BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP010H09 445 bp,:Filtered

Length=445
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAK27969.1|AF242373_1  cysteine protease                             182   8e-53   Ipomoea batatas [batate]
gb|AAF40414.1|AF216783_1  papain-like cysteine proteinase isoform I     182   1e-52   Ipomoea batatas [batate]
gb|AAF61440.1|AF138264_1  papain-like cysteine proteinase isoform I     182   1e-52   Ipomoea batatas [batate]
gb|AAF40415.1|AF216784_1  papain-like cysteine proteinase isoform II    182   1e-52   Ipomoea batatas [batate]
gb|AAF40416.1|AF216785_1  papain-like cysteine proteinase isoform...    182   1e-52   Ipomoea batatas [batate]
gb|AAF61441.1|AF138265_1  papain-like cysteine proteinase isoform II    180   7e-52   Ipomoea batatas [batate]
ref|XP_002512963.1|  cysteine protease, putative                        176   1e-50   Ricinus communis
sp|P05993.1|PAPA5_CARPA  RecName: Full=Cysteine proteinase; AltNa...    167   3e-50   Carica papaya [mamon]
gb|KDP41743.1|  hypothetical protein JCGZ_26761                         175   4e-50   Jatropha curcas
gb|KHG24064.1|  Cysteinease RD19a -like protein                         175   4e-50   Gossypium arboreum [tree cotton]
gb|AIB06024.1|  CP2                                                     175   5e-50   Hevea brasiliensis [jebe]
gb|AAX19661.1|  cysteine proteinase                                     175   6e-50   Populus tomentosa [Chinese white poplar]
gb|ABK96252.1|  unknown                                                 168   7e-50   Populus trichocarpa x Populus deltoides
gb|KJB32561.1|  hypothetical protein B456_005G247000                    174   9e-50   Gossypium raimondii
ref|XP_011047717.1|  PREDICTED: cysteine proteinase RD19a               174   9e-50   Populus euphratica
gb|ABQ10201.1|  cysteine protease Cp3                                   174   1e-49   Actinidia deliciosa [Chinese gooseberry]
emb|CDP20652.1|  unnamed protein product                                174   2e-49   Coffea canephora [robusta coffee]
gb|KJB79047.1|  hypothetical protein B456_013G033800                    174   2e-49   Gossypium raimondii
emb|CAE54306.1|  putative papain-like cysteine proteinase               173   2e-49   Gossypium hirsutum [American cotton]
ref|XP_002313770.1|  cysteine proteinase A494 precursor                 173   3e-49   Populus trichocarpa [western balsam poplar]
gb|KHG15253.1|  Cysteinease RD19a -like protein                         173   3e-49   Gossypium arboreum [tree cotton]
gb|ABK92536.1|  unknown                                                 173   3e-49   Populus trichocarpa [western balsam poplar]
ref|NP_001267989.1|  cysteine protease precursor                        172   5e-49   Vitis vinifera
ref|XP_007042077.1|  Papain family cysteine protease                    173   6e-49   Theobroma cacao [chocolate]
ref|XP_009351218.1|  PREDICTED: cysteine proteinase RD19a-like          170   6e-49   Pyrus x bretschneideri [bai li]
gb|AAL69389.1|AF462226_1  putative cysteine proteinase                  165   6e-49   Narcissus pseudonarcissus
ref|XP_009373025.1|  PREDICTED: cysteine proteinase RD19a-like          172   8e-49   Pyrus x bretschneideri [bai li]
ref|XP_010271520.1|  PREDICTED: cysteine proteinase RD19a-like          172   1e-48   Nelumbo nucifera [Indian lotus]
ref|XP_009373000.1|  PREDICTED: cysteine proteinase RD19a               171   1e-48   Pyrus x bretschneideri [bai li]
gb|ACI04578.1|  cysteine protease-like protein                          171   1e-48   Robinia pseudoacacia [black locust]
ref|XP_008382317.1|  PREDICTED: cysteine proteinase RD19a               171   1e-48   Malus domestica [apple tree]
ref|XP_010028631.1|  PREDICTED: cysteine proteinase RD19a-like          171   1e-48   Eucalyptus grandis [rose gum]
ref|XP_004290288.1|  PREDICTED: probable cysteine proteinase A494       171   1e-48   Fragaria vesca subsp. vesca
ref|XP_008236965.1|  PREDICTED: cysteine proteinase RD19a               171   2e-48   Prunus mume [ume]
gb|KHN39817.1|  Cysteine proteinase RD19a                               170   2e-48   Glycine soja [wild soybean]
ref|XP_007201310.1|  hypothetical protein PRUPE_ppa007454mg             171   2e-48   Prunus persica
ref|XP_011037175.1|  PREDICTED: cysteine proteinase RD19a-like          171   2e-48   Populus euphratica
gb|AAR92156.1|  putative cysteine protease 3                            169   2e-48   Iris x hollandica [Dutch iris]
ref|XP_003606998.1|  Cysteine proteinase                                170   3e-48   Medicago truncatula
ref|XP_011028940.1|  PREDICTED: cysteine proteinase 15A-like            171   3e-48   Populus euphratica
gb|KDO49483.1|  hypothetical protein CISIN_1g017318mg                   171   3e-48   Citrus sinensis [apfelsine]
ref|XP_006487337.1|  PREDICTED: cysteine proteinase RD19a-like          171   3e-48   Citrus sinensis [apfelsine]
gb|ABK96580.1|  unknown                                                 170   3e-48   Populus trichocarpa x Populus deltoides
ref|XP_002305451.2|  cysteine proteinase A494 precursor                 170   3e-48   Populus trichocarpa [western balsam poplar]
ref|XP_003539008.1|  PREDICTED: cysteine proteinase RD19a-like          170   3e-48   Glycine max [soybeans]
gb|ABK94801.1|  unknown                                                 170   4e-48   Populus trichocarpa [western balsam poplar]
ref|XP_002302004.2|  hypothetical protein POPTR_0002s03020g             170   4e-48   Populus trichocarpa [western balsam poplar]
ref|XP_006423403.1|  hypothetical protein CICLE_v10028670mg             170   5e-48   Citrus clementina
ref|XP_010066197.1|  PREDICTED: probable cysteine proteinase A494       170   6e-48   Eucalyptus grandis [rose gum]
ref|XP_011092831.1|  PREDICTED: cysteine proteinase RD19a-like          170   6e-48   Sesamum indicum [beniseed]
ref|XP_011088458.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    170   7e-48   Sesamum indicum [beniseed]
ref|XP_009376976.1|  PREDICTED: cysteine proteinase RD19a-like          171   1e-47   Pyrus x bretschneideri [bai li]
ref|XP_004507484.1|  PREDICTED: cysteine proteinase RD19a-like          169   1e-47   Cicer arietinum [garbanzo]
gb|ABK93575.1|  unknown                                                 162   1e-47   Populus trichocarpa [western balsam poplar]
ref|XP_007131787.1|  hypothetical protein PHAVU_011G041600g             168   2e-47   Phaseolus vulgaris [French bean]
ref|XP_009376977.1|  PREDICTED: cysteine proteinase RD19a-like          170   2e-47   Pyrus x bretschneideri [bai li]
gb|AAU81591.1|  cysteine proteinase                                     163   2e-47   Petunia x hybrida [garden petunia]
ref|XP_009406357.1|  PREDICTED: cysteine proteinase 1-like              168   2e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002510469.1|  cysteine protease, putative                        167   3e-47   Ricinus communis
gb|AJP16692.1|  cysteine protease                                       161   3e-47   Striga hermonthica [purple witchweed]
ref|XP_004148554.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    168   4e-47   
emb|CDQ51995.1|  Cysteine proteinase                                    161   4e-47   Fagus sylvatica
gb|KGN43159.1|  Papain-like cysteine proteinase isoform I               167   5e-47   Cucumis sativus [cucumbers]
ref|XP_004165230.1|  PREDICTED: cysteine proteinase RD19a-like          167   5e-47   
ref|XP_010268619.1|  PREDICTED: cysteine proteinase RD19a-like          167   5e-47   Nelumbo nucifera [Indian lotus]
ref|XP_010061009.1|  PREDICTED: cysteine proteinase RD19a-like          166   9e-47   Eucalyptus grandis [rose gum]
ref|XP_003540987.1|  PREDICTED: cysteine proteinase RD19a-like          166   1e-46   Glycine max [soybeans]
ref|XP_003523684.1|  PREDICTED: cysteine proteinase 15A-like            166   1e-46   Glycine max [soybeans]
ref|XP_004150061.1|  PREDICTED: cysteine proteinase RD19a-like          166   1e-46   Cucumis sativus [cucumbers]
gb|ABF46642.1|  papain-like cysteine proteinase                         166   1e-46   Pachysandra terminalis
gb|KHN45894.1|  Cysteine proteinase RD19a                               166   2e-46   Glycine soja [wild soybean]
ref|NP_001241450.1|  uncharacterized protein LOC100778716 precursor     166   2e-46   Glycine max [soybeans]
dbj|BAJ53178.1|  JHL18I08.12                                            166   2e-46   Jatropha curcas
ref|XP_010910124.1|  PREDICTED: cysteine proteinase 1-like              166   2e-46   Elaeis guineensis
ref|XP_008775532.1|  PREDICTED: cysteine proteinase 1-like              165   3e-46   Phoenix dactylifera
gb|AAB62937.1|  stress-induced cysteine proteinase                      159   4e-46   Lavatera thuringiaca
ref|XP_009602233.1|  PREDICTED: cysteine proteinase RD19a-like          165   4e-46   Nicotiana tomentosiformis
ref|XP_011045161.1|  PREDICTED: cysteine proteinase 15A-like            164   4e-46   Populus euphratica
gb|AAL05851.1|AF411121_1  cysteine proteinase precursor                 164   5e-46   Sandersonia aurantiaca [Chinese-lantern lily]
gb|KHN12668.1|  Cysteine proteinase 15A                                 158   6e-46   Glycine soja [wild soybean]
ref|XP_010531457.1|  PREDICTED: probable cysteine proteinase A494       164   6e-46   Tarenaya hassleriana [spider flower]
gb|AAU81589.1|  cysteine proteinase                                     161   6e-46   Petunia x hybrida [garden petunia]
ref|XP_002306900.1|  hypothetical protein POPTR_0005s25540g             164   6e-46   Populus trichocarpa [western balsam poplar]
gb|EYU42593.1|  hypothetical protein MIMGU_mgv1a008336mg                164   6e-46   Erythranthe guttata [common monkey flower]
ref|XP_008448073.1|  PREDICTED: cysteine proteinase RD19a-like          164   7e-46   Cucumis melo [Oriental melon]
ref|XP_002275759.1|  PREDICTED: cysteine proteinase RD19a               164   7e-46   Vitis vinifera
ref|XP_008460996.1|  PREDICTED: cysteine proteinase RD19a-like          164   7e-46   Cucumis melo [Oriental melon]
gb|KHN25410.1|  Cysteine proteinase RD19a                               164   7e-46   Glycine soja [wild soybean]
ref|XP_002280798.2|  PREDICTED: cysteine proteinase 15A                 164   7e-46   Vitis vinifera
ref|XP_009392632.1|  PREDICTED: cysteine proteinase 1-like              164   8e-46   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN22211.1|  Cysteine proteinase 15A                                 164   8e-46   Glycine soja [wild soybean]
gb|EYU37835.1|  hypothetical protein MIMGU_mgv1a008237mg                164   1e-45   Erythranthe guttata [common monkey flower]
ref|XP_004291404.1|  PREDICTED: cysteine proteinase 15A-like            163   1e-45   Fragaria vesca subsp. vesca
ref|XP_010105270.1|  Cysteine proteinase 15A                            164   1e-45   Morus notabilis
ref|XP_006362019.1|  PREDICTED: cysteine proteinase RD19a-like          164   1e-45   Solanum tuberosum [potatoes]
ref|XP_004230928.1|  PREDICTED: cysteine proteinase RD19a               163   1e-45   Solanum lycopersicum
gb|AGV54334.1|  cysteine proteinase RD19a-like protein                  163   1e-45   Phaseolus vulgaris [French bean]
ref|XP_009109502.1|  PREDICTED: cysteine proteinase RD19a-like          163   1e-45   Brassica rapa
ref|XP_007136047.1|  hypothetical protein PHAVU_009G013600g             163   2e-45   Phaseolus vulgaris [French bean]
ref|XP_010530325.1|  PREDICTED: cysteine proteinase RD19a               163   2e-45   Tarenaya hassleriana [spider flower]
gb|AIB06025.1|  CP3                                                     163   2e-45   Hevea brasiliensis [jebe]
dbj|BAC41322.1|  hypothetical protein                                   162   2e-45   Lotus japonicus
gb|KJB07487.1|  hypothetical protein B456_001G026600                    163   2e-45   Gossypium raimondii
ref|XP_007017672.1|  Papain family cysteine protease                    164   2e-45   Theobroma cacao [chocolate]
ref|XP_006828787.1|  hypothetical protein AMTR_s00001p00114210          162   2e-45   Amborella trichopoda
emb|CAE45588.1|  papain-like cysteine proteinase-like protein 1         162   3e-45   Lotus japonicus
dbj|BAF98584.1|  CM0216.500.nc                                          162   4e-45   Lotus japonicus
dbj|BAD94010.1|  drought-inducible cysteine proteinase RD19A prec...    154   4e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008387995.1|  PREDICTED: cysteine proteinase 15A                 162   4e-45   Malus domestica [apple tree]
ref|XP_006411706.1|  hypothetical protein EUTSA_v10025494mg             162   4e-45   Eutrema salsugineum
gb|AAL60581.1|AF454959_1  senescence-associated cysteine protease       162   6e-45   Brassica oleracea
emb|CAE45589.1|  papain-like cysteine proteinase-like protein 2         161   6e-45   Lotus japonicus
dbj|BAF46302.1|  cysteine proteinase precursor                          162   6e-45   Ipomoea nil [qian niu]
emb|CDY71205.1|  BnaCnng71840D                                          162   6e-45   Brassica napus [oilseed rape]
gb|AAM65162.1|  cysteine proteinase RD19A                               162   6e-45   Arabidopsis thaliana [mouse-ear cress]
gb|KFK30492.1|  hypothetical protein AALP_AA7G268600                    161   7e-45   Arabis alpina [alpine rockcress]
dbj|BAF98585.1|  CM0216.510.nc                                          161   7e-45   Lotus japonicus
ref|NP_568052.1|  cysteine proteinase RD19a                             161   7e-45   Arabidopsis thaliana [mouse-ear cress]
gb|ACX54787.2|  cysteine protease                                       160   1e-44   Arachis diogoi
ref|XP_006283963.1|  hypothetical protein CARUB_v10005086mg             161   1e-44   Capsella rubella
ref|XP_006473584.1|  PREDICTED: cysteine proteinase 15A-like            160   2e-44   Citrus sinensis [apfelsine]
ref|XP_006665032.1|  PREDICTED: cysteine proteinase 1-like              155   2e-44   
emb|CDY41960.1|  BnaA01g05320D                                          160   2e-44   Brassica napus [oilseed rape]
ref|XP_003550405.2|  PREDICTED: cysteine proteinase 15A                 160   3e-44   
ref|XP_007160702.1|  hypothetical protein PHAVU_001G009900g             160   3e-44   Phaseolus vulgaris [French bean]
gb|KDO84720.1|  hypothetical protein CISIN_1g017548mg                   160   3e-44   Citrus sinensis [apfelsine]
ref|XP_009146338.1|  PREDICTED: cysteine proteinase 15A-like            160   3e-44   Brassica rapa
ref|XP_008775280.1|  PREDICTED: cysteine proteinase 1-like              160   3e-44   Phoenix dactylifera
emb|CDY34441.1|  BnaC01g21920D                                          160   3e-44   Brassica napus [oilseed rape]
ref|XP_003545051.1|  PREDICTED: cysteine proteinase 15A-like            160   3e-44   Glycine max [soybeans]
ref|XP_002868883.1|  hypothetical protein ARALYDRAFT_490677             160   3e-44   Arabidopsis lyrata subsp. lyrata
ref|XP_010431862.1|  PREDICTED: cysteine proteinase RD19a               159   4e-44   Camelina sativa [gold-of-pleasure]
ref|XP_006435090.1|  hypothetical protein CICLE_v10001559mg             160   4e-44   Citrus clementina
ref|XP_010446443.1|  PREDICTED: cysteine proteinase RD19a               159   4e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010437007.1|  PREDICTED: cysteine proteinase RD19a-like          159   4e-44   Camelina sativa [gold-of-pleasure]
dbj|BAF03553.1|  cysteine proteinase CP2                                159   4e-44   Phaseolus vulgaris [French bean]
gb|ACM80348.1|  cysteine proteinase                                     159   4e-44   Solanum lycopersicum
emb|CAA52403.1|  putative thiol protease                                158   4e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009150026.1|  PREDICTED: cysteine proteinase RD19a               159   6e-44   Brassica rapa
ref|XP_006653265.1|  PREDICTED: cysteine proteinase 1-like              159   6e-44   
dbj|BAD43619.1|  putative cysteine proteinase                           159   6e-44   Arabidopsis thaliana [mouse-ear cress]
emb|CAB53397.1|  cysteine protease                                      155   6e-44   Medicago sativa [alfalfa]
ref|NP_565512.1|  Papain family cysteine protease                       159   7e-44   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA92495.1|  cysteine protease                                      159   8e-44   Vigna mungo [urad dal]
ref|XP_010943608.1|  PREDICTED: cysteine proteinase 1-like              159   9e-44   Elaeis guineensis
ref|XP_009335626.1|  PREDICTED: cysteine proteinase 15A                 159   9e-44   Pyrus x bretschneideri [bai li]
gb|ACK57563.1|  cysteine protease-like protein                          158   1e-43   Arachis hypogaea [goober]
ref|XP_008221329.1|  PREDICTED: cysteine proteinase 15A-like            158   1e-43   Prunus mume [ume]
gb|KJB29611.1|  hypothetical protein B456_005G110200                    158   1e-43   Gossypium raimondii
ref|XP_002880378.1|  hypothetical protein ARALYDRAFT_481008             157   2e-43   Arabidopsis lyrata subsp. lyrata
ref|XP_010440192.1|  PREDICTED: cysteine proteinase RD19a-like          157   2e-43   Camelina sativa [gold-of-pleasure]
ref|XP_011083631.1|  PREDICTED: cysteine proteinase 15A-like            157   2e-43   Sesamum indicum [beniseed]
ref|XP_007223351.1|  hypothetical protein PRUPE_ppa007441mg             157   2e-43   Prunus persica
gb|AAQ81938.1|  cysteine proteinase precursor                           157   3e-43   Ipomoea batatas [batate]
ref|XP_010449835.1|  PREDICTED: cysteine proteinase 15A-like            157   3e-43   Camelina sativa [gold-of-pleasure]
emb|CAA57675.1|  cysteine proteinase                                    151   3e-43   Zea mays [maize]
ref|XP_002280808.2|  PREDICTED: cysteine proteinase 15A                 157   3e-43   Vitis vinifera
gb|EMT16425.1|  Cysteine proteinase 1                                   157   3e-43   Aegilops tauschii
gb|KHG15062.1|  Cysteinease RD19a -like protein                         157   3e-43   Gossypium arboreum [tree cotton]
ref|XP_010434865.1|  PREDICTED: cysteine proteinase 15A-like            157   3e-43   Camelina sativa [gold-of-pleasure]
emb|CAB17075.1|  cysteine proteinase precursor                          157   4e-43   Phaseolus vulgaris [French bean]
ref|XP_003579573.2|  PREDICTED: cysteine proteinase 1-like              157   5e-43   Brachypodium distachyon [annual false brome]
ref|XP_002452058.1|  hypothetical protein SORBIDRAFT_04g017830          156   6e-43   Sorghum bicolor [broomcorn]
gb|KJB58164.1|  hypothetical protein B456_009G197400                    157   6e-43   Gossypium raimondii
gb|EAY93546.1|  hypothetical protein OsI_15336                          156   6e-43   Oryza sativa Indica Group [Indian rice]
emb|CDY09707.1|  BnaC07g33540D                                          156   6e-43   Brassica napus [oilseed rape]
emb|CAD40319.2|  OSJNBb0054B09.3                                        157   6e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003589348.1|  Cysteine proteinase                                156   7e-43   Medicago truncatula
gb|EEE60725.1|  hypothetical protein OsJ_14236                          156   7e-43   Oryza sativa Japonica Group [Japonica rice]
gb|AEX97108.1|  cysteine proteinase                                     149   8e-43   Malus domestica [apple tree]
emb|CDP07452.1|  unnamed protein product                                156   9e-43   Coffea canephora [robusta coffee]
emb|CDX99593.1|  BnaC04g33500D                                          155   9e-43   Brassica napus [oilseed rape]
gb|EMS53996.1|  Cysteine proteinase 1                                   157   1e-42   Triticum urartu
ref|XP_006404590.1|  hypothetical protein EUTSA_v10000210mg             155   1e-42   Eutrema salsugineum
gb|AAD29084.1|AF082181_1  cysteine proteinase precursor                 155   1e-42   Solanum melongena [aubergine]
ref|XP_004952477.1|  PREDICTED: cysteine proteinase 1-like              155   1e-42   Setaria italica
ref|NP_001052440.1|  Os04g0311400                                       156   1e-42   
emb|CDY15894.1|  BnaA04g12170D                                          155   1e-42   Brassica napus [oilseed rape]
ref|XP_009140277.1|  PREDICTED: probable cysteine proteinase A494       155   1e-42   Brassica rapa
gb|AAB16996.1|  thiol protease isoform B                                154   2e-42   Glycine max [soybeans]
ref|XP_008444769.1|  PREDICTED: cysteine proteinase RD19a-like          155   2e-42   Cucumis melo [Oriental melon]
ref|XP_010672379.1|  PREDICTED: cysteine proteinase RD19a-like          155   2e-42   Beta vulgaris subsp. vulgaris [field beet]
sp|P25804.1|CYSP_PEA  RecName: Full=Cysteine proteinase 15A; AltN...    155   2e-42   Pisum sativum [garden pea]
ref|XP_006283974.1|  hypothetical protein CARUB_v10005098mg             155   2e-42   Capsella rubella
ref|XP_004975256.1|  PREDICTED: cysteine proteinase 1-like              155   3e-42   Setaria italica
gb|AAO11786.1|  pre-pro cysteine proteinase                             154   3e-42   Vicia faba [broad bean]
gb|AAB67878.1|  pre-pro-cysteine proteinase                             154   3e-42   Vicia faba [broad bean]
ref|XP_009405542.1|  PREDICTED: cysteine proteinase 1-like              154   3e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009136751.1|  PREDICTED: cysteine proteinase RD19a-like          154   3e-42   Brassica rapa
ref|XP_006414378.1|  hypothetical protein EUTSA_v10025521mg             154   3e-42   Eutrema salsugineum
emb|CDX90537.1|  BnaA03g42440D                                          154   4e-42   Brassica napus [oilseed rape]
gb|ACF86683.1|  unknown                                                 154   4e-42   Zea mays [maize]
gb|AGS43121.1|  cysteine protease 1                                     146   5e-42   Zea mays [maize]
ref|NP_001105685.1|  cysteine proteinase 1 precursor                    154   5e-42   Zea mays [maize]
ref|XP_009611293.1|  PREDICTED: cysteine proteinase 15A-like            154   5e-42   Nicotiana tomentosiformis
gb|AAK07731.1|  CPR2-like cysteine proteinase                           154   5e-42   Nicotiana tabacum [American tobacco]
emb|CAA78365.1|  tobacco pre-pro-cysteine proteinase                    154   6e-42   Nicotiana tabacum [American tobacco]
ref|XP_003574963.1|  PREDICTED: cysteine proteinase 1-like              154   6e-42   Brachypodium distachyon [annual false brome]
emb|CAA78361.1|  tobacco pre-pro-cysteine proteinase                    154   6e-42   Nicotiana tabacum [American tobacco]
gb|AJA74415.1|  cysteine protease                                       154   6e-42   Cicer arietinum [garbanzo]
ref|NP_001266121.1|  uncharacterized protein LOC101501911 precursor     154   7e-42   Cicer arietinum [garbanzo]
emb|CAH59428.1|  cysteine protease 2                                    150   7e-42   Plantago major [cart-track plant]
ref|XP_009776238.1|  PREDICTED: cysteine proteinase 15A-like            154   7e-42   Nicotiana sylvestris
gb|ABK24153.1|  unknown                                                 154   8e-42   Picea sitchensis
gb|KFK24413.1|  hypothetical protein AALP_AAs58848U000200               153   9e-42   Arabis alpina [alpine rockcress]
emb|CAA82995.1|  cysteine proteinase                                    153   1e-41   Vicia sativa [spring vetch]
ref|XP_002870174.1|  hypothetical protein ARALYDRAFT_915142             153   1e-41   Arabidopsis lyrata subsp. lyrata
ref|NP_567489.1|  papain family cysteine protease                       153   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003607110.1|  Cysteine proteinase                                152   2e-41   Medicago truncatula
ref|NP_001046828.1|  Os02g0469600                                       152   2e-41   
gb|KEH30505.1|  papain family cysteine protease                         152   2e-41   Medicago truncatula
ref|XP_004152668.1|  PREDICTED: cysteine proteinase RD19a-like          152   3e-41   Cucumis sativus [cucumbers]
gb|EMS64962.1|  Cysteine proteinase 1                                   150   3e-41   Triticum urartu
gb|ABK21238.1|  unknown                                                 152   3e-41   Picea sitchensis
gb|ABK24688.1|  unknown                                                 152   3e-41   Picea sitchensis
gb|ACN40679.1|  unknown                                                 152   3e-41   Picea sitchensis
tpe|CAD66657.1|  TPA: putative cysteine proteinase precursor            152   4e-41   Hordeum vulgare subsp. vulgare [barley]
gb|EYU27644.1|  hypothetical protein MIMGU_mgv1a008452mg                152   4e-41   Erythranthe guttata [common monkey flower]
ref|XP_004238314.1|  PREDICTED: cysteine proteinase 15A                 151   6e-41   
gb|EMT10192.1|  Cysteine proteinase 1                                   151   6e-41   Aegilops tauschii
gb|AAW21813.1|  cysteine protease                                       150   1e-40   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006341997.1|  PREDICTED: cysteine proteinase 15A-like            150   1e-40   Solanum tuberosum [potatoes]
gb|AES89347.2|  papain family cysteine protease                         149   1e-40   Medicago truncatula
ref|XP_003607150.1|  Cysteine proteinase                                149   1e-40   
gb|ADY04293.1|  cysteine protease                                       144   2e-40   Clarkia xantiana subsp. xantiana
gb|AAB16997.1|  thiol protease isoform A                                149   2e-40   Glycine max [soybeans]
gb|ADY04361.1|  cysteine protease                                       143   3e-40   Clarkia xantiana subsp. xantiana
ref|XP_009786000.1|  PREDICTED: cysteine proteinase RD19a-like          149   3e-40   Nicotiana sylvestris
emb|CAQ00101.1|  papain-like cysteine proteinase                        149   3e-40   Hordeum vulgare subsp. vulgare [barley]
emb|CAA78403.1|  pre-pro-cysteine proteinase                            149   3e-40   Solanum lycopersicum
gb|ADY04342.1|  cysteine protease                                       143   3e-40   Clarkia xantiana subsp. xantiana
gb|ADY04336.1|  cysteine protease                                       143   3e-40   Clarkia xantiana subsp. xantiana
gb|ADY04262.1|  cysteine protease                                       143   3e-40   Clarkia xantiana subsp. xantiana
gb|ADY04414.1|  cysteine protease                                       143   3e-40   Clarkia xantiana subsp. xantiana
gb|ADY04457.1|  cysteine protease                                       143   3e-40   Clarkia xantiana subsp. xantiana
dbj|BAG16515.1|  putative cysteine proteinase                           149   4e-40   Capsicum chinense [bonnet pepper]
gb|ADY04359.1|  cysteine protease                                       143   4e-40   Clarkia xantiana subsp. xantiana
gb|AAZ32411.1|  cysteine proteinase glycinain type                      149   5e-40   Nicotiana benthamiana
gb|ADY04482.1|  cysteine protease                                       143   5e-40   Clarkia xantiana subsp. xantiana
gb|ADY04358.1|  cysteine protease                                       142   6e-40   Clarkia xantiana subsp. xantiana
ref|XP_002279862.1|  PREDICTED: cysteine proteinase RD19a               148   6e-40   Vitis vinifera
gb|ADY04368.1|  cysteine protease                                       142   7e-40   Clarkia xantiana subsp. xantiana
gb|ADY04480.1|  cysteine protease                                       142   9e-40   Clarkia xantiana subsp. xantiana
gb|ADY04268.1|  cysteine protease                                       142   1e-39   Clarkia xantiana subsp. xantiana
dbj|BAD10859.1|  cysteine protease                                      147   1e-39   Tripolium pannonicum [sea starwort]
gb|ADY04295.1|  cysteine protease                                       141   2e-39   Clarkia xantiana subsp. xantiana
dbj|BAC57957.1|  thiol protease                                         142   3e-39   Tripolium pannonicum [sea starwort]
gb|EPS70818.1|  cysteine proteinase                                     146   3e-39   Genlisea aurea
gb|AAB53103.1|  cysteine protease                                       138   6e-39   Brassica napus [oilseed rape]
gb|EPS65881.1|  cysteine proteinase                                     144   1e-38   Genlisea aurea
ref|XP_002960585.1|  hypothetical protein SELMODRAFT_266583             142   7e-38   Selaginella moellendorffii
ref|XP_002969223.1|  hypothetical protein SELMODRAFT_91274              142   1e-37   Selaginella moellendorffii
emb|CCA95098.1|  putative responsive to dehydration 19                  132   8e-36   Liriodendron tulipifera
gb|ADY04490.1|  cysteine protease                                       131   1e-35   Clarkia xantiana subsp. xantiana
gb|EMS59778.1|  Cysteine proteinase 15A                                 132   2e-35   Triticum urartu
ref|XP_010504326.1|  PREDICTED: cysteine proteinase 15A-like            136   3e-35   Camelina sativa [gold-of-pleasure]
ref|XP_006293095.1|  hypothetical protein CARUB_v10019394mg             136   3e-35   Capsella rubella
ref|XP_008776953.1|  PREDICTED: cysteine proteinase-like                130   3e-35   Phoenix dactylifera
emb|CAB41090.1|  cysteine proteinase precursor-like protein             135   4e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KEH43476.1|  papain family cysteine protease                         136   4e-35   Medicago truncatula
ref|XP_002876278.1|  hypothetical protein ARALYDRAFT_485911             135   5e-35   Arabidopsis lyrata subsp. lyrata
ref|NP_567010.5|  Papain family cysteine protease                       135   5e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KHN00877.1|  Cysteine proteinase 15A                                 134   8e-35   Glycine soja [wild soybean]
gb|KFK34737.1|  hypothetical protein AALP_AA5G186400                    135   9e-35   Arabis alpina [alpine rockcress]
ref|XP_008804021.1|  PREDICTED: cysteine proteinase RD19a-like          131   1e-34   Phoenix dactylifera
ref|XP_002460693.1|  hypothetical protein SORBIDRAFT_02g033270          134   1e-34   Sorghum bicolor [broomcorn]
ref|XP_004496226.1|  PREDICTED: cysteine proteinase 15A-like            134   2e-34   Cicer arietinum [garbanzo]
ref|NP_001059639.1|  Os07g0480900                                       133   4e-34   
ref|XP_008354070.1|  PREDICTED: cysteine proteinase 15A-like            131   5e-34   Malus domestica [apple tree]
ref|XP_009404192.1|  PREDICTED: cysteine proteinase 15A                 132   5e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001781954.1|  predicted protein                                  132   7e-34   Physcomitrella patens
emb|CAB16316.1|  cysteine proteinase precursor                          132   7e-34   Vicia sativa [spring vetch]
ref|XP_004959670.1|  PREDICTED: cysteine proteinase 1-like              132   7e-34   Setaria italica
gb|KHN37802.1|  Cysteine proteinase 1                                   132   8e-34   Glycine soja [wild soybean]
ref|XP_008362714.1|  PREDICTED: cysteine proteinase 15A                 132   1e-33   Malus domestica [apple tree]
ref|NP_001236888.1|  cysteine proteinase precursor                      132   1e-33   Glycine max [soybeans]
gb|AAD46920.1|AF167986_1  putative cysteine proteinase GmPM33           131   1e-33   Glycine max [soybeans]
emb|CDX98179.1|  BnaC07g09190D                                          124   2e-33   Brassica napus [oilseed rape]
tpg|DAA40800.1|  TPA: putative cysteine protease family protein         131   2e-33   Zea mays [maize]
emb|CDY56961.1|  BnaA09g55030D                                          131   2e-33   
ref|XP_009116190.1|  PREDICTED: probable cysteine proteinase A494       131   2e-33   
emb|CAQ00102.1|  papain-like cysteine proteinase                        131   2e-33   
emb|CDX73424.1|  BnaC08g25790D                                          131   2e-33   
ref|XP_003560213.1|  PREDICTED: cysteine proteinase 1                   131   2e-33   
ref|XP_008802783.1|  PREDICTED: probable cysteine proteinase A494       131   2e-33   
ref|XP_010534431.1|  PREDICTED: cysteine proteinase 15A                 131   2e-33   
ref|XP_001761980.1|  predicted protein                                  131   3e-33   
ref|XP_010690815.1|  PREDICTED: cysteine proteinase RD19a               131   4e-33   
gb|ABO93617.1|  papain-like cysteine proteinase                         125   5e-33   
gb|EYU39642.1|  hypothetical protein MIMGU_mgv1a008552mg                129   9e-33   
ref|XP_010243268.1|  PREDICTED: cysteine proteinase 15A                 129   9e-33   
ref|XP_007143764.1|  hypothetical protein PHAVU_007G099600g             130   9e-33   
ref|XP_007218137.1|  hypothetical protein PRUPE_ppa007240mg             129   1e-32   
ref|XP_008233261.1|  PREDICTED: cysteine proteinase 15A                 129   1e-32   
emb|CCA95082.1|  putative responsive to dehydration 19                  123   2e-32   
ref|XP_006403513.1|  hypothetical protein EUTSA_v10010475mg             129   2e-32   
ref|XP_009789260.1|  PREDICTED: cysteine proteinase 15A                 129   2e-32   
gb|EEC82027.1|  hypothetical protein OsI_25996                          131   2e-32   
ref|XP_009617441.1|  PREDICTED: cysteine proteinase 15A                 128   3e-32   
gb|AEQ54770.1|  cysteine proteinase CP1                                 128   3e-32   
gb|KJB73490.1|  hypothetical protein B456_011G235500                    128   4e-32   
gb|KHG08355.1|  Cysteinease 1                                           127   4e-32   
ref|XP_004250044.1|  PREDICTED: cysteine proteinase 15A                 128   4e-32   
emb|CBI31400.3|  unnamed protein product                                125   7e-32   
ref|XP_010918606.1|  PREDICTED: probable cysteine proteinase A494       127   8e-32   
ref|XP_011094506.1|  PREDICTED: cysteine proteinase 15A                 127   9e-32   
emb|CAB17077.1|  cysteine proteinase precursor                          126   1e-31   
ref|XP_009117680.1|  PREDICTED: probable cysteine proteinase A494       126   1e-31   
emb|CDO99795.1|  unnamed protein product                                126   1e-31   
emb|CDY13816.1|  BnaA09g43180D                                          124   2e-31   
ref|XP_011024366.1|  PREDICTED: cysteine proteinase 15A                 125   3e-31   
ref|XP_006850211.1|  hypothetical protein AMTR_s00022p00251800          125   3e-31   
gb|ADE76932.1|  unknown                                                 125   4e-31   
ref|XP_006361690.1|  PREDICTED: cysteine proteinase 15A-like            125   4e-31   
ref|XP_010034320.1|  PREDICTED: cysteine proteinase 1                   125   4e-31   
ref|XP_008446834.1|  PREDICTED: cysteine proteinase 15A                 124   6e-31   
gb|KDP30486.1|  hypothetical protein JCGZ_16165                         124   7e-31   
ref|XP_010688493.1|  PREDICTED: cysteine proteinase 15A                 124   7e-31   
ref|XP_006436511.1|  hypothetical protein CICLE_v10031865mg             124   1e-30   
ref|XP_004142497.1|  PREDICTED: cysteine proteinase 15A-like            124   1e-30   
ref|XP_004157559.1|  PREDICTED: cysteine proteinase 15A-like            124   1e-30   
ref|XP_002316398.1|  hypothetical protein POPTR_0010s23510g             123   1e-30   
emb|CAN64491.1|  hypothetical protein VITISV_015725                     123   1e-30   
ref|XP_002266821.1|  PREDICTED: cysteine proteinase 15A                 122   3e-30   
ref|XP_002533377.1|  cysteine protease, putative                        122   4e-30   
ref|XP_010103534.1|  putative cysteine proteinase A494                  122   4e-30   
ref|XP_007010012.1|  Papain family cysteine protease                    121   9e-30   
ref|XP_008647122.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin 7-...    117   6e-29   
ref|XP_007510080.1|  unknown                                            119   1e-28   
ref|XP_011469621.1|  PREDICTED: cysteine proteinase 15A-like            114   2e-28   
ref|XP_003081549.1|  Cysteine proteinase Cathepsin F (ISS)              116   3e-28   
emb|CEF99324.1|  Cysteine peptidase, cysteine active site               117   4e-28   
gb|AFW72358.1|  putative cysteine protease family protein               118   6e-28   
ref|XP_001419933.1|  predicted protein                                  113   2e-27   
gb|EPS63354.1|  hypothetical protein M569_11429                         114   3e-27   
ref|XP_011169692.1|  PREDICTED: putative cysteine proteinase CG12163    107   8e-24   
emb|CAN71324.1|  hypothetical protein VITISV_013970                     105   9e-24   
ref|XP_003057227.1|  predicted protein                                  104   9e-24   
ref|XP_006658557.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    104   1e-23   
ref|XP_006608091.1|  PREDICTED: uncharacterized protein LOC102680728    106   2e-23   
gb|EFN80374.1|  Putative cysteine proteinase CG12163                    106   2e-23   
ref|XP_011145705.1|  PREDICTED: uncharacterized protein LOC105186896    106   2e-23   
ref|XP_003696602.1|  PREDICTED: putative cysteine proteinase CG12...    106   3e-23   
emb|CAN80141.1|  hypothetical protein VITISV_038978                     102   5e-23   
ref|XP_011203808.1|  PREDICTED: putative cysteine proteinase CG12163    105   6e-23   
ref|XP_004519757.1|  PREDICTED: putative cysteine proteinase CG12...    105   6e-23   
ref|XP_011184040.1|  PREDICTED: putative cysteine proteinase CG12163    105   6e-23   
ref|XP_003492760.1|  PREDICTED: hypothetical protein LOC100745708       104   1e-22   
ref|XP_392381.3|  PREDICTED: putative cysteine proteinase CG12163...    104   1e-22   
ref|XP_006567715.1|  PREDICTED: putative cysteine proteinase CG12...    104   1e-22   
ref|XP_004519758.1|  PREDICTED: putative cysteine proteinase CG12...    102   2e-22   
emb|CAN81617.1|  hypothetical protein VITISV_001998                     100   2e-22   
ref|XP_011496222.1|  PREDICTED: uncharacterized protein LOC105360904    103   3e-22   
emb|CAN81619.1|  hypothetical protein VITISV_002000                   99.8    4e-22   
gb|EFN65613.1|  Putative cysteine proteinase CG12163                    102   4e-22   
ref|XP_005184487.1|  PREDICTED: putative cysteine proteinase CG12...    102   4e-22   
ref|XP_002505924.1|  cysteine endopeptidase                           99.4    4e-22   
ref|XP_001607324.1|  PREDICTED: uncharacterized protein LOC100123649    102   4e-22   
ref|XP_005184486.1|  PREDICTED: putative cysteine proteinase CG12...    102   5e-22   
dbj|BAI44279.1|  cysteine proteinase inhibitor precursor                103   6e-22   
gb|EGI66903.1|  Putative cysteine proteinase                            102   6e-22   
emb|CBI23088.3|  unnamed protein product                              96.7    6e-22   
ref|XP_011260522.1|  PREDICTED: uncharacterized protein LOC105253881    102   6e-22   
ref|XP_011052455.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    102   7e-22   
ref|XP_011493714.1|  AAEL017153-PA                                      102   7e-22   
gb|KFB38327.1|  AGAP002879-PB-like protein                              102   7e-22   
ref|XP_008550537.1|  PREDICTED: uncharacterized protein LOC103573287    102   8e-22   
ref|XP_001844355.1|  conserved hypothetical protein                     102   1e-21   
ref|XP_003707276.1|  PREDICTED: uncharacterized protein LOC100880620    101   1e-21   
ref|XP_001994049.1|  GH22731                                            100   2e-21   
ref|XP_002000409.1|  GI10216                                            100   2e-21   
ref|XP_002017233.1|  GL22196                                            100   2e-21   
ref|XP_002056575.1|  GJ11017                                          99.8    2e-21   
gb|AJF94882.1|  C1 family cathepsin F10                                 100   3e-21   
ref|XP_002096026.1|  GE25302                                          99.8    3e-21   
ref|XP_002137768.1|  GA27408, isoform A                               99.8    3e-21   
ref|XP_002988513.1|  hypothetical protein SELMODRAFT_128220           94.0    3e-21   
ref|NP_730901.1|  CG12163, isoform A                                  99.8    3e-21   
ref|XP_002038380.1|  GM10654                                          99.4    4e-21   
ref|XP_001978897.1|  GG11133                                          99.4    4e-21   
ref|XP_003736743.1|  GA27408, isoform B                               98.2    4e-21   
ref|XP_001955780.1|  GF16067                                          99.4    4e-21   
gb|ETN61472.1|  hypothetical protein AND_006867                         100   4e-21   
gb|ACR08662.1|  cathepsin F                                           94.7    5e-21   
gb|EZA58965.1|  Putative cysteine proteinase                          99.8    5e-21   
gb|AFQ01139.1|  cathepsin F-like protease                             98.6    6e-21   
ref|NP_649521.1|  CG12163, isoform B                                  97.8    6e-21   
ref|XP_011331416.1|  PREDICTED: uncharacterized protein LOC105275911  99.8    8e-21   
ref|XP_312034.5|  AGAP002879-PA                                       99.4    9e-21   
ref|XP_003436277.1|  AGAP002879-PB                                    99.4    9e-21   
ref|XP_008195657.1|  PREDICTED: uncharacterized protein LOC662417...  99.4    1e-20   
ref|XP_008195656.1|  PREDICTED: uncharacterized protein LOC662417...  99.4    1e-20   
gb|EHJ64782.1|  cysteine proteinase inhibitor precursor               92.8    1e-20   
gb|ABE72973.1|  cathepsin L                                           95.1    1e-20   
ref|XP_002073772.1|  GK14287                                          97.8    1e-20   
ref|XP_002979143.1|  hypothetical protein SELMODRAFT_110288           94.0    2e-20   
ref|XP_003436276.1|  AGAP002879-PC                                    97.1    5e-20   
emb|CBY11269.1|  unnamed protein product                              94.0    5e-20   
ref|XP_011309436.1|  PREDICTED: uncharacterized protein LOC105270293  96.7    7e-20   
emb|CDX82031.1|  BnaC08g35700D                                        92.8    8e-20   
ref|XP_005184488.1|  PREDICTED: putative cysteine proteinase CG12...  94.4    1e-19   
gb|KDR17524.1|  Putative cysteine proteinase                          95.5    2e-19   
emb|CAC94443.1|  cysteine proteinase                                  89.0    3e-19   
ref|XP_009029595.1|  hypothetical protein HELRODRAFT_157956           91.3    3e-19   
gb|ENN81374.1|  hypothetical protein YQE_02191                        94.7    4e-19   
gb|EKC42097.1|  Cathepsin F                                           93.6    5e-19   
ref|XP_011434326.1|  PREDICTED: uncharacterized protein LOC105333...  93.6    5e-19   
ref|XP_011434325.1|  PREDICTED: uncharacterized protein LOC105333...  93.6    5e-19   
gb|ABC48936.1|  cathepsin F like protease                             92.4    5e-19   
emb|CBY31096.1|  unnamed protein product                              91.3    6e-19   
gb|ERG79645.1|  cysteine proteinase                                   86.7    7e-19   
gb|KHN72698.1|  Putative cysteine proteinase                          87.0    9e-19   
ref|XP_009047014.1|  hypothetical protein LOTGIDRAFT_172186           89.4    1e-18   
gb|AII16490.1|  cathepsin F                                           89.0    2e-18   
gb|ELT97360.1|  hypothetical protein CAPTEDRAFT_147978                87.4    7e-18   
gb|KFM67613.1|  putative cysteine proteinase                          89.0    8e-18   
ref|XP_009161938.1|  hypothetical protein T265_00017                  86.3    8e-18   
emb|CAC94444.1|  cysteine proteinase                                  84.7    9e-18   
dbj|GAA47436.1|  cathepsin L                                          86.3    1e-17   
gb|AFM37363.1|  cathepsin F1                                          88.2    1e-17   
gb|EYC18288.1|  hypothetical protein Y032_0028g1777                   82.4    3e-17   
gb|AEW08440.1|  hypothetical protein 2_9845_02                        81.6    3e-17   
ref|XP_002427787.1|  Cathepsin F precursor, putative                  87.0    4e-17   
ref|NP_001156453.1|  cathepsin F isoform 1 precursor                  87.8    4e-17   
ref|XP_003115597.1|  CRE-TAG-196 protein                              87.4    4e-17   
gb|ERL92611.1|  hypothetical protein D910_09924                       87.0    5e-17   
ref|XP_002681317.1|  cysteine protease                                85.5    6e-17   
emb|CDJ26737.1|  cathepsin F-like cysteine peptidase protein          86.7    6e-17   
ref|NP_505215.2|  Protein TAG-196                                     86.7    7e-17   
ref|XP_002682087.1|  predicted protein                                84.7    9e-17   
dbj|BAN20819.1|  cysteine-type endopeptidase                          86.7    1e-16   
ref|XP_002635317.1|  C. briggsae CBR-TAG-196 protein                  85.9    1e-16   
gb|EGT34543.1|  hypothetical protein CAEBREN_26318                    85.5    2e-16   
gb|EFX71333.1|  hypothetical protein DAPPUDRAFT_189155                82.8    3e-16   
gb|AAF21461.1|U69120_1  cysteine proteinase PWCP1                     84.3    3e-16   
emb|CDJ88889.1|  Proteinase inhibitor I25 and Proteinase inhibito...  84.7    3e-16   
emb|CDJ92562.1|  Proteinase inhibitor I25 and Proteinase inhibito...  84.7    3e-16   
ref|XP_002610214.1|  hypothetical protein BRAFLDRAFT_216923           82.4    4e-16   
ref|NP_001156454.1|  cathepsin F isoform 2 precursor                  84.3    6e-16   
ref|XP_008472006.1|  PREDICTED: putative cysteine proteinase CG12163  80.5    7e-16   
gb|AAB01769.1|  cysteine proteinase homolog                           82.0    1e-15   
gb|AAR27011.1|  cysteine protease                                     80.9    1e-15   
ref|XP_009035714.1|  hypothetical protein AURANDRAFT_53321            81.3    2e-15   
ref|XP_003389037.1|  PREDICTED: cathepsin L1-like                     80.5    3e-15   
ref|XP_001029851.1|  Papain family cysteine protease containing p...  80.1    4e-15   
ref|XP_002119872.3|  PREDICTED: cathepsin L-like                      81.6    4e-15   
ref|XP_003148243.1|  hypothetical protein LOAG_12683                  79.0    4e-15   
gb|EGT34572.1|  hypothetical protein CAEBREN_13324                    81.6    4e-15   
gb|EFO15826.2|  hypothetical protein LOAG_12683                       79.0    5e-15   
gb|KIH48456.1|  cysteine proteinase family protein                    75.1    7e-15   
dbj|BAF94154.1|  cathepsin F-like cysteine protease                   81.6    7e-15   
ref|XP_635374.1|  cysteine protease                                   79.7    8e-15   
ref|XP_006268168.1|  PREDICTED: cathepsin F-like                      80.5    8e-15   
ref|XP_007438969.1|  PREDICTED: cathepsin F-like                      77.8    1e-14   
gb|AEE62591.1|  unknown                                               79.3    1e-14   
ref|XP_009034680.1|  hypothetical protein AURANDRAFT_22129            78.6    1e-14   
gb|ENN81994.1|  hypothetical protein YQE_01705                        79.0    1e-14   
ref|XP_004351999.1|  cysteine protease                                79.0    1e-14   
ref|XP_005305646.1|  PREDICTED: cathepsin W-like                      79.0    1e-14   
ref|XP_002734978.1|  PREDICTED: cathepsin F-like                      79.0    1e-14   
ref|XP_004034698.1|  papain family cysteine protease, putative        77.8    2e-14   
gb|KGB33519.1|  Cathepsin L                                           78.2    2e-14   
gb|ABC69430.1|  cysteine protease                                     78.2    2e-14   
gb|ABC69431.1|  cysteine protease                                     78.2    2e-14   
gb|ABY75169.1|  cysteine protease                                     73.9    2e-14   
gb|ABC69429.1|  cysteine protease                                     78.2    2e-14   
gb|ABK91811.1|  cathepsin F precursor                                 78.2    2e-14   
ref|XP_006121731.1|  PREDICTED: cathepsin W-like                      76.6    3e-14   
ref|XP_003284553.1|  hypothetical protein DICPUDRAFT_96752            77.8    3e-14   
gb|AAT09103.1|  digestive cysteine proteinase                         77.8    3e-14   
ref|XP_635417.1|  cysteine proteinase 1                               77.8    4e-14   
gb|AAF40479.1|  cystein protease                                      77.4    4e-14   
emb|CAA26255.1|  cysteine proteinase I precursor                      77.4    4e-14   
ref|XP_003375070.1|  viral cathepsin                                  78.6    4e-14   
ref|XP_001634814.1|  predicted protein                                76.6    5e-14   
gb|AAP33049.1|  cysteine proteinase 1                                 77.0    6e-14   
gb|ELV09527.1|  Cathepsin F                                           78.6    6e-14   
ref|XP_006036937.1|  PREDICTED: cathepsin F-like                      77.8    6e-14   
ref|XP_002672864.1|  predicted protein                                77.0    6e-14   
emb|CEF63690.1|  Cathepsin F                                          77.4    6e-14   
ref|XP_006980634.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      78.2    7e-14   
ref|XP_005351748.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      78.2    7e-14   
ref|XP_003386471.1|  PREDICTED: cysteine proteinase 1-like            77.0    8e-14   
dbj|GAM23991.1|  hypothetical protein SAMD00019534_071660             76.6    8e-14   
ref|XP_007056266.1|  PREDICTED: cathepsin F-like                      77.8    9e-14   
gb|EKC21001.1|  Cathepsin F                                           77.4    9e-14   
ref|XP_008577225.1|  PREDICTED: cathepsin F                           78.2    9e-14   
gb|AAM44058.1|AF510740_1  cathepsin L1                                76.3    9e-14   
gb|AAA87848.1|  cathepsin L                                           75.5    1e-13   
ref|XP_011449944.1|  PREDICTED: cathepsin L1-like                     77.0    1e-13   
ref|XP_010765827.1|  PREDICTED: cathepsin W                           77.8    1e-13   
gb|EGW06365.1|  Cathepsin F                                           77.4    1e-13   
sp|Q26534.1|CATL_SCHMA  RecName: Full=Cathepsin L; AltName: Full=...  75.9    1e-13   
ref|XP_007648967.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      77.4    1e-13   
ref|XP_005101893.1|  PREDICTED: cathepsin F-like isoform X1           77.8    1e-13   
ref|NP_001133678.1|  Cathepsin F precursor                            77.4    1e-13   
gb|EDM12431.1|  cathepsin F, isoform CRA_b                            73.2    1e-13   
gb|AAF21470.1|U85983_1  cysteine proteinase                           75.1    1e-13   
gb|ERE78742.1|  cathepsin F                                           77.4    1e-13   
ref|XP_002970484.1|  hypothetical protein SELMODRAFT_93661            76.3    1e-13   



>gb|AAK27969.1|AF242373_1 cysteine protease [Ipomoea batatas]
Length=366

 Score =   182 bits (462),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE 
Sbjct  277  NAVFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGEN  336

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTSD  270
            GYYKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  337  GYYKICRGRNVCGVDSMVSTVAAVSTTTSD  366



>gb|AAF40414.1|AF216783_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE 
Sbjct  279  NAVFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGEN  338

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTSD  270
            GYYKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  339  GYYKICRGRNVCGVDSMVSTVAAVSTTTSD  368



>gb|AAF61440.1|AF138264_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE 
Sbjct  279  NAVFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGEN  338

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTSD  270
            GYYKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  339  GYYKICRGRNVCGVDSMVSTVAAVSTTTSD  368



>gb|AAF40415.1|AF216784_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=368

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE 
Sbjct  279  NAVFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGEN  338

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTSD  270
            GYYKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  339  GYYKICRGRNVCGVDSMVSTVAAVSTTTSD  368



>gb|AAF40416.1|AF216785_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
 gb|AAF61442.1|AF138266_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
Length=366

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE 
Sbjct  277  NAVFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGEN  336

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTSD  270
            GYYKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  337  GYYKICRGRNVCGVDSMVSTVAAVSTTTSD  366



>gb|AAF61441.1|AF138265_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=366

 Score =   180 bits (456),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA F+QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE 
Sbjct  277  NAVFVQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGEN  336

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTSD  270
            GYYKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  337  GYYKICRGRNVCGVDSMVSTVAAVSTTTSD  366



>ref|XP_002512963.1| cysteine protease, putative [Ricinus communis]
 gb|EEF49466.1| cysteine protease, putative [Ricinus communis]
Length=373

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGE+WGE 
Sbjct  285  NAVFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGENWGES  344

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPT  264
            GYYKICRGRNICGVDSMVSTVAAV T +
Sbjct  345  GYYKICRGRNICGVDSMVSTVAAVQTAS  372



>sp|P05993.1|PAPA5_CARPA RecName: Full=Cysteine proteinase; AltName: Full=Clone PLBPC13, 
partial [Carica papaya]
 emb|CAA27609.1| pot. cysteine proteinase [Carica papaya]
Length=96

 Score =   167 bits (424),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/89 (88%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYICS+RL+HGVLLVGYGSAGYAPIRLKEKPYW+IKNSWGE+WGE 
Sbjct  8    NAAYMQTYIGGVSCPYICSRRLNHGVLLVGYGSAGYAPIRLKEKPYWVIKNSWGENWGEN  67

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            GYYKICRGRNICGVDSMVSTVAAV+T + 
Sbjct  68   GYYKICRGRNICGVDSMVSTVAAVHTTSQ  96



>gb|KDP41743.1| hypothetical protein JCGZ_26761 [Jatropha curcas]
Length=370

 Score =   175 bits (444),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGE+WGE 
Sbjct  282  NAVYMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGETWGES  341

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPT  264
            GYYKICRGRN+CGVDSMVSTVAAV T +
Sbjct  342  GYYKICRGRNVCGVDSMVSTVAAVQTSS  369



>gb|KHG24064.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=374

 Score =   175 bits (444),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLK+KPYWIIKNSWGE+WGE 
Sbjct  286  NAVFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKDKPYWIIKNSWGETWGEN  345

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRGRN+CGVDS+VSTVAAVNT
Sbjct  346  GYYKICRGRNVCGVDSLVSTVAAVNT  371



>gb|AIB06024.1| CP2 [Hevea brasiliensis]
Length=372

 Score =   175 bits (444),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 85/89 (96%), Gaps = 1/89 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAP+RLKEKPYWIIKNSWGE+WGE 
Sbjct  283  NAVFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPVRLKEKPYWIIKNSWGENWGES  342

Query  181  GYYKICRGRNICGVDSMVSTVAA-VNTPT  264
            GYYKICRGRNICGVDSMVSTVAA V TP+
Sbjct  343  GYYKICRGRNICGVDSMVSTVAAVVQTPS  371



>gb|AAX19661.1| cysteine proteinase [Populus tomentosa]
Length=374

 Score =   175 bits (443),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYICS+RLDHGVLLVGYGSAGYAP+R+KEKPYWIIKNSWGESWGE 
Sbjct  286  NAVFMQTYIGGVSCPYICSRRLDHGVLLVGYGSAGYAPVRMKEKPYWIIKNSWGESWGEN  345

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPT  264
            G+YKICRGRNICGVDSMVSTVAAV T +
Sbjct  346  GFYKICRGRNICGVDSMVSTVAAVQTSS  373



>gb|ABK96252.1| unknown [Populus trichocarpa x Populus deltoides]
Length=156

 Score =   168 bits (426),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 75/88 (85%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYICS+RLDHGVLLVGYGSAGY+P+R+KEKP+WIIKNSWGE WGE 
Sbjct  69   NAVFMQTYIGGVSCPYICSRRLDHGVLLVGYGSAGYSPVRMKEKPFWIIKNSWGEKWGEN  128

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPT  264
            G+YKICRGRN+CGVDSMVSTVAAV T +
Sbjct  129  GFYKICRGRNVCGVDSMVSTVAAVQTSS  156



>gb|KJB32561.1| hypothetical protein B456_005G247000 [Gossypium raimondii]
Length=374

 Score =   174 bits (442),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLK+KPYWIIKNSWGE+WGE 
Sbjct  286  NAVFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKDKPYWIIKNSWGETWGEN  345

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            G+YKICRGRN+CGVDS+VSTVAAVNT
Sbjct  346  GFYKICRGRNVCGVDSLVSTVAAVNT  371



>ref|XP_011047717.1| PREDICTED: cysteine proteinase RD19a [Populus euphratica]
Length=368

 Score =   174 bits (442),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYICS+RLDHGVLLVGYGSAGYAP+R+KEKPYWIIKNSWGESWGE 
Sbjct  280  NAVFMQTYIGGVSCPYICSRRLDHGVLLVGYGSAGYAPVRMKEKPYWIIKNSWGESWGEN  339

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            G+YKICRGRNICGVDSMVSTVAAV T
Sbjct  340  GFYKICRGRNICGVDSMVSTVAAVQT  365



>gb|ABQ10201.1| cysteine protease Cp3 [Actinidia deliciosa]
Length=365

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/89 (88%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE 
Sbjct  277  NAVFMQTYVGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGEN  336

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            G+YKIC+GRN+CGVDSMVSTVAAV+T ++
Sbjct  337  GFYKICQGRNVCGVDSMVSTVAAVHTTSN  365



>emb|CDP20652.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYICSKRLDHGVLLVGYGS+GYAPIR+KEKPYWIIKNSWGE WGE 
Sbjct  285  NAVFMQTYIGGVSCPYICSKRLDHGVLLVGYGSSGYAPIRMKEKPYWIIKNSWGEHWGEN  344

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPT  264
            GYYKICRG NICGVDSMVSTVAAV+T T
Sbjct  345  GYYKICRGHNICGVDSMVSTVAAVHTST  372



>gb|KJB79047.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
Length=373

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAP+R+K+KPYWIIKNSWGE+WGE 
Sbjct  285  NAVFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGEN  344

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            G+Y+ICRGRNICGVDSMVSTVAAVNT
Sbjct  345  GFYRICRGRNICGVDSMVSTVAAVNT  370



>emb|CAE54306.1| putative papain-like cysteine proteinase [Gossypium hirsutum]
Length=373

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAP+R+K+KPYWIIKNSWGE+WGE 
Sbjct  285  NAVFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGEN  344

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            G+Y+ICRGRNICGVDSMVSTVAAVNT
Sbjct  345  GFYRICRGRNICGVDSMVSTVAAVNT  370



>ref|XP_002313770.1| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE87725.1| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYICS+RLDHGVLLVGYGSA YAP+R+KEKPYWIIKNSWGESWGE 
Sbjct  280  NAVFMQTYIGGVSCPYICSRRLDHGVLLVGYGSAAYAPVRMKEKPYWIIKNSWGESWGEN  339

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            G+YKICRGRNICGVDSMVSTVAAV T
Sbjct  340  GFYKICRGRNICGVDSMVSTVAAVQT  365



>gb|KHG15253.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=373

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAP+R+K+KPYWIIKNSWGE+WGE 
Sbjct  285  NAVFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGEN  344

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            G+Y+ICRGRNICGVDSMVSTVAAVNT
Sbjct  345  GFYRICRGRNICGVDSMVSTVAAVNT  370



>gb|ABK92536.1| unknown [Populus trichocarpa]
Length=368

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYICS+RLDHGVLLVGYGSA YAP+R+KEKPYWIIKNSWGESWGE 
Sbjct  280  NAVFMQTYIGGVSCPYICSRRLDHGVLLVGYGSAAYAPVRMKEKPYWIIKNSWGESWGEN  339

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            G+YKICRGRNICGVDSMVSTVAAV T
Sbjct  340  GFYKICRGRNICGVDSMVSTVAAVQT  365



>ref|NP_001267989.1| cysteine protease precursor [Vitis vinifera]
 gb|ABX79341.1| cysteine protease [Vitis vinifera]
Length=377

 Score =   172 bits (437),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+K+KPYWIIKNSWGE+WGE 
Sbjct  289  NAVFMQTYVGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKDKPYWIIKNSWGENWGEN  348

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            G+YKICRGRN+CGVDSMVSTVAAV+T ++
Sbjct  349  GFYKICRGRNVCGVDSMVSTVAAVHTTSN  377



>ref|XP_007042077.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOX97908.1| Papain family cysteine protease [Theobroma cacao]
Length=395

 Score =   173 bits (438),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYI GVSCPYICSKRLDHGVLLVGYGSAGYAP+R+K+KPYWIIKNSWGESWGE 
Sbjct  307  NAVFMQTYIKGVSCPYICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGESWGED  366

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            G+YKICRGRNICGVDSMVSTVAAV+T
Sbjct  367  GFYKICRGRNICGVDSMVSTVAAVDT  392



>ref|XP_009351218.1| PREDICTED: cysteine proteinase RD19a-like, partial [Pyrus x bretschneideri]
Length=282

 Score =   170 bits (430),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKRLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE 
Sbjct  192  NAVFMQTYVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGEN  251

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            G+YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  252  GFYKICRGRNICGVDSMVSTVAAASVKTN  280



>gb|AAL69389.1|AF462226_1 putative cysteine proteinase [Narcissus pseudonarcissus]
Length=136

 Score =   165 bits (418),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYIC K LDHGVLLVGYGS+G+APIR KEKPYWIIKNSWGE+WGEK
Sbjct  47   NAAFMQTYIGGVSCPYICGKHLDHGVLLVGYGSSGWAPIRFKEKPYWIIKNSWGENWGEK  106

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTSD  270
            GYYKIC+GRN+CGVDSMVSTV A++T   D
Sbjct  107  GYYKICKGRNVCGVDSMVSTVTAIHTTPKD  136



>ref|XP_009373025.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=371

 Score =   172 bits (435),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKRLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE 
Sbjct  281  NAVFMQTYVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGEN  340

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            G+YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  341  GFYKICRGRNICGVDSMVSTVAAASVKTN  369



>ref|XP_010271520.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=370

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/85 (93%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYICSKRLDHGVLLVGYGS GYAPIRLK+KPYWIIKNSWGE WGE 
Sbjct  282  NAVFMQTYIGGVSCPYICSKRLDHGVLLVGYGSEGYAPIRLKDKPYWIIKNSWGEGWGEN  341

Query  181  GYYKICRGRNICGVDSMVSTVAAVN  255
            GYYKICRGRN+CGVDSMVSTVAAVN
Sbjct  342  GYYKICRGRNVCGVDSMVSTVAAVN  366



>ref|XP_009373000.1| PREDICTED: cysteine proteinase RD19a [Pyrus x bretschneideri]
Length=371

 Score =   171 bits (434),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKRLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE 
Sbjct  281  NAVFMQTYVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGEN  340

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            G+YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  341  GFYKICRGRNICGVDSMVSTVAAASVKTN  369



>gb|ACI04578.1| cysteine protease-like protein [Robinia pseudoacacia]
Length=335

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYIC K LDHGVLLVGYG AGYAPIRLKEKPYWIIKNSWGESWGE 
Sbjct  247  NAVFMQTYIGGVSCPYICGKNLDHGVLLVGYGKAGYAPIRLKEKPYWIIKNSWGESWGEN  306

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRGRN+CGVDSMVSTVAAV+T
Sbjct  307  GYYKICRGRNVCGVDSMVSTVAAVHT  332



>ref|XP_008382317.1| PREDICTED: cysteine proteinase RD19a [Malus domestica]
Length=371

 Score =   171 bits (434),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKRLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE 
Sbjct  281  NAVFMQTYVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGEN  340

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            G+YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  341  GFYKICRGRNICGVDSMVSTVAAASVKTN  369



>ref|XP_010028631.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW55393.1| hypothetical protein EUGRSUZ_I01305 [Eucalyptus grandis]
Length=370

 Score =   171 bits (434),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/91 (89%), Positives = 84/91 (92%), Gaps = 2/91 (2%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+K+KPYWIIKNSWGE+WGE 
Sbjct  279  NAVFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKDKPYWIIKNSWGETWGEN  338

Query  181  GYYKICRGRNICGVDSMVSTVAAV--NTPTS  267
            GYYKICRGRNICGVDSMVSTVAA    TP S
Sbjct  339  GYYKICRGRNICGVDSMVSTVAAAVHTTPGS  369



>ref|XP_004290288.1| PREDICTED: probable cysteine proteinase A494 [Fragaria vesca 
subsp. vesca]
Length=372

 Score =   171 bits (434),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKRLDHGVLLVGYGSAGY+P+R+KEKPYWIIKNSWGE+WGEK
Sbjct  287  NAVFMQTYVGGVSCPYICSKRLDHGVLLVGYGSAGYSPVRMKEKPYWIIKNSWGENWGEK  346

Query  181  GYYKICRGRNICGVDSMVSTVAAVN  255
            G+YKICRGRNICGVDSMVSTVAAV 
Sbjct  347  GFYKICRGRNICGVDSMVSTVAAVE  371



>ref|XP_008236965.1| PREDICTED: cysteine proteinase RD19a [Prunus mume]
Length=367

 Score =   171 bits (433),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKRLDHGVLLVGYG+AGY+PIR+KEKPYWIIKNSWGE+WGEK
Sbjct  277  NAVFMQTYVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRMKEKPYWIIKNSWGENWGEK  336

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            G+YKIC+GRNICGVDSMVSTVAA +  T+
Sbjct  337  GFYKICKGRNICGVDSMVSTVAAASVETN  365



>gb|KHN39817.1| Cysteine proteinase RD19a [Glycine soja]
Length=332

 Score =   170 bits (430),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYICS+RLDHGVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE 
Sbjct  244  NAAYMQTYIGGVSCPYICSRRLDHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGEN  303

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            GYYKICRGRNICGVDSMVSTVAAV+T T 
Sbjct  304  GYYKICRGRNICGVDSMVSTVAAVHTTTQ  332



>ref|XP_007201310.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
 gb|EMJ02509.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
Length=367

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKRLDHGVLLVGYG+AGY+PIR+KEKPYWIIKNSWGE+WGEK
Sbjct  277  NAVFMQTYVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRMKEKPYWIIKNSWGENWGEK  336

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            G+YKIC+GRNICGVDSMVSTVAA +  T+
Sbjct  337  GFYKICKGRNICGVDSMVSTVAAASVETN  365



>ref|XP_011037175.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
 ref|XP_011037176.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
Length=368

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYICS+RLDHGVLLVGYGSAGY+PIR+K+KPYWIIKNSWGE WGE 
Sbjct  280  NAVFMQTYIGGVSCPYICSRRLDHGVLLVGYGSAGYSPIRMKDKPYWIIKNSWGEKWGEN  339

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPT  264
            G+YKICRGRN+CGVDSMVSTVAAV T +
Sbjct  340  GFYKICRGRNVCGVDSMVSTVAAVQTTS  367



>gb|AAR92156.1| putative cysteine protease 3 [Iris x hollandica]
Length=292

 Score =   169 bits (427),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYIC K LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGE+WGE 
Sbjct  202  NAVFMQTYIGGVSCPYICGKHLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGETWGEN  261

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRGRN+CGVDSMVSTV A++T
Sbjct  262  GYYKICRGRNVCGVDSMVSTVTAIHT  287



>ref|XP_003606998.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89195.1| papain family cysteine protease [Medicago truncatula]
Length=362

 Score =   170 bits (431),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+GGVSCPYICSKRLDHGVLLVGYGS  Y+PIRLKEKPYWIIKNSWGE+WGE 
Sbjct  275  NAVYMQTYVGGVSCPYICSKRLDHGVLLVGYGSGAYSPIRLKEKPYWIIKNSWGETWGEN  334

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPT  264
            GYYKICRGRNICGVDSMVSTVAAV+T T
Sbjct  335  GYYKICRGRNICGVDSMVSTVAAVHTTT  362



>ref|XP_011028940.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score =   171 bits (432),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKR DHGVLLVGYGSAGYAPIR KEKP+WIIKNSWGE+WGE 
Sbjct  279  NAVFMQTYVGGVSCPYICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGENWGEN  338

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRGRNICGVDSMVSTVAA++T
Sbjct  339  GYYKICRGRNICGVDSMVSTVAAIHT  364



>gb|KDO49483.1| hypothetical protein CISIN_1g017318mg [Citrus sinensis]
Length=373

 Score =   171 bits (432),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYICS+RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE 
Sbjct  289  NAVYMQTYIGGVSCPYICSRRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEN  348

Query  181  GYYKICRGRNICGVDSMVSTVAAV  252
            GYYKICRGRN+CGVDSMVSTVAA 
Sbjct  349  GYYKICRGRNVCGVDSMVSTVAAA  372



>ref|XP_006487337.1| PREDICTED: cysteine proteinase RD19a-like [Citrus sinensis]
Length=373

 Score =   171 bits (432),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYICS+RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE 
Sbjct  289  NAVYMQTYIGGVSCPYICSRRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEN  348

Query  181  GYYKICRGRNICGVDSMVSTVAAV  252
            GYYKICRGRN+CGVDSMVSTVAA 
Sbjct  349  GYYKICRGRNVCGVDSMVSTVAAA  372



>gb|ABK96580.1| unknown [Populus trichocarpa x Populus deltoides]
Length=367

 Score =   170 bits (431),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/86 (88%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKR DHGVLLVGYGSAGYAPIR KEKP+WIIKNSWG++WGE 
Sbjct  279  NAAFMQTYVGGVSCPYICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGEN  338

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRGRNICGVDSMVSTVAA++T
Sbjct  339  GYYKICRGRNICGVDSMVSTVAAIHT  364



>ref|XP_002305451.2| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE85962.2| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   170 bits (431),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 75/88 (85%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYICS+RLDHGVLLVGYGSAGY+P+R+KEKP+WIIKNSWGE WGE 
Sbjct  280  NAVFMQTYIGGVSCPYICSRRLDHGVLLVGYGSAGYSPVRMKEKPFWIIKNSWGEKWGEN  339

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPT  264
            G+YKICRGRN+CGVDSMVSTVAAV T +
Sbjct  340  GFYKICRGRNVCGVDSMVSTVAAVQTSS  367



>ref|XP_003539008.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=363

 Score =   170 bits (431),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYICS+RLDHGVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE 
Sbjct  275  NAAYMQTYIGGVSCPYICSRRLDHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGEN  334

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPT  264
            GYYKICRGRNICGVDSMVSTVAAV+T T
Sbjct  335  GYYKICRGRNICGVDSMVSTVAAVHTTT  362



>gb|ABK94801.1| unknown [Populus trichocarpa]
Length=367

 Score =   170 bits (430),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 76/86 (88%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKR DHGVLLVGYGSAGYAPIR KEKP+WIIKNSWG++WGE 
Sbjct  279  NAAFMQTYVGGVSCPYICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGEN  338

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRGRNICGVDSMVSTVAA++T
Sbjct  339  GYYKICRGRNICGVDSMVSTVAAIHT  364



>ref|XP_002302004.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
 gb|ABK94746.1| unknown [Populus trichocarpa]
 gb|EEE81277.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
Length=367

 Score =   170 bits (430),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 76/86 (88%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKR DHGVLLVGYGSAGYAPIR KEKP+WIIKNSWG++WGE 
Sbjct  279  NAAFMQTYVGGVSCPYICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGEN  338

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRGRNICGVDSMVSTVAA++T
Sbjct  339  GYYKICRGRNICGVDSMVSTVAAIHT  364



>ref|XP_006423403.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
 gb|ESR36643.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
Length=375

 Score =   170 bits (430),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYICS+RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE 
Sbjct  289  NAVYMQTYIGGVSCPYICSRRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEN  348

Query  181  GYYKICRGRNICGVDSMVSTVAAV  252
            GYYKICRGRN+CGVDSMVST+AA 
Sbjct  349  GYYKICRGRNVCGVDSMVSTIAAA  372



>ref|XP_010066197.1| PREDICTED: probable cysteine proteinase A494 [Eucalyptus grandis]
 gb|KCW64029.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
 gb|KCW64030.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
Length=376

 Score =   170 bits (430),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 76/86 (88%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKRLDHGVLLVGYGSA Y+PIR+KEKPYWIIKNSWGE+WGE 
Sbjct  288  NAVFMQTYVGGVSCPYICSKRLDHGVLLVGYGSAAYSPIRMKEKPYWIIKNSWGENWGEN  347

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            G+YKICRGRNICGVDSMVSTVAA++T
Sbjct  348  GFYKICRGRNICGVDSMVSTVAAIHT  373



>ref|XP_011092831.1| PREDICTED: cysteine proteinase RD19a-like [Sesamum indicum]
Length=378

 Score =   170 bits (430),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCP+ICSKRLDHGVLLVGYG+A YAPIRLKEKPYWIIKNSWGE+WGE 
Sbjct  291  NAVFMQTYIGGVSCPFICSKRLDHGVLLVGYGAASYAPIRLKEKPYWIIKNSWGENWGEN  350

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRG N+CGVDSMVSTVAAV+T
Sbjct  351  GYYKICRGHNVCGVDSMVSTVAAVST  376



>ref|XP_011088458.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Sesamum indicum]
Length=379

 Score =   170 bits (430),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCP ICSKRLDHGVLLVGYG AGYAPIR KEKPYWIIKNSWGE WGEK
Sbjct  292  NAVYMQTYIGGVSCPLICSKRLDHGVLLVGYGEAGYAPIRRKEKPYWIIKNSWGEKWGEK  351

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRGRNICGVDSMVSTVAAV+T
Sbjct  352  GYYKICRGRNICGVDSMVSTVAAVST  377



>ref|XP_009376976.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=445

 Score =   171 bits (432),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 75/89 (84%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVS PYICS+RLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGESW E 
Sbjct  355  NAVFMQTYVGGVSYPYICSRRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGESWRES  414

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            G+YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  415  GFYKICRGRNICGVDSMVSTVAAASVKTN  443



>ref|XP_004507484.1| PREDICTED: cysteine proteinase RD19a-like [Cicer arietinum]
Length=363

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+GGVSCPYICS+RLDHGVLLVGYGS  YAPIR+KEKPYWIIKNSWGE+WGE 
Sbjct  275  NAVYMQTYVGGVSCPYICSRRLDHGVLLVGYGSGAYAPIRMKEKPYWIIKNSWGENWGEN  334

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            G+YKICRGRNICGVDSMVSTVAAV+T T 
Sbjct  335  GFYKICRGRNICGVDSMVSTVAAVHTTTQ  363



>gb|ABK93575.1| unknown [Populus trichocarpa]
Length=157

 Score =   162 bits (411),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYICSK  DHGVLLVGYG+AGYAPIR KEKP+WIIKNSWGE+WGE 
Sbjct  69   NAVFMQTYIGGVSCPYICSKHQDHGVLLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGEN  128

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICR RNICGVDSMVSTVAA++ 
Sbjct  129  GYYKICRARNICGVDSMVSTVAAIHA  154



>ref|XP_007131787.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
 gb|ESW03781.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
Length=361

 Score =   168 bits (425),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+ GVSCPYICS+RLDHGVLLVGYGS  YAPIR+KEKPYWIIKNSWGE+WGE 
Sbjct  273  NAVFMQTYMHGVSCPYICSRRLDHGVLLVGYGSGAYAPIRMKEKPYWIIKNSWGENWGEN  332

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPT  264
            GYYKICRGRNICGVDSMVSTVAAV+T T
Sbjct  333  GYYKICRGRNICGVDSMVSTVAAVHTTT  360



>ref|XP_009376977.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=447

 Score =   170 bits (430),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 75/89 (84%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVS PYICS+RLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGESW E 
Sbjct  357  NAVFMQTYVGGVSYPYICSRRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGESWRES  416

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            G+YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  417  GFYKICRGRNICGVDSMVSTVAAASVKTN  445



>gb|AAU81591.1| cysteine proteinase, partial [Petunia x hybrida]
Length=190

 Score =   163 bits (412),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 82/88 (93%), Gaps = 1/88 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKR DHGVLLVGYGS G+APIR+KEKPYWIIKNSWGE WGE 
Sbjct  104  NAVFMQTYVGGVSCPYICSKRQDHGVLLVGYGS-GFAPIRMKEKPYWIIKNSWGEKWGES  162

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPT  264
            GYYKICRGRN+CGVDSMVSTVAAV+T +
Sbjct  163  GYYKICRGRNVCGVDSMVSTVAAVSTSS  190



>ref|XP_009406357.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=372

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC + LDHGVLLVGYGSAGY+PIRLK+KP+WIIKNSWGE+WGEK
Sbjct  283  NAVYMQTYIGGVSCPYICGRHLDHGVLLVGYGSAGYSPIRLKQKPFWIIKNSWGETWGEK  342

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRGRN+CGVDSMVSTV A+NT
Sbjct  343  GYYKICRGRNVCGVDSMVSTVTAINT  368



>ref|XP_002510469.1| cysteine protease, putative [Ricinus communis]
 gb|EEF52656.1| cysteine protease, putative [Ricinus communis]
Length=366

 Score =   167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYICSKR DHGV+LVGYGSAGYAP+RLK+KP+WIIKNSWGE+WGE 
Sbjct  278  NAVFMQTYIGGVSCPYICSKRQDHGVVLVGYGSAGYAPVRLKDKPFWIIKNSWGENWGEN  337

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRGRN+CGVD+MVSTVAA++T
Sbjct  338  GYYKICRGRNVCGVDAMVSTVAAIHT  363



>gb|AJP16692.1| cysteine protease, partial [Striga hermonthica]
Length=148

 Score =   161 bits (408),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 73/83 (88%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+ GVSCPYICSKRLDHGVLLVGYG +GYAPIR+K+KPYWIIKNSWGE+WGE 
Sbjct  66   NAVFMQTYMKGVSCPYICSKRLDHGVLLVGYGESGYAPIRMKDKPYWIIKNSWGENWGEN  125

Query  181  GYYKICRGRNICGVDSMVSTVAA  249
            GYYKICRGRN+CGVDSMVSTVAA
Sbjct  126  GYYKICRGRNVCGVDSMVSTVAA  148



>ref|XP_004148554.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Cucumis sativus]
Length=381

 Score =   168 bits (425),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCP+ICSKRLDHGVLLVGYGSAGYAPIR+++K YWIIKNSWGESWGE 
Sbjct  283  NAVFMQTYIGGVSCPFICSKRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGEN  342

Query  181  GYYKICRGRNICGVDSMVSTVAAVN  255
            GYYKICRGRNICGVDS+VSTVAAV+
Sbjct  343  GYYKICRGRNICGVDSLVSTVAAVH  367



>emb|CDQ51995.1| Cysteine proteinase, partial [Fagus sylvatica]
Length=165

 Score =   161 bits (408),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+ GVSCPYIC + LDHGVLLVG+GSAGYAPIRLKEKP+WIIKNSWGE+WGE 
Sbjct  80   NAVFMQTYMKGVSCPYICGRHLDHGVLLVGFGSAGYAPIRLKEKPFWIIKNSWGENWGEN  139

Query  181  GYYKICRGRNICGVDSMVSTVAAVN  255
            GYYKICRGRN+CGVDSMVSTVAA+N
Sbjct  140  GYYKICRGRNVCGVDSMVSTVAAIN  164



>gb|KGN43159.1| Papain-like cysteine proteinase isoform I [Cucumis sativus]
Length=387

 Score =   167 bits (424),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCP+ICSKRLDHGVLLVGYGSAGYAPIR+++K YWIIKNSWGESWGE 
Sbjct  289  NAVFMQTYIGGVSCPFICSKRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGEN  348

Query  181  GYYKICRGRNICGVDSMVSTVAAVN  255
            GYYKICRGRNICGVDS+VSTVAAV+
Sbjct  349  GYYKICRGRNICGVDSLVSTVAAVH  373



>ref|XP_004165230.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
Length=387

 Score =   167 bits (424),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCP+ICSKRLDHGVLLVGYGSAGYAPIR+++K YWIIKNSWGESWGE 
Sbjct  289  NAVFMQTYIGGVSCPFICSKRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGEN  348

Query  181  GYYKICRGRNICGVDSMVSTVAAVN  255
            GYYKICRGRNICGVDS+VSTVAAV+
Sbjct  349  GYYKICRGRNICGVDSLVSTVAAVH  373



>ref|XP_010268619.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=369

 Score =   167 bits (423),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYICS+RL+HGVLLVGYGS GY+PIR+K+KPYWIIKNSWGESWGE 
Sbjct  281  NAVFMQTYIGGVSCPYICSRRLNHGVLLVGYGSEGYSPIRMKDKPYWIIKNSWGESWGEN  340

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRGR++CGVDSMVSTVAA++T
Sbjct  341  GYYKICRGRDVCGVDSMVSTVAAIHT  366



>ref|XP_010061009.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW67908.1| hypothetical protein EUGRSUZ_F01612 [Eucalyptus grandis]
Length=369

 Score =   166 bits (421),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 76/86 (88%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC K LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE 
Sbjct  281  NAVYMQTYIGGVSCPYICGKHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEN  340

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRGR+ICGVDSMVSTVAA++T
Sbjct  341  GYYKICRGRDICGVDSMVSTVAAIHT  366



>ref|XP_003540987.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=365

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPY+CS+RL+HGVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE 
Sbjct  277  NAAYMQTYIGGVSCPYVCSRRLNHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGEN  336

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPT  264
            GYYKICRGRNICGVDSMVSTVA+V+T T
Sbjct  337  GYYKICRGRNICGVDSMVSTVASVHTTT  364



>ref|XP_003523684.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=366

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYIC K LDHGVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+
Sbjct  278  NAVFMQTYIGGVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEE  337

Query  181  GYYKICRGRNICGVDSMVSTVAAVN  255
            GYYKICRGRN+CGVDSMVSTVAA++
Sbjct  338  GYYKICRGRNVCGVDSMVSTVAAIH  362



>ref|XP_004150061.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004166953.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN61836.1| Cysteine protease [Cucumis sativus]
Length=377

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYI GVSCPYICSK LDHGVLLVGYGS GYAPIRLK+KPYWIIKNSWG +WGE 
Sbjct  289  NAVFMQTYIKGVSCPYICSKHLDHGVLLVGYGSDGYAPIRLKDKPYWIIKNSWGANWGEN  348

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRGRNICGVDSMVSTVAAV+T
Sbjct  349  GYYKICRGRNICGVDSMVSTVAAVHT  374



>gb|ABF46642.1| papain-like cysteine proteinase [Pachysandra terminalis]
Length=374

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 82/89 (92%), Gaps = 2/89 (2%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRL-DHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE  177
            NA FMQTYIGGVSCPYICSKRL DHGVLLVGYGSAG+APIR KEKPYWIIKNSWGESWGE
Sbjct  285  NAMFMQTYIGGVSCPYICSKRLLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGESWGE  344

Query  178  KGYYKICRGRNICGVDSMVSTVAAVNTPT  264
            KGYYKICRGRNICG+DSMVS VAA   PT
Sbjct  345  KGYYKICRGRNICGMDSMVSAVAAA-VPT  372



>gb|KHN45894.1| Cysteine proteinase RD19a [Glycine soja]
Length=366

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYIC K LDHGVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+
Sbjct  278  NAVFMQTYIGGVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEE  337

Query  181  GYYKICRGRNICGVDSMVSTVAAVN  255
            GYYKICRGRN+CGVDSMVSTVAA++
Sbjct  338  GYYKICRGRNVCGVDSMVSTVAAIH  362



>ref|NP_001241450.1| uncharacterized protein LOC100778716 precursor [Glycine max]
 gb|ACU20049.1| unknown [Glycine max]
Length=366

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYIC K LDHGVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+
Sbjct  278  NAVFMQTYIGGVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEE  337

Query  181  GYYKICRGRNICGVDSMVSTVAAVN  255
            GYYKICRGRN+CGVDSMVSTVAA++
Sbjct  338  GYYKICRGRNVCGVDSMVSTVAAIH  362



>dbj|BAJ53178.1| JHL18I08.12 [Jatropha curcas]
 gb|KDP38578.1| hypothetical protein JCGZ_04503 [Jatropha curcas]
Length=368

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKR DHGVLLVGYGSAGYAPIRLK+KP+WIIKNSWGESWGE 
Sbjct  279  NAVFMQTYMGGVSCPYICSKRQDHGVLLVGYGSAGYAPIRLKDKPFWIIKNSWGESWGEN  338

Query  181  GYYKICRGRNICGVDSMVSTVAAVN  255
            GYY+ICRGRNICGVD+MVS+VAA++
Sbjct  339  GYYRICRGRNICGVDAMVSSVAAIH  363



>ref|XP_010910124.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=374

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYIC K LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE 
Sbjct  288  NAVFMQTYIGGVSCPYICGKHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGED  347

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKIC+GRN+CGVDSMVSTV AV +
Sbjct  348  GYYKICKGRNVCGVDSMVSTVTAVRS  373



>ref|XP_008775532.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=371

 Score =   165 bits (418),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYIC + LDHGVLLVGYGSA YAPIR KEKPYWIIKNSWGE WGE 
Sbjct  285  NAVFMQTYIGGVSCPYICGRHLDHGVLLVGYGSAAYAPIRFKEKPYWIIKNSWGEKWGEN  344

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRGRN+CGVDSMVSTVAAV +
Sbjct  345  GYYKICRGRNVCGVDSMVSTVAAVRS  370



>gb|AAB62937.1| stress-induced cysteine proteinase [Lavatera thuringiaca]
Length=175

 Score =   159 bits (403),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYIC + LDHGVLLVGYG+AGYAP+R KEKP+WIIKNSWG +WGE 
Sbjct  87   NAAFMQTYIGGVSCPYICFRSLDHGVLLVGYGAAGYAPVRFKEKPFWIIKNSWGANWGED  146

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            GYYKICRGRN+CGVDSMVS+VAA+ T + 
Sbjct  147  GYYKICRGRNVCGVDSMVSSVAALQTKSQ  175



>ref|XP_009602233.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana tomentosiformis]
Length=369

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/88 (85%), Positives = 83/88 (94%), Gaps = 1/88 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKRLDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE 
Sbjct  282  NAVFMQTYVGGVSCPYICSKRLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGEN  340

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPT  264
            GYYKICRGRN+CGVDSMVSTVAAV+T +
Sbjct  341  GYYKICRGRNVCGVDSMVSTVAAVSTSS  368



>ref|XP_011045161.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score =   164 bits (416),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYICSK  DHGVLLVGYG+AGYAPIR KEKP+WIIKNSWGE+WGE 
Sbjct  279  NAVFMQTYIGGVSCPYICSKHQDHGVLLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGEN  338

Query  181  GYYKICRGRNICGVDSMVSTVAAVN  255
            GYYKICR RNICGVDSMVSTVAA++
Sbjct  339  GYYKICRARNICGVDSMVSTVAAIH  363



>gb|AAL05851.1|AF411121_1 cysteine proteinase precursor [Sandersonia aurantiaca]
Length=360

 Score =   164 bits (416),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYIC K LDHGVLLVGYGSAG+APIR KEKPYWIIKNSWGE+WGE 
Sbjct  273  NAVFMQTYVGGVSCPYICGKHLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGENWGEN  332

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRGRN+CGVDSMVS+V+A +T
Sbjct  333  GYYKICRGRNVCGVDSMVSSVSAFHT  358



>gb|KHN12668.1| Cysteine proteinase 15A [Glycine soja]
Length=156

 Score =   158 bits (400),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYIC K LDHGVLLVGYG   YAPIR K KPYWIIKNSWGESWGE 
Sbjct  68   NAVFMQTYVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGEN  127

Query  181  GYYKICRGRNICGVDSMVSTVAAV  252
            GYYKICRGRN+CGVDSMVSTVAA+
Sbjct  128  GYYKICRGRNVCGVDSMVSTVAAI  151



>ref|XP_010531457.1| PREDICTED: probable cysteine proteinase A494 [Tarenaya hassleriana]
Length=364

 Score =   164 bits (415),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 73/83 (88%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYICS+RL+HGVLLVGYGSAGYAP R+KEKP+WIIKNSWGE+WGEK
Sbjct  278  NAAYMQTYIGGVSCPYICSRRLNHGVLLVGYGSAGYAPARMKEKPFWIIKNSWGENWGEK  337

Query  181  GYYKICRGRNICGVDSMVSTVAA  249
            G+YKICRGRNICGVDS+VSTVAA
Sbjct  338  GFYKICRGRNICGVDSLVSTVAA  360



>gb|AAU81589.1| cysteine proteinase [Petunia x hybrida]
Length=257

 Score =   161 bits (408),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+GGVSCP IC KR DHGVLLVGYGSAG+APIRLKEKPYWIIKNSWGESWGE+
Sbjct  167  NAAWMQTYVGGVSCPLICFKRQDHGVLLVGYGSAGFAPIRLKEKPYWIIKNSWGESWGEQ  226

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRGRNICGVD+MVSTV A +T
Sbjct  227  GYYKICRGRNICGVDAMVSTVTAAHT  252



>ref|XP_002306900.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
 gb|ABK92924.1| unknown [Populus trichocarpa]
 gb|EEE93896.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
Length=367

 Score =   164 bits (415),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYICSK  DHGVLLVGYG+AGYAPIR KEKP+WIIKNSWGE+WGE 
Sbjct  279  NAVFMQTYIGGVSCPYICSKHQDHGVLLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGEN  338

Query  181  GYYKICRGRNICGVDSMVSTVAAVN  255
            GYYKICR RNICGVDSMVSTVAA++
Sbjct  339  GYYKICRARNICGVDSMVSTVAAIH  363



>gb|EYU42593.1| hypothetical protein MIMGU_mgv1a008336mg [Erythranthe guttata]
Length=377

 Score =   164 bits (416),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCP+IC+KRLDHGVLLVGYG+  +APIR+KEKPYWIIKNSWG +WGEK
Sbjct  291  NAVFMQTYVGGVSCPFICAKRLDHGVLLVGYGAGAFAPIRMKEKPYWIIKNSWGPNWGEK  350

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKIC+GRN+CGVDSMVSTVAAV T
Sbjct  351  GYYKICQGRNLCGVDSMVSTVAAVTT  376



>ref|XP_008448073.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=385

 Score =   164 bits (416),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCP+ICS RLDHGVLLVGYGSAGYAPIR+++K YWIIKNSWGE+WGE 
Sbjct  287  NAVFMQTYIGGVSCPFICSNRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGENWGEN  346

Query  181  GYYKICRGRNICGVDSMVSTVAAVN  255
            GYYKICRGRNICGVDS+VSTVAAV+
Sbjct  347  GYYKICRGRNICGVDSLVSTVAAVH  371



>ref|XP_002275759.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI17456.3| unnamed protein product [Vitis vinifera]
Length=367

 Score =   164 bits (415),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+ GVSCPYICS+ LDHGV+LVGYGSAGYAPIR KEKPYWIIKNSWGESWGE 
Sbjct  279  NAVFMQTYMKGVSCPYICSRNLDHGVVLVGYGSAGYAPIRFKEKPYWIIKNSWGESWGED  338

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            GYYKICRG N CGVDSMVSTVAA+ T T 
Sbjct  339  GYYKICRGHNACGVDSMVSTVAAIQTTTQ  367



>ref|XP_008460996.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=377

 Score =   164 bits (416),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYI GVSCPYICS+ LDHGVLLVGYGS GYAPIR+K+KPYWIIKNSWG +WGE 
Sbjct  289  NAVFMQTYIRGVSCPYICSRHLDHGVLLVGYGSEGYAPIRMKDKPYWIIKNSWGANWGEN  348

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRGRNICGVDSMVSTVAAV+T
Sbjct  349  GYYKICRGRNICGVDSMVSTVAAVHT  374



>gb|KHN25410.1| Cysteine proteinase RD19a [Glycine soja]
Length=365

 Score =   164 bits (415),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPY+CS+RL+HGVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE 
Sbjct  277  NAAYMQTYIGGVSCPYVCSRRLNHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGEN  336

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPT  264
            GYYKICRGR+ICGVDSMVSTVA+V+T T
Sbjct  337  GYYKICRGRSICGVDSMVSTVASVHTTT  364



>ref|XP_002280798.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CAN73591.1| hypothetical protein VITISV_022889 [Vitis vinifera]
 emb|CBI19785.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   164 bits (415),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY  GVSCPYICS  LDHGVLLVGYGSAGY+PIR KEKPYWIIKNSWGESWGE+
Sbjct  283  NAVFMQTYKSGVSCPYICSSTLDHGVLLVGYGSAGYSPIRFKEKPYWIIKNSWGESWGEQ  342

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRG NICGVDSMVSTVAA++T
Sbjct  343  GYYKICRGHNICGVDSMVSTVAAIHT  368



>ref|XP_009392632.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=369

 Score =   164 bits (415),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            N+ FMQTYIGGVSCPYIC + LDHGVLLVGYGSAGY+PIRLK+KP+WIIKNSWGE+WGE 
Sbjct  280  NSVFMQTYIGGVSCPYICGRHLDHGVLLVGYGSAGYSPIRLKDKPFWIIKNSWGENWGEH  339

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRGRNICGVDSMVS+V+A++T
Sbjct  340  GYYKICRGRNICGVDSMVSSVSAIHT  365



>gb|KHN22211.1| Cysteine proteinase 15A [Glycine soja]
Length=366

 Score =   164 bits (414),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYIC K LDHGVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+
Sbjct  278  NAVFMQTYIGGVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEE  337

Query  181  GYYKICRGRNICGVDSMVSTVAAVN  255
            GYY ICRGRN+CGVDSMVSTVAA++
Sbjct  338  GYYNICRGRNVCGVDSMVSTVAAIH  362



>gb|EYU37835.1| hypothetical protein MIMGU_mgv1a008237mg [Erythranthe guttata]
Length=380

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+ GVSCPYIC+KRLDHGVLLVGYG  GY+PIR+KEKPYWIIKNSWG +WGE 
Sbjct  292  NAAYMQTYMKGVSCPYICTKRLDHGVLLVGYGETGYSPIRMKEKPYWIIKNSWGPNWGED  351

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPT  264
            GYYKICRGRNICGVDSMVSTVAAV+T +
Sbjct  352  GYYKICRGRNICGVDSMVSTVAAVSTTS  379



>ref|XP_004291404.1| PREDICTED: cysteine proteinase 15A-like [Fragaria vesca subsp. 
vesca]
Length=365

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 82/87 (94%), Gaps = 1/87 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE  177
            NA FMQTYIGGVSCPYIC K  LDHGVLLVGYGS+GYAPIR KEKPYWIIKNSWG+SWGE
Sbjct  279  NAVFMQTYIGGVSCPYICGKNHLDHGVLLVGYGSSGYAPIRFKEKPYWIIKNSWGQSWGE  338

Query  178  KGYYKICRGRNICGVDSMVSTVAAVNT  258
            +GYYKICRGRN+CGVDSMVSTVAA++T
Sbjct  339  EGYYKICRGRNVCGVDSMVSTVAAMHT  365



>ref|XP_010105270.1| Cysteine proteinase 15A [Morus notabilis]
 gb|EXC04205.1| Cysteine proteinase 15A [Morus notabilis]
Length=372

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 82/86 (95%), Gaps = 1/86 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE  177
            NA FMQTYIGGVSCPYICSK  LDHGVLLVGYG+AGYAPIR K+KPYWIIKNSWGE+WGE
Sbjct  278  NAVFMQTYIGGVSCPYICSKHMLDHGVLLVGYGTAGYAPIRFKDKPYWIIKNSWGENWGE  337

Query  178  KGYYKICRGRNICGVDSMVSTVAAVN  255
            +GYYKICRGRN+CGVDSMVSTVAA++
Sbjct  338  QGYYKICRGRNVCGVDSMVSTVAALH  363



>ref|XP_006362019.1| PREDICTED: cysteine proteinase RD19a-like [Solanum tuberosum]
Length=368

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 83/88 (94%), Gaps = 1/88 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSK+LDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE 
Sbjct  282  NAVFMQTYVGGVSCPYICSKQLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGEN  340

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPT  264
            GYYKICRGRN+CGVDSMVSTVAAV+T +
Sbjct  341  GYYKICRGRNVCGVDSMVSTVAAVSTSS  368



>ref|XP_004230928.1| PREDICTED: cysteine proteinase RD19a [Solanum lycopersicum]
Length=369

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 83/88 (94%), Gaps = 1/88 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSK+LDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE 
Sbjct  282  NAVFMQTYVGGVSCPYICSKQLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGES  340

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPT  264
            GYYKICRGRN+CGVDSMVSTVAAV+T +
Sbjct  341  GYYKICRGRNVCGVDSMVSTVAAVSTSS  368



>gb|AGV54334.1| cysteine proteinase RD19a-like protein [Phaseolus vulgaris]
Length=366

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYIC K LDHGVLLVGYG+  YAPIR KEKP+WIIKNSWGESWGE 
Sbjct  278  NAIFMQTYIGGVSCPYICGKHLDHGVLLVGYGAGAYAPIRFKEKPFWIIKNSWGESWGEN  337

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPT  264
            GYYKICRG N+CGVDSMVSTVAA++T +
Sbjct  338  GYYKICRGHNVCGVDSMVSTVAAIHTSS  365



>ref|XP_009109502.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
 emb|CDX90310.1| BnaA08g16740D [Brassica napus]
Length=369

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE 
Sbjct  280  NAAYMQTYIGGVSCPYICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEN  339

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            G+YKICRGRN+CGVDS+VSTV A  +PT+
Sbjct  340  GFYKICRGRNVCGVDSLVSTVTAAVSPTA  368



>ref|XP_007136047.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
 gb|ESW08041.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
Length=366

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYIC K LDHGVLLVGYG+  YAPIR KEKP+WIIKNSWGESWGE 
Sbjct  278  NAIFMQTYIGGVSCPYICGKHLDHGVLLVGYGAGAYAPIRFKEKPFWIIKNSWGESWGEN  337

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPT  264
            GYYKICRG N+CGVDSMVSTVAA++T +
Sbjct  338  GYYKICRGHNVCGVDSMVSTVAAIHTSS  365



>ref|XP_010530325.1| PREDICTED: cysteine proteinase RD19a [Tarenaya hassleriana]
Length=370

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYICSKR DHGVLLVGYGSAGY+PIRLKEKPYWIIKNSWG +WGE+
Sbjct  282  NAMWMQTYIGGVSCPYICSKRQDHGVLLVGYGSAGYSPIRLKEKPYWIIKNSWGANWGEE  341

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            GYYKIC GRN+CG+D+MVS+VAAV+T T 
Sbjct  342  GYYKICHGRNLCGMDTMVSSVAAVHTSTQ  370



>gb|AIB06025.1| CP3 [Hevea brasiliensis]
Length=366

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYICSK  DHGVLLVGYG+AGYAPIR K+KP+WIIKNSWGE+WGE 
Sbjct  278  NAMFMQTYIGGVSCPYICSKSQDHGVLLVGYGAAGYAPIRFKDKPFWIIKNSWGENWGEN  337

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRGRNICG+D+MVS+VAA++T
Sbjct  338  GYYKICRGRNICGMDAMVSSVAAIHT  363



>dbj|BAC41322.1| hypothetical protein [Lotus japonicus]
Length=358

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+GGVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE 
Sbjct  272  NAVYMQTYVGGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGEN  331

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRGRNICGVDSMVSTVAA++T
Sbjct  332  GYYKICRGRNICGVDSMVSTVAALHT  357



>gb|KJB07487.1| hypothetical protein B456_001G026600 [Gossypium raimondii]
Length=377

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            N+ FMQTYIGGVSCP+ICSK LDHGVLLVGYGSAGY+PI LK+KPYWIIKNSWGE+WGE 
Sbjct  289  NSVFMQTYIGGVSCPFICSKHLDHGVLLVGYGSAGYSPIHLKDKPYWIIKNSWGENWGEN  348

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            GYYKICRG N+CGVDS+VSTV A+NT + 
Sbjct  349  GYYKICRGSNVCGVDSLVSTVVALNTKSQ  377



>ref|XP_007017672.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOY14897.1| Papain family cysteine protease [Theobroma cacao]
Length=401

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+ GVSCPYIC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE+
Sbjct  313  NAVFMQTYMKGVSCPYICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEE  372

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRGRN+CGVDSMVS+VAA+ T
Sbjct  373  GYYKICRGRNVCGVDSMVSSVAALQT  398



>ref|XP_006828787.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
 gb|ERM96203.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
Length=365

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 82/87 (94%), Gaps = 1/87 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE  177
            NA FMQTYIGGVSCPYICSKR LDHGVL+VGYGSAGYAPIRLK+K YWIIKNSWGE+WGE
Sbjct  279  NAVFMQTYIGGVSCPYICSKRNLDHGVLIVGYGSAGYAPIRLKDKAYWIIKNSWGETWGE  338

Query  178  KGYYKICRGRNICGVDSMVSTVAAVNT  258
            KGYYKICRG NICGVDSMVSTVA++ +
Sbjct  339  KGYYKICRGHNICGVDSMVSTVASIQS  365



>emb|CAE45588.1| papain-like cysteine proteinase-like protein 1 [Lotus japonicus]
Length=359

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+GGVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE 
Sbjct  273  NAVYMQTYVGGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGEN  332

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRGRNICGVDSMVSTVAA++T
Sbjct  333  GYYKICRGRNICGVDSMVSTVAALHT  358



>dbj|BAF98584.1| CM0216.500.nc [Lotus japonicus]
Length=360

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+GGVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE 
Sbjct  272  NAVYMQTYVGGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGEN  331

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRGRNICGVDSMVSTVAA++T
Sbjct  332  GYYKICRGRNICGVDSMVSTVAALHT  357



>dbj|BAD94010.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
Length=86

 Score =   154 bits (388),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +1

Query  13   MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  192
            MQTYIGGVSCPYIC++RL+HGVLLVGYG+AGYAP R KEKPYWIIKNSWGE+WGE G+YK
Sbjct  1    MQTYIGGVSCPYICTRRLNHGVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYK  60

Query  193  ICRGRNICGVDSMVSTVAAVNTPTSD  270
            IC+GRNICGVDSMVSTVAA  + T+ 
Sbjct  61   ICKGRNICGVDSMVSTVAATVSTTAH  86



>ref|XP_008387995.1| PREDICTED: cysteine proteinase 15A [Malus domestica]
Length=365

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYIC KR+DHGVLLVGYGS+G+APIRLKEKPYWI+KNSWG+SWGE+
Sbjct  277  NAVFMQTYVGGVSCPYICGKRIDHGVLLVGYGSSGFAPIRLKEKPYWILKNSWGQSWGEQ  336

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRG N CGVDS+VSTVAA++T
Sbjct  337  GYYKICRGYNSCGVDSLVSTVAALHT  362



>ref|XP_006411706.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
 dbj|BAJ33785.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53159.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
Length=373

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGESWGE 
Sbjct  284  NAAYMQTYIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGESWGEN  343

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            G+YKIC+GRNICGVDS+VSTV+A  + T+
Sbjct  344  GFYKICKGRNICGVDSLVSTVSATVSTTA  372



>gb|AAL60581.1|AF454959_1 senescence-associated cysteine protease [Brassica oleracea]
Length=368

 Score =   162 bits (409),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE 
Sbjct  279  NAAYMQTYIGGVSCPYICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGED  338

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            G+YKICRGRN+CGVDS+VSTV A  +P +
Sbjct  339  GFYKICRGRNVCGVDSLVSTVTATVSPAA  367



>emb|CAE45589.1| papain-like cysteine proteinase-like protein 2 [Lotus japonicus]
Length=361

 Score =   161 bits (408),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+GGVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE 
Sbjct  273  NAVYMQTYVGGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGEN  332

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRGRN+CGVDSMVSTVAA++T
Sbjct  333  GYYKICRGRNVCGVDSMVSTVAALHT  358



>dbj|BAF46302.1| cysteine proteinase precursor [Ipomoea nil]
Length=369

 Score =   162 bits (409),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 81/87 (93%), Gaps = 1/87 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE  177
            NA FMQTYIGGVSCPYICSKR LDHGVLLVGYG+AGYAPIR K+KPYWI+KNSWGE+WGE
Sbjct  280  NAVFMQTYIGGVSCPYICSKRNLDHGVLLVGYGAAGYAPIRFKDKPYWIVKNSWGENWGE  339

Query  178  KGYYKICRGRNICGVDSMVSTVAAVNT  258
            +GYYKICRG NICG+DSMVSTV A +T
Sbjct  340  EGYYKICRGNNICGIDSMVSTVTAAST  366



>emb|CDY71205.1| BnaCnng71840D [Brassica napus]
Length=368

 Score =   162 bits (409),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE 
Sbjct  279  NAAYMQTYIGGVSCPYICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGED  338

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            G+YKICRGRN+CGVDS+VSTV A  +P +
Sbjct  339  GFYKICRGRNVCGVDSLVSTVTATVSPAA  367



>gb|AAM65162.1| cysteine proteinase RD19A [Arabidopsis thaliana]
Length=368

 Score =   162 bits (409),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC++RL+HGVLLVGYG+AGYAP R KEKPYWIIKNSWGE+WGE 
Sbjct  279  NAGYMQTYIGGVSCPYICTRRLNHGVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGEN  338

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            G+YKIC+GRNICGVDSMVSTVAA  + T+
Sbjct  339  GFYKICKGRNICGVDSMVSTVAATVSTTA  367



>gb|KFK30492.1| hypothetical protein AALP_AA7G268600 [Arabis alpina]
Length=367

 Score =   161 bits (408),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE 
Sbjct  278  NAAYMQTYIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEN  337

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            G+YKIC+GRNICGVDS+VSTVAA  + T+
Sbjct  338  GFYKICKGRNICGVDSLVSTVAATVSTTA  366



>dbj|BAF98585.1| CM0216.510.nc [Lotus japonicus]
Length=360

 Score =   161 bits (408),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+GGVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE 
Sbjct  272  NAVYMQTYVGGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGEN  331

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRGRN+CGVDSMVSTVAA++T
Sbjct  332  GYYKICRGRNVCGVDSMVSTVAALHT  357



>ref|NP_568052.1| cysteine proteinase RD19a [Arabidopsis thaliana]
 sp|P43296.1|RD19A_ARATH RecName: Full=Cysteine proteinase RD19a; Short=RD19; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA02373.1| thiol protease [Arabidopsis thaliana]
 emb|CAB38829.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 emb|CAB80572.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AAL85009.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 gb|AAM91778.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 dbj|BAE98545.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AEE87016.1| cysteine proteinase RD19a [Arabidopsis thaliana]
Length=368

 Score =   161 bits (408),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC++RL+HGVLLVGYG+AGYAP R KEKPYWIIKNSWGE+WGE 
Sbjct  279  NAGYMQTYIGGVSCPYICTRRLNHGVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGEN  338

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            G+YKIC+GRNICGVDSMVSTVAA  + T+
Sbjct  339  GFYKICKGRNICGVDSMVSTVAATVSTTA  367



>gb|ACX54787.2| cysteine protease [Arachis diogoi]
Length=360

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYIC K LDHGVLLVGYG+AGYAPIR K+KP+WIIKNSWGESWGE 
Sbjct  270  NAIFMQTYIGGVSCPYICGKNLDHGVLLVGYGAAGYAPIRFKDKPFWIIKNSWGESWGED  329

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTSD  270
            GYYKICRG+N+CGVDSMVS+V A    +S+
Sbjct  330  GYYKICRGKNVCGVDSMVSSVVATTFTSSN  359



>ref|XP_006283963.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
 gb|EOA16861.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
Length=368

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE 
Sbjct  279  NAAYMQTYIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEN  338

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            G+YKIC+GRNICGVDS+VSTV+A  + T+
Sbjct  339  GFYKICKGRNICGVDSLVSTVSATVSTTA  367



>ref|XP_006473584.1| PREDICTED: cysteine proteinase 15A-like [Citrus sinensis]
Length=369

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC K LDHGVL+VGYGS+G+APIR KEKPYWIIKNSWGE+WGE 
Sbjct  281  NAVWMQTYIGGVSCPYICGKYLDHGVLIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGEN  340

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            GYYKIC GRN+CGVDSMVS+VAAV+T +S
Sbjct  341  GYYKICMGRNVCGVDSMVSSVAAVHTTSS  369



>ref|XP_006665032.1| PREDICTED: cysteine proteinase 1-like [Oryza brachyantha]
Length=191

 Score =   155 bits (392),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 80/89 (90%), Gaps = 3/89 (3%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC K LDHGVLLVGYGS+G+APIRLK+KPYWIIKNSWGE+WGE 
Sbjct  100  NAAYMQTYIGGVSCPYICGKHLDHGVLLVGYGSSGFAPIRLKDKPYWIIKNSWGENWGEH  159

Query  181  GYYKICRGRNI---CGVDSMVSTVAAVNT  258
            GYYKICRG N+   CGVDSMVSTV A++T
Sbjct  160  GYYKICRGSNVRDKCGVDSMVSTVTAIHT  188



>emb|CDY41960.1| BnaA01g05320D [Brassica napus]
Length=367

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE 
Sbjct  278  NAAYMQTYIGGVSCPYICTRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEN  337

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            G+YKIC+GRNICGVDS+VSTV A  + T+
Sbjct  338  GFYKICKGRNICGVDSLVSTVTAAVSTTA  366



>ref|XP_003550405.2| PREDICTED: cysteine proteinase 15A [Glycine max]
Length=392

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYIC K LDHGVLLVGYG   YAPIR K KPYWIIKNSWGESWGE 
Sbjct  304  NAVFMQTYVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGEN  363

Query  181  GYYKICRGRNICGVDSMVSTVAAV  252
            GYYKICRGRN+CGVDSMVSTVAA+
Sbjct  364  GYYKICRGRNVCGVDSMVSTVAAI  387



>ref|XP_007160702.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
 gb|ESW32696.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
Length=365

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+GGVSCPYIC K LDHGVLLVGYG   YAPIR KEKPYWIIKNSWGE+WGE 
Sbjct  277  NAVYMQTYVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGEN  336

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            GYYKICRGRN+CGVDSMVSTV A++  T 
Sbjct  337  GYYKICRGRNVCGVDSMVSTVGAIHASTQ  365



>gb|KDO84720.1| hypothetical protein CISIN_1g017548mg [Citrus sinensis]
Length=369

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC K LDHGVL+VGYGS+G+APIR KEKPYWIIKNSWGE+WGE 
Sbjct  281  NAVWMQTYIGGVSCPYICGKYLDHGVLIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGEN  340

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            GYYKIC GRN+CGVDSMVS+VAA++T +S
Sbjct  341  GYYKICMGRNVCGVDSMVSSVAAIHTTSS  369



>ref|XP_009146338.1| PREDICTED: cysteine proteinase 15A-like [Brassica rapa]
 emb|CDY32227.1| BnaA01g17570D [Brassica napus]
Length=368

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 82/90 (91%), Gaps = 1/90 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYICSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG +WGE 
Sbjct  279  NAMWMQTYIGGVSCPYICSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGSTWGED  338

Query  181  GYYKICRGR-NICGVDSMVSTVAAVNTPTS  267
            GYYKICRGR NICG+D+MVSTVAAV+T T 
Sbjct  339  GYYKICRGRHNICGMDTMVSTVAAVHTSTQ  368



>ref|XP_008775280.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=368

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYIC + LDHGVLLVGYGSAGYAPIR K+KPYWIIKNSWGE+WGE 
Sbjct  283  NAVFMQTYIGGVSCPYICGRHLDHGVLLVGYGSAGYAPIRFKDKPYWIIKNSWGENWGED  342

Query  181  GYYKICRGRNICGVDSMVSTVAAV  252
            GYYKICRG NICGV+SMVSTV A+
Sbjct  343  GYYKICRGHNICGVESMVSTVTAI  366



>emb|CDY34441.1| BnaC01g21920D [Brassica napus]
Length=368

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 82/89 (92%), Gaps = 1/89 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYICSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG +WGE 
Sbjct  279  NAMWMQTYIGGVSCPYICSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGSTWGED  338

Query  181  GYYKICRGR-NICGVDSMVSTVAAVNTPT  264
            GYYKICRGR NICG+D+MVSTVAAV+T T
Sbjct  339  GYYKICRGRHNICGMDTMVSTVAAVHTST  367



>ref|XP_003545051.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=367

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYIC K LDHGVL+VGYG   YAPIR K KPYWIIKNSWGESWGE 
Sbjct  279  NAVFMQTYIGGVSCPYICGKHLDHGVLIVGYGEGAYAPIRFKNKPYWIIKNSWGESWGEN  338

Query  181  GYYKICRGRNICGVDSMVSTVAAV  252
            GYYKICRGRN+CGVDSMVSTVAA+
Sbjct  339  GYYKICRGRNVCGVDSMVSTVAAI  362



>ref|XP_002868883.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45142.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE 
Sbjct  279  NAGYMQTYIGGVSCPYICTRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEN  338

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            G+YKIC+GRNICGVDS+VSTV A  + T+
Sbjct  339  GFYKICKGRNICGVDSLVSTVTAAVSTTA  367



>ref|XP_010431862.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score =   159 bits (403),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE 
Sbjct  278  NAAYMQTYIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEN  337

Query  181  GYYKICRGRNICGVDSMVSTVAAV  252
            G+YKIC+GRNICGVDS+VSTV+A 
Sbjct  338  GFYKICKGRNICGVDSLVSTVSAT  361



>ref|XP_006435090.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
 gb|ESR48330.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
Length=369

 Score =   160 bits (404),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC K LDHGVL+VGYGS+G+APIR KEKPYWIIKNSWGE+WGE 
Sbjct  281  NAVWMQTYIGGVSCPYICGKYLDHGVLIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGEN  340

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            GYYKIC GRN+CGVDSMVS+VAA++T +S
Sbjct  341  GYYKICMGRNVCGVDSMVSSVAAIHTTSS  369



>ref|XP_010446443.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score =   159 bits (403),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE 
Sbjct  278  NAAYMQTYIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEN  337

Query  181  GYYKICRGRNICGVDSMVSTVAAV  252
            G+YKIC+GRNICGVDS+VSTV+A 
Sbjct  338  GFYKICKGRNICGVDSLVSTVSAT  361



>ref|XP_010437007.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=368

 Score =   159 bits (403),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE 
Sbjct  279  NAAYMQTYIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEN  338

Query  181  GYYKICRGRNICGVDSMVSTVAAV  252
            G+YKIC+GRNICGVDS+VSTV+A 
Sbjct  339  GFYKICKGRNICGVDSLVSTVSAT  362



>dbj|BAF03553.1| cysteine proteinase CP2 [Phaseolus vulgaris]
Length=365

 Score =   159 bits (403),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+GGVSCPYIC K LDHGVLLVGYG   YAPIR KEKPYWIIKNSWGE+WGE 
Sbjct  277  NAVYMQTYVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGEN  336

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            GYYKICRGRN+CGVDSMVSTV A++  T 
Sbjct  337  GYYKICRGRNVCGVDSMVSTVGAIHASTQ  365



>gb|ACM80348.1| cysteine proteinase [Solanum lycopersicum]
Length=368

 Score =   159 bits (403),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 82/88 (93%), Gaps = 1/88 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSK+LDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE 
Sbjct  282  NAVFMQTYVGGVSCPYICSKQLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGES  340

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPT  264
            GYYKI RGRN+CGVDSMVSTVAAV+T +
Sbjct  341  GYYKIRRGRNVCGVDSMVSTVAAVSTSS  368



>emb|CAA52403.1| putative thiol protease [Arabidopsis thaliana]
Length=313

 Score =   158 bits (400),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYICS+RL+HGVLLVGYGSAG++  RLKEKPYWIIKNSWGESWGE 
Sbjct  228  NAAYMQTYIGGVSCPYICSRRLNHGVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGEN  287

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            G+YKIC+GRNICGVDS+VSTVAA  +
Sbjct  288  GFYKICKGRNICGVDSLVSTVAATTS  313



>ref|XP_009150026.1| PREDICTED: cysteine proteinase RD19a [Brassica rapa]
Length=367

 Score =   159 bits (402),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KE+PYWIIKNSWGE+WGE 
Sbjct  278  NAAYMQTYIGGVSCPYICTRRLNHGVLLVGYGSAGYAPARFKERPYWIIKNSWGETWGEN  337

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            G+YKIC+GRNICGVDS+VSTV A  + T+
Sbjct  338  GFYKICKGRNICGVDSLVSTVTAAVSTTA  366



>ref|XP_006653265.1| PREDICTED: cysteine proteinase 1-like, partial [Oryza brachyantha]
Length=366

 Score =   159 bits (402),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 79/89 (89%), Gaps = 3/89 (3%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYIC K LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE 
Sbjct  274  NAVFMQTYIGGVSCPYICGKHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEN  333

Query  181  GYYKICRG---RNICGVDSMVSTVAAVNT  258
            GYYKICRG   +N CGVDSMVSTV A++T
Sbjct  334  GYYKICRGPHVQNKCGVDSMVSTVTAIHT  362



>dbj|BAD43619.1| putative cysteine proteinase [Arabidopsis thaliana]
Length=361

 Score =   159 bits (402),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYICS+RL+HGVLLVGYGSAG++  RLKEKPYWIIKNSWGESWGE 
Sbjct  276  NAAYMQTYIGGVSCPYICSRRLNHGVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGEN  335

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            G+YKIC+GRNICGVDS+VSTVAA  +
Sbjct  336  GFYKICKGRNICGVDSLVSTVAATTS  361



>emb|CAB53397.1| cysteine protease [Medicago sativa]
Length=209

 Score =   155 bits (391),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 81/87 (93%), Gaps = 1/87 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE  177
            NA +MQTY+ GVSCP+IC+K RLDHGVLLVG+GS GYAPIRLKEKPYWIIKNSWG++WGE
Sbjct  123  NAAWMQTYMSGVSCPHICAKARLDHGVLLVGFGSGGYAPIRLKEKPYWIIKNSWGQNWGE  182

Query  178  KGYYKICRGRNICGVDSMVSTVAAVNT  258
            +GYYKICRGRN+CGVDSMVSTVAA  +
Sbjct  183  EGYYKICRGRNVCGVDSMVSTVAAAQS  209



>ref|NP_565512.1| Papain family cysteine protease [Arabidopsis thaliana]
 sp|P43295.2|A494_ARATH RecName: Full=Probable cysteine proteinase A494; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD23687.1| cysteine proteinase [Arabidopsis thaliana]
 gb|ABJ98563.1| At2g21430 [Arabidopsis thaliana]
 gb|AEC07177.1| Papain family cysteine protease [Arabidopsis thaliana]
Length=361

 Score =   159 bits (401),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYICS+RL+HGVLLVGYGSAG++  RLKEKPYWIIKNSWGESWGE 
Sbjct  276  NAAYMQTYIGGVSCPYICSRRLNHGVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGEN  335

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            G+YKIC+GRNICGVDS+VSTVAA  +
Sbjct  336  GFYKICKGRNICGVDSLVSTVAATTS  361



>dbj|BAA92495.1| cysteine protease [Vigna mungo]
Length=364

 Score =   159 bits (401),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC+KRLDHGV +VGYG +GYAPIR KEKPYWIIKNSWGESWGE 
Sbjct  276  NAVYMQTYIGGVSCPYICAKRLDHGVQIVGYGESGYAPIRFKEKPYWIIKNSWGESWGEN  335

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRG+N CGVDSMVSTV A++ 
Sbjct  336  GYYKICRGQNACGVDSMVSTVGAIHA  361



>ref|XP_010943608.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=371

 Score =   159 bits (401),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYIC + LDHGVLLVGYGSAGYAPIR K+KPYWIIKNSWG +WGE 
Sbjct  285  NAIFMQTYIGGVSCPYICGRHLDHGVLLVGYGSAGYAPIRFKDKPYWIIKNSWGGNWGED  344

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRG+NICGV+SMVSTV AV T
Sbjct  345  GYYKICRGQNICGVESMVSTVTAVRT  370



>ref|XP_009335626.1| PREDICTED: cysteine proteinase 15A [Pyrus x bretschneideri]
Length=366

 Score =   159 bits (401),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYIC KR+DHGVLLVGYGS+G+APIR KEKPYWI+KNSWG+SWGE+
Sbjct  278  NAVFMQTYVGGVSCPYICGKRIDHGVLLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEQ  337

Query  181  GYYKICRGRNICGVDSMVSTVAAVN  255
            GYYKICRG N CGVDS+VSTVAA++
Sbjct  338  GYYKICRGYNSCGVDSLVSTVAALH  362



>gb|ACK57563.1| cysteine protease-like protein [Arachis hypogaea]
Length=364

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCP+IC K LDHGVLLVGYG+ GYAPIR KEKPYWIIKNSWGE+WGE 
Sbjct  276  NAVYMQTYIGGVSCPFICGKHLDHGVLLVGYGAGGYAPIRFKEKPYWIIKNSWGENWGEN  335

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRG N+CGVDSMVSTV A++T
Sbjct  336  GYYKICRGPNMCGVDSMVSTVIAIHT  361



>ref|XP_008221329.1| PREDICTED: cysteine proteinase 15A-like [Prunus mume]
Length=366

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+ GVSCPYIC KR+DHGVLLVGYGS+G+APIR KEKPYWI+KNSWG+SWGE+
Sbjct  278  NALFMQTYVKGVSCPYICGKRIDHGVLLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEE  337

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRG N CGVDS+VSTVA+++T
Sbjct  338  GYYKICRGHNPCGVDSLVSTVASLHT  363



>gb|KJB29611.1| hypothetical protein B456_005G110200 [Gossypium raimondii]
Length=370

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYIC + LDHGVLLVGYG+AGY+PIR K+KP+WIIKNSWG +WGE 
Sbjct  282  NAVFMQTYMGGVSCPYICFRTLDHGVLLVGYGAAGYSPIRFKDKPFWIIKNSWGANWGED  341

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            GYYKICRGRN+CGVDSMVS+VAA++T + 
Sbjct  342  GYYKICRGRNVCGVDSMVSSVAALHTKSQ  370



>ref|XP_002880378.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56637.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYICS+RL+HGVLL+GYGS+GY+  RLKEKPYWIIKNSWGESWGE 
Sbjct  275  NAAYMQTYIGGVSCPYICSRRLNHGVLLMGYGSSGYSQARLKEKPYWIIKNSWGESWGEN  334

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            G+YKIC+GRNICGVDS+VSTVAA  +
Sbjct  335  GFYKICKGRNICGVDSLVSTVAAATS  360



>ref|XP_010440192.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=365

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 80/89 (90%), Gaps = 1/89 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPY+CSK  DHGVLLVG+GSAGYAPIRLKEKPYWIIKNSWG  WGE 
Sbjct  276  NAMWMQTYIGGVSCPYVCSKSQDHGVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEH  335

Query  181  GYYKICRG-RNICGVDSMVSTVAAVNTPT  264
            GYYKICRG  N+CG+DSMVSTVAAV+T T
Sbjct  336  GYYKICRGPHNVCGMDSMVSTVAAVHTTT  364



>ref|XP_011083631.1| PREDICTED: cysteine proteinase 15A-like [Sesamum indicum]
Length=371

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 79/88 (90%), Gaps = 1/88 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC K LDHGVLLVGYG+AGYAPIRLKEKPYWIIKNSWGE+WGE 
Sbjct  283  NAAWMQTYIGGVSCPYICGKHLDHGVLLVGYGAAGYAPIRLKEKPYWIIKNSWGENWGEN  342

Query  181  GYYKICRGRNICGVDSMVSTVAAVN-TP  261
            GYYKICRG N+CGV SMVSTV A + TP
Sbjct  343  GYYKICRGHNVCGVASMVSTVTAAHVTP  370



>ref|XP_007223351.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
 gb|EMJ24550.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
Length=367

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+ GVSCPYIC KR+DHGVLLVGYGS+G+APIR KEKPYWI+KNSWG+SWGE+
Sbjct  279  NAVFMQTYVKGVSCPYICGKRIDHGVLLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEE  338

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            G+YKICRG N CGVDS+VSTVA+++T
Sbjct  339  GFYKICRGHNSCGVDSLVSTVASLHT  364



>gb|AAQ81938.1| cysteine proteinase precursor [Ipomoea batatas]
Length=371

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 81/87 (93%), Gaps = 1/87 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE  177
            N+ FMQTYIGGVSCPYICSK+ LDHGVL+VGYG+AGYAPIR K+KPYWIIKNSWGE+WGE
Sbjct  282  NSIFMQTYIGGVSCPYICSKKNLDHGVLIVGYGAAGYAPIRFKDKPYWIIKNSWGENWGE  341

Query  178  KGYYKICRGRNICGVDSMVSTVAAVNT  258
            +GYYKICRG NICGVDSMVS+V A +T
Sbjct  342  EGYYKICRGNNICGVDSMVSSVTAAST  368



>ref|XP_010449835.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 80/89 (90%), Gaps = 1/89 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPY+CSK  DHGVLLVG+GSAGYAPIRLKEKPYWIIKNSWG  WGE 
Sbjct  276  NAMWMQTYIGGVSCPYVCSKNQDHGVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEH  335

Query  181  GYYKICRG-RNICGVDSMVSTVAAVNTPT  264
            GYYKICRG  N+CG+DSMVSTVAAV+T T
Sbjct  336  GYYKICRGPHNMCGMDSMVSTVAAVHTTT  364



>emb|CAA57675.1| cysteine proteinase [Zea mays]
Length=145

 Score =   151 bits (381),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 80/89 (90%), Gaps = 3/89 (3%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC + LDHGVLLVGYG++G+AP+RLK+KPYWIIKNSWGE+WGE 
Sbjct  54   NAAYMQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPMRLKDKPYWIIKNSWGENWGEN  113

Query  181  GYYKICRG---RNICGVDSMVSTVAAVNT  258
            GYYKICRG   RN CGVDSMVSTV+AV+ 
Sbjct  114  GYYKICRGSNVRNKCGVDSMVSTVSAVHA  142



>ref|XP_002280808.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CBI19783.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQ+Y GGVSCP+ICS  L+HGVLLVGYGSAGY+PIR KEKPYW++KNSWG++WGE 
Sbjct  278  NAIFMQSYAGGVSCPFICSTSLNHGVLLVGYGSAGYSPIRFKEKPYWLLKNSWGQNWGEH  337

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPT  264
            GYYKICRG NICGVDSMVSTVAA+ + T
Sbjct  338  GYYKICRGHNICGVDSMVSTVAAIQSAT  365



>gb|EMT16425.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=379

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 79/89 (89%), Gaps = 3/89 (3%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYIC + LDHGVLLVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE 
Sbjct  287  NAVFMQTYIGGVSCPYICGRHLDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGES  346

Query  181  GYYKICRG---RNICGVDSMVSTVAAVNT  258
            GYYKICRG   +N CGVDSMVSTV A++T
Sbjct  347  GYYKICRGPHVKNKCGVDSMVSTVTAIHT  375



>gb|KHG15062.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=370

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYIC + LDHGVLLVGYG+AGY+PIR K+KP+WIIKNSWG +WGE 
Sbjct  282  NAVFMQTYMGGVSCPYICFRTLDHGVLLVGYGAAGYSPIRFKDKPFWIIKNSWGANWGED  341

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            GYY+ICRGRN+CGVDSMVS+VAA++T + 
Sbjct  342  GYYRICRGRNVCGVDSMVSSVAALHTKSQ  370



>ref|XP_010434865.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 80/89 (90%), Gaps = 1/89 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPY+CSK  DHGVLLVG+GSAGYAPIRLKEKPYWIIKNSWG  WGE 
Sbjct  276  NAMWMQTYIGGVSCPYVCSKSQDHGVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEH  335

Query  181  GYYKICRG-RNICGVDSMVSTVAAVNTPT  264
            GYYKICRG  N+CG+DSMVSTVAAV+T T
Sbjct  336  GYYKICRGPHNMCGMDSMVSTVAAVHTTT  364



>emb|CAB17075.1| cysteine proteinase precursor [Phaseolus vulgaris]
Length=365

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+GGVSCPYIC K LDHGVLLVGYG   YAPIR KEKPYWIIKNSWGE+WG  
Sbjct  277  NAVYMQTYVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGGN  336

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            GYYKICRGRN+CGVDSMVSTV A++  T 
Sbjct  337  GYYKICRGRNVCGVDSMVSTVGAIHASTQ  365



>ref|XP_003579573.2| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=399

 Score =   157 bits (397),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 80/93 (86%), Gaps = 3/93 (3%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCP+IC + LDHGVLLVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE 
Sbjct  307  NAVFMQTYIGGVSCPFICGRHLDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGES  366

Query  181  GYYKICRG---RNICGVDSMVSTVAAVNTPTSD  270
            GYYKICRG   +N CGVDSMVSTV A++T   +
Sbjct  367  GYYKICRGAHVKNKCGVDSMVSTVTAIHTSNKE  399



>ref|XP_002452058.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
 gb|EES05034.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
Length=371

 Score =   156 bits (395),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 80/89 (90%), Gaps = 3/89 (3%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC + LDHGVLLVGYG+AG+APIRLK+KPYWIIKNSWGE+WGE 
Sbjct  280  NAAYMQTYIGGVSCPYICGRTLDHGVLLVGYGAAGFAPIRLKDKPYWIIKNSWGENWGEN  339

Query  181  GYYKICRG---RNICGVDSMVSTVAAVNT  258
            GYYKICRG   RN CGVDSMVSTV+AV T
Sbjct  340  GYYKICRGSNVRNKCGVDSMVSTVSAVRT  368



>gb|KJB58164.1| hypothetical protein B456_009G197400 [Gossypium raimondii]
Length=375

 Score =   157 bits (396),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYI GVSCPYIC K LDHGVLLVGYGSAGYAP+R K KPYWIIKNSWGE+WGE 
Sbjct  282  NAVFMQTYIHGVSCPYICGKHLDHGVLLVGYGSAGYAPVRFKNKPYWIIKNSWGENWGEN  341

Query  181  GYYKICRGRNICGVDSMVSTVAAVN  255
            GYYKICRG N+CGVDSMVS+V+A++
Sbjct  342  GYYKICRGNNVCGVDSMVSSVSALH  366



>gb|EAY93546.1| hypothetical protein OsI_15336 [Oryza sativa Indica Group]
Length=348

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 80/89 (90%), Gaps = 3/89 (3%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCP+IC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEK
Sbjct  255  NAAYMQTYIGGVSCPFICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEK  314

Query  181  GYYKICRG---RNICGVDSMVSTVAAVNT  258
            GYYKICRG   +N CGVDSMVS+V A++T
Sbjct  315  GYYKICRGPHDKNKCGVDSMVSSVTAIHT  343



>emb|CDY09707.1| BnaC07g33540D [Brassica napus]
Length=366

 Score =   156 bits (395),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 79/87 (91%), Gaps = 1/87 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYI GVSCPY+CSK  DHGVLLVG+GSAGYAP+RL+EKPYWIIKNSWG  WGEK
Sbjct  277  NALWMQTYIAGVSCPYVCSKNQDHGVLLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEK  336

Query  181  GYYKICRGR-NICGVDSMVSTVAAVNT  258
            GYYKICRG  NICGVD+MVSTVAAVNT
Sbjct  337  GYYKICRGTPNICGVDTMVSTVAAVNT  363



>emb|CAD40319.2| OSJNBb0054B09.3 [Oryza sativa Japonica Group]
 emb|CAH66180.1| OSIGBa0130O15.4 [Oryza sativa Indica Group]
 emb|CAH66205.1| OSIGBa0148D14.11 [Oryza sativa Indica Group]
Length=381

 Score =   157 bits (396),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 80/89 (90%), Gaps = 3/89 (3%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCP+IC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEK
Sbjct  288  NAAYMQTYIGGVSCPFICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEK  347

Query  181  GYYKICRG---RNICGVDSMVSTVAAVNT  258
            GYYKICRG   +N CGVDSMVS+V A++T
Sbjct  348  GYYKICRGPHDKNKCGVDSMVSSVTAIHT  376



>ref|XP_003589348.1| Cysteine proteinase [Medicago truncatula]
 gb|AES59599.1| papain family cysteine protease [Medicago truncatula]
Length=364

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 80/87 (92%), Gaps = 1/87 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE  177
            NA +MQTY+ GVSCPYIC+K RLDHGVLL+G+G  GYAPIRLKEKPYWIIKNSWG++WGE
Sbjct  278  NAAWMQTYMSGVSCPYICAKARLDHGVLLLGFGQGGYAPIRLKEKPYWIIKNSWGQNWGE  337

Query  178  KGYYKICRGRNICGVDSMVSTVAAVNT  258
            +GYYKICRGRN+CGVDSMVSTVAA  +
Sbjct  338  EGYYKICRGRNVCGVDSMVSTVAAAQS  364



>gb|EEE60725.1| hypothetical protein OsJ_14236 [Oryza sativa Japonica Group]
Length=364

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 80/89 (90%), Gaps = 3/89 (3%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCP+IC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEK
Sbjct  271  NAAYMQTYIGGVSCPFICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEK  330

Query  181  GYYKICRG---RNICGVDSMVSTVAAVNT  258
            GYYKICRG   +N CGVDSMVS+V A++T
Sbjct  331  GYYKICRGPHDKNKCGVDSMVSSVTAIHT  359



>gb|AEX97108.1| cysteine proteinase, partial [Malus domestica]
Length=128

 Score =   149 bits (377),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 1/84 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE  177
            NA FMQTYI GVSCPYICSKR LDHGVLLVGYGSAG+APIR KEKPYWIIKNSWG++WGE
Sbjct  4    NAVFMQTYIKGVSCPYICSKRNLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGQNWGE  63

Query  178  KGYYKICRGRNICGVDSMVSTVAA  249
             GYY IC+GRNICG +SMVS+VAA
Sbjct  64   NGYYLICKGRNICGSESMVSSVAA  87



>emb|CDP07452.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   156 bits (394),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 80/87 (92%), Gaps = 1/87 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYICSK  DHGVLLVGYG+AGYAPIRLK+KPYWIIKNSWGE+WGE 
Sbjct  290  NAIWMQTYIGGVSCPYICSKSQDHGVLLVGYGAAGYAPIRLKDKPYWIIKNSWGENWGEN  349

Query  181  GYYKICRG-RNICGVDSMVSTVAAVNT  258
            GYYK CR  RN+CGVDSMVS+VAAV+T
Sbjct  350  GYYKFCRADRNLCGVDSMVSSVAAVHT  376



>emb|CDX99593.1| BnaC04g33500D [Brassica napus]
Length=343

 Score =   155 bits (392),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+GGVSCPYICSKRL+HGVLLVGYGSAG++  R KEKPYWIIKNSWGE+WGE 
Sbjct  259  NAAYMQTYMGGVSCPYICSKRLNHGVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGEN  318

Query  181  GYYKICRGRNICGVDSMVSTVAAV  252
            G+YK+C+GRN+CGVDSMVSTVAA 
Sbjct  319  GFYKLCKGRNVCGVDSMVSTVAAA  342



>gb|EMS53996.1| Cysteine proteinase 1 [Triticum urartu]
Length=405

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 79/89 (89%), Gaps = 3/89 (3%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYIC + LDHGVLLVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE 
Sbjct  313  NAVFMQTYIGGVSCPYICGRHLDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGES  372

Query  181  GYYKICRG---RNICGVDSMVSTVAAVNT  258
            GYYKICRG   +N CGVDSMVSTV A++T
Sbjct  373  GYYKICRGPHVKNKCGVDSMVSTVTAIHT  401



>ref|XP_006404590.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
 gb|ESQ46043.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
Length=363

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYICS+RL+HGVLLVGYGSAG+A  RLK+KPYWIIKNSWGE+WGE 
Sbjct  279  NAGYMQTYIGGVSCPYICSRRLNHGVLLVGYGSAGFAQARLKKKPYWIIKNSWGETWGEN  338

Query  181  GYYKICRGRNICGVDSMVSTVA  246
            GYYK+CRGRNICGVDS+VSTVA
Sbjct  339  GYYKLCRGRNICGVDSLVSTVA  360



>gb|AAD29084.1|AF082181_1 cysteine proteinase precursor [Solanum melongena]
Length=363

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+ GVSCP IC KR DHGVLLVGYGSAG+APIRLKEKPYWIIKNSWGE+WGE 
Sbjct  273  NAAWMQTYMRGVSCPLICFKRQDHGVLLVGYGSAGFAPIRLKEKPYWIIKNSWGENWGEH  332

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRG NICGVD+MVSTV A +T
Sbjct  333  GYYKICRGHNICGVDAMVSTVTATHT  358



>ref|XP_004952477.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=374

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 80/89 (90%), Gaps = 3/89 (3%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC + LDHGVLLVGYG+AG+APIRLKEKPYWIIKNSWGE+WGE 
Sbjct  282  NAAYMQTYIGGVSCPYICGRHLDHGVLLVGYGAAGFAPIRLKEKPYWIIKNSWGENWGEN  341

Query  181  GYYKICRG---RNICGVDSMVSTVAAVNT  258
            GYYKICRG   RN CGVDSMVSTV+A++ 
Sbjct  342  GYYKICRGSNVRNKCGVDSMVSTVSAIHA  370



>ref|NP_001052440.1| Os04g0311400 [Oryza sativa Japonica Group]
 dbj|BAF14354.1| Os04g0311400, partial [Oryza sativa Japonica Group]
Length=384

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 80/89 (90%), Gaps = 3/89 (3%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCP+IC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEK
Sbjct  291  NAAYMQTYIGGVSCPFICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEK  350

Query  181  GYYKICRG---RNICGVDSMVSTVAAVNT  258
            GYYKICRG   +N CGVDSMVS+V A++T
Sbjct  351  GYYKICRGPHDKNKCGVDSMVSSVTAIHT  379



>emb|CDY15894.1| BnaA04g12170D [Brassica napus]
Length=362

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+GGVSCPYICSKRL+HGVLLVGYGSAG++  R KEKPYWIIKNSWGE+WGE 
Sbjct  278  NAAYMQTYMGGVSCPYICSKRLNHGVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGEN  337

Query  181  GYYKICRGRNICGVDSMVSTVAAV  252
            G+YK+C+GRN+CG+DSMVSTVAA 
Sbjct  338  GFYKLCKGRNVCGIDSMVSTVAAA  361



>ref|XP_009140277.1| PREDICTED: probable cysteine proteinase A494 [Brassica rapa]
Length=362

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+GGVSCPYICSKRL+HGVLLVGYGSAG++  R KEKPYWIIKNSWGE+WGE 
Sbjct  278  NAAYMQTYMGGVSCPYICSKRLNHGVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGEN  337

Query  181  GYYKICRGRNICGVDSMVSTVAAV  252
            G+YK+C+GRN+CG+DSMVSTVAA 
Sbjct  338  GFYKLCKGRNVCGIDSMVSTVAAA  361



>gb|AAB16996.1| thiol protease isoform B, partial [Glycine max]
Length=319

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYIC K LDHGVLLVGYG   YAPIR K KPYWIIKNSWGESWGE 
Sbjct  231  NAVFMQTYVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGEN  290

Query  181  GYYKICRGRNICGVDSMVSTVAAV  252
            GY +ICRGRN+CGVDSMVSTVAA+
Sbjct  291  GYDEICRGRNVCGVDSMVSTVAAI  314



>ref|XP_008444769.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=373

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 79/89 (89%), Gaps = 1/89 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE  177
            NA FMQTY+ GVSCPYICSKR LDHGVLLVGYGSAG+APIR KEKPYWIIKNSWGE+WGE
Sbjct  285  NAVFMQTYMKGVSCPYICSKRNLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGENWGE  344

Query  178  KGYYKICRGRNICGVDSMVSTVAAVNTPT  264
             GYY IC+G+N+CG +SMVS+VAA  TP 
Sbjct  345  NGYYFICKGKNVCGSESMVSSVAAAATPN  373



>ref|XP_010672379.1| PREDICTED: cysteine proteinase RD19a-like [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            +A +MQTYIGGVSCP +C + LDHGV+LVGYGSAGYAPIR KEKPYWIIKNSWG +WG++
Sbjct  286  HAGYMQTYIGGVSCPLVCLRSLDHGVVLVGYGSAGYAPIRFKEKPYWIIKNSWGPNWGDQ  345

Query  181  GYYKICRGRNICGVDSMVSTVAAVN  255
            GYYKICRG N+CGVDSMVSTVAAVN
Sbjct  346  GYYKICRGHNVCGVDSMVSTVAAVN  370



>sp|P25804.1|CYSP_PEA RecName: Full=Cysteine proteinase 15A; AltName: Full=Turgor-responsive 
protein 15A; Flags: Precursor [Pisum sativum]
 emb|CAA38242.1| unnamed protein product [Pisum sativum]
Length=363

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 79/87 (91%), Gaps = 1/87 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE  177
            NA +MQTY+ GVSCPY+C+K RLDHGVLLVG+G   YAPIRLKEKPYWIIKNSWG++WGE
Sbjct  275  NAAWMQTYMSGVSCPYVCAKSRLDHGVLLVGFGKGAYAPIRLKEKPYWIIKNSWGQNWGE  334

Query  178  KGYYKICRGRNICGVDSMVSTVAAVNT  258
            +GYYKICRGRN+CGVDSMVSTVAA  +
Sbjct  335  QGYYKICRGRNVCGVDSMVSTVAAAQS  361



>ref|XP_006283974.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
 gb|EOA16872.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
Length=365

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 80/89 (90%), Gaps = 1/89 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPY+CSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE 
Sbjct  276  NAMWMQTYIGGVSCPYVCSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGSMWGEH  335

Query  181  GYYKICRG-RNICGVDSMVSTVAAVNTPT  264
            GYYKICRG  N+CG+D+MVSTVAAV+T T
Sbjct  336  GYYKICRGPHNMCGMDTMVSTVAAVHTTT  364



>ref|XP_004975256.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=388

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 78/88 (89%), Gaps = 3/88 (3%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYIC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE 
Sbjct  296  NAIFMQTYIGGVSCPYICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEN  355

Query  181  GYYKICRG---RNICGVDSMVSTVAAVN  255
            GYYK+CRG   +N CGVDSMVSTV A++
Sbjct  356  GYYKLCRGPFVKNKCGVDSMVSTVTAIH  383



>gb|AAO11786.1| pre-pro cysteine proteinase [Vicia faba]
Length=363

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 79/87 (91%), Gaps = 1/87 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE  177
            NA +MQTY+ GVSCPY+C+K RLDHGVLLVG+G   YAPIRLKEKPYWI+KNSWG++WGE
Sbjct  275  NAAWMQTYMSGVSCPYVCAKSRLDHGVLLVGFGKGAYAPIRLKEKPYWIVKNSWGQNWGE  334

Query  178  KGYYKICRGRNICGVDSMVSTVAAVNT  258
            +GYYKICRGRN+CGVDSMVSTVAA  +
Sbjct  335  QGYYKICRGRNVCGVDSMVSTVAAAQS  361



>gb|AAB67878.1| pre-pro-cysteine proteinase [Vicia faba]
Length=363

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 79/87 (91%), Gaps = 1/87 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE  177
            NA +MQTY+ GVSCPY+C+K RLDHGVLLVG+G   YAPIRLKEKPYWI+KNSWG++WGE
Sbjct  275  NAAWMQTYMSGVSCPYVCAKSRLDHGVLLVGFGKGAYAPIRLKEKPYWIVKNSWGQNWGE  334

Query  178  KGYYKICRGRNICGVDSMVSTVAAVNT  258
            +GYYKICRGRN+CGVDSMVSTVAA  +
Sbjct  335  QGYYKICRGRNVCGVDSMVSTVAAAQS  361



>ref|XP_009405542.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=366

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+ GVSCPYIC K L+HGVLLVGYGSAGYAP R KEK YWIIKNSWGE+WGE 
Sbjct  281  NAVFMQTYVHGVSCPYICGKHLNHGVLLVGYGSAGYAPARFKEKSYWIIKNSWGENWGEN  340

Query  181  GYYKICRGRNICGVDSMVSTVAAV  252
            GYYKICRGRNICGVDSMVS+V A+
Sbjct  341  GYYKICRGRNICGVDSMVSSVTAI  364



>ref|XP_009136751.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
Length=368

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 79/87 (91%), Gaps = 1/87 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYI GVSCPY+CSK  DHGVLLVG+GSAGYAP+RL+EKPYWIIKNSWG  WGEK
Sbjct  279  NALWMQTYIAGVSCPYVCSKNQDHGVLLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEK  338

Query  181  GYYKICRGR-NICGVDSMVSTVAAVNT  258
            GYYKICRG  NICGVD+MVSTVAAV+T
Sbjct  339  GYYKICRGTPNICGVDTMVSTVAAVHT  365



>ref|XP_006414378.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
 gb|ESQ55831.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
Length=367

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 79/90 (88%), Gaps = 1/90 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPY+CSK  DHGVLLVG+GS+GY+PIRLKEKPYWIIKNSWG  WGE 
Sbjct  278  NALWMQTYIGGVSCPYVCSKSQDHGVLLVGFGSSGYSPIRLKEKPYWIIKNSWGSMWGEH  337

Query  181  GYYKICRG-RNICGVDSMVSTVAAVNTPTS  267
            GYYKICRG  NICG+D+MVSTVAAV T T 
Sbjct  338  GYYKICRGSHNICGMDTMVSTVAAVQTSTQ  367



>emb|CDX90537.1| BnaA03g42440D [Brassica napus]
Length=366

 Score =   154 bits (390),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 79/87 (91%), Gaps = 1/87 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYI GVSCPY+CSK  DHGVLLVG+GSAGYAP+RL+EKPYWIIKNSWG  WGEK
Sbjct  277  NALWMQTYIAGVSCPYVCSKNQDHGVLLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEK  336

Query  181  GYYKICRGR-NICGVDSMVSTVAAVNT  258
            GYYKICRG  NICGVD+MVSTVAAV+T
Sbjct  337  GYYKICRGTPNICGVDTMVSTVAAVHT  363



>gb|ACF86683.1| unknown [Zea mays]
 gb|AFW71402.1| cysteine protease1 [Zea mays]
Length=371

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 80/89 (90%), Gaps = 3/89 (3%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC + LDHGVLLVGYG++G+APIRLK+KPYWIIKNSWGE+WGE 
Sbjct  280  NAAYMQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPIRLKDKPYWIIKNSWGENWGEN  339

Query  181  GYYKICRG---RNICGVDSMVSTVAAVNT  258
            GYYKICRG   RN CGVDSMVSTV+AV+ 
Sbjct  340  GYYKICRGSNVRNKCGVDSMVSTVSAVHA  368



>gb|AGS43121.1| cysteine protease 1, partial [Zea mays]
Length=90

 Score =   146 bits (368),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 78/86 (91%), Gaps = 3/86 (3%)
 Frame = +1

Query  10   FMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYY  189
            +MQTYIGGVSCPYIC + LDHGVLLVGYG++G+APIRLK+KPYWIIKNSWGE+WGE GYY
Sbjct  2    YMQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENGYY  61

Query  190  KICRG---RNICGVDSMVSTVAAVNT  258
            KICRG   RN CGVDSMVSTV+AV+ 
Sbjct  62   KICRGSNVRNKCGVDSMVSTVSAVHA  87



>ref|NP_001105685.1| cysteine proteinase 1 precursor [Zea mays]
 sp|Q10716.1|CYSP1_MAIZE RecName: Full=Cysteine proteinase 1; Flags: Precursor [Zea mays]
 dbj|BAA08244.1| cysteine proteinase [Zea mays]
Length=371

 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 80/89 (90%), Gaps = 3/89 (3%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC + LDHGVLLVGYG++G+APIRLK+KPYWIIKNSWGE+WGE 
Sbjct  280  NAAYMQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPIRLKDKPYWIIKNSWGENWGEN  339

Query  181  GYYKICRG---RNICGVDSMVSTVAAVNT  258
            GYYKICRG   RN CGVDSMVSTV+AV+ 
Sbjct  340  GYYKICRGSNVRNKCGVDSMVSTVSAVHA  368



>ref|XP_009611293.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana tomentosiformis]
 emb|CAB44983.1| putative preprocysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE 
Sbjct  273  NAAWMQTYVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEH  332

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRG NICGVD+MVSTV A +T
Sbjct  333  GYYKICRGHNICGVDAMVSTVTAAHT  358



>gb|AAK07731.1| CPR2-like cysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE 
Sbjct  273  NAAWMQTYVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEH  332

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRG NICGVD+MVSTV A +T
Sbjct  333  GYYKICRGHNICGVDAMVSTVTAAHT  358



>emb|CAA78365.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=365

 Score =   154 bits (388),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE 
Sbjct  275  NAAWMQTYVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEH  334

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRG NICGVD+MVSTV A +T
Sbjct  335  GYYKICRGHNICGVDAMVSTVTAAHT  360



>ref|XP_003574963.1| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=377

 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 79/89 (89%), Gaps = 3/89 (3%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC + LDHGVLLVGYG++G+AP RLK KPYW+IKNSWGE+WGEK
Sbjct  285  NAAYMQTYIGGVSCPYICGRSLDHGVLLVGYGASGFAPSRLKNKPYWVIKNSWGENWGEK  344

Query  181  GYYKICRG---RNICGVDSMVSTVAAVNT  258
            GYYKICRG   RN CGVDSMVSTVAA +T
Sbjct  345  GYYKICRGSNVRNKCGVDSMVSTVAAAHT  373



>emb|CAA78361.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   154 bits (388),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE 
Sbjct  273  NAAWMQTYVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEH  332

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRG NICGVD+MVSTV A +T
Sbjct  333  GYYKICRGHNICGVDAMVSTVTAAHT  358



>gb|AJA74415.1| cysteine protease [Cicer arietinum]
Length=358

 Score =   154 bits (388),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 82/86 (95%), Gaps = 2/86 (2%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE  177
            NA +MQTY+ GVSCPYIC+K RLDHGVLLVG+G+ G+APIRLKEKPYWIIKNSWG++WGE
Sbjct  270  NAAWMQTYMSGVSCPYICAKSRLDHGVLLVGFGN-GFAPIRLKEKPYWIIKNSWGQNWGE  328

Query  178  KGYYKICRGRNICGVDSMVSTVAAVN  255
            +GYYKICRGRNICGVDSMVSTVAAV+
Sbjct  329  EGYYKICRGRNICGVDSMVSTVAAVH  354



>ref|NP_001266121.1| uncharacterized protein LOC101501911 precursor [Cicer arietinum]
 emb|CAA08906.1| cysteine proteinase [Cicer arietinum]
Length=362

 Score =   154 bits (388),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 82/86 (95%), Gaps = 2/86 (2%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE  177
            NA +MQTY+ GVSCPYIC+K RLDHGVLLVG+G+ G+APIRLKEKPYWIIKNSWG++WGE
Sbjct  274  NAAWMQTYMSGVSCPYICAKSRLDHGVLLVGFGN-GFAPIRLKEKPYWIIKNSWGQNWGE  332

Query  178  KGYYKICRGRNICGVDSMVSTVAAVN  255
            +GYYKICRGRNICGVDSMVSTVAAV+
Sbjct  333  EGYYKICRGRNICGVDSMVSTVAAVH  358



>emb|CAH59428.1| cysteine protease 2 [Plantago major]
Length=245

 Score =   150 bits (380),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 79/89 (89%), Gaps = 1/89 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC K LDHGVL+VGYG+ GYAP+RLK KPYWIIKNSWGESWGE 
Sbjct  158  NAAWMQTYIGGVSCPYICGKSLDHGVLIVGYGT-GYAPVRLKNKPYWIIKNSWGESWGES  216

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            GYYKICRGRN+CGV+SMVS+V A +  T+
Sbjct  217  GYYKICRGRNVCGVESMVSSVTAAHFTTT  245



>ref|XP_009776238.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana sylvestris]
Length=365

 Score =   154 bits (388),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE 
Sbjct  275  NAAWMQTYVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEH  334

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRG NICGVD+MVSTV A +T
Sbjct  335  GYYKICRGHNICGVDAMVSTVTAAHT  360



>gb|ABK24153.1| unknown [Picea sitchensis]
Length=394

 Score =   154 bits (389),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 79/91 (87%), Gaps = 1/91 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE  177
            NA FMQTY+GGVSCPY+C+K+ LDHGVLLVGYG+AGYAP RLK KP+WIIKNSWG  WGE
Sbjct  303  NAAFMQTYVGGVSCPYVCNKQNLDHGVLLVGYGAAGYAPGRLKNKPFWIIKNSWGPDWGE  362

Query  178  KGYYKICRGRNICGVDSMVSTVAAVNTPTSD  270
             GYYK+CRG N+CG+++MVSTVAA N  T D
Sbjct  363  DGYYKLCRGHNVCGINTMVSTVAAANIQTDD  393



>gb|KFK24413.1| hypothetical protein AALP_AAs58848U000200 [Arabis alpina]
Length=372

 Score =   153 bits (387),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 80/89 (90%), Gaps = 2/89 (2%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPY+CSK  DHGVLLVG+G +GYAPIRLKEKPYWIIKNSWG+ WGE 
Sbjct  283  NAMWMQTYIGGVSCPYVCSKSQDHGVLLVGFGESGYAPIRLKEKPYWIIKNSWGKMWGEH  342

Query  181  GYYKICRGR-NICGVDSMVSTVAAVN-TP  261
            GYYKICRGR NICG+D+MVSTVAAV  TP
Sbjct  343  GYYKICRGRHNICGMDTMVSTVAAVQITP  371



>emb|CAA82995.1| cysteine proteinase [Vicia sativa]
Length=358

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 78/87 (90%), Gaps = 1/87 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE  177
            NA +MQ Y+ GVSCPY+C+K RLDHGVLLVG+G   YAPIRLKEKPYWIIKNSWG++WGE
Sbjct  270  NAAWMQAYMSGVSCPYVCAKARLDHGVLLVGFGKGAYAPIRLKEKPYWIIKNSWGQNWGE  329

Query  178  KGYYKICRGRNICGVDSMVSTVAAVNT  258
            +GYYKICRGRN+CGVDSMVSTVAA  +
Sbjct  330  QGYYKICRGRNVCGVDSMVSTVAAAQS  356



>ref|XP_002870174.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46433.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
Length=373

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 79/87 (91%), Gaps = 1/87 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPY+CSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE 
Sbjct  284  NAMWMQTYIGGVSCPYVCSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGAMWGEH  343

Query  181  GYYKICRG-RNICGVDSMVSTVAAVNT  258
            GYYKICRG  N+CG+D+MVSTVAAV+T
Sbjct  344  GYYKICRGPHNMCGMDTMVSTVAAVHT  370



>ref|NP_567489.1| papain family cysteine protease [Arabidopsis thaliana]
 emb|CAB10398.1| cysteine proteinase like protein [Arabidopsis thaliana]
 emb|CAB78661.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AAK62611.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM91059.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM96982.1| cysteine proteinase [Arabidopsis thaliana]
 gb|AAN31875.1| putative cysteine proteinase [Arabidopsis thaliana]
 dbj|BAE98514.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AEE83713.1| papain family cysteine protease [Arabidopsis thaliana]
Length=373

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 79/87 (91%), Gaps = 1/87 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPY+CSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE 
Sbjct  284  NAMWMQTYIGGVSCPYVCSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGAMWGEH  343

Query  181  GYYKICRG-RNICGVDSMVSTVAAVNT  258
            GYYKICRG  N+CG+D+MVSTVAAV+T
Sbjct  344  GYYKICRGPHNMCGMDTMVSTVAAVHT  370



>ref|XP_003607110.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89307.1| papain family cysteine protease [Medicago truncatula]
Length=331

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+GG+SCPYIC++RLD GVLLVGYGS   A ++ KEKPYWI+KNSWGE+WGE 
Sbjct  243  NAVYMQTYVGGISCPYICTRRLDLGVLLVGYGSGAGADMKEKEKPYWIVKNSWGETWGEN  302

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            GYYKICRGRNICGVDSMVSTVAA +T T 
Sbjct  303  GYYKICRGRNICGVDSMVSTVAAAHTTTQ  331



>ref|NP_001046828.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAD19579.1| putative cysteine proteinase 1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF08742.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAG92750.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93804.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94031.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83204.1| hypothetical protein OsI_28465 [Oryza sativa Indica Group]
 gb|EEE56967.1| hypothetical protein OsJ_06681 [Oryza sativa Japonica Group]
Length=373

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 80/89 (90%), Gaps = 3/89 (3%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC + LDHGVLLVGYG++G+APIRLK+K YWIIKNSWGE+WGE 
Sbjct  282  NAAYMQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPIRLKDKAYWIIKNSWGENWGEH  341

Query  181  GYYKICRG---RNICGVDSMVSTVAAVNT  258
            GYYKICRG   RN CGVDSMVSTV+A++T
Sbjct  342  GYYKICRGSNVRNKCGVDSMVSTVSAIHT  370



>gb|KEH30505.1| papain family cysteine protease [Medicago truncatula]
Length=330

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+GG+SCPYIC++RLD GVLLVGYGS   A ++ KEKPYWI+KNSWGE+WGE 
Sbjct  242  NAVYMQTYVGGISCPYICTRRLDLGVLLVGYGSGAGADMKEKEKPYWIVKNSWGETWGEN  301

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            GYYKICRGRNICGVDSMVSTVAA +T T 
Sbjct  302  GYYKICRGRNICGVDSMVSTVAAAHTNTQ  330



>ref|XP_004152668.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004167370.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN62647.1| Cysteine protease [Cucumis sativus]
Length=371

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 79/85 (93%), Gaps = 1/85 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE  177
            NA FMQTY+ G+SCPYICSKR LDHGVLLVGYG+AG+APIRLKEKPYWIIKNSWGE+WGE
Sbjct  285  NAVFMQTYMKGISCPYICSKRNLDHGVLLVGYGAAGFAPIRLKEKPYWIIKNSWGENWGE  344

Query  178  KGYYKICRGRNICGVDSMVSTVAAV  252
             GYY IC+G+NICG +SMVS+VAA+
Sbjct  345  NGYYFICKGKNICGSESMVSSVAAI  369



>gb|EMS64962.1| Cysteine proteinase 1 [Triticum urartu]
Length=302

 Score =   150 bits (380),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 78/89 (88%), Gaps = 3/89 (3%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC + LDHGVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+K
Sbjct  210  NAAYMQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDK  269

Query  181  GYYKICRG---RNICGVDSMVSTVAAVNT  258
            GYYKICRG   RN CGVDSMVSTV+A + 
Sbjct  270  GYYKICRGSNVRNKCGVDSMVSTVSATHA  298



>gb|ABK21238.1| unknown [Picea sitchensis]
 gb|ABR16087.1| unknown [Picea sitchensis]
 gb|ABR17330.1| unknown [Picea sitchensis]
 gb|ABR17545.1| unknown [Picea sitchensis]
 gb|ACN40765.1| unknown [Picea sitchensis]
Length=366

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 79/85 (93%), Gaps = 1/85 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE  177
            NA FMQTY+GGVSCPY+CSKR LDHGVLLVGYG+A +APIR+K+KPYW+IKNSWG +WGE
Sbjct  282  NAAFMQTYVGGVSCPYVCSKRNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGE  341

Query  178  KGYYKICRGRNICGVDSMVSTVAAV  252
             GYYK+CRG N+CG+++MVSTVAA+
Sbjct  342  NGYYKLCRGHNVCGINNMVSTVAAI  366



>gb|ABK24688.1| unknown [Picea sitchensis]
 gb|ACN39791.1| unknown [Picea sitchensis]
 gb|ACN40241.1| unknown [Picea sitchensis]
Length=366

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 79/85 (93%), Gaps = 1/85 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE  177
            NA FMQTY+GGVSCPY+CSKR LDHGVLLVGYG+A +APIR+K+KPYW+IKNSWG +WGE
Sbjct  282  NAAFMQTYVGGVSCPYVCSKRNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGE  341

Query  178  KGYYKICRGRNICGVDSMVSTVAAV  252
             GYYK+CRG N+CG+++MVSTVAA+
Sbjct  342  NGYYKLCRGHNVCGINNMVSTVAAI  366



>gb|ACN40679.1| unknown [Picea sitchensis]
Length=366

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 79/85 (93%), Gaps = 1/85 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE  177
            NA FMQTY+GGVSCPY+CSKR LDHGVLLVGYG+A +APIR+K+KPYW+IKNSWG +WGE
Sbjct  282  NAAFMQTYVGGVSCPYVCSKRNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGE  341

Query  178  KGYYKICRGRNICGVDSMVSTVAAV  252
             GYYK+CRG N+CG+++MVSTVAA+
Sbjct  342  NGYYKLCRGHNVCGINNMVSTVAAI  366



>tpe|CAD66657.1| TPA: putative cysteine proteinase precursor [Hordeum vulgare 
subsp. vulgare]
 dbj|BAJ94057.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   152 bits (383),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 79/89 (89%), Gaps = 3/89 (3%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC + LDHGVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+K
Sbjct  285  NAAYMQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDK  344

Query  181  GYYKICRG---RNICGVDSMVSTVAAVNT  258
            GYYKICRG   RN CGVDSMVSTV+A ++
Sbjct  345  GYYKICRGSNVRNKCGVDSMVSTVSATHS  373



>gb|EYU27644.1| hypothetical protein MIMGU_mgv1a008452mg [Erythranthe guttata]
Length=373

 Score =   152 bits (383),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 82/90 (91%), Gaps = 1/90 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE  177
            NA +MQTYIGGVSCPY+C KR LDHGVLLVGYG+AGY+ IRLK KPYWI+KNSWGESWGE
Sbjct  284  NAAWMQTYIGGVSCPYVCGKRNLDHGVLLVGYGAAGYSTIRLKNKPYWIVKNSWGESWGE  343

Query  178  KGYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            +GYYKIC+G N+CGV+SMVS+V A++T ++
Sbjct  344  EGYYKICKGHNVCGVESMVSSVNAIHTTSA  373



>ref|XP_004238314.1| PREDICTED: cysteine proteinase 15A [Solanum lycopersicum]
Length=363

 Score =   151 bits (381),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+ GVSCP IC KR DHGVLLVGYGS G+APIRLK KPYWIIKNSWG++WGE 
Sbjct  273  NAAWMQTYVRGVSCPLICFKRQDHGVLLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEH  332

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRG NICGVD+MVSTV A +T
Sbjct  333  GYYKICRGHNICGVDAMVSTVTATHT  358



>gb|EMT10192.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=369

 Score =   151 bits (381),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 78/89 (88%), Gaps = 3/89 (3%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC + LDHGVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+K
Sbjct  277  NAAYMQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDK  336

Query  181  GYYKICRG---RNICGVDSMVSTVAAVNT  258
            GYYKICRG   RN CGVDSMVSTV+A + 
Sbjct  337  GYYKICRGSNVRNKCGVDSMVSTVSATHA  365



>gb|AAW21813.1| cysteine protease [Triticum aestivum]
Length=377

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 78/89 (88%), Gaps = 3/89 (3%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTYIGGVSCPYIC + LDHGVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+K
Sbjct  285  NAAYMQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDK  344

Query  181  GYYKICRG---RNICGVDSMVSTVAAVNT  258
            GYYKICRG   RN CGVDSMVSTV+A + 
Sbjct  345  GYYKICRGSNVRNKCGVDSMVSTVSATHA  373



>ref|XP_006341997.1| PREDICTED: cysteine proteinase 15A-like [Solanum tuberosum]
Length=376

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+ GVSCP IC KR DHGVLLVGYGS G+APIRLK KPYWIIKNSWG++WGE 
Sbjct  286  NAAWMQTYVRGVSCPLICLKRQDHGVLLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEH  345

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRG NICGVD+MVSTV A +T
Sbjct  346  GYYKICRGHNICGVDAMVSTVTATHT  371



>gb|AES89347.2| papain family cysteine protease [Medicago truncatula]
Length=327

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 75/88 (85%), Gaps = 4/88 (5%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+GGVSCPY C++RLDHGVLLVGYGS  Y     KEKPYWI+K+SWGE+WGE 
Sbjct  243  NAAYMQTYVGGVSCPYTCTRRLDHGVLLVGYGSGAYT----KEKPYWIVKSSWGETWGEN  298

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPT  264
            GYYKICRGRNICGVDSMVSTVAA  T T
Sbjct  299  GYYKICRGRNICGVDSMVSTVAAAQTTT  326



>ref|XP_003607150.1| Cysteine proteinase [Medicago truncatula]
Length=326

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 75/88 (85%), Gaps = 4/88 (5%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+GGVSCPY C++RLDHGVLLVGYGS  Y     KEKPYWI+K+SWGE+WGE 
Sbjct  242  NAAYMQTYVGGVSCPYTCTRRLDHGVLLVGYGSGAYT----KEKPYWIVKSSWGETWGEN  297

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPT  264
            GYYKICRGRNICGVDSMVSTVAA  T T
Sbjct  298  GYYKICRGRNICGVDSMVSTVAAAQTTT  325



>gb|ADY04293.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04297.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   144 bits (363),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+RLKEKPYWIIKNSWG+ WGE+
Sbjct  72   NAVFMQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRLKEKPYWIIKNSWGDKWGEE  131

Query  181  GYYKICRGRNICG  219
            G+YKICRGRNICG
Sbjct  132  GFYKICRGRNICG  144



>gb|AAB16997.1| thiol protease isoform A, partial [Glycine max]
Length=318

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 74/85 (87%), Gaps = 1/85 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYIC K LDHGVLLVGYG   YAPIR K KPYWIIKNSWGESWGE 
Sbjct  229  NAVFMQTYVGGVSCPYICGKHLDHGVLLVGYGEGRYAPIRFKNKPYWIIKNSWGESWGEN  288

Query  181  -GYYKICRGRNICGVDSMVSTVAAV  252
             GY +ICRGRN+CGVD+MVSTVAA+
Sbjct  289  DGYDEICRGRNVCGVDAMVSTVAAI  313



>gb|ADY04361.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   143 bits (361),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+
Sbjct  72   NAVFMQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEE  131

Query  181  GYYKICRGRNICG  219
            G+YKICRGRNICG
Sbjct  132  GFYKICRGRNICG  144



>ref|XP_009786000.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana sylvestris]
Length=370

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 73/77 (95%), Gaps = 1/77 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSK+LDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE 
Sbjct  283  NAVFMQTYVGGVSCPYICSKKLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGEN  341

Query  181  GYYKICRGRNICGVDSM  231
            GYYKICRGRN+CGVDSM
Sbjct  342  GYYKICRGRNVCGVDSM  358



>emb|CAQ00101.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=381

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 77/89 (87%), Gaps = 4/89 (4%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTYIGGVSCPYIC + LDH V LVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE 
Sbjct  290  NAVFMQTYIGGVSCPYICGRHLDH-VFLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGES  348

Query  181  GYYKICRG---RNICGVDSMVSTVAAVNT  258
            GYYKICRG   +N CGVDSMVSTV A++T
Sbjct  349  GYYKICRGPHVKNKCGVDSMVSTVTAIHT  377



>emb|CAA78403.1| pre-pro-cysteine proteinase [Solanum lycopersicum]
Length=361

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+ GVSCP IC KR DHGVLLVGYGS G+APIRLK KPYWIIKNSWG++WGE 
Sbjct  271  NAAWMQTYVRGVSCPLICFKRQDHGVLLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEH  330

Query  181  GYYKICRGRNICGVDSMVSTVAAVNT  258
            GYYKICRG +ICGVD+MVSTV A +T
Sbjct  331  GYYKICRGHHICGVDAMVSTVTATHT  356



>gb|ADY04342.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   143 bits (361),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+
Sbjct  72   NAVFMQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEE  131

Query  181  GYYKICRGRNICG  219
            G+YKICRGRNICG
Sbjct  132  GFYKICRGRNICG  144



>gb|ADY04336.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04343.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   143 bits (361),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+
Sbjct  72   NAVFMQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEE  131

Query  181  GYYKICRGRNICG  219
            G+YKICRGRNICG
Sbjct  132  GFYKICRGRNICG  144



>gb|ADY04262.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04263.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04264.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04265.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04266.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04267.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04269.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04270.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04271.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04272.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04273.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04274.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04275.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04276.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04277.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04278.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04279.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04280.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04281.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04282.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04283.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04284.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04285.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04286.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04287.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04288.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04289.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04290.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04291.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04292.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04294.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04296.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04298.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04299.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04300.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04301.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04302.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04303.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04304.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04305.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04306.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04307.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04308.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04309.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04310.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04311.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04312.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04313.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04314.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04315.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04316.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04317.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04318.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04319.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04320.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04321.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04322.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04323.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04324.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04325.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04326.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04327.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04328.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04329.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04330.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04331.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04332.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04333.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04334.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04335.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04337.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04338.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04339.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04340.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04341.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04344.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04345.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04346.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04347.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04348.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04349.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04350.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04351.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04352.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04353.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04354.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04355.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04356.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04357.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04360.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04362.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04363.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04364.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04365.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04366.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04367.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04369.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04370.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04371.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04372.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04373.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04374.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04377.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04378.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04379.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04380.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04381.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04382.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04383.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04384.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04385.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04386.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04387.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04388.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04389.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04391.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04392.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04393.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04394.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04395.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04396.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04397.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04398.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04399.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04400.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04401.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04402.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04403.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04404.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04405.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04406.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04407.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04408.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04409.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04410.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04411.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04412.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04413.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04415.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04416.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04417.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04418.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04419.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04420.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04421.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04422.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04423.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04424.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04425.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04426.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04427.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04428.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04429.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04430.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04431.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04432.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04433.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04434.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04435.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04436.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04437.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04438.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04439.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04440.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04441.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04442.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04443.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04444.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04445.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04446.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04447.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04448.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04449.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04450.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04451.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04452.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04453.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04454.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04455.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04456.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04458.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04459.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04460.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04461.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04462.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04463.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04464.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04465.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04466.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04467.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04468.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04469.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04470.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04471.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04472.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04473.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04474.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04475.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04476.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04478.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04481.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04483.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04484.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04485.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04486.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04487.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04488.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04489.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04491.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04493.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04501.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04502.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04503.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04504.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04505.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04506.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04507.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04508.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04509.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04510.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04511.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04512.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04513.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04514.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04515.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04516.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04517.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04518.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   143 bits (361),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+
Sbjct  72   NAVFMQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEE  131

Query  181  GYYKICRGRNICG  219
            G+YKICRGRNICG
Sbjct  132  GFYKICRGRNICG  144



>gb|ADY04414.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   143 bits (361),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+
Sbjct  72   NAVFMQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEE  131

Query  181  GYYKICRGRNICG  219
            G+YKICRGRNICG
Sbjct  132  GFYKICRGRNICG  144



>gb|ADY04457.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   143 bits (361),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+
Sbjct  72   NAVFMQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEE  131

Query  181  GYYKICRGRNICG  219
            G+YKICRGRNICG
Sbjct  132  GFYKICRGRNICG  144



>dbj|BAG16515.1| putative cysteine proteinase [Capsicum chinense]
Length=367

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            N+ +MQTYIGGVSCP +C K  DHGVLLVGYGSAG+APIRLK KPYWIIKNSWGE WGE 
Sbjct  276  NSAWMQTYIGGVSCPLVCFKHQDHGVLLVGYGSAGFAPIRLKAKPYWIIKNSWGEHWGEH  335

Query  181  GYYKICRGR-NICGVDSMVSTVAAVNT  258
            GYYKICRG+ NICGVD+MVSTV A +T
Sbjct  336  GYYKICRGQHNICGVDAMVSTVTAAHT  362



>gb|ADY04359.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   143 bits (360),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+
Sbjct  72   NAVFMQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDRWGEE  131

Query  181  GYYKICRGRNICG  219
            G+YKICRGRNICG
Sbjct  132  GFYKICRGRNICG  144



>gb|AAZ32411.1| cysteine proteinase glycinain type [Nicotiana benthamiana]
Length=355

 Score =   149 bits (375),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA +MQTY+GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE 
Sbjct  275  NAAWMQTYVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEH  334

Query  181  GYYKICRGRNICGVDSMVSTV  243
            GYYKICRG NICGVD+MVSTV
Sbjct  335  GYYKICRGHNICGVDAMVSTV  355



>gb|ADY04482.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   143 bits (360),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+
Sbjct  72   NAVFMQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRVKEKPYWIIKNSWGDKWGEE  131

Query  181  GYYKICRGRNICG  219
            G+YKICRGRNICG
Sbjct  132  GFYKICRGRNICG  144



>gb|ADY04358.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   142 bits (359),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKRLDHGVLLVGYG++GY+P+R+KEKPYWIIKNSWG+ WGE+
Sbjct  72   NAVFMQTYMGGVSCPYICSKRLDHGVLLVGYGTSGYSPVRMKEKPYWIIKNSWGDKWGEE  131

Query  181  GYYKICRGRNICG  219
            G+YKICRGRNICG
Sbjct  132  GFYKICRGRNICG  144



>ref|XP_002279862.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI19784.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   148 bits (374),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY  GVSCP++CS  LDHGVLLVGYGSAGY+PIR KEKPYWI+KNSW + WGE 
Sbjct  279  NAVFMQTYTAGVSCPFLCSGELDHGVLLVGYGSAGYSPIRFKEKPYWILKNSWSKYWGEH  338

Query  181  GYYKICRGRNICGVDSMVSTVAAVNTPTS  267
            GYY+ICRG+N+CGVDSMVS+V A    TS
Sbjct  339  GYYRICRGQNMCGVDSMVSSVVAAIQTTS  367



>gb|ADY04368.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04375.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04376.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04390.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04477.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04479.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   142 bits (358),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG  WGE+
Sbjct  72   NAVFMQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGNKWGEE  131

Query  181  GYYKICRGRNICG  219
            G+YKICRGRNICG
Sbjct  132  GFYKICRGRNICG  144



>gb|ADY04480.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   142 bits (358),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+++KEKPYWIIKNSWG+ WGE+
Sbjct  72   NAVFMQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVKMKEKPYWIIKNSWGDKWGEE  131

Query  181  GYYKICRGRNICG  219
            G+YKICRGRNICG
Sbjct  132  GFYKICRGRNICG  144



>gb|ADY04268.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   142 bits (357),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKP+WIIKNSWG+ WGE+
Sbjct  72   NAVFMQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPHWIIKNSWGDKWGEE  131

Query  181  GYYKICRGRNICG  219
            G+YKICRGRNICG
Sbjct  132  GFYKICRGRNICG  144



>dbj|BAD10859.1| cysteine protease [Aster tripolium]
Length=363

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE  177
            NA +MQTYIG VSCPYICSK ++DHGVLLVGYGSAGYAP+R KEKPYWIIKNSWGE WGE
Sbjct  277  NAAWMQTYIGQVSCPYICSKTKMDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGEDWGE  336

Query  178  KGYYKICRGRNICGVDSMVSTVAAVNT  258
             GYYK+C G N CG+D+MVS V + NT
Sbjct  337  DGYYKLCSGYNACGMDTMVSAVVSTNT  363



>gb|ADY04295.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   141 bits (355),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK  180
            NA FMQTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+ +KEKPYWIIKNSWG+ WGE+
Sbjct  72   NAVFMQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVSMKEKPYWIIKNSWGDKWGEE  131

Query  181  GYYKICRGRNICG  219
            G+YKICRGRNICG
Sbjct  132  GFYKICRGRNICG  144



>dbj|BAC57957.1| thiol protease [Aster tripolium]
Length=188

 Score =   142 bits (358),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE  177
            NA +MQTYIG VSCPY+CSK+ LDHGVLLVGYGSAGYAP RLKEKPYWIIKNSWG  WGE
Sbjct  102  NAAWMQTYIGKVSCPYVCSKKPLDHGVLLVGYGSAGYAPSRLKEKPYWIIKNSWGPDWGE  161

Query  178  KGYYKICRGRNICGVDSMVSTVAAVNT  258
             GYYKIC G N+CG+D+MVS V + + 
Sbjct  162  DGYYKICSGHNLCGMDTMVSAVVSTSA  188



>gb|EPS70818.1| cysteine proteinase, partial [Genlisea aurea]
Length=355

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 78/87 (90%), Gaps = 1/87 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE  177
            NA +MQTYI GVSCP +C K  LDHGVL+VGYGS+GYAPIRLK KPYWI+KNSWG++WGE
Sbjct  269  NAAWMQTYIRGVSCPLVCGKSNLDHGVLMVGYGSSGYAPIRLKNKPYWIVKNSWGKNWGE  328

Query  178  KGYYKICRGRNICGVDSMVSTVAAVNT  258
            KGYYKICRG NICGV+SMVSTV A+++
Sbjct  329  KGYYKICRGSNICGVESMVSTVTAIHS  355



>gb|AAB53103.1| cysteine protease, partial [Brassica napus]
Length=85

 Score =   138 bits (347),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 71/79 (90%), Gaps = 1/79 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVS-CPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE  177
            NA +MQTYIGGVS CPYIC +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE
Sbjct  7    NAAYMQTYIGGVSACPYICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGE  66

Query  178  KGYYKICRGRNICGVDSMV  234
             G+YKICRGRN+CGVD  V
Sbjct  67   NGFYKICRGRNVCGVDMSV  85



>gb|EPS65881.1| cysteine proteinase, partial [Genlisea aurea]
Length=335

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 77/84 (92%), Gaps = 1/84 (1%)
 Frame = +1

Query  1    NAEFMQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE  177
            NA +MQTY+ GVSCP IC K RLDHG+L+VGYG++GYAPIRLKEKPYWI+KNSWGE+WGE
Sbjct  252  NAAWMQTYVHGVSCPLICMKTRLDHGILIVGYGASGYAPIRLKEKPYWIVKNSWGENWGE  311

Query  178  KGYYKICRGRNICGVDSMVSTVAA  249
            +GYYKIC+G N+CGV+S+VSTV A
Sbjct  312  QGYYKICKGHNVCGVESLVSTVTA  335



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557830460880