.2    9e-16   
emb|CCA95082.1|  putative responsive to dehydration 19                78.2    1e-15   
gb|EFN80374.1|  Putative cysteine proteinase CG12163                  82.0    2e-15   
ref|XP_011145705.1|  PREDICTED: uncharacterized protein LOC105186896  82.0    2e-15   
ref|XP_011496222.1|  PREDICTED: uncharacterized protein LOC105360904  82.0    3e-15   
ref|XP_006608091.1|  PREDICTED: uncharacterized protein LOC102680728  80.9    5e-15   
ref|XP_003696602.1|  PREDICTED: putative cysteine proteinase CG12...  80.9    5e-15   
dbj|BAI44279.1|  cysteine proteinase inhibitor precursor              81.3    5e-15   
ref|XP_003492760.1|  PREDICTED: hypothetical protein LOC100745708     80.5    7e-15   
gb|ABY75169.1|  cysteine protease                                     73.9    8e-15   
ref|XP_005184486.1|  PREDICTED: putative cysteine proteinase CG12...  80.1    1e-14   
gb|AFW72358.1|  putative cysteine protease family protein             79.7    1e-14   
ref|XP_005184487.1|  PREDICTED: putative cysteine proteinase CG12...  80.1    1e-14   
ref|XP_011184040.1|  PREDICTED: putative cysteine proteinase CG12163  80.1    1e-14   
ref|XP_003707276.1|  PREDICTED: uncharacterized protein LOC100880620  80.1    1e-14   
ref|XP_011203808.1|  PREDICTED: putative cysteine proteinase CG12163  79.7    1e-14   
ref|XP_004519757.1|  PREDICTED: putative cysteine proteinase CG12...  79.7    1e-14   
ref|XP_392381.3|  PREDICTED: putative cysteine proteinase CG12163...  79.3    2e-14   
ref|XP_006567715.1|  PREDICTED: putative cysteine proteinase CG12...  79.3    2e-14   
ref|XP_001607324.1|  PREDICTED: uncharacterized protein LOC100123649  79.3    2e-14   
ref|XP_003057227.1|  predicted protein                                77.0    2e-14   
emb|CBY11269.1|  unnamed protein product                              77.4    3e-14   
gb|KFB38327.1|  AGAP002879-PB-like protein                            79.3    3e-14   
ref|XP_312034.5|  AGAP002879-PA                                       78.6    4e-14   
ref|XP_003436277.1|  AGAP002879-PB                                    78.6    4e-14   
ref|XP_011493714.1|  AAEL017153-PA                                    78.2    5e-14   
gb|AFM37363.1|  cathepsin F1                                          77.0    5e-14   
gb|EFN65613.1|  Putative cysteine proteinase CG12163                  77.8    7e-14   
ref|XP_011260522.1|  PREDICTED: uncharacterized protein LOC105253881  77.8    9e-14   
ref|XP_001844355.1|  conserved hypothetical protein                   77.4    9e-14   
ref|XP_003115597.1|  CRE-TAG-196 protein                              76.6    1e-13   
gb|ETN61472.1|  hypothetical protein AND_006867                       77.4    1e-13   
emb|CBY31096.1|  unnamed protein product                              75.5    1e-13   
ref|NP_505215.2|  Protein TAG-196                                     75.9    1e-13   
ref|XP_008550537.1|  PREDICTED: uncharacterized protein LOC103573287  76.3    2e-13   
ref|XP_003436276.1|  AGAP002879-PC                                    76.3    2e-13   
ref|XP_001994049.1|  GH22731                                          75.5    3e-13   
ref|XP_002635317.1|  C. briggsae CBR-TAG-196 protein                  75.1    3e-13   
gb|AFQ01139.1|  cathepsin F-like protease                             75.1    3e-13   
ref|XP_002000409.1|  GI10216                                          75.5    3e-13   
gb|EHJ64782.1|  cysteine proteinase inhibitor precursor               71.6    3e-13   
ref|XP_002073772.1|  GK14287                                          75.1    4e-13   
gb|EGT34543.1|  hypothetical protein CAEBREN_26318                    74.7    4e-13   
ref|XP_002056575.1|  GJ11017                                          74.7    5e-13   
ref|XP_011309436.1|  PREDICTED: uncharacterized protein LOC105270293  75.1    5e-13   
ref|XP_002017233.1|  GL22196                                          74.7    5e-13   
gb|EGT34572.1|  hypothetical protein CAEBREN_13324                    74.3    6e-13   
gb|ERG79645.1|  cysteine proteinase                                   69.7    6e-13   
ref|XP_002096026.1|  GE25302                                          74.3    7e-13   
ref|XP_002988513.1|  hypothetical protein SELMODRAFT_128220           70.5    7e-13   
ref|XP_002137768.1|  GA27408, isoform A                               74.3    7e-13   
gb|KHN72698.1|  Putative cysteine proteinase                          70.1    7e-13   
gb|ABE72973.1|  cathepsin L                                           72.0    7e-13   
gb|ACR08662.1|  cathepsin F                                           71.2    8e-13   
gb|KIH48456.1|  cysteine proteinase family protein                    68.9    8e-13   
gb|AJF94882.1|  C1 family cathepsin F10                               74.7    8e-13   
gb|EYC18288.1|  hypothetical protein Y032_0028g1777                   69.7    8e-13   
ref|NP_730901.1|  CG12163, isoform A                                  74.3    8e-13   
ref|XP_002038380.1|  GM10654                                          74.3    9e-13   
ref|XP_001955780.1|  GF16067                                          73.9    9e-13   
ref|XP_001978897.1|  GG11133                                          73.9    1e-12   
ref|XP_003736743.1|  GA27408, isoform B                               73.2    1e-12   
gb|EZA58965.1|  Putative cysteine proteinase                          73.9    1e-12   
ref|XP_005184488.1|  PREDICTED: putative cysteine proteinase CG12...  73.2    2e-12   
ref|NP_649521.1|  CG12163, isoform B                                  72.8    2e-12   
ref|XP_011331416.1|  PREDICTED: uncharacterized protein LOC105275911  73.9    2e-12   
ref|XP_002979143.1|  hypothetical protein SELMODRAFT_110288           70.5    2e-12   
ref|XP_008195657.1|  PREDICTED: uncharacterized protein LOC662417...  73.2    3e-12   
ref|XP_008195656.1|  PREDICTED: uncharacterized protein LOC662417...  73.2    3e-12   
emb|CAN80141.1|  hypothetical protein VITISV_038978                   71.6    3e-12   
ref|XP_004519758.1|  PREDICTED: putative cysteine proteinase CG12...  72.4    3e-12   
ref|XP_011434326.1|  PREDICTED: uncharacterized protein LOC105333...  72.8    3e-12   
ref|XP_011434325.1|  PREDICTED: uncharacterized protein LOC105333...  72.8    3e-12   
emb|CDJ92562.1|  Proteinase inhibitor I25 and Proteinase inhibito...  72.0    3e-12   
emb|CDJ88889.1|  Proteinase inhibitor I25 and Proteinase inhibito...  72.0    3e-12   
gb|EKC42097.1|  Cathepsin F                                           72.4    3e-12   
gb|KDR17524.1|  Putative cysteine proteinase                          72.4    6e-12   
gb|ENN81374.1|  hypothetical protein YQE_02191                        72.4    6e-12   
emb|CAN71324.1|  hypothetical protein VITISV_013970                   70.9    8e-12   
ref|XP_003148243.1|  hypothetical protein LOAG_12683                  67.8    1e-11   
gb|EFO15826.2|  hypothetical protein LOAG_12683                       67.8    1e-11   
ref|XP_009047014.1|  hypothetical protein LOTGIDRAFT_172186           68.2    2e-11   
gb|ABC48936.1|  cathepsin F like protease                             70.1    2e-11   
gb|ERL92611.1|  hypothetical protein D910_09924                       69.3    3e-11   
emb|CAN81617.1|  hypothetical protein VITISV_001998                   67.8    3e-11   
emb|CAN81619.1|  hypothetical protein VITISV_002000                   67.8    3e-11   
gb|KFM67613.1|  putative cysteine proteinase                          68.6    5e-11   
ref|XP_635417.1|  cysteine proteinase 1                               67.8    6e-11   
emb|CAA26255.1|  cysteine proteinase I precursor                      67.8    6e-11   
gb|AII16490.1|  cathepsin F                                           67.0    6e-11   
ref|XP_002427787.1|  Cathepsin F precursor, putative                  67.8    9e-11   
ref|XP_006268168.1|  PREDICTED: cathepsin F-like                      67.4    1e-10   
gb|EFX71333.1|  hypothetical protein DAPPUDRAFT_189155                65.5    1e-10   
ref|XP_002682087.1|  predicted protein                                66.6    2e-10   
ref|XP_002505924.1|  cysteine endopeptidase                           65.9    2e-10   
ref|XP_006036937.1|  PREDICTED: cathepsin F-like                      66.6    2e-10   
emb|CBI23088.3|  unnamed protein product                              64.3    2e-10   
ref|XP_006007112.1|  PREDICTED: cathepsin F-like                      66.6    2e-10   
ref|XP_005305646.1|  PREDICTED: cathepsin W-like                      65.9    3e-10   
ref|XP_003386471.1|  PREDICTED: cysteine proteinase 1-like            65.9    3e-10   
ref|NP_001156454.1|  cathepsin F isoform 2 precursor                  66.6    3e-10   
ref|XP_006038953.1|  PREDICTED: cathepsin W-like                      65.9    3e-10   
ref|XP_007438969.1|  PREDICTED: cathepsin F-like                      63.5    4e-10   
ref|XP_001894882.1|  cathepsin F-like cysteine proteinase             63.2    4e-10   
ref|XP_008177856.1|  PREDICTED: cathepsin W-like                      62.4    4e-10   
gb|ELW65130.1|  Cathepsin W                                           65.9    5e-10   
ref|XP_006121731.1|  PREDICTED: cathepsin W-like                      63.5    5e-10   
gb|AAT07059.1|  cathepsin F-like cysteine proteinase                  65.9    5e-10   
dbj|BAD94378.1|  hypothetical protein                                 60.8    5e-10   
ref|XP_006149977.1|  PREDICTED: cathepsin W                           65.1    6e-10   
ref|XP_003375070.1|  viral cathepsin                                  65.5    6e-10   
emb|CDX88753.1|  BnaA03g08960D                                        64.7    7e-10   
gb|ELV09527.1|  Cathepsin F                                           65.5    7e-10   
emb|CDJ26737.1|  cathepsin F-like cysteine peptidase protein          65.1    8e-10   
ref|XP_005351748.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      65.1    8e-10   
ref|XP_006980634.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      65.1    8e-10   
gb|ELT97360.1|  hypothetical protein CAPTEDRAFT_147978                63.5    8e-10   
ref|XP_009029595.1|  hypothetical protein HELRODRAFT_157956           63.9    9e-10   
ref|NP_001133678.1|  Cathepsin F precursor                            65.1    9e-10   
emb|CEF63690.1|  Cathepsin F                                          64.3    1e-09   
ref|XP_006827472.1|  hypothetical protein AMTR_s00009p00129100        64.3    1e-09   
gb|EGW06365.1|  Cathepsin F                                           64.7    1e-09   
ref|XP_007648967.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      64.7    1e-09   
ref|XP_006276364.1|  PREDICTED: uncharacterized protein LOC102558525  64.7    1e-09   
ref|XP_008479905.1|  PREDICTED: cathepsin L-like                      63.9    1e-09   
ref|XP_004351999.1|  cysteine protease                                63.9    1e-09   
gb|ERE78742.1|  cathepsin F                                           64.3    1e-09   
ref|XP_005305555.1|  PREDICTED: cathepsin F                           63.9    2e-09   
emb|CDQ79130.1|  unnamed protein product                              64.3    2e-09   
ref|XP_002610214.1|  hypothetical protein BRAFLDRAFT_216923           62.8    2e-09   
ref|XP_003284553.1|  hypothetical protein DICPUDRAFT_96752            63.5    2e-09   
ref|XP_004596903.1|  PREDICTED: cathepsin W                           63.9    2e-09   
gb|AAF21461.1|U69120_1  cysteine proteinase PWCP1                     63.9    2e-09   
emb|CDP90584.1|  Protein BM-TAG-196                                   64.3    2e-09   
ref|XP_004596891.1|  PREDICTED: cathepsin F                           63.9    2e-09   
ref|XP_635374.1|  cysteine protease                                   63.5    2e-09   
ref|XP_005064094.1|  PREDICTED: cathepsin F                           63.9    2e-09   
ref|XP_008821074.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      63.9    2e-09   
ref|XP_010896687.1|  PREDICTED: cathepsin F                           63.9    2e-09   
ref|XP_006258352.1|  PREDICTED: cathepsin W-like                      62.8    2e-09   
gb|ACN10907.1|  Cathepsin F precursor                                 63.9    2e-09   
ref|NP_001156453.1|  cathepsin F isoform 1 precursor                  64.3    2e-09   
ref|XP_006036386.1|  PREDICTED: cathepsin W-like                      60.8    2e-09   
ref|XP_004364962.1|  cysteine proteinase 7                            63.2    2e-09   
ref|XP_003578189.1|  PREDICTED: thiol protease aleurain               63.5    2e-09   
gb|EJW79799.1|  cysteine protease 6                                   62.0    2e-09   
ref|XP_009161938.1|  hypothetical protein T265_00017                  61.2    3e-09   
gb|AAO12867.1|  papain-like cysteine proteinase                       58.9    3e-09   
gb|AAB82455.1|  lymphopain                                            63.2    3e-09   
ref|XP_010765827.1|  PREDICTED: cathepsin W                           63.9    3e-09   
ref|NP_034115.2|  cathepsin W preproprotein                           63.2    3e-09   
ref|XP_006129733.1|  PREDICTED: cathepsin F-like                      63.2    3e-09   
ref|XP_002119872.3|  PREDICTED: cathepsin L-like                      63.5    3e-09   
ref|XP_003747496.1|  PREDICTED: cathepsin L-like                      62.8    3e-09   
ref|XP_005770574.1|  hypothetical protein EMIHUDRAFT_349865           63.2    3e-09   
ref|NP_001029282.1|  cathepsin F precursor                            63.5    3e-09   
gb|AAT09103.1|  digestive cysteine proteinase                         63.2    3e-09   
ref|XP_011367167.1|  PREDICTED: cathepsin W                           63.2    3e-09   
dbj|GAA47436.1|  cathepsin L                                          61.6    3e-09   
ref|XP_011406938.1|  PREDICTED: silicatein-like                       60.8    3e-09   
ref|XP_006171430.1|  PREDICTED: cathepsin F                           63.2    3e-09   
ref|XP_007056266.1|  PREDICTED: cathepsin F-like                      63.5    3e-09   
gb|AAF40479.1|  cystein protease                                      62.8    3e-09   



>gb|AAK27969.1|AF242373_1 cysteine protease [Ipomoea batatas]
Length=366

 Score =   140 bits (352),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 61/66 (92%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAAV
Sbjct  301  GVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAV  360

Query  183  NTPTSD  200
            +T TSD
Sbjct  361  STTTSD  366



>gb|AAF40415.1|AF216784_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=368

 Score =   139 bits (350),  Expect = 6e-37, Method: Composition-based stats.
 Identities = 61/66 (92%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAAV
Sbjct  303  GVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAV  362

Query  183  NTPTSD  200
            +T TSD
Sbjct  363  STTTSD  368



>gb|AAF61440.1|AF138264_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   139 bits (350),  Expect = 7e-37, Method: Composition-based stats.
 Identities = 61/66 (92%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAAV
Sbjct  303  GVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAV  362

Query  183  NTPTSD  200
            +T TSD
Sbjct  363  STTTSD  368



>gb|AAF40414.1|AF216783_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   139 bits (350),  Expect = 7e-37, Method: Composition-based stats.
 Identities = 61/66 (92%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAAV
Sbjct  303  GVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAV  362

Query  183  NTPTSD  200
            +T TSD
Sbjct  363  STTTSD  368



>gb|AAF61441.1|AF138265_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=366

 Score =   139 bits (349),  Expect = 9e-37, Method: Composition-based stats.
 Identities = 61/66 (92%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAAV
Sbjct  301  GVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAV  360

Query  183  NTPTSD  200
            +T TSD
Sbjct  361  STTTSD  366



>gb|AAF40416.1|AF216785_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
 gb|AAF61442.1|AF138266_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
Length=366

 Score =   137 bits (346),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 61/66 (92%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAAV
Sbjct  301  GVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAV  360

Query  183  NTPTSD  200
            +T TSD
Sbjct  361  STTTSD  366



>gb|KDP41743.1| hypothetical protein JCGZ_26761 [Jatropha curcas]
Length=370

 Score =   133 bits (334),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 58/64 (91%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTVAAV
Sbjct  306  GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGETWGESGYYKICRGRNVCGVDSMVSTVAAV  365

Query  183  NTPT  194
             T +
Sbjct  366  QTSS  369



>ref|XP_007042077.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOX97908.1| Papain family cysteine protease [Theobroma cacao]
Length=395

 Score =   133 bits (334),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAP+R+K+KPYWIIKNSWGESWGE G+YKICRGRNICGVDSMVSTVAAV
Sbjct  331  GVLLVGYGSAGYAPVRMKDKPYWIIKNSWGESWGEDGFYKICRGRNICGVDSMVSTVAAV  390

Query  183  NT  188
            +T
Sbjct  391  DT  392



>ref|XP_002512963.1| cysteine protease, putative [Ricinus communis]
 gb|EEF49466.1| cysteine protease, putative [Ricinus communis]
Length=373

 Score =   132 bits (333),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 58/64 (91%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIR+KEKPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAAV
Sbjct  309  GVLLVGYGSAGYAPIRMKEKPYWIIKNSWGENWGESGYYKICRGRNICGVDSMVSTVAAV  368

Query  183  NTPT  194
             T +
Sbjct  369  QTAS  372



>gb|AIB06024.1| CP2 [Hevea brasiliensis]
Length=372

 Score =   132 bits (331),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 59/65 (91%), Positives = 62/65 (95%), Gaps = 1/65 (2%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA-  179
            GVLLVGYGSAGYAP+RLKEKPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA 
Sbjct  307  GVLLVGYGSAGYAPVRLKEKPYWIIKNSWGENWGESGYYKICRGRNICGVDSMVSTVAAV  366

Query  180  VNTPT  194
            V TP+
Sbjct  367  VQTPS  371



>ref|XP_011088458.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Sesamum indicum]
Length=379

 Score =   131 bits (330),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG AGYAPIR KEKPYWIIKNSWGE WGEKGYYKICRGRNICGVDSMVSTVAAV
Sbjct  316  GVLLVGYGEAGYAPIRRKEKPYWIIKNSWGEKWGEKGYYKICRGRNICGVDSMVSTVAAV  375

Query  183  NT  188
            +T
Sbjct  376  ST  377



>gb|KHG24064.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=374

 Score =   131 bits (330),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 57/62 (92%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIRLK+KPYWIIKNSWGE+WGE GYYKICRGRN+CGVDS+VSTVAAV
Sbjct  310  GVLLVGYGSAGYAPIRLKDKPYWIIKNSWGETWGENGYYKICRGRNVCGVDSLVSTVAAV  369

Query  183  NT  188
            NT
Sbjct  370  NT  371



>ref|XP_009406357.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=372

 Score =   131 bits (329),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGY+PIRLK+KP+WIIKNSWGE+WGEKGYYKICRGRN+CGVDSMVSTV A+
Sbjct  307  GVLLVGYGSAGYSPIRLKQKPFWIIKNSWGETWGEKGYYKICRGRNVCGVDSMVSTVTAI  366

Query  183  NT  188
            NT
Sbjct  367  NT  368



>gb|AAX19661.1| cysteine proteinase [Populus tomentosa]
Length=374

 Score =   131 bits (329),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 57/64 (89%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAP+R+KEKPYWIIKNSWGESWGE G+YKICRGRNICGVDSMVSTVAAV
Sbjct  310  GVLLVGYGSAGYAPVRMKEKPYWIIKNSWGESWGENGFYKICRGRNICGVDSMVSTVAAV  369

Query  183  NTPT  194
             T +
Sbjct  370  QTSS  373



>emb|CDP20652.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   131 bits (329),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 57/64 (89%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS+GYAPIR+KEKPYWIIKNSWGE WGE GYYKICRG NICGVDSMVSTVAAV
Sbjct  309  GVLLVGYGSSGYAPIRMKEKPYWIIKNSWGEHWGENGYYKICRGHNICGVDSMVSTVAAV  368

Query  183  NTPT  194
            +T T
Sbjct  369  HTST  372



>ref|XP_011047717.1| PREDICTED: cysteine proteinase RD19a [Populus euphratica]
Length=368

 Score =   130 bits (328),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAP+R+KEKPYWIIKNSWGESWGE G+YKICRGRNICGVDSMVSTVAAV
Sbjct  304  GVLLVGYGSAGYAPVRMKEKPYWIIKNSWGESWGENGFYKICRGRNICGVDSMVSTVAAV  363

Query  183  NT  188
             T
Sbjct  364  QT  365



>ref|XP_002280798.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CAN73591.1| hypothetical protein VITISV_022889 [Vitis vinifera]
 emb|CBI19785.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   130 bits (328),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGY+PIR KEKPYWIIKNSWGESWGE+GYYKICRG NICGVDSMVSTVAA+
Sbjct  307  GVLLVGYGSAGYSPIRFKEKPYWIIKNSWGESWGEQGYYKICRGHNICGVDSMVSTVAAI  366

Query  183  NT  188
            +T
Sbjct  367  HT  368



>gb|KJB79047.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
Length=373

 Score =   130 bits (327),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAP+R+K+KPYWIIKNSWGE+WGE G+Y+ICRGRNICGVDSMVSTVAAV
Sbjct  309  GVLLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGENGFYRICRGRNICGVDSMVSTVAAV  368

Query  183  NT  188
            NT
Sbjct  369  NT  370



>gb|KJB32561.1| hypothetical protein B456_005G247000 [Gossypium raimondii]
Length=374

 Score =   130 bits (326),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIRLK+KPYWIIKNSWGE+WGE G+YKICRGRN+CGVDS+VSTVAAV
Sbjct  310  GVLLVGYGSAGYAPIRLKDKPYWIIKNSWGETWGENGFYKICRGRNVCGVDSLVSTVAAV  369

Query  183  NT  188
            NT
Sbjct  370  NT  371



>gb|ABQ10201.1| cysteine protease Cp3 [Actinidia deliciosa]
Length=365

 Score =   130 bits (326),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 56/65 (86%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE G+YKIC+GRN+CGVDSMVSTVAAV
Sbjct  301  GVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGFYKICQGRNVCGVDSMVSTVAAV  360

Query  183  NTPTS  197
            +T ++
Sbjct  361  HTTSN  365



>gb|KDO49483.1| hypothetical protein CISIN_1g017318mg [Citrus sinensis]
Length=373

 Score =   130 bits (326),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 57/59 (97%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  179
            GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAA
Sbjct  313  GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAA  371



>ref|XP_006487337.1| PREDICTED: cysteine proteinase RD19a-like [Citrus sinensis]
Length=373

 Score =   130 bits (326),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 57/59 (97%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  179
            GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAA
Sbjct  313  GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAA  371



>emb|CAE54306.1| putative papain-like cysteine proteinase [Gossypium hirsutum]
Length=373

 Score =   129 bits (325),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAP+R+K+KPYWIIKNSWGE+WGE G+Y+ICRGRNICGVDSMVSTVAAV
Sbjct  309  GVLLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGENGFYRICRGRNICGVDSMVSTVAAV  368

Query  183  NT  188
            NT
Sbjct  369  NT  370



>ref|XP_010271520.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=370

 Score =   129 bits (324),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 56/61 (92%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS GYAPIRLK+KPYWIIKNSWGE WGE GYYKICRGRN+CGVDSMVSTVAAV
Sbjct  306  GVLLVGYGSEGYAPIRLKDKPYWIIKNSWGEGWGENGYYKICRGRNVCGVDSMVSTVAAV  365

Query  183  N  185
            N
Sbjct  366  N  366



>ref|XP_011028940.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score =   129 bits (324),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIR KEKP+WIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA+
Sbjct  303  GVLLVGYGSAGYAPIRFKEKPFWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAI  362

Query  183  NT  188
            +T
Sbjct  363  HT  364



>sp|P05993.1|PAPA5_CARPA RecName: Full=Cysteine proteinase; AltName: Full=Clone PLBPC13, 
partial [Carica papaya]
 emb|CAA27609.1| pot. cysteine proteinase [Carica papaya]
Length=96

 Score =   122 bits (307),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIRLKEKPYW+IKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAAV
Sbjct  32   GVLLVGYGSAGYAPIRLKEKPYWVIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAV  91

Query  183  NTPTS  197
            +T + 
Sbjct  92   HTTSQ  96



>gb|KHG15253.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=373

 Score =   129 bits (324),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAP+R+K+KPYWIIKNSWGE+WGE G+Y+ICRGRNICGVDSMVSTVAAV
Sbjct  309  GVLLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGENGFYRICRGRNICGVDSMVSTVAAV  368

Query  183  NT  188
            NT
Sbjct  369  NT  370



>ref|XP_002313770.1| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE87725.1| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   129 bits (324),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSA YAP+R+KEKPYWIIKNSWGESWGE G+YKICRGRNICGVDSMVSTVAAV
Sbjct  304  GVLLVGYGSAAYAPVRMKEKPYWIIKNSWGESWGENGFYKICRGRNICGVDSMVSTVAAV  363

Query  183  NT  188
             T
Sbjct  364  QT  365



>gb|ABK92536.1| unknown [Populus trichocarpa]
Length=368

 Score =   129 bits (324),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSA YAP+R+KEKPYWIIKNSWGESWGE G+YKICRGRNICGVDSMVSTVAAV
Sbjct  304  GVLLVGYGSAAYAPVRMKEKPYWIIKNSWGESWGENGFYKICRGRNICGVDSMVSTVAAV  363

Query  183  NT  188
             T
Sbjct  364  QT  365



>ref|XP_007131787.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
 gb|ESW03781.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
Length=361

 Score =   129 bits (323),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 57/64 (89%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS  YAPIR+KEKPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAAV
Sbjct  297  GVLLVGYGSGAYAPIRMKEKPYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAV  356

Query  183  NTPT  194
            +T T
Sbjct  357  HTTT  360



>ref|XP_003606998.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89195.1| papain family cysteine protease [Medicago truncatula]
Length=362

 Score =   129 bits (323),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 57/64 (89%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS  Y+PIRLKEKPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAAV
Sbjct  299  GVLLVGYGSGAYSPIRLKEKPYWIIKNSWGETWGENGYYKICRGRNICGVDSMVSTVAAV  358

Query  183  NTPT  194
            +T T
Sbjct  359  HTTT  362



>ref|NP_001267989.1| cysteine protease precursor [Vitis vinifera]
 gb|ABX79341.1| cysteine protease [Vitis vinifera]
Length=377

 Score =   129 bits (323),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 55/65 (85%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIR+K+KPYWIIKNSWGE+WGE G+YKICRGRN+CGVDSMVSTVAAV
Sbjct  313  GVLLVGYGSAGYAPIRMKDKPYWIIKNSWGENWGENGFYKICRGRNVCGVDSMVSTVAAV  372

Query  183  NTPTS  197
            +T ++
Sbjct  373  HTTSN  377



>gb|ABK94801.1| unknown [Populus trichocarpa]
Length=367

 Score =   128 bits (322),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIR KEKP+WIIKNSWG++WGE GYYKICRGRNICGVDSMVSTVAA+
Sbjct  303  GVLLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGENGYYKICRGRNICGVDSMVSTVAAI  362

Query  183  NT  188
            +T
Sbjct  363  HT  364



>ref|XP_006423403.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
 gb|ESR36643.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
Length=375

 Score =   128 bits (322),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 56/59 (95%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  179
            GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVST+AA
Sbjct  313  GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTIAA  371



>ref|XP_009373025.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=371

 Score =   128 bits (322),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YKICRGRNICGVDSMVSTVAA 
Sbjct  305  GVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAA  364

Query  183  NTPTS  197
            +  T+
Sbjct  365  SVKTN  369



>ref|XP_010061009.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW67908.1| hypothetical protein EUGRSUZ_F01612 [Eucalyptus grandis]
Length=369

 Score =   128 bits (322),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYKICRGR+ICGVDSMVSTVAA+
Sbjct  305  GVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGRDICGVDSMVSTVAAI  364

Query  183  NT  188
            +T
Sbjct  365  HT  366



>ref|XP_007017672.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOY14897.1| Papain family cysteine protease [Theobroma cacao]
Length=401

 Score =   129 bits (323),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 55/64 (86%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE+GYYKICRGRN+CGVDSMVS+VAA+
Sbjct  337  GVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEEGYYKICRGRNVCGVDSMVSSVAAL  396

Query  183  NTPT  194
             T +
Sbjct  397  QTKS  400



>gb|ABK96580.1| unknown [Populus trichocarpa x Populus deltoides]
Length=367

 Score =   128 bits (321),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIR KEKP+WIIKNSWG++WGE GYYKICRGRNICGVDSMVSTVAA+
Sbjct  303  GVLLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGENGYYKICRGRNICGVDSMVSTVAAI  362

Query  183  NT  188
            +T
Sbjct  363  HT  364



>ref|XP_003523684.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=366

 Score =   128 bits (321),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 54/61 (89%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYYKICRGRN+CGVDSMVSTVAA+
Sbjct  302  GVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYKICRGRNVCGVDSMVSTVAAI  361

Query  183  N  185
            +
Sbjct  362  H  362



>ref|XP_004291404.1| PREDICTED: cysteine proteinase 15A-like [Fragaria vesca subsp. 
vesca]
Length=365

 Score =   128 bits (321),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS+GYAPIR KEKPYWIIKNSWG+SWGE+GYYKICRGRN+CGVDSMVSTVAA+
Sbjct  304  GVLLVGYGSSGYAPIRFKEKPYWIIKNSWGQSWGEEGYYKICRGRNVCGVDSMVSTVAAM  363

Query  183  NT  188
            +T
Sbjct  364  HT  365



>ref|NP_001241450.1| uncharacterized protein LOC100778716 precursor [Glycine max]
 gb|ACU20049.1| unknown [Glycine max]
Length=366

 Score =   128 bits (321),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 54/61 (89%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYYKICRGRN+CGVDSMVSTVAA+
Sbjct  302  GVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYKICRGRNVCGVDSMVSTVAAI  361

Query  183  N  185
            +
Sbjct  362  H  362



>dbj|BAJ53178.1| JHL18I08.12 [Jatropha curcas]
 gb|KDP38578.1| hypothetical protein JCGZ_04503 [Jatropha curcas]
Length=368

 Score =   128 bits (321),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 55/65 (85%), Positives = 62/65 (95%), Gaps = 1/65 (2%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIRLK+KP+WIIKNSWGESWGE GYY+ICRGRNICGVD+MVS+VAA+
Sbjct  303  GVLLVGYGSAGYAPIRLKDKPFWIIKNSWGESWGENGYYRICRGRNICGVDAMVSSVAAI  362

Query  183  NTPTS  197
            + P S
Sbjct  363  H-PNS  366



>ref|XP_011037175.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
 ref|XP_011037176.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
Length=368

 Score =   128 bits (321),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGY+PIR+K+KPYWIIKNSWGE WGE G+YKICRGRN+CGVDSMVSTVAAV
Sbjct  304  GVLLVGYGSAGYSPIRMKDKPYWIIKNSWGEKWGENGFYKICRGRNVCGVDSMVSTVAAV  363

Query  183  NTPT  194
             T +
Sbjct  364  QTTS  367



>ref|XP_004290288.1| PREDICTED: probable cysteine proteinase A494 [Fragaria vesca 
subsp. vesca]
Length=372

 Score =   127 bits (320),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 55/60 (92%), Positives = 60/60 (100%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGY+P+R+KEKPYWIIKNSWGE+WGEKG+YKICRGRNICGVDSMVSTVAAV
Sbjct  311  GVLLVGYGSAGYSPVRMKEKPYWIIKNSWGENWGEKGFYKICRGRNICGVDSMVSTVAAV  370



>ref|XP_004507484.1| PREDICTED: cysteine proteinase RD19a-like [Cicer arietinum]
Length=363

 Score =   127 bits (320),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS  YAPIR+KEKPYWIIKNSWGE+WGE G+YKICRGRNICGVDSMVSTVAAV
Sbjct  299  GVLLVGYGSGAYAPIRMKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAV  358

Query  183  NTPT  194
            +T T
Sbjct  359  HTTT  362



>ref|XP_002275759.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI17456.3| unnamed protein product [Vitis vinifera]
Length=367

 Score =   127 bits (320),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 56/64 (88%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GV+LVGYGSAGYAPIR KEKPYWIIKNSWGESWGE GYYKICRG N CGVDSMVSTVAA+
Sbjct  303  GVVLVGYGSAGYAPIRFKEKPYWIIKNSWGESWGEDGYYKICRGHNACGVDSMVSTVAAI  362

Query  183  NTPT  194
             T T
Sbjct  363  QTTT  366



>ref|XP_010105270.1| Cysteine proteinase 15A [Morus notabilis]
 gb|EXC04205.1| Cysteine proteinase 15A [Morus notabilis]
Length=372

 Score =   127 bits (320),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 53/61 (87%), Positives = 60/61 (98%), Gaps = 0/61 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+AGYAPIR K+KPYWIIKNSWGE+WGE+GYYKICRGRN+CGVDSMVSTVAA+
Sbjct  303  GVLLVGYGTAGYAPIRFKDKPYWIIKNSWGENWGEQGYYKICRGRNVCGVDSMVSTVAAL  362

Query  183  N  185
            +
Sbjct  363  H  363



>ref|XP_003539008.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=363

 Score =   127 bits (319),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAAV
Sbjct  299  GVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAV  358

Query  183  NTPT  194
            +T T
Sbjct  359  HTTT  362



>ref|XP_011092831.1| PREDICTED: cysteine proteinase RD19a-like [Sesamum indicum]
Length=378

 Score =   127 bits (320),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+A YAPIRLKEKPYWIIKNSWGE+WGE GYYKICRG N+CGVDSMVSTVAAV
Sbjct  315  GVLLVGYGAASYAPIRLKEKPYWIIKNSWGENWGENGYYKICRGHNVCGVDSMVSTVAAV  374

Query  183  NT  188
            +T
Sbjct  375  ST  376



>gb|KHN45894.1| Cysteine proteinase RD19a [Glycine soja]
Length=366

 Score =   127 bits (319),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 54/61 (89%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYYKICRGRN+CGVDSMVSTVAA+
Sbjct  302  GVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYKICRGRNVCGVDSMVSTVAAI  361

Query  183  N  185
            +
Sbjct  362  H  362



>ref|XP_002302004.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
 gb|ABK94746.1| unknown [Populus trichocarpa]
 gb|EEE81277.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
Length=367

 Score =   127 bits (319),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIR KEKP+WIIKNSWG++WGE GYYKICRGRNICGVDSMVSTVAA+
Sbjct  303  GVLLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGENGYYKICRGRNICGVDSMVSTVAAI  362

Query  183  NT  188
            +T
Sbjct  363  HT  364



>gb|ABF46642.1| papain-like cysteine proteinase [Pachysandra terminalis]
Length=374

 Score =   127 bits (319),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 57/64 (89%), Positives = 59/64 (92%), Gaps = 1/64 (2%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAG+APIR KEKPYWIIKNSWGESWGEKGYYKICRGRNICG+DSMVS VAA 
Sbjct  310  GVLLVGYGSAGFAPIRFKEKPYWIIKNSWGESWGEKGYYKICRGRNICGMDSMVSAVAAA  369

Query  183  NTPT  194
              PT
Sbjct  370  -VPT  372



>ref|XP_004148554.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Cucumis sativus]
Length=381

 Score =   127 bits (319),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 54/61 (89%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIR+++K YWIIKNSWGESWGE GYYKICRGRNICGVDS+VSTVAAV
Sbjct  307  GVLLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGENGYYKICRGRNICGVDSLVSTVAAV  366

Query  183  N  185
            +
Sbjct  367  H  367



>ref|XP_008236965.1| PREDICTED: cysteine proteinase RD19a [Prunus mume]
Length=367

 Score =   127 bits (319),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 54/65 (83%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+AGY+PIR+KEKPYWIIKNSWGE+WGEKG+YKIC+GRNICGVDSMVSTVAA 
Sbjct  301  GVLLVGYGAAGYSPIRMKEKPYWIIKNSWGENWGEKGFYKICKGRNICGVDSMVSTVAAA  360

Query  183  NTPTS  197
            +  T+
Sbjct  361  SVETN  365



>gb|KGN43159.1| Papain-like cysteine proteinase isoform I [Cucumis sativus]
Length=387

 Score =   127 bits (319),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 54/61 (89%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIR+++K YWIIKNSWGESWGE GYYKICRGRNICGVDS+VSTVAAV
Sbjct  313  GVLLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGENGYYKICRGRNICGVDSLVSTVAAV  372

Query  183  N  185
            +
Sbjct  373  H  373



>ref|XP_004165230.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
Length=387

 Score =   127 bits (319),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 54/61 (89%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIR+++K YWIIKNSWGESWGE GYYKICRGRNICGVDS+VSTVAAV
Sbjct  313  GVLLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGENGYYKICRGRNICGVDSLVSTVAAV  372

Query  183  N  185
            +
Sbjct  373  H  373



>ref|XP_002305451.2| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE85962.2| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   127 bits (318),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 53/64 (83%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGY+P+R+KEKP+WIIKNSWGE WGE G+YKICRGRN+CGVDSMVSTVAAV
Sbjct  304  GVLLVGYGSAGYSPVRMKEKPFWIIKNSWGEKWGENGFYKICRGRNVCGVDSMVSTVAAV  363

Query  183  NTPT  194
             T +
Sbjct  364  QTSS  367



>ref|XP_002510469.1| cysteine protease, putative [Ricinus communis]
 gb|EEF52656.1| cysteine protease, putative [Ricinus communis]
Length=366

 Score =   127 bits (318),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GV+LVGYGSAGYAP+RLK+KP+WIIKNSWGE+WGE GYYKICRGRN+CGVD+MVSTVAA+
Sbjct  302  GVVLVGYGSAGYAPVRLKDKPFWIIKNSWGENWGENGYYKICRGRNVCGVDAMVSTVAAI  361

Query  183  NT  188
            +T
Sbjct  362  HT  363



>ref|XP_009373000.1| PREDICTED: cysteine proteinase RD19a [Pyrus x bretschneideri]
Length=371

 Score =   127 bits (318),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YKICRGRNICGVDSMVSTVAA 
Sbjct  305  GVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAA  364

Query  183  NTPTS  197
            +  T+
Sbjct  365  SVKTN  369



>ref|XP_010268619.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=369

 Score =   127 bits (318),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS GY+PIR+K+KPYWIIKNSWGESWGE GYYKICRGR++CGVDSMVSTVAA+
Sbjct  305  GVLLVGYGSEGYSPIRMKDKPYWIIKNSWGESWGENGYYKICRGRDVCGVDSMVSTVAAI  364

Query  183  NT  188
            +T
Sbjct  365  HT  366



>ref|XP_007201310.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
 gb|EMJ02509.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
Length=367

 Score =   127 bits (318),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 54/65 (83%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+AGY+PIR+KEKPYWIIKNSWGE+WGEKG+YKIC+GRNICGVDSMVSTVAA 
Sbjct  301  GVLLVGYGAAGYSPIRMKEKPYWIIKNSWGENWGEKGFYKICKGRNICGVDSMVSTVAAA  360

Query  183  NTPTS  197
            +  T+
Sbjct  361  SVETN  365



>ref|XP_008382317.1| PREDICTED: cysteine proteinase RD19a [Malus domestica]
Length=371

 Score =   127 bits (318),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YKICRGRNICGVDSMVSTVAA 
Sbjct  305  GVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAA  364

Query  183  NTPTS  197
            +  T+
Sbjct  365  SVKTN  369



>gb|ACI04578.1| cysteine protease-like protein [Robinia pseudoacacia]
Length=335

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG AGYAPIRLKEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAAV
Sbjct  271  GVLLVGYGKAGYAPIRLKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAV  330

Query  183  NT  188
            +T
Sbjct  331  HT  332



>ref|XP_010028631.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW55393.1| hypothetical protein EUGRSUZ_I01305 [Eucalyptus grandis]
Length=370

 Score =   126 bits (317),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 58/67 (87%), Positives = 61/67 (91%), Gaps = 2/67 (3%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA 
Sbjct  303  GVLLVGYGSAGYAPIRMKDKPYWIIKNSWGETWGENGYYKICRGRNICGVDSMVSTVAAA  362

Query  183  --NTPTS  197
               TP S
Sbjct  363  VHTTPGS  369



>ref|XP_010066197.1| PREDICTED: probable cysteine proteinase A494 [Eucalyptus grandis]
 gb|KCW64029.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
 gb|KCW64030.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
Length=376

 Score =   126 bits (317),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSA Y+PIR+KEKPYWIIKNSWGE+WGE G+YKICRGRNICGVDSMVSTVAA+
Sbjct  312  GVLLVGYGSAAYSPIRMKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAI  371

Query  183  NT  188
            +T
Sbjct  372  HT  373



>ref|XP_009392632.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=369

 Score =   126 bits (316),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGY+PIRLK+KP+WIIKNSWGE+WGE GYYKICRGRNICGVDSMVS+V+A+
Sbjct  304  GVLLVGYGSAGYSPIRLKDKPFWIIKNSWGENWGEHGYYKICRGRNICGVDSMVSSVSAI  363

Query  183  NT  188
            +T
Sbjct  364  HT  365



>gb|AAD29084.1|AF082181_1 cysteine proteinase precursor [Solanum melongena]
Length=363

 Score =   126 bits (316),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAG+APIRLKEKPYWIIKNSWGE+WGE GYYKICRG NICGVD+MVSTV A 
Sbjct  297  GVLLVGYGSAGFAPIRLKEKPYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAT  356

Query  183  NT  188
            +T
Sbjct  357  HT  358



>ref|XP_003540987.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=365

 Score =   126 bits (316),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 55/64 (86%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVA+V
Sbjct  301  GVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVASV  360

Query  183  NTPT  194
            +T T
Sbjct  361  HTTT  364



>ref|XP_011045161.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score =   126 bits (316),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 53/61 (87%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+AGYAPIR KEKP+WIIKNSWGE+WGE GYYKICR RNICGVDSMVSTVAA+
Sbjct  303  GVLLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGENGYYKICRARNICGVDSMVSTVAAI  362

Query  183  N  185
            +
Sbjct  363  H  363



>gb|KHN22211.1| Cysteine proteinase 15A [Glycine soja]
Length=366

 Score =   125 bits (315),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 53/61 (87%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYY ICRGRN+CGVDSMVSTVAA+
Sbjct  302  GVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYNICRGRNVCGVDSMVSTVAAI  361

Query  183  N  185
            +
Sbjct  362  H  362



>gb|EYU37835.1| hypothetical protein MIMGU_mgv1a008237mg [Erythranthe guttata]
Length=380

 Score =   126 bits (316),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG  GY+PIR+KEKPYWIIKNSWG +WGE GYYKICRGRNICGVDSMVSTVAAV
Sbjct  316  GVLLVGYGETGYSPIRMKEKPYWIIKNSWGPNWGEDGYYKICRGRNICGVDSMVSTVAAV  375

Query  183  NTPT  194
            +T +
Sbjct  376  STTS  379



>emb|CDQ51995.1| Cysteine proteinase, partial [Fagus sylvatica]
Length=165

 Score =   121 bits (304),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 60/61 (98%), Gaps = 0/61 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVG+GSAGYAPIRLKEKP+WIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTVAA+
Sbjct  104  GVLLVGFGSAGYAPIRLKEKPFWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVAAI  163

Query  183  N  185
            N
Sbjct  164  N  164



>ref|XP_008775532.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=371

 Score =   125 bits (315),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSA YAPIR KEKPYWIIKNSWGE WGE GYYKICRGRN+CGVDSMVSTVAAV
Sbjct  309  GVLLVGYGSAAYAPIRFKEKPYWIIKNSWGEKWGENGYYKICRGRNVCGVDSMVSTVAAV  368

Query  183  NT  188
             +
Sbjct  369  RS  370



>ref|XP_008448073.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=385

 Score =   126 bits (316),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 53/61 (87%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIR+++K YWIIKNSWGE+WGE GYYKICRGRNICGVDS+VSTVAAV
Sbjct  311  GVLLVGYGSAGYAPIRMRDKDYWIIKNSWGENWGENGYYKICRGRNICGVDSLVSTVAAV  370

Query  183  N  185
            +
Sbjct  371  H  371



>ref|XP_004150061.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004166953.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN61836.1| Cysteine protease [Cucumis sativus]
Length=377

 Score =   125 bits (314),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS GYAPIRLK+KPYWIIKNSWG +WGE GYYKICRGRNICGVDSMVSTVAAV
Sbjct  313  GVLLVGYGSDGYAPIRLKDKPYWIIKNSWGANWGENGYYKICRGRNICGVDSMVSTVAAV  372

Query  183  NT  188
            +T
Sbjct  373  HT  374



>gb|AIB06025.1| CP3 [Hevea brasiliensis]
Length=366

 Score =   125 bits (314),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+AGYAPIR K+KP+WIIKNSWGE+WGE GYYKICRGRNICG+D+MVS+VAA+
Sbjct  302  GVLLVGYGAAGYAPIRFKDKPFWIIKNSWGENWGENGYYKICRGRNICGMDAMVSSVAAI  361

Query  183  NT  188
            +T
Sbjct  362  HT  363



>gb|AAR92156.1| putative cysteine protease 3 [Iris x hollandica]
Length=292

 Score =   124 bits (311),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTV A+
Sbjct  226  GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGETWGENGYYKICRGRNVCGVDSMVSTVTAI  285

Query  183  NT  188
            +T
Sbjct  286  HT  287



>ref|XP_010672379.1| PREDICTED: cysteine proteinase RD19a-like [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score =   125 bits (314),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 53/61 (87%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GV+LVGYGSAGYAPIR KEKPYWIIKNSWG +WG++GYYKICRG N+CGVDSMVSTVAAV
Sbjct  310  GVVLVGYGSAGYAPIRFKEKPYWIIKNSWGPNWGDQGYYKICRGHNVCGVDSMVSTVAAV  369

Query  183  N  185
            N
Sbjct  370  N  370



>ref|XP_009376976.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=445

 Score =   126 bits (316),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 55/65 (85%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+AGY+PIRLKEKPYWIIKNSWGESW E G+YKICRGRNICGVDSMVSTVAA 
Sbjct  379  GVLLVGYGAAGYSPIRLKEKPYWIIKNSWGESWRESGFYKICRGRNICGVDSMVSTVAAA  438

Query  183  NTPTS  197
            +  T+
Sbjct  439  SVKTN  443



>ref|XP_008460996.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=377

 Score =   125 bits (313),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS GYAPIR+K+KPYWIIKNSWG +WGE GYYKICRGRNICGVDSMVSTVAAV
Sbjct  313  GVLLVGYGSEGYAPIRMKDKPYWIIKNSWGANWGENGYYKICRGRNICGVDSMVSTVAAV  372

Query  183  NT  188
            +T
Sbjct  373  HT  374



>gb|KJB07487.1| hypothetical protein B456_001G026600 [Gossypium raimondii]
Length=377

 Score =   125 bits (313),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGY+PI LK+KPYWIIKNSWGE+WGE GYYKICRG N+CGVDS+VSTV A+
Sbjct  313  GVLLVGYGSAGYSPIHLKDKPYWIIKNSWGENWGENGYYKICRGSNVCGVDSLVSTVVAL  372

Query  183  NTPT  194
            NT +
Sbjct  373  NTKS  376



>ref|XP_010910124.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=374

 Score =   125 bits (313),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYKIC+GRN+CGVDSMVSTV AV
Sbjct  312  GVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEDGYYKICKGRNVCGVDSMVSTVTAV  371

Query  183  NT  188
             +
Sbjct  372  RS  373



>ref|XP_007136047.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
 gb|ESW08041.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
Length=366

 Score =   125 bits (313),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+  YAPIR KEKP+WIIKNSWGESWGE GYYKICRG N+CGVDSMVSTVAA+
Sbjct  302  GVLLVGYGAGAYAPIRFKEKPFWIIKNSWGESWGENGYYKICRGHNVCGVDSMVSTVAAI  361

Query  183  NTPT  194
            +T +
Sbjct  362  HTSS  365



>ref|XP_002280808.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CBI19783.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   125 bits (313),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGY+PIR KEKPYW++KNSWG++WGE GYYKICRG NICGVDSMVSTVAA+
Sbjct  302  GVLLVGYGSAGYSPIRFKEKPYWLLKNSWGQNWGEHGYYKICRGHNICGVDSMVSTVAAI  361

Query  183  NTPT  194
             + T
Sbjct  362  QSAT  365



>gb|AGV54334.1| cysteine proteinase RD19a-like protein [Phaseolus vulgaris]
Length=366

 Score =   125 bits (313),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+  YAPIR KEKP+WIIKNSWGESWGE GYYKICRG N+CGVDSMVSTVAA+
Sbjct  302  GVLLVGYGAGAYAPIRFKEKPFWIIKNSWGESWGENGYYKICRGHNVCGVDSMVSTVAAI  361

Query  183  NTPT  194
            +T +
Sbjct  362  HTSS  365



>gb|AAU81589.1| cysteine proteinase [Petunia x hybrida]
Length=257

 Score =   122 bits (307),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAG+APIRLKEKPYWIIKNSWGESWGE+GYYKICRGRNICGVD+MVSTV A 
Sbjct  191  GVLLVGYGSAGFAPIRLKEKPYWIIKNSWGESWGEQGYYKICRGRNICGVDAMVSTVTAA  250

Query  183  NT  188
            +T
Sbjct  251  HT  252



>gb|AAL69389.1|AF462226_1 putative cysteine proteinase [Narcissus pseudonarcissus]
Length=136

 Score =   119 bits (299),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS+G+APIR KEKPYWIIKNSWGE+WGEKGYYKIC+GRN+CGVDSMVSTV A+
Sbjct  71   GVLLVGYGSSGWAPIRFKEKPYWIIKNSWGENWGEKGYYKICKGRNVCGVDSMVSTVTAI  130

Query  183  NTPTSD  200
            +T   D
Sbjct  131  HTTPKD  136



>ref|XP_010530325.1| PREDICTED: cysteine proteinase RD19a [Tarenaya hassleriana]
Length=370

 Score =   124 bits (312),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 53/64 (83%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGY+PIRLKEKPYWIIKNSWG +WGE+GYYKIC GRN+CG+D+MVS+VAAV
Sbjct  306  GVLLVGYGSAGYSPIRLKEKPYWIIKNSWGANWGEEGYYKICHGRNLCGMDTMVSSVAAV  365

Query  183  NTPT  194
            +T T
Sbjct  366  HTST  369



>gb|ABK96252.1| unknown [Populus trichocarpa x Populus deltoides]
Length=156

 Score =   120 bits (300),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGY+P+R+KEKP+WIIKNSWGE WGE G+YKICRGRN+CGVDSMVSTVAAV
Sbjct  93   GVLLVGYGSAGYSPVRMKEKPFWIIKNSWGEKWGENGFYKICRGRNVCGVDSMVSTVAAV  152

Query  183  NTPT  194
             T +
Sbjct  153  QTSS  156



>ref|XP_009146338.1| PREDICTED: cysteine proteinase 15A-like [Brassica rapa]
 emb|CDY32227.1| BnaA01g17570D [Brassica napus]
Length=368

 Score =   124 bits (312),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 1/65 (2%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR-NICGVDSMVSTVAA  179
            GVLLVG+GS+GYAPIRLKEKPYWIIKNSWG +WGE GYYKICRGR NICG+D+MVSTVAA
Sbjct  303  GVLLVGFGSSGYAPIRLKEKPYWIIKNSWGSTWGEDGYYKICRGRHNICGMDTMVSTVAA  362

Query  180  VNTPT  194
            V+T T
Sbjct  363  VHTST  367



>ref|XP_009376977.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=447

 Score =   125 bits (314),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 55/65 (85%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+AGY+PIRLKEKPYWIIKNSWGESW E G+YKICRGRNICGVDSMVSTVAA 
Sbjct  381  GVLLVGYGAAGYSPIRLKEKPYWIIKNSWGESWRESGFYKICRGRNICGVDSMVSTVAAA  440

Query  183  NTPTS  197
            +  T+
Sbjct  441  SVKTN  445



>emb|CDY34441.1| BnaC01g21920D [Brassica napus]
Length=368

 Score =   124 bits (312),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 1/65 (2%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR-NICGVDSMVSTVAA  179
            GVLLVG+GS+GYAPIRLKEKPYWIIKNSWG +WGE GYYKICRGR NICG+D+MVSTVAA
Sbjct  303  GVLLVGFGSSGYAPIRLKEKPYWIIKNSWGSTWGEDGYYKICRGRHNICGMDTMVSTVAA  362

Query  180  VNTPT  194
            V+T T
Sbjct  363  VHTST  367



>dbj|BAC41322.1| hypothetical protein [Lotus japonicus]
Length=358

 Score =   124 bits (311),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA+
Sbjct  296  GVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAL  355

Query  183  NT  188
            +T
Sbjct  356  HT  357



>ref|XP_002306900.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
 gb|ABK92924.1| unknown [Populus trichocarpa]
 gb|EEE93896.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
Length=367

 Score =   124 bits (311),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 53/61 (87%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+AGYAPIR KEKP+WIIKNSWGE+WGE GYYKICR RNICGVDSMVSTVAA+
Sbjct  303  GVLLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGENGYYKICRARNICGVDSMVSTVAAI  362

Query  183  N  185
            +
Sbjct  363  H  363



>gb|KHN25410.1| Cysteine proteinase RD19a [Glycine soja]
Length=365

 Score =   124 bits (310),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYKICRGR+ICGVDSMVSTVA+V
Sbjct  301  GVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKICRGRSICGVDSMVSTVASV  360

Query  183  NTPT  194
            +T T
Sbjct  361  HTTT  364



>gb|AAL05851.1|AF411121_1 cysteine proteinase precursor [Sandersonia aurantiaca]
Length=360

 Score =   124 bits (310),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAG+APIR KEKPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVS+V+A 
Sbjct  297  GVLLVGYGSAGFAPIRFKEKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSSVSAF  356

Query  183  NT  188
            +T
Sbjct  357  HT  358



>ref|XP_006473584.1| PREDICTED: cysteine proteinase 15A-like [Citrus sinensis]
Length=369

 Score =   124 bits (310),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 53/65 (82%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVL+VGYGS+G+APIR KEKPYWIIKNSWGE+WGE GYYKIC GRN+CGVDSMVS+VAAV
Sbjct  305  GVLIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGENGYYKICMGRNVCGVDSMVSSVAAV  364

Query  183  NTPTS  197
            +T +S
Sbjct  365  HTTSS  369



>emb|CAE45588.1| papain-like cysteine proteinase-like protein 1 [Lotus japonicus]
Length=359

 Score =   123 bits (309),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA+
Sbjct  297  GVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAL  356

Query  183  NT  188
            +T
Sbjct  357  HT  358



>gb|KHN39817.1| Cysteine proteinase RD19a [Glycine soja]
Length=332

 Score =   123 bits (308),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAAV
Sbjct  268  GVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAV  327

Query  183  NTPTS  197
            +T T 
Sbjct  328  HTTTQ  332



>emb|CDY09707.1| BnaC07g33540D [Brassica napus]
Length=366

 Score =   123 bits (309),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 55/63 (87%), Positives = 59/63 (94%), Gaps = 1/63 (2%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR-NICGVDSMVSTVAA  179
            GVLLVG+GSAGYAP+RL+EKPYWIIKNSWG  WGEKGYYKICRG  NICGVD+MVSTVAA
Sbjct  301  GVLLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEKGYYKICRGTPNICGVDTMVSTVAA  360

Query  180  VNT  188
            VNT
Sbjct  361  VNT  363



>gb|KDO84720.1| hypothetical protein CISIN_1g017548mg [Citrus sinensis]
Length=369

 Score =   123 bits (309),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 52/65 (80%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVL+VGYGS+G+APIR KEKPYWIIKNSWGE+WGE GYYKIC GRN+CGVDSMVS+VAA+
Sbjct  305  GVLIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGENGYYKICMGRNVCGVDSMVSSVAAI  364

Query  183  NTPTS  197
            +T +S
Sbjct  365  HTTSS  369



>ref|XP_010531457.1| PREDICTED: probable cysteine proteinase A494 [Tarenaya hassleriana]
Length=364

 Score =   123 bits (308),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 53/59 (90%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  179
            GVLLVGYGSAGYAP R+KEKP+WIIKNSWGE+WGEKG+YKICRGRNICGVDS+VSTVAA
Sbjct  302  GVLLVGYGSAGYAPARMKEKPFWIIKNSWGENWGEKGFYKICRGRNICGVDSLVSTVAA  360



>dbj|BAF98584.1| CM0216.500.nc [Lotus japonicus]
Length=360

 Score =   123 bits (308),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA+
Sbjct  296  GVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAL  355

Query  183  NT  188
            +T
Sbjct  356  HT  357



>gb|EYU42593.1| hypothetical protein MIMGU_mgv1a008336mg [Erythranthe guttata]
Length=377

 Score =   123 bits (308),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+  +APIR+KEKPYWIIKNSWG +WGEKGYYKIC+GRN+CGVDSMVSTVAAV
Sbjct  315  GVLLVGYGAGAFAPIRMKEKPYWIIKNSWGPNWGEKGYYKICQGRNLCGVDSMVSTVAAV  374

Query  183  NT  188
             T
Sbjct  375  TT  376



>ref|XP_006435090.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
 gb|ESR48330.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
Length=369

 Score =   122 bits (307),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 52/65 (80%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVL+VGYGS+G+APIR KEKPYWIIKNSWGE+WGE GYYKIC GRN+CGVDSMVS+VAA+
Sbjct  305  GVLIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGENGYYKICMGRNVCGVDSMVSSVAAI  364

Query  183  NTPTS  197
            +T +S
Sbjct  365  HTTSS  369



>ref|XP_003589348.1| Cysteine proteinase [Medicago truncatula]
 gb|AES59599.1| papain family cysteine protease [Medicago truncatula]
Length=364

 Score =   122 bits (307),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLL+G+G  GYAPIRLKEKPYWIIKNSWG++WGE+GYYKICRGRN+CGVDSMVSTVAA 
Sbjct  303  GVLLLGFGQGGYAPIRLKEKPYWIIKNSWGQNWGEEGYYKICRGRNVCGVDSMVSTVAAA  362

Query  183  NT  188
             +
Sbjct  363  QS  364



>gb|ABK93575.1| unknown [Populus trichocarpa]
Length=157

 Score =   118 bits (295),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+AGYAPIR KEKP+WIIKNSWGE+WGE GYYKICR RNICGVDSMVSTVAA+
Sbjct  93   GVLLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGENGYYKICRARNICGVDSMVSTVAAI  152

Query  183  NT  188
            + 
Sbjct  153  HA  154



>emb|CAE45589.1| papain-like cysteine proteinase-like protein 2 [Lotus japonicus]
Length=361

 Score =   122 bits (307),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTVAA+
Sbjct  297  GVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVAAL  356

Query  183  NT  188
            +T
Sbjct  357  HT  358



>ref|XP_010440192.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=365

 Score =   122 bits (307),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 55/65 (85%), Positives = 59/65 (91%), Gaps = 1/65 (2%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-RNICGVDSMVSTVAA  179
            GVLLVG+GSAGYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  N+CG+DSMVSTVAA
Sbjct  300  GVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGPHNVCGMDSMVSTVAA  359

Query  180  VNTPT  194
            V+T T
Sbjct  360  VHTTT  364



>ref|XP_009351218.1| PREDICTED: cysteine proteinase RD19a-like, partial [Pyrus x bretschneideri]
Length=282

 Score =   121 bits (303),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YKICRGRNICGVDSMVSTVAA 
Sbjct  216  GVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAA  275

Query  183  NTPTS  197
            +  T+
Sbjct  276  SVKTN  280



>ref|XP_004230928.1| PREDICTED: cysteine proteinase RD19a [Solanum lycopersicum]
Length=369

 Score =   122 bits (306),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 53/64 (83%), Positives = 60/64 (94%), Gaps = 1/64 (2%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKICRGRN+CGVDSMVSTVAAV
Sbjct  306  GVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGESGYYKICRGRNVCGVDSMVSTVAAV  364

Query  183  NTPT  194
            +T +
Sbjct  365  STSS  368



>ref|XP_006362019.1| PREDICTED: cysteine proteinase RD19a-like [Solanum tuberosum]
Length=368

 Score =   122 bits (306),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 53/64 (83%), Positives = 60/64 (94%), Gaps = 1/64 (2%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKICRGRN+CGVDSMVSTVAAV
Sbjct  306  GVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGENGYYKICRGRNVCGVDSMVSTVAAV  364

Query  183  NTPT  194
            +T +
Sbjct  365  STSS  368



>gb|AAM65162.1| cysteine proteinase RD19A [Arabidopsis thaliana]
Length=368

 Score =   122 bits (306),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 53/65 (82%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+AGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDSMVSTVAA 
Sbjct  303  GVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSMVSTVAAT  362

Query  183  NTPTS  197
             + T+
Sbjct  363  VSTTA  367



>ref|XP_006828787.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
 gb|ERM96203.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
Length=365

 Score =   122 bits (306),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVL+VGYGSAGYAPIRLK+K YWIIKNSWGE+WGEKGYYKICRG NICGVDSMVSTVA++
Sbjct  304  GVLIVGYGSAGYAPIRLKDKAYWIIKNSWGETWGEKGYYKICRGHNICGVDSMVSTVASI  363

Query  183  NT  188
             +
Sbjct  364  QS  365



>ref|XP_010434865.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score =   122 bits (306),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 55/65 (85%), Positives = 59/65 (91%), Gaps = 1/65 (2%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-RNICGVDSMVSTVAA  179
            GVLLVG+GSAGYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  N+CG+DSMVSTVAA
Sbjct  300  GVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGPHNMCGMDSMVSTVAA  359

Query  180  VNTPT  194
            V+T T
Sbjct  360  VHTTT  364



>ref|XP_003550405.2| PREDICTED: cysteine proteinase 15A [Glycine max]
Length=392

 Score =   122 bits (306),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 52/60 (87%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG   YAPIR K KPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAA+
Sbjct  328  GVLLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAI  387



>emb|CDX98179.1| BnaC07g09190D [Brassica napus]
Length=72

 Score =   115 bits (287),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKICRGRN+CGVDS+VSTV A 
Sbjct  7    GVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEDGFYKICRGRNVCGVDSLVSTVTAT  66

Query  183  NTPTSD  200
             +P + 
Sbjct  67   VSPAAH  72



>ref|NP_568052.1| cysteine proteinase RD19a [Arabidopsis thaliana]
 sp|P43296.1|RD19A_ARATH RecName: Full=Cysteine proteinase RD19a; Short=RD19; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA02373.1| thiol protease [Arabidopsis thaliana]
 emb|CAB38829.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 emb|CAB80572.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AAL85009.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 gb|AAM91778.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 dbj|BAE98545.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AEE87016.1| cysteine proteinase RD19a [Arabidopsis thaliana]
Length=368

 Score =   122 bits (305),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 53/65 (82%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+AGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDSMVSTVAA 
Sbjct  303  GVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSMVSTVAAT  362

Query  183  NTPTS  197
             + T+
Sbjct  363  VSTTA  367



>dbj|BAF98585.1| CM0216.510.nc [Lotus japonicus]
Length=360

 Score =   122 bits (305),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTVAA+
Sbjct  296  GVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVAAL  355

Query  183  NT  188
            +T
Sbjct  356  HT  357



>ref|XP_008387995.1| PREDICTED: cysteine proteinase 15A [Malus domestica]
Length=365

 Score =   122 bits (305),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS+G+APIRLKEKPYWI+KNSWG+SWGE+GYYKICRG N CGVDS+VSTVAA+
Sbjct  301  GVLLVGYGSSGFAPIRLKEKPYWILKNSWGQSWGEQGYYKICRGYNSCGVDSLVSTVAAL  360

Query  183  NT  188
            +T
Sbjct  361  HT  362



>ref|XP_010449835.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score =   122 bits (305),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 55/65 (85%), Positives = 59/65 (91%), Gaps = 1/65 (2%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-RNICGVDSMVSTVAA  179
            GVLLVG+GSAGYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  N+CG+DSMVSTVAA
Sbjct  300  GVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGPHNMCGMDSMVSTVAA  359

Query  180  VNTPT  194
            V+T T
Sbjct  360  VHTTT  364



>gb|ACK57563.1| cysteine protease-like protein [Arachis hypogaea]
Length=364

 Score =   122 bits (305),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+ GYAPIR KEKPYWIIKNSWGE+WGE GYYKICRG N+CGVDSMVSTV A+
Sbjct  300  GVLLVGYGAGGYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGPNMCGVDSMVSTVIAI  359

Query  183  NT  188
            +T
Sbjct  360  HT  361



>ref|XP_004238314.1| PREDICTED: cysteine proteinase 15A [Solanum lycopersicum]
Length=363

 Score =   122 bits (305),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS G+APIRLK KPYWIIKNSWG++WGE GYYKICRG NICGVD+MVSTV A 
Sbjct  297  GVLLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEHGYYKICRGHNICGVDAMVSTVTAT  356

Query  183  NT  188
            +T
Sbjct  357  HT  358



>ref|XP_008775280.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=368

 Score =   122 bits (305),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 52/60 (87%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIR K+KPYWIIKNSWGE+WGE GYYKICRG NICGV+SMVSTV A+
Sbjct  307  GVLLVGYGSAGYAPIRFKDKPYWIIKNSWGENWGEDGYYKICRGHNICGVESMVSTVTAI  366



>sp|P25804.1|CYSP_PEA RecName: Full=Cysteine proteinase 15A; AltName: Full=Turgor-responsive 
protein 15A; Flags: Precursor [Pisum sativum]
 emb|CAA38242.1| unnamed protein product [Pisum sativum]
Length=363

 Score =   121 bits (304),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVG+G   YAPIRLKEKPYWIIKNSWG++WGE+GYYKICRGRN+CGVDSMVSTVAA 
Sbjct  300  GVLLVGFGKGAYAPIRLKEKPYWIIKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTVAAA  359

Query  183  NT  188
             +
Sbjct  360  QS  361



>ref|XP_007160702.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
 gb|ESW32696.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
Length=365

 Score =   121 bits (304),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG   YAPIR KEKPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTV A+
Sbjct  301  GVLLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVGAI  360

Query  183  NTPT  194
            +  T
Sbjct  361  HAST  364



>ref|XP_006341997.1| PREDICTED: cysteine proteinase 15A-like [Solanum tuberosum]
Length=376

 Score =   121 bits (304),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS G+APIRLK KPYWIIKNSWG++WGE GYYKICRG NICGVD+MVSTV A 
Sbjct  310  GVLLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEHGYYKICRGHNICGVDAMVSTVTAT  369

Query  183  NT  188
            +T
Sbjct  370  HT  371



>emb|CAA82995.1| cysteine proteinase [Vicia sativa]
Length=358

 Score =   121 bits (303),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVG+G   YAPIRLKEKPYWIIKNSWG++WGE+GYYKICRGRN+CGVDSMVSTVAA 
Sbjct  295  GVLLVGFGKGAYAPIRLKEKPYWIIKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTVAAA  354

Query  183  NT  188
             +
Sbjct  355  QS  356



>dbj|BAD94010.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
Length=86

 Score =   114 bits (286),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+AGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDSMVSTVAA 
Sbjct  21   GVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSMVSTVAAT  80

Query  183  NTPTSD  200
             + T+ 
Sbjct  81   VSTTAH  86



>ref|XP_009602233.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana tomentosiformis]
Length=369

 Score =   121 bits (304),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 53/64 (83%), Positives = 60/64 (94%), Gaps = 1/64 (2%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKICRGRN+CGVDSMVSTVAAV
Sbjct  306  GVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGENGYYKICRGRNVCGVDSMVSTVAAV  364

Query  183  NTPT  194
            +T +
Sbjct  365  STSS  368



>dbj|BAF46302.1| cysteine proteinase precursor [Ipomoea nil]
Length=369

 Score =   121 bits (304),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+AGYAPIR K+KPYWI+KNSWGE+WGE+GYYKICRG NICG+DSMVSTV A 
Sbjct  305  GVLLVGYGAAGYAPIRFKDKPYWIVKNSWGENWGEEGYYKICRGNNICGIDSMVSTVTAA  364

Query  183  NT  188
            +T
Sbjct  365  ST  366



>ref|XP_009136751.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
Length=368

 Score =   121 bits (303),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 54/63 (86%), Positives = 59/63 (94%), Gaps = 1/63 (2%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR-NICGVDSMVSTVAA  179
            GVLLVG+GSAGYAP+RL+EKPYWIIKNSWG  WGEKGYYKICRG  NICGVD+MVSTVAA
Sbjct  303  GVLLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEKGYYKICRGTPNICGVDTMVSTVAA  362

Query  180  VNT  188
            V+T
Sbjct  363  VHT  365



>emb|CAB53397.1| cysteine protease [Medicago sativa]
Length=209

 Score =   118 bits (295),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVG+GS GYAPIRLKEKPYWIIKNSWG++WGE+GYYKICRGRN+CGVDSMVSTVAA 
Sbjct  148  GVLLVGFGSGGYAPIRLKEKPYWIIKNSWGQNWGEEGYYKICRGRNVCGVDSMVSTVAAA  207

Query  183  NT  188
             +
Sbjct  208  QS  209



>emb|CDX90537.1| BnaA03g42440D [Brassica napus]
Length=366

 Score =   121 bits (303),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 54/63 (86%), Positives = 59/63 (94%), Gaps = 1/63 (2%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR-NICGVDSMVSTVAA  179
            GVLLVG+GSAGYAP+RL+EKPYWIIKNSWG  WGEKGYYKICRG  NICGVD+MVSTVAA
Sbjct  301  GVLLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEKGYYKICRGTPNICGVDTMVSTVAA  360

Query  180  VNT  188
            V+T
Sbjct  361  VHT  363



>ref|XP_009611293.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana tomentosiformis]
 emb|CAB44983.1| putative preprocysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   121 bits (303),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG NICGVD+MVSTV A 
Sbjct  297  GVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAA  356

Query  183  NT  188
            +T
Sbjct  357  HT  358



>gb|AAK07731.1| CPR2-like cysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   121 bits (303),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG NICGVD+MVSTV A 
Sbjct  297  GVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAA  356

Query  183  NT  188
            +T
Sbjct  357  HT  358



>dbj|BAF03553.1| cysteine proteinase CP2 [Phaseolus vulgaris]
Length=365

 Score =   121 bits (303),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG   YAPIR KEKPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTV A+
Sbjct  301  GVLLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVGAI  360

Query  183  NTPT  194
            +  T
Sbjct  361  HAST  364



>ref|XP_008221329.1| PREDICTED: cysteine proteinase 15A-like [Prunus mume]
Length=366

 Score =   121 bits (303),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS+G+APIR KEKPYWI+KNSWG+SWGE+GYYKICRG N CGVDS+VSTVA++
Sbjct  302  GVLLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEEGYYKICRGHNPCGVDSLVSTVASL  361

Query  183  NT  188
            +T
Sbjct  362  HT  363



>gb|AAO11786.1| pre-pro cysteine proteinase [Vicia faba]
Length=363

 Score =   121 bits (303),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVG+G   YAPIRLKEKPYWI+KNSWG++WGE+GYYKICRGRN+CGVDSMVSTVAA 
Sbjct  300  GVLLVGFGKGAYAPIRLKEKPYWIVKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTVAAA  359

Query  183  NT  188
             +
Sbjct  360  QS  361



>gb|AAB67878.1| pre-pro-cysteine proteinase [Vicia faba]
Length=363

 Score =   120 bits (302),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVG+G   YAPIRLKEKPYWI+KNSWG++WGE+GYYKICRGRN+CGVDSMVSTVAA 
Sbjct  300  GVLLVGFGKGAYAPIRLKEKPYWIVKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTVAAA  359

Query  183  NT  188
             +
Sbjct  360  QS  361



>emb|CAA78361.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   120 bits (302),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG NICGVD+MVSTV A 
Sbjct  297  GVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAA  356

Query  183  NT  188
            +T
Sbjct  357  HT  358



>emb|CAA78365.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=365

 Score =   120 bits (302),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG NICGVD+MVSTV A 
Sbjct  299  GVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAA  358

Query  183  NT  188
            +T
Sbjct  359  HT  360



>gb|AAQ81938.1| cysteine proteinase precursor [Ipomoea batatas]
Length=371

 Score =   120 bits (302),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVL+VGYG+AGYAPIR K+KPYWIIKNSWGE+WGE+GYYKICRG NICGVDSMVS+V A 
Sbjct  307  GVLIVGYGAAGYAPIRFKDKPYWIIKNSWGENWGEEGYYKICRGNNICGVDSMVSSVTAA  366

Query  183  NT  188
            +T
Sbjct  367  ST  368



>gb|KJB29611.1| hypothetical protein B456_005G110200 [Gossypium raimondii]
Length=370

 Score =   120 bits (302),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 50/64 (78%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+AGY+PIR K+KP+WIIKNSWG +WGE GYYKICRGRN+CGVDSMVS+VAA+
Sbjct  306  GVLLVGYGAAGYSPIRFKDKPFWIIKNSWGANWGEDGYYKICRGRNVCGVDSMVSSVAAL  365

Query  183  NTPT  194
            +T +
Sbjct  366  HTKS  369



>emb|CDP07452.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   120 bits (302),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 53/63 (84%), Positives = 59/63 (94%), Gaps = 1/63 (2%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-RNICGVDSMVSTVAA  179
            GVLLVGYG+AGYAPIRLK+KPYWIIKNSWGE+WGE GYYK CR  RN+CGVDSMVS+VAA
Sbjct  314  GVLLVGYGAAGYAPIRLKDKPYWIIKNSWGENWGENGYYKFCRADRNLCGVDSMVSSVAA  373

Query  180  VNT  188
            V+T
Sbjct  374  VHT  376



>ref|NP_001266121.1| uncharacterized protein LOC101501911 precursor [Cicer arietinum]
 emb|CAA08906.1| cysteine proteinase [Cicer arietinum]
Length=362

 Score =   120 bits (301),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 53/61 (87%), Positives = 60/61 (98%), Gaps = 1/61 (2%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVG+G+ G+APIRLKEKPYWIIKNSWG++WGE+GYYKICRGRNICGVDSMVSTVAAV
Sbjct  299  GVLLVGFGN-GFAPIRLKEKPYWIIKNSWGQNWGEEGYYKICRGRNICGVDSMVSTVAAV  357

Query  183  N  185
            +
Sbjct  358  H  358



>gb|AAU81591.1| cysteine proteinase, partial [Petunia x hybrida]
Length=190

 Score =   117 bits (292),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 60/64 (94%), Gaps = 1/64 (2%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS G+APIR+KEKPYWIIKNSWGE WGE GYYKICRGRN+CGVDSMVSTVAAV
Sbjct  128  GVLLVGYGS-GFAPIRMKEKPYWIIKNSWGEKWGESGYYKICRGRNVCGVDSMVSTVAAV  186

Query  183  NTPT  194
            +T +
Sbjct  187  STSS  190



>ref|XP_006283974.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
 gb|EOA16872.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
Length=365

 Score =   120 bits (301),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 53/65 (82%), Positives = 59/65 (91%), Gaps = 1/65 (2%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-RNICGVDSMVSTVAA  179
            GVLLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  N+CG+D+MVSTVAA
Sbjct  300  GVLLVGFGSSGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGPHNMCGMDTMVSTVAA  359

Query  180  VNTPT  194
            V+T T
Sbjct  360  VHTTT  364



>ref|XP_006283963.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
 gb|EOA16861.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
Length=368

 Score =   120 bits (301),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 52/65 (80%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTV+A 
Sbjct  303  GVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVSAT  362

Query  183  NTPTS  197
             + T+
Sbjct  363  VSTTA  367



>gb|KHG15062.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=370

 Score =   120 bits (301),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+AGY+PIR K+KP+WIIKNSWG +WGE GYY+ICRGRN+CGVDSMVS+VAA+
Sbjct  306  GVLLVGYGAAGYSPIRFKDKPFWIIKNSWGANWGEDGYYRICRGRNVCGVDSMVSSVAAL  365

Query  183  NTPT  194
            +T +
Sbjct  366  HTKS  369



>ref|XP_009405542.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=366

 Score =   120 bits (301),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 52/60 (87%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAP R KEK YWIIKNSWGE+WGE GYYKICRGRNICGVDSMVS+V A+
Sbjct  305  GVLLVGYGSAGYAPARFKEKSYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSSVTAI  364



>gb|AJA74415.1| cysteine protease [Cicer arietinum]
Length=358

 Score =   120 bits (300),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 53/61 (87%), Positives = 60/61 (98%), Gaps = 1/61 (2%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVG+G+ G+APIRLKEKPYWIIKNSWG++WGE+GYYKICRGRNICGVDSMVSTVAAV
Sbjct  295  GVLLVGFGN-GFAPIRLKEKPYWIIKNSWGQNWGEEGYYKICRGRNICGVDSMVSTVAAV  353

Query  183  N  185
            +
Sbjct  354  H  354



>gb|ACX54787.2| cysteine protease [Arachis diogoi]
Length=360

 Score =   120 bits (300),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 51/66 (77%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+AGYAPIR K+KP+WIIKNSWGESWGE GYYKICRG+N+CGVDSMVS+V A 
Sbjct  294  GVLLVGYGAAGYAPIRFKDKPFWIIKNSWGESWGEDGYYKICRGKNVCGVDSMVSSVVAT  353

Query  183  NTPTSD  200
               +S+
Sbjct  354  TFTSSN  359



>gb|AJP16692.1| cysteine protease, partial [Striga hermonthica]
Length=148

 Score =   115 bits (288),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  179
            GVLLVGYG +GYAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTVAA
Sbjct  90   GVLLVGYGESGYAPIRMKDKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVAA  148



>gb|KJB58164.1| hypothetical protein B456_009G197400 [Gossypium raimondii]
Length=375

 Score =   120 bits (301),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 50/61 (82%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAP+R K KPYWIIKNSWGE+WGE GYYKICRG N+CGVDSMVS+V+A+
Sbjct  306  GVLLVGYGSAGYAPVRFKNKPYWIIKNSWGENWGENGYYKICRGNNVCGVDSMVSSVSAL  365

Query  183  N  185
            +
Sbjct  366  H  366



>gb|EPS70818.1| cysteine proteinase, partial [Genlisea aurea]
Length=355

 Score =   120 bits (300),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVL+VGYGS+GYAPIRLK KPYWI+KNSWG++WGEKGYYKICRG NICGV+SMVSTV A+
Sbjct  294  GVLMVGYGSSGYAPIRLKNKPYWIVKNSWGKNWGEKGYYKICRGSNICGVESMVSTVTAI  353

Query  183  NT  188
            ++
Sbjct  354  HS  355



>ref|XP_006414378.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
 gb|ESQ55831.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
Length=367

 Score =   120 bits (300),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 53/65 (82%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-RNICGVDSMVSTVAA  179
            GVLLVG+GS+GY+PIRLKEKPYWIIKNSWG  WGE GYYKICRG  NICG+D+MVSTVAA
Sbjct  302  GVLLVGFGSSGYSPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGSHNICGMDTMVSTVAA  361

Query  180  VNTPT  194
            V T T
Sbjct  362  VQTST  366



>ref|XP_009109502.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
 emb|CDX90310.1| BnaA08g16740D [Brassica napus]
Length=369

 Score =   120 bits (300),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKICRGRN+CGVDS+VSTV A 
Sbjct  304  GVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICRGRNVCGVDSLVSTVTAA  363

Query  183  NTPTS  197
             +PT+
Sbjct  364  VSPTA  368



>ref|XP_007223351.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
 gb|EMJ24550.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
Length=367

 Score =   120 bits (300),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 49/62 (79%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS+G+APIR KEKPYWI+KNSWG+SWGE+G+YKICRG N CGVDS+VSTVA++
Sbjct  303  GVLLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEEGFYKICRGHNSCGVDSLVSTVASL  362

Query  183  NT  188
            +T
Sbjct  363  HT  364



>ref|XP_010943608.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=371

 Score =   120 bits (300),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAPIR K+KPYWIIKNSWG +WGE GYYKICRG+NICGV+SMVSTV AV
Sbjct  309  GVLLVGYGSAGYAPIRFKDKPYWIIKNSWGGNWGEDGYYKICRGQNICGVESMVSTVTAV  368

Query  183  NT  188
             T
Sbjct  369  RT  370



>ref|XP_009776238.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana sylvestris]
Length=365

 Score =   120 bits (300),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG NICGVD+MVSTV A 
Sbjct  299  GVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAA  358

Query  183  NT  188
            +T
Sbjct  359  HT  360



>gb|AAB62937.1| stress-induced cysteine proteinase [Lavatera thuringiaca]
Length=175

 Score =   115 bits (289),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+AGYAP+R KEKP+WIIKNSWG +WGE GYYKICRGRN+CGVDSMVS+VAA+
Sbjct  111  GVLLVGYGAAGYAPVRFKEKPFWIIKNSWGANWGEDGYYKICRGRNVCGVDSMVSSVAAL  170

Query  183  NTPTS  197
             T + 
Sbjct  171  QTKSQ  175



>emb|CAA78403.1| pre-pro-cysteine proteinase [Solanum lycopersicum]
Length=361

 Score =   119 bits (299),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS G+APIRLK KPYWIIKNSWG++WGE GYYKICRG +ICGVD+MVSTV A 
Sbjct  295  GVLLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEHGYYKICRGHHICGVDAMVSTVTAT  354

Query  183  NT  188
            +T
Sbjct  355  HT  356



>ref|XP_010437007.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=368

 Score =   119 bits (299),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 51/59 (86%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  179
            GVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTV+A
Sbjct  303  GVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVSA  361



>ref|XP_010431862.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score =   119 bits (299),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 51/59 (86%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  179
            GVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTV+A
Sbjct  302  GVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVSA  360



>ref|XP_008444769.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=373

 Score =   119 bits (298),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 50/63 (79%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAG+APIR KEKPYWIIKNSWGE+WGE GYY IC+G+N+CG +SMVS+VAA 
Sbjct  310  GVLLVGYGSAGFAPIRFKEKPYWIIKNSWGENWGENGYYFICKGKNVCGSESMVSSVAAA  369

Query  183  NTP  191
             TP
Sbjct  370  ATP  372



>ref|XP_011083631.1| PREDICTED: cysteine proteinase 15A-like [Sesamum indicum]
Length=371

 Score =   119 bits (298),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 58/64 (91%), Gaps = 1/64 (2%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+AGYAPIRLKEKPYWIIKNSWGE+WGE GYYKICRG N+CGV SMVSTV A 
Sbjct  307  GVLLVGYGAAGYAPIRLKEKPYWIIKNSWGENWGENGYYKICRGHNVCGVASMVSTVTAA  366

Query  183  N-TP  191
            + TP
Sbjct  367  HVTP  370



>dbj|BAG16515.1| putative cysteine proteinase [Capsicum chinense]
Length=367

 Score =   119 bits (298),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 53/63 (84%), Positives = 57/63 (90%), Gaps = 1/63 (2%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR-NICGVDSMVSTVAA  179
            GVLLVGYGSAG+APIRLK KPYWIIKNSWGE WGE GYYKICRG+ NICGVD+MVSTV A
Sbjct  300  GVLLVGYGSAGFAPIRLKAKPYWIIKNSWGEHWGEHGYYKICRGQHNICGVDAMVSTVTA  359

Query  180  VNT  188
             +T
Sbjct  360  AHT  362



>emb|CAD40319.2| OSJNBb0054B09.3 [Oryza sativa Japonica Group]
 emb|CAH66180.1| OSIGBa0130O15.4 [Oryza sativa Indica Group]
 emb|CAH66205.1| OSIGBa0148D14.11 [Oryza sativa Indica Group]
Length=381

 Score =   119 bits (298),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 54/65 (83%), Positives = 59/65 (91%), Gaps = 3/65 (5%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTV  173
            GVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYKICRG   +N CGVDSMVS+V
Sbjct  312  GVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKICRGPHDKNKCGVDSMVSSV  371

Query  174  AAVNT  188
             A++T
Sbjct  372  TAIHT  376



>gb|EEE60725.1| hypothetical protein OsJ_14236 [Oryza sativa Japonica Group]
Length=364

 Score =   119 bits (297),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 54/65 (83%), Positives = 59/65 (91%), Gaps = 3/65 (5%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTV  173
            GVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYKICRG   +N CGVDSMVS+V
Sbjct  295  GVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKICRGPHDKNKCGVDSMVSSV  354

Query  174  AAVNT  188
             A++T
Sbjct  355  TAIHT  359



>ref|XP_003579573.2| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=399

 Score =   119 bits (297),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 53/69 (77%), Positives = 59/69 (86%), Gaps = 3/69 (4%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTV  173
            GVLLVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVSTV
Sbjct  331  GVLLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKICRGAHVKNKCGVDSMVSTV  390

Query  174  AAVNTPTSD  200
             A++T   +
Sbjct  391  TAIHTSNKE  399



>gb|AAL60581.1|AF454959_1 senescence-associated cysteine protease [Brassica oleracea]
Length=368

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKICRGRN+CGVDS+VSTV A 
Sbjct  303  GVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEDGFYKICRGRNVCGVDSLVSTVTAT  362

Query  183  NTPTS  197
             +P +
Sbjct  363  VSPAA  367



>gb|ACM80348.1| cysteine proteinase [Solanum lycopersicum]
Length=368

 Score =   118 bits (296),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 59/64 (92%), Gaps = 1/64 (2%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKI RGRN+CGVDSMVSTVAAV
Sbjct  306  GVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGESGYYKIRRGRNVCGVDSMVSTVAAV  364

Query  183  NTPT  194
            +T +
Sbjct  365  STSS  368



>emb|CDY71205.1| BnaCnng71840D [Brassica napus]
Length=368

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKICRGRN+CGVDS+VSTV A 
Sbjct  303  GVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEDGFYKICRGRNVCGVDSLVSTVTAT  362

Query  183  NTPTS  197
             +P +
Sbjct  363  VSPAA  367



>gb|KHN12668.1| Cysteine proteinase 15A [Glycine soja]
Length=156

 Score =   114 bits (284),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG   YAPIR K KPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAA+
Sbjct  92   GVLLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAI  151



>gb|EAY93546.1| hypothetical protein OsI_15336 [Oryza sativa Indica Group]
Length=348

 Score =   118 bits (295),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 54/65 (83%), Positives = 59/65 (91%), Gaps = 3/65 (5%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTV  173
            GVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYKICRG   +N CGVDSMVS+V
Sbjct  279  GVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKICRGPHDKNKCGVDSMVSSV  338

Query  174  AAVNT  188
             A++T
Sbjct  339  TAIHT  343



>emb|CAB17075.1| cysteine proteinase precursor [Phaseolus vulgaris]
Length=365

 Score =   118 bits (296),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 51/64 (80%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG   YAPIR KEKPYWIIKNSWGE+WG  GYYKICRGRN+CGVDSMVSTV A+
Sbjct  301  GVLLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGGNGYYKICRGRNVCGVDSMVSTVGAI  360

Query  183  NTPT  194
            +  T
Sbjct  361  HAST  364



>ref|XP_009335626.1| PREDICTED: cysteine proteinase 15A [Pyrus x bretschneideri]
Length=366

 Score =   118 bits (296),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 50/61 (82%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS+G+APIR KEKPYWI+KNSWG+SWGE+GYYKICRG N CGVDS+VSTVAA+
Sbjct  302  GVLLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEQGYYKICRGYNSCGVDSLVSTVAAL  361

Query  183  N  185
            +
Sbjct  362  H  362



>ref|NP_567489.1| papain family cysteine protease [Arabidopsis thaliana]
 emb|CAB10398.1| cysteine proteinase like protein [Arabidopsis thaliana]
 emb|CAB78661.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AAK62611.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM91059.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM96982.1| cysteine proteinase [Arabidopsis thaliana]
 gb|AAN31875.1| putative cysteine proteinase [Arabidopsis thaliana]
 dbj|BAE98514.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AEE83713.1| papain family cysteine protease [Arabidopsis thaliana]
Length=373

 Score =   118 bits (295),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 52/63 (83%), Positives = 58/63 (92%), Gaps = 1/63 (2%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-RNICGVDSMVSTVAA  179
            GVLLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  N+CG+D+MVSTVAA
Sbjct  308  GVLLVGFGSSGYAPIRLKEKPYWIIKNSWGAMWGEHGYYKICRGPHNMCGMDTMVSTVAA  367

Query  180  VNT  188
            V+T
Sbjct  368  VHT  370



>gb|KFK24413.1| hypothetical protein AALP_AAs58848U000200 [Arabis alpina]
Length=372

 Score =   118 bits (295),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 54/65 (83%), Positives = 59/65 (91%), Gaps = 2/65 (3%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR-NICGVDSMVSTVAA  179
            GVLLVG+G +GYAPIRLKEKPYWIIKNSWG+ WGE GYYKICRGR NICG+D+MVSTVAA
Sbjct  307  GVLLVGFGESGYAPIRLKEKPYWIIKNSWGKMWGEHGYYKICRGRHNICGMDTMVSTVAA  366

Query  180  VN-TP  191
            V  TP
Sbjct  367  VQITP  371



>gb|EMT16425.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=379

 Score =   118 bits (295),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 53/65 (82%), Positives = 58/65 (89%), Gaps = 3/65 (5%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTV  173
            GVLLVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVSTV
Sbjct  311  GVLLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKICRGPHVKNKCGVDSMVSTV  370

Query  174  AAVNT  188
             A++T
Sbjct  371  TAIHT  375



>gb|ABK24153.1| unknown [Picea sitchensis]
Length=394

 Score =   118 bits (295),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 49/66 (74%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+AGYAP RLK KP+WIIKNSWG  WGE GYYK+CRG N+CG+++MVSTVAA 
Sbjct  328  GVLLVGYGAAGYAPGRLKNKPFWIIKNSWGPDWGEDGYYKLCRGHNVCGINTMVSTVAAA  387

Query  183  NTPTSD  200
            N  T D
Sbjct  388  NIQTDD  393



>ref|XP_002452058.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
 gb|EES05034.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
Length=371

 Score =   117 bits (294),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 54/65 (83%), Positives = 59/65 (91%), Gaps = 3/65 (5%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTV  173
            GVLLVGYG+AG+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV
Sbjct  304  GVLLVGYGAAGFAPIRLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTV  363

Query  174  AAVNT  188
            +AV T
Sbjct  364  SAVRT  368



>ref|XP_002870174.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46433.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
Length=373

 Score =   117 bits (294),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 52/63 (83%), Positives = 58/63 (92%), Gaps = 1/63 (2%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-RNICGVDSMVSTVAA  179
            GVLLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  N+CG+D+MVSTVAA
Sbjct  308  GVLLVGFGSSGYAPIRLKEKPYWIIKNSWGAMWGEHGYYKICRGPHNMCGMDTMVSTVAA  367

Query  180  VNT  188
            V+T
Sbjct  368  VHT  370



>ref|XP_006411706.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
 dbj|BAJ33785.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53159.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
Length=373

 Score =   117 bits (293),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAP R KEKPYWIIKNSWGESWGE G+YKIC+GRNICGVDS+VSTV+A 
Sbjct  308  GVLLVGYGSAGYAPARFKEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSLVSTVSAT  367

Query  183  NTPTS  197
             + T+
Sbjct  368  VSTTA  372



>dbj|BAD43619.1| putative cysteine proteinase [Arabidopsis thaliana]
Length=361

 Score =   117 bits (293),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAG++  RLKEKPYWIIKNSWGESWGE G+YKIC+GRNICGVDS+VSTVAA 
Sbjct  300  GVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSLVSTVAAT  359

Query  183  NT  188
             +
Sbjct  360  TS  361



>ref|XP_006653265.1| PREDICTED: cysteine proteinase 1-like, partial [Oryza brachyantha]
Length=366

 Score =   117 bits (293),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 54/65 (83%), Positives = 58/65 (89%), Gaps = 3/65 (5%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTV  173
            GVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVSTV
Sbjct  298  GVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGPHVQNKCGVDSMVSTV  357

Query  174  AAVNT  188
             A++T
Sbjct  358  TAIHT  362



>ref|XP_004152668.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004167370.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN62647.1| Cysteine protease [Cucumis sativus]
Length=371

 Score =   117 bits (293),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 49/60 (82%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+AG+APIRLKEKPYWIIKNSWGE+WGE GYY IC+G+NICG +SMVS+VAA+
Sbjct  310  GVLLVGYGAAGFAPIRLKEKPYWIIKNSWGENWGENGYYFICKGKNICGSESMVSSVAAI  369



>gb|KFK30492.1| hypothetical protein AALP_AA7G268600 [Arabis alpina]
Length=367

 Score =   117 bits (293),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTVAA 
Sbjct  302  GVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVAAT  361

Query  183  NTPTS  197
             + T+
Sbjct  362  VSTTA  366



>ref|XP_004952477.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=374

 Score =   117 bits (293),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 53/64 (83%), Positives = 59/64 (92%), Gaps = 3/64 (5%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTV  173
            GVLLVGYG+AG+APIRLKEKPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV
Sbjct  306  GVLLVGYGAAGFAPIRLKEKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTV  365

Query  174  AAVN  185
            +A++
Sbjct  366  SAIH  369



>ref|NP_565512.1| Papain family cysteine protease [Arabidopsis thaliana]
 sp|P43295.2|A494_ARATH RecName: Full=Probable cysteine proteinase A494; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD23687.1| cysteine proteinase [Arabidopsis thaliana]
 gb|ABJ98563.1| At2g21430 [Arabidopsis thaliana]
 gb|AEC07177.1| Papain family cysteine protease [Arabidopsis thaliana]
Length=361

 Score =   117 bits (292),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAG++  RLKEKPYWIIKNSWGESWGE G+YKIC+GRNICGVDS+VSTVAA 
Sbjct  300  GVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSLVSTVAAT  359

Query  183  NT  188
             +
Sbjct  360  TS  361



>gb|EMS53996.1| Cysteine proteinase 1 [Triticum urartu]
Length=405

 Score =   117 bits (293),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 53/65 (82%), Positives = 58/65 (89%), Gaps = 3/65 (5%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTV  173
            GVLLVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVSTV
Sbjct  337  GVLLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKICRGPHVKNKCGVDSMVSTV  396

Query  174  AAVNT  188
             A++T
Sbjct  397  TAIHT  401



>ref|XP_002279862.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI19784.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   117 bits (292),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 49/65 (75%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGY+PIR KEKPYWI+KNSW + WGE GYY+ICRG+N+CGVDSMVS+V A 
Sbjct  303  GVLLVGYGSAGYSPIRFKEKPYWILKNSWSKYWGEHGYYRICRGQNMCGVDSMVSSVVAA  362

Query  183  NTPTS  197
               TS
Sbjct  363  IQTTS  367



>ref|XP_006404590.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
 gb|ESQ46043.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
Length=363

 Score =   117 bits (292),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVA  176
            GVLLVGYGSAG+A  RLK+KPYWIIKNSWGE+WGE GYYK+CRGRNICGVDS+VSTVA
Sbjct  303  GVLLVGYGSAGFAQARLKKKPYWIIKNSWGETWGENGYYKLCRGRNICGVDSLVSTVA  360



>ref|XP_002880378.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56637.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score =   116 bits (290),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLL+GYGS+GY+  RLKEKPYWIIKNSWGESWGE G+YKIC+GRNICGVDS+VSTVAA 
Sbjct  299  GVLLMGYGSSGYSQARLKEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSLVSTVAAA  358

Query  183  NT  188
             +
Sbjct  359  TS  360



>dbj|BAA92495.1| cysteine protease [Vigna mungo]
Length=364

 Score =   116 bits (290),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 50/61 (82%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GV +VGYG +GYAPIR KEKPYWIIKNSWGESWGE GYYKICRG+N CGVDSMVSTV A+
Sbjct  300  GVQIVGYGESGYAPIRFKEKPYWIIKNSWGESWGENGYYKICRGQNACGVDSMVSTVGAI  359

Query  183  N  185
            +
Sbjct  360  H  360



>ref|XP_002868883.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45142.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTV A 
Sbjct  303  GVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVTAA  362

Query  183  NTPTS  197
             + T+
Sbjct  363  VSTTA  367



>ref|XP_004975256.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=388

 Score =   116 bits (290),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 3/64 (5%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTV  173
            GVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYK+CRG   +N CGVDSMVSTV
Sbjct  320  GVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGENGYYKLCRGPFVKNKCGVDSMVSTV  379

Query  174  AAVN  185
             A++
Sbjct  380  TAIH  383



>emb|CDY41960.1| BnaA01g05320D [Brassica napus]
Length=367

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTV A 
Sbjct  302  GVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVTAA  361

Query  183  NTPTS  197
             + T+
Sbjct  362  VSTTA  366



>gb|AAZ32411.1| cysteine proteinase glycinain type [Nicotiana benthamiana]
Length=355

 Score =   115 bits (288),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTV  173
            GVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG NICGVD+MVSTV
Sbjct  299  GVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTV  355



>ref|XP_010446443.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTV+A 
Sbjct  302  GVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVSAT  361



>ref|XP_006665032.1| PREDICTED: cysteine proteinase 1-like [Oryza brachyantha]
Length=191

 Score =   112 bits (280),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 59/65 (91%), Gaps = 3/65 (5%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNI---CGVDSMVSTV  173
            GVLLVGYGS+G+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG N+   CGVDSMVSTV
Sbjct  124  GVLLVGYGSSGFAPIRLKDKPYWIIKNSWGENWGEHGYYKICRGSNVRDKCGVDSMVSTV  183

Query  174  AAVNT  188
             A++T
Sbjct  184  TAIHT  188



>ref|NP_001105685.1| cysteine proteinase 1 precursor [Zea mays]
 sp|Q10716.1|CYSP1_MAIZE RecName: Full=Cysteine proteinase 1; Flags: Precursor [Zea mays]
 dbj|BAA08244.1| cysteine proteinase [Zea mays]
Length=371

 Score =   115 bits (288),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 59/64 (92%), Gaps = 3/64 (5%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTV  173
            GVLLVGYG++G+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV
Sbjct  304  GVLLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTV  363

Query  174  AAVN  185
            +AV+
Sbjct  364  SAVH  367



>gb|ACF86683.1| unknown [Zea mays]
 gb|AFW71402.1| cysteine protease1 [Zea mays]
Length=371

 Score =   115 bits (287),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 59/64 (92%), Gaps = 3/64 (5%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTV  173
            GVLLVGYG++G+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV
Sbjct  304  GVLLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTV  363

Query  174  AAVN  185
            +AV+
Sbjct  364  SAVH  367



>gb|EYU27644.1| hypothetical protein MIMGU_mgv1a008452mg [Erythranthe guttata]
Length=373

 Score =   115 bits (287),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 48/65 (74%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+AGY+ IRLK KPYWI+KNSWGESWGE+GYYKIC+G N+CGV+SMVS+V A+
Sbjct  309  GVLLVGYGAAGYSTIRLKNKPYWIVKNSWGESWGEEGYYKICKGHNVCGVESMVSSVNAI  368

Query  183  NTPTS  197
            +T ++
Sbjct  369  HTTSA  373



>ref|XP_003574963.1| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=377

 Score =   115 bits (287),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 52/65 (80%), Positives = 58/65 (89%), Gaps = 3/65 (5%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTV  173
            GVLLVGYG++G+AP RLK KPYW+IKNSWGE+WGEKGYYKICRG   RN CGVDSMVSTV
Sbjct  309  GVLLVGYGASGFAPSRLKNKPYWVIKNSWGENWGEKGYYKICRGSNVRNKCGVDSMVSTV  368

Query  174  AAVNT  188
            AA +T
Sbjct  369  AAAHT  373



>ref|XP_009150026.1| PREDICTED: cysteine proteinase RD19a [Brassica rapa]
Length=367

 Score =   115 bits (287),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAP R KE+PYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTV A 
Sbjct  302  GVLLVGYGSAGYAPARFKERPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVTAA  361

Query  183  NTPTS  197
             + T+
Sbjct  362  VSTTA  366



>ref|XP_003545051.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=367

 Score =   114 bits (286),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVL+VGYG   YAPIR K KPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAA+
Sbjct  303  GVLIVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAI  362



>emb|CAQ00101.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=381

 Score =   115 bits (287),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 51/64 (80%), Positives = 56/64 (88%), Gaps = 3/64 (5%)
 Frame = +3

Query  6    VLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVA  176
            V LVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVSTV 
Sbjct  314  VFLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKICRGPHVKNKCGVDSMVSTVT  373

Query  177  AVNT  188
            A++T
Sbjct  374  AIHT  377



>emb|CDX99593.1| BnaC04g33500D [Brassica napus]
Length=343

 Score =   114 bits (286),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 48/59 (81%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  179
            GVLLVGYGSAG++  R KEKPYWIIKNSWGE+WGE G+YK+C+GRN+CGVDSMVSTVAA
Sbjct  283  GVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENGFYKLCKGRNVCGVDSMVSTVAA  341



>ref|XP_009140277.1| PREDICTED: probable cysteine proteinase A494 [Brassica rapa]
Length=362

 Score =   114 bits (286),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 47/59 (80%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  179
            GVLLVGYGSAG++  R KEKPYWIIKNSWGE+WGE G+YK+C+GRN+CG+DSMVSTVAA
Sbjct  302  GVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENGFYKLCKGRNVCGIDSMVSTVAA  360



>emb|CDY15894.1| BnaA04g12170D [Brassica napus]
Length=362

 Score =   114 bits (286),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 47/59 (80%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  179
            GVLLVGYGSAG++  R KEKPYWIIKNSWGE+WGE G+YK+C+GRN+CG+DSMVSTVAA
Sbjct  302  GVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENGFYKLCKGRNVCGIDSMVSTVAA  360



>dbj|BAD10859.1| cysteine protease [Aster tripolium]
Length=363

 Score =   114 bits (285),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 48/62 (77%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAP+R KEKPYWIIKNSWGE WGE GYYK+C G N CG+D+MVS V + 
Sbjct  302  GVLLVGYGSAGYAPLRFKEKPYWIIKNSWGEDWGEDGYYKLCSGYNACGMDTMVSAVVST  361

Query  183  NT  188
            NT
Sbjct  362  NT  363



>ref|NP_001052440.1| Os04g0311400 [Oryza sativa Japonica Group]
 dbj|BAF14354.1| Os04g0311400, partial [Oryza sativa Japonica Group]
Length=384

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 59/65 (91%), Gaps = 3/65 (5%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTV  173
            GVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYKICRG   +N CGVDSMVS+V
Sbjct  315  GVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKICRGPHDKNKCGVDSMVSSV  374

Query  174  AAVNT  188
             A++T
Sbjct  375  TAIHT  379



>emb|CAA52403.1| putative thiol protease [Arabidopsis thaliana]
Length=313

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAG++  RLKEKPYWIIKNSWGESWGE G+YKIC+GRNICGVDS+VSTVAA 
Sbjct  252  GVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSLVSTVAAT  311

Query  183  NT  188
             +
Sbjct  312  TS  313



>gb|ABK21238.1| unknown [Picea sitchensis]
 gb|ABR16087.1| unknown [Picea sitchensis]
 gb|ABR17330.1| unknown [Picea sitchensis]
 gb|ABR17545.1| unknown [Picea sitchensis]
 gb|ACN40765.1| unknown [Picea sitchensis]
Length=366

 Score =   114 bits (284),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+A +APIR+K+KPYW+IKNSWG +WGE GYYK+CRG N+CG+++MVSTVAA+
Sbjct  307  GVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENGYYKLCRGHNVCGINNMVSTVAAI  366



>gb|ABK24688.1| unknown [Picea sitchensis]
 gb|ACN39791.1| unknown [Picea sitchensis]
 gb|ACN40241.1| unknown [Picea sitchensis]
Length=366

 Score =   114 bits (284),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+A +APIR+K+KPYW+IKNSWG +WGE GYYK+CRG N+CG+++MVSTVAA+
Sbjct  307  GVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENGYYKLCRGHNVCGINNMVSTVAAI  366



>gb|ACN40679.1| unknown [Picea sitchensis]
Length=366

 Score =   113 bits (283),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+A +APIR+K+KPYW+IKNSWG +WGE GYYK+CRG N+CG+++MVSTVAA+
Sbjct  307  GVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENGYYKLCRGHNVCGINNMVSTVAAI  366



>gb|AGS43121.1| cysteine protease 1, partial [Zea mays]
Length=90

 Score =   107 bits (267),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 59/65 (91%), Gaps = 3/65 (5%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTV  173
            GVLLVGYG++G+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV
Sbjct  23   GVLLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTV  82

Query  174  AAVNT  188
            +AV+ 
Sbjct  83   SAVHA  87



>gb|AEX97108.1| cysteine proteinase, partial [Malus domestica]
Length=128

 Score =   107 bits (268),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  179
            GVLLVGYGSAG+APIR KEKPYWIIKNSWG++WGE GYY IC+GRNICG +SMVS+VAA
Sbjct  29   GVLLVGYGSAGFAPIRFKEKPYWIIKNSWGQNWGENGYYLICKGRNICGSESMVSSVAA  87



>emb|CAA57675.1| cysteine proteinase [Zea mays]
Length=145

 Score =   108 bits (269),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 59/65 (91%), Gaps = 3/65 (5%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTV  173
            GVLLVGYG++G+AP+RLK+KPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV
Sbjct  78   GVLLVGYGASGFAPMRLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTV  137

Query  174  AAVNT  188
            +AV+ 
Sbjct  138  SAVHA  142



>ref|NP_001046828.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAD19579.1| putative cysteine proteinase 1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF08742.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAG92750.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93804.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94031.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83204.1| hypothetical protein OsI_28465 [Oryza sativa Indica Group]
 gb|EEE56967.1| hypothetical protein OsJ_06681 [Oryza sativa Japonica Group]
Length=373

 Score =   112 bits (280),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 51/65 (78%), Positives = 59/65 (91%), Gaps = 3/65 (5%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTV  173
            GVLLVGYG++G+APIRLK+K YWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV
Sbjct  306  GVLLVGYGASGFAPIRLKDKAYWIIKNSWGENWGEHGYYKICRGSNVRNKCGVDSMVSTV  365

Query  174  AAVNT  188
            +A++T
Sbjct  366  SAIHT  370



>gb|EMT10192.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=369

 Score =   112 bits (279),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 50/64 (78%), Positives = 57/64 (89%), Gaps = 3/64 (5%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTV  173
            GVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYKICRG   RN CGVDSMVSTV
Sbjct  301  GVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTV  360

Query  174  AAVN  185
            +A +
Sbjct  361  SATH  364



>tpe|CAD66657.1| TPA: putative cysteine proteinase precursor [Hordeum vulgare 
subsp. vulgare]
 dbj|BAJ94057.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   112 bits (279),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 50/65 (77%), Positives = 58/65 (89%), Gaps = 3/65 (5%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTV  173
            GVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYKICRG   RN CGVDSMVSTV
Sbjct  309  GVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTV  368

Query  174  AAVNT  188
            +A ++
Sbjct  369  SATHS  373



>ref|XP_003607110.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89307.1| papain family cysteine protease [Medicago truncatula]
Length=331

 Score =   111 bits (278),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS   A ++ KEKPYWI+KNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA 
Sbjct  267  GVLLVGYGSGAGADMKEKEKPYWIVKNSWGETWGENGYYKICRGRNICGVDSMVSTVAAA  326

Query  183  NTPTS  197
            +T T 
Sbjct  327  HTTTQ  331



>gb|KEH30505.1| papain family cysteine protease [Medicago truncatula]
Length=330

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS   A ++ KEKPYWI+KNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA 
Sbjct  266  GVLLVGYGSGAGADMKEKEKPYWIVKNSWGETWGENGYYKICRGRNICGVDSMVSTVAAA  325

Query  183  NTPTS  197
            +T T 
Sbjct  326  HTNTQ  330



>gb|AAW21813.1| cysteine protease [Triticum aestivum]
Length=377

 Score =   111 bits (277),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 50/64 (78%), Positives = 57/64 (89%), Gaps = 3/64 (5%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTV  173
            GVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYKICRG   RN CGVDSMVSTV
Sbjct  309  GVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTV  368

Query  174  AAVN  185
            +A +
Sbjct  369  SATH  372



>gb|AAB16996.1| thiol protease isoform B, partial [Glycine max]
Length=319

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG   YAPIR K KPYWIIKNSWGESWGE GY +ICRGRN+CGVDSMVSTVAA+
Sbjct  255  GVLLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYDEICRGRNVCGVDSMVSTVAAI  314



>gb|EPS65881.1| cysteine proteinase, partial [Genlisea aurea]
Length=335

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  179
            G+L+VGYG++GYAPIRLKEKPYWI+KNSWGE+WGE+GYYKIC+G N+CGV+S+VSTV A
Sbjct  277  GILIVGYGASGYAPIRLKEKPYWIVKNSWGENWGEQGYYKICKGHNVCGVESLVSTVTA  335



>emb|CAH59428.1| cysteine protease 2 [Plantago major]
Length=245

 Score =   108 bits (269),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVL+VGYG+ GYAP+RLK KPYWIIKNSWGESWGE GYYKICRGRN+CGV+SMVS+V A 
Sbjct  182  GVLIVGYGT-GYAPVRLKNKPYWIIKNSWGESWGESGYYKICRGRNVCGVESMVSSVTAA  240

Query  183  NTPTS  197
            +  T+
Sbjct  241  HFTTT  245



>ref|XP_002969223.1| hypothetical protein SELMODRAFT_91274 [Selaginella moellendorffii]
 gb|EFJ29311.1| hypothetical protein SELMODRAFT_91274 [Selaginella moellendorffii]
Length=367

 Score =   109 bits (272),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVA  176
            GVLLVGYG+ GYAPIR  EKPYWIIKNSWG +WGE+GYYKICRG  +CG+++MVSTVA
Sbjct  310  GVLLVGYGAKGYAPIRFTEKPYWIIKNSWGATWGEQGYYKICRGHGMCGMNTMVSTVA  367



>gb|EMS64962.1| Cysteine proteinase 1 [Triticum urartu]
Length=302

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 57/64 (89%), Gaps = 3/64 (5%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTV  173
            GVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYKICRG   RN CGVDSMVSTV
Sbjct  234  GVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTV  293

Query  174  AAVN  185
            +A +
Sbjct  294  SATH  297



>ref|XP_009786000.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana sylvestris]
Length=370

 Score =   108 bits (269),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 45/53 (85%), Positives = 50/53 (94%), Gaps = 1/53 (2%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSM  161
            GVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKICRGRN+CGVDSM
Sbjct  307  GVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGENGYYKICRGRNVCGVDSM  358



>dbj|BAC57957.1| thiol protease [Aster tripolium]
Length=188

 Score =   104 bits (259),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGYAP RLKEKPYWIIKNSWG  WGE GYYKIC G N+CG+D+MVS V + 
Sbjct  127  GVLLVGYGSAGYAPSRLKEKPYWIIKNSWGPDWGEDGYYKICSGHNLCGMDTMVSAVVST  186

Query  183  NT  188
            + 
Sbjct  187  SA  188



>ref|XP_010690815.1| PREDICTED: cysteine proteinase RD19a [Beta vulgaris subsp. vulgaris]
Length=403

 Score =   106 bits (265),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 56/63 (89%), Gaps = 2/63 (3%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGSAGY+ +R +EKPYWIIKNSWGE WGE GYY++CRG ++CGV+++VSTVA  
Sbjct  342  GVLLVGYGSAGYSDMRKEEKPYWIIKNSWGEYWGENGYYRLCRGYDLCGVNTLVSTVA--  399

Query  183  NTP  191
            +TP
Sbjct  400  DTP  402



>gb|AAB53103.1| cysteine protease, partial [Brassica napus]
Length=85

 Score =   100 bits (249),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMV  164
            GVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKICRGRN+CGVD  V
Sbjct  32   GVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICRGRNVCGVDMSV  85



>gb|AES89347.2| papain family cysteine protease [Medicago truncatula]
Length=327

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 53/64 (83%), Gaps = 4/64 (6%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS  Y     KEKPYWI+K+SWGE+WGE GYYKICRGRNICGVDSMVSTVAA 
Sbjct  267  GVLLVGYGSGAYT----KEKPYWIVKSSWGETWGENGYYKICRGRNICGVDSMVSTVAAA  322

Query  183  NTPT  194
             T T
Sbjct  323  QTTT  326



>ref|XP_003607150.1| Cysteine proteinase [Medicago truncatula]
Length=326

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 53/64 (83%), Gaps = 4/64 (6%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYGS  Y     KEKPYWI+K+SWGE+WGE GYYKICRGRNICGVDSMVSTVAA 
Sbjct  266  GVLLVGYGSGAYT----KEKPYWIVKSSWGETWGENGYYKICRGRNICGVDSMVSTVAAA  321

Query  183  NTPT  194
             T T
Sbjct  322  QTTT  325



>gb|AAB16997.1| thiol protease isoform A, partial [Glycine max]
Length=318

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 53/61 (87%), Gaps = 1/61 (2%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK-GYYKICRGRNICGVDSMVSTVAA  179
            GVLLVGYG   YAPIR K KPYWIIKNSWGESWGE  GY +ICRGRN+CGVD+MVSTVAA
Sbjct  253  GVLLVGYGEGRYAPIRFKNKPYWIIKNSWGESWGENDGYDEICRGRNVCGVDAMVSTVAA  312

Query  180  V  182
            +
Sbjct  313  I  313



>ref|XP_002960585.1| hypothetical protein SELMODRAFT_266583 [Selaginella moellendorffii]
 gb|EFJ38124.1| hypothetical protein SELMODRAFT_266583 [Selaginella moellendorffii]
Length=330

 Score =   103 bits (258),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVA  176
            GVLLVGYG+ GYAPIR  EKPYWIIKNSWG +WGE+GYYKICRG  +CG+++MVSTVA
Sbjct  273  GVLLVGYGAKGYAPIRFTEKPYWIIKNSWGATWGEQGYYKICRGHGMCGMNTMVSTVA  330



>ref|NP_001059639.1| Os07g0480900 [Oryza sativa Japonica Group]
 dbj|BAC45132.1| putative cysteine proteinase [Oryza sativa Japonica Group]
 dbj|BAF21553.1| Os07g0480900 [Oryza sativa Japonica Group]
 dbj|BAG88694.1| unnamed protein product [Oryza sativa Japonica Group]
Length=376

 Score =   102 bits (255),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 43/63 (68%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG  G+A +RL  +PYWIIKNSWG++WGE+GYY++CRGRN+CGVD+MVS VA  
Sbjct  313  GVLLVGYGERGFAALRLGHRPYWIIKNSWGKAWGEQGYYRLCRGRNVCGVDTMVSAVAVA  372

Query  183  NTP  191
              P
Sbjct  373  PPP  375



>ref|XP_009404192.1| PREDICTED: cysteine proteinase 15A [Musa acuminata subsp. malaccensis]
Length=361

 Score =   102 bits (253),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+ GY+ +RL  +PYWIIKNSWG+ WGE+GYY++CRG NICG+DSMVS VAA 
Sbjct  301  GVLLVGYGARGYSILRLGYRPYWIIKNSWGKQWGEQGYYRLCRGHNICGIDSMVSAVAAA  360

Query  183  N  185
            +
Sbjct  361  S  361



>ref|XP_002460693.1| hypothetical protein SORBIDRAFT_02g033270 [Sorghum bicolor]
 gb|EER97214.1| hypothetical protein SORBIDRAFT_02g033270 [Sorghum bicolor]
Length=373

 Score =   102 bits (253),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  182
            GVLLVGYG+ G+A +RL  +PYWIIKNSWGE WGE+GYY++CRG N+CGVDSMVS VA  
Sbjct  311  GVLLVGYGARGFAALRLGYRPYWIIKNSWGERWGEQGYYRLCRGSNVCGVDSMVSAVAVA  370

Query  183  NTP  191
              P
Sbjct  371  PVP  373



>ref|XP_006293095.1| hypothetical protein CARUB_v10019394mg [Capsella rubella]
 gb|EOA25993.1| hypothetical protein CARUB_v10019394mg [Capsella rubella]
Length=367

 Score =   101 bits (251),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVA  176
            GVLLVGYGS G++ +RL  KPYWIIKNSWG+ WGE GYYK+CRG +ICG++SMVS VA
Sbjct  305  GVLLVGYGSKGFSILRLSNKPYWIIKNSWGKKWGEDGYYKLCRGHDICGINSMVSAVA  362



>ref|XP_006658557.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase 15A-like 
[Oryza brachyantha]
Length=346

 Score =   100 bits (249),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVA  176
            GVLLVGYG  G++ +RL  +PYWIIKNSWG++WGE+GYY++CRGRN+CGVDSMVS VA
Sbjct  285  GVLLVGYGERGFSALRLGYRPYWIIKNSWGKAWGEQGYYRLCRGRNVCGVDSMVSAVA  342



>ref|XP_004959670.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=374

 Score =   100 bits (248),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVA  176
            GVLLVGYG+ G+A +RL  +PYW+IKNSWGE WGEKGYY++CRG N+CGVD+MVS VA
Sbjct  309  GVLLVGYGARGFAALRLGYRPYWVIKNSWGEQWGEKGYYRLCRGSNVCGVDTMVSAVA  366



>tpg|DAA40800.1| TPA: putative cysteine protease family protein [Zea mays]
Length=381

 Score =   100 bits (248),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVA  176
            GVLLVGYG+ G+A +RL  +PYWIIKNSWG+ WGE+GYY++CRG N+CGVDSMVS VA
Sbjct  319  GVLLVGYGARGFAALRLGYRPYWIIKNSWGKQWGEQGYYRLCRGSNVCGVDSMVSAVA  376



>ref|XP_010504326.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=363

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVA  176
            GVLLVGYGS G++ +RL  KPYWIIKNSWG+ WGE GYYK+CRG +ICG++SMVS VA
Sbjct  301  GVLLVGYGSKGFSILRLSNKPYWIIKNSWGKKWGEDGYYKLCRGHDICGINSMVSAVA  358



>gb|KFK34737.1| hypothetical protein AALP_AA5G186400 [Arabis alpina]
Length=369

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 41/58 (71%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVA  176
            GVLLVGYGS G++ +RL  KPYWIIKNSWG+ WGE GYYK+CRG ++CG++SMVS VA
Sbjct  307  GVLLVGYGSKGFSLLRLSNKPYWIIKNSWGKKWGENGYYKLCRGHDMCGINSMVSAVA  364



>gb|EMS59778.1| Cysteine proteinase 15A [Triticum urartu]
Length=195

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    GVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVA  176
            GVLLVGYG+ G++ +RL  +PYW+IKNSWG+ WGE GYYK+CRGRN+CGVDSMVS VA
Sbjct  135  GVLLVGYGARGFSALRLGYRPYWLIKNSWGQQWGEGGYYKLCRGRNVCGVDSMVSAVA  192



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556620951360