BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP010F10 400 bp,:Filtered

Length=400
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAK27969.1|AF242373_1  cysteine protease                             153   7e-42   Ipomoea batatas [batate]
gb|AAF61440.1|AF138264_1  papain-like cysteine proteinase isoform I     152   1e-41   Ipomoea batatas [batate]
gb|AAF40415.1|AF216784_1  papain-like cysteine proteinase isoform II    152   1e-41   Ipomoea batatas [batate]
gb|AAF40414.1|AF216783_1  papain-like cysteine proteinase isoform I     152   1e-41   Ipomoea batatas [batate]
gb|AAF61441.1|AF138265_1  papain-like cysteine proteinase isoform II    152   1e-41   Ipomoea batatas [batate]
gb|AAF40416.1|AF216785_1  papain-like cysteine proteinase isoform...    152   1e-41   Ipomoea batatas [batate]
gb|KDP41743.1|  hypothetical protein JCGZ_26761                         147   8e-40   Jatropha curcas
sp|P05993.1|PAPA5_CARPA  RecName: Full=Cysteine proteinase; AltNa...    139   1e-39   Carica papaya [mamon]
ref|XP_002512963.1|  cysteine protease, putative                        147   1e-39   Ricinus communis
gb|KHG24064.1|  Cysteinease RD19a -like protein                         146   3e-39   Gossypium arboreum [tree cotton]
gb|AIB06024.1|  CP2                                                     146   4e-39   Hevea brasiliensis [jebe]
ref|XP_007042077.1|  Papain family cysteine protease                    146   4e-39   Theobroma cacao [chocolate]
gb|AAX19661.1|  cysteine proteinase                                     145   5e-39   Populus tomentosa [Chinese white poplar]
gb|KJB32561.1|  hypothetical protein B456_005G247000                    145   5e-39   Gossypium raimondii
gb|ABQ10201.1|  cysteine protease Cp3                                   145   6e-39   Actinidia deliciosa [Chinese gooseberry]
ref|XP_011047717.1|  PREDICTED: cysteine proteinase RD19a               145   6e-39   Populus euphratica
gb|ABK96252.1|  unknown                                                 139   8e-39   Populus trichocarpa x Populus deltoides
gb|KJB79047.1|  hypothetical protein B456_013G033800                    144   1e-38   Gossypium raimondii
emb|CAE54306.1|  putative papain-like cysteine proteinase               144   1e-38   Gossypium hirsutum [American cotton]
emb|CDP20652.1|  unnamed protein product                                144   1e-38   Coffea canephora [robusta coffee]
gb|KHG15253.1|  Cysteinease RD19a -like protein                         144   2e-38   Gossypium arboreum [tree cotton]
ref|NP_001267989.1|  cysteine protease precursor                        144   2e-38   Vitis vinifera
ref|XP_009376976.1|  PREDICTED: cysteine proteinase RD19a-like          145   2e-38   Pyrus x bretschneideri [bai li]
ref|XP_002313770.1|  cysteine proteinase A494 precursor                 144   2e-38   Populus trichocarpa [western balsam poplar]
gb|ABK92536.1|  unknown                                                 144   2e-38   Populus trichocarpa [western balsam poplar]
ref|XP_003606998.1|  Cysteine proteinase                                143   3e-38   Medicago truncatula
ref|XP_007017672.1|  Papain family cysteine protease                    144   3e-38   Theobroma cacao [chocolate]
ref|XP_009376977.1|  PREDICTED: cysteine proteinase RD19a-like          144   3e-38   Pyrus x bretschneideri [bai li]
ref|XP_009351218.1|  PREDICTED: cysteine proteinase RD19a-like          141   4e-38   Pyrus x bretschneideri [bai li]
ref|XP_009373025.1|  PREDICTED: cysteine proteinase RD19a-like          143   4e-38   Pyrus x bretschneideri [bai li]
ref|XP_004290288.1|  PREDICTED: probable cysteine proteinase A494       143   6e-38   Fragaria vesca subsp. vesca
ref|XP_007131787.1|  hypothetical protein PHAVU_011G041600g             142   6e-38   Phaseolus vulgaris [French bean]
ref|XP_006487337.1|  PREDICTED: cysteine proteinase RD19a-like          142   6e-38   Citrus sinensis [apfelsine]
gb|KDO49483.1|  hypothetical protein CISIN_1g017318mg                   142   6e-38   Citrus sinensis [apfelsine]
gb|KHN39817.1|  Cysteine proteinase RD19a                               142   7e-38   Glycine soja [wild soybean]
ref|XP_009373000.1|  PREDICTED: cysteine proteinase RD19a               142   7e-38   Pyrus x bretschneideri [bai li]
ref|XP_008382317.1|  PREDICTED: cysteine proteinase RD19a               142   7e-38   Malus domestica [apple tree]
ref|XP_008236965.1|  PREDICTED: cysteine proteinase RD19a               142   7e-38   Prunus mume [ume]
ref|XP_003539008.1|  PREDICTED: cysteine proteinase RD19a-like          142   7e-38   Glycine max [soybeans]
ref|XP_007201310.1|  hypothetical protein PRUPE_ppa007454mg             142   7e-38   Prunus persica
ref|XP_010271520.1|  PREDICTED: cysteine proteinase RD19a-like          142   8e-38   Nelumbo nucifera [Indian lotus]
gb|ACI04578.1|  cysteine protease-like protein                          141   9e-38   Robinia pseudoacacia [black locust]
ref|XP_004507484.1|  PREDICTED: cysteine proteinase RD19a-like          142   1e-37   Cicer arietinum [garbanzo]
ref|XP_010028631.1|  PREDICTED: cysteine proteinase RD19a-like          142   1e-37   Eucalyptus grandis [rose gum]
ref|XP_011028940.1|  PREDICTED: cysteine proteinase 15A-like            142   1e-37   Populus euphratica
ref|XP_006423403.1|  hypothetical protein CICLE_v10028670mg             142   1e-37   Citrus clementina
ref|XP_011088458.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    142   1e-37   Sesamum indicum [beniseed]
emb|CDQ51995.1|  Cysteine proteinase                                    136   1e-37   Fagus sylvatica
gb|AAL69389.1|AF462226_1  putative cysteine proteinase                  135   2e-37   Narcissus pseudonarcissus
ref|XP_011037175.1|  PREDICTED: cysteine proteinase RD19a-like          141   2e-37   Populus euphratica
gb|AAR92156.1|  putative cysteine protease 3                            139   2e-37   Iris x hollandica [Dutch iris]
ref|XP_010066197.1|  PREDICTED: probable cysteine proteinase A494       141   2e-37   Eucalyptus grandis [rose gum]
ref|XP_002305451.2|  cysteine proteinase A494 precursor                 141   2e-37   Populus trichocarpa [western balsam poplar]
gb|ABK96580.1|  unknown                                                 141   2e-37   Populus trichocarpa x Populus deltoides
gb|AJP16692.1|  cysteine protease                                       135   2e-37   Striga hermonthica [purple witchweed]
ref|XP_002302004.2|  hypothetical protein POPTR_0002s03020g             141   3e-37   Populus trichocarpa [western balsam poplar]
gb|ABK94801.1|  unknown                                                 141   3e-37   Populus trichocarpa [western balsam poplar]
ref|XP_009406357.1|  PREDICTED: cysteine proteinase 1-like              140   3e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011092831.1|  PREDICTED: cysteine proteinase RD19a-like          140   5e-37   Sesamum indicum [beniseed]
ref|XP_002280798.2|  PREDICTED: cysteine proteinase 15A                 140   8e-37   Vitis vinifera
ref|XP_004150061.1|  PREDICTED: cysteine proteinase RD19a-like          139   1e-36   Cucumis sativus [cucumbers]
gb|ABK93575.1|  unknown                                                 134   1e-36   Populus trichocarpa [western balsam poplar]
ref|XP_010061009.1|  PREDICTED: cysteine proteinase RD19a-like          139   1e-36   Eucalyptus grandis [rose gum]
gb|AAU81591.1|  cysteine proteinase                                     134   1e-36   Petunia x hybrida [garden petunia]
gb|EYU37835.1|  hypothetical protein MIMGU_mgv1a008237mg                139   1e-36   Erythranthe guttata [common monkey flower]
ref|XP_002275759.1|  PREDICTED: cysteine proteinase RD19a               139   2e-36   Vitis vinifera
ref|XP_002510469.1|  cysteine protease, putative                        139   2e-36   Ricinus communis
dbj|BAD94010.1|  drought-inducible cysteine proteinase RD19A prec...    131   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003540987.1|  PREDICTED: cysteine proteinase RD19a-like          138   3e-36   Glycine max [soybeans]
ref|XP_004148554.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    138   4e-36   
gb|KGN43159.1|  Papain-like cysteine proteinase isoform I               138   4e-36   Cucumis sativus [cucumbers]
ref|XP_004165230.1|  PREDICTED: cysteine proteinase RD19a-like          138   4e-36   
gb|AAU81589.1|  cysteine proteinase                                     135   4e-36   Petunia x hybrida [garden petunia]
ref|XP_010268619.1|  PREDICTED: cysteine proteinase RD19a-like          138   4e-36   Nelumbo nucifera [Indian lotus]
ref|XP_008460996.1|  PREDICTED: cysteine proteinase RD19a-like          138   4e-36   Cucumis melo [Oriental melon]
dbj|BAJ53178.1|  JHL18I08.12                                            137   4e-36   Jatropha curcas
gb|ABF46642.1|  papain-like cysteine proteinase                         137   9e-36   Pachysandra terminalis
ref|NP_001241450.1|  uncharacterized protein LOC100778716 precursor     137   1e-35   Glycine max [soybeans]
ref|XP_003523684.1|  PREDICTED: cysteine proteinase 15A-like            136   1e-35   Glycine max [soybeans]
gb|KHN45894.1|  Cysteine proteinase RD19a                               136   1e-35   Glycine soja [wild soybean]
ref|XP_010530325.1|  PREDICTED: cysteine proteinase RD19a               136   1e-35   Tarenaya hassleriana [spider flower]
gb|KHN25410.1|  Cysteine proteinase RD19a                               136   2e-35   Glycine soja [wild soybean]
ref|XP_010531457.1|  PREDICTED: probable cysteine proteinase A494       136   2e-35   Tarenaya hassleriana [spider flower]
dbj|BAC41322.1|  hypothetical protein                                   136   2e-35   Lotus japonicus
ref|XP_010910124.1|  PREDICTED: cysteine proteinase 1-like              136   2e-35   Elaeis guineensis
gb|EYU42593.1|  hypothetical protein MIMGU_mgv1a008336mg                136   2e-35   Erythranthe guttata [common monkey flower]
gb|AAL05851.1|AF411121_1  cysteine proteinase precursor                 135   2e-35   Sandersonia aurantiaca [Chinese-lantern lily]
ref|XP_009602233.1|  PREDICTED: cysteine proteinase RD19a-like          136   2e-35   Nicotiana tomentosiformis
emb|CAE45588.1|  papain-like cysteine proteinase-like protein 1         135   2e-35   Lotus japonicus
ref|XP_008775532.1|  PREDICTED: cysteine proteinase 1-like              136   2e-35   Phoenix dactylifera
ref|XP_009392632.1|  PREDICTED: cysteine proteinase 1-like              135   2e-35   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAF98584.1|  CM0216.500.nc                                          135   3e-35   Lotus japonicus
ref|XP_011045161.1|  PREDICTED: cysteine proteinase 15A-like            135   3e-35   Populus euphratica
ref|XP_009109502.1|  PREDICTED: cysteine proteinase RD19a-like          135   3e-35   Brassica rapa
gb|KHN12668.1|  Cysteine proteinase 15A                                 130   3e-35   Glycine soja [wild soybean]
ref|XP_002306900.1|  hypothetical protein POPTR_0005s25540g             135   4e-35   Populus trichocarpa [western balsam poplar]
ref|XP_008448073.1|  PREDICTED: cysteine proteinase RD19a-like          135   4e-35   Cucumis melo [Oriental melon]
emb|CAE45589.1|  papain-like cysteine proteinase-like protein 2         135   4e-35   Lotus japonicus
ref|XP_006362019.1|  PREDICTED: cysteine proteinase RD19a-like          135   4e-35   Solanum tuberosum [potatoes]
gb|KHN22211.1|  Cysteine proteinase 15A                                 135   5e-35   Glycine soja [wild soybean]
ref|XP_004230928.1|  PREDICTED: cysteine proteinase RD19a               135   5e-35   Solanum lycopersicum
emb|CAB53397.1|  cysteine protease                                      131   5e-35   Medicago sativa [alfalfa]
gb|AAB62937.1|  stress-induced cysteine proteinase                      130   6e-35   Lavatera thuringiaca
ref|XP_004291404.1|  PREDICTED: cysteine proteinase 15A-like            134   6e-35   Fragaria vesca subsp. vesca
gb|KJB07487.1|  hypothetical protein B456_001G026600                    135   6e-35   Gossypium raimondii
dbj|BAF98585.1|  CM0216.510.nc                                          134   6e-35   Lotus japonicus
ref|XP_007136047.1|  hypothetical protein PHAVU_009G013600g             134   7e-35   Phaseolus vulgaris [French bean]
gb|AGV54334.1|  cysteine proteinase RD19a-like protein                  134   7e-35   Phaseolus vulgaris [French bean]
gb|AAM65162.1|  cysteine proteinase RD19A                               134   7e-35   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568052.1|  cysteine proteinase RD19a                             134   8e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006473584.1|  PREDICTED: cysteine proteinase 15A-like            134   8e-35   Citrus sinensis [apfelsine]
ref|XP_010105270.1|  Cysteine proteinase 15A                            134   8e-35   Morus notabilis
gb|AIB06025.1|  CP3                                                     134   1e-34   Hevea brasiliensis [jebe]
ref|XP_006435090.1|  hypothetical protein CICLE_v10001559mg             134   1e-34   Citrus clementina
gb|KDO84720.1|  hypothetical protein CISIN_1g017548mg                   134   1e-34   Citrus sinensis [apfelsine]
gb|AAL60581.1|AF454959_1  senescence-associated cysteine protease       134   1e-34   Brassica oleracea
emb|CDY71205.1|  BnaCnng71840D                                          134   1e-34   Brassica napus [oilseed rape]
ref|XP_006411706.1|  hypothetical protein EUTSA_v10025494mg             134   1e-34   Eutrema salsugineum
ref|XP_008387995.1|  PREDICTED: cysteine proteinase 15A                 133   1e-34   Malus domestica [apple tree]
gb|KFK30492.1|  hypothetical protein AALP_AA7G268600                    134   1e-34   Arabis alpina [alpine rockcress]
ref|XP_006828787.1|  hypothetical protein AMTR_s00001p00114210          133   2e-34   Amborella trichopoda
ref|XP_009146338.1|  PREDICTED: cysteine proteinase 15A-like            133   2e-34   Brassica rapa
ref|XP_007160702.1|  hypothetical protein PHAVU_001G009900g             133   2e-34   Phaseolus vulgaris [French bean]
emb|CDY34441.1|  BnaC01g21920D                                          133   2e-34   Brassica napus [oilseed rape]
gb|AAD29084.1|AF082181_1  cysteine proteinase precursor                 133   3e-34   Solanum melongena [aubergine]
dbj|BAF03553.1|  cysteine proteinase CP2                                133   3e-34   Phaseolus vulgaris [French bean]
ref|XP_006283963.1|  hypothetical protein CARUB_v10005086mg             133   3e-34   Capsella rubella
ref|XP_008221329.1|  PREDICTED: cysteine proteinase 15A-like            132   3e-34   Prunus mume [ume]
dbj|BAF46302.1|  cysteine proteinase precursor                          132   3e-34   Ipomoea nil [qian niu]
ref|XP_002868883.1|  hypothetical protein ARALYDRAFT_490677             132   4e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_003589348.1|  Cysteine proteinase                                132   4e-34   Medicago truncatula
emb|CDY09707.1|  BnaC07g33540D                                          132   5e-34   Brassica napus [oilseed rape]
gb|ACX54787.2|  cysteine protease                                       132   5e-34   Arachis diogoi
emb|CDY41960.1|  BnaA01g05320D                                          132   6e-34   Brassica napus [oilseed rape]
ref|XP_002280808.2|  PREDICTED: cysteine proteinase 15A                 132   6e-34   Vitis vinifera
ref|XP_003550405.2|  PREDICTED: cysteine proteinase 15A                 132   7e-34   
gb|EMS53996.1|  Cysteine proteinase 1                                   132   7e-34   Triticum urartu
ref|XP_007223351.1|  hypothetical protein PRUPE_ppa007441mg             132   7e-34   Prunus persica
dbj|BAA92495.1|  cysteine protease                                      131   8e-34   Vigna mungo [urad dal]
ref|XP_010446443.1|  PREDICTED: cysteine proteinase RD19a               131   9e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010431862.1|  PREDICTED: cysteine proteinase RD19a               131   9e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010437007.1|  PREDICTED: cysteine proteinase RD19a-like          131   1e-33   Camelina sativa [gold-of-pleasure]
gb|ACK57563.1|  cysteine protease-like protein                          131   1e-33   Arachis hypogaea [goober]
ref|XP_010440192.1|  PREDICTED: cysteine proteinase RD19a-like          131   1e-33   Camelina sativa [gold-of-pleasure]
emb|CAA52403.1|  putative thiol protease                                130   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006665032.1|  PREDICTED: cysteine proteinase 1-like              127   1e-33   
ref|XP_010449835.1|  PREDICTED: cysteine proteinase 15A-like            131   1e-33   Camelina sativa [gold-of-pleasure]
emb|CDX98179.1|  BnaC07g09190D                                          123   1e-33   Brassica napus [oilseed rape]
sp|P25804.1|CYSP_PEA  RecName: Full=Cysteine proteinase 15A; AltN...    131   1e-33   Pisum sativum [garden pea]
ref|XP_009150026.1|  PREDICTED: cysteine proteinase RD19a               131   1e-33   Brassica rapa
ref|XP_010434865.1|  PREDICTED: cysteine proteinase 15A-like            130   2e-33   Camelina sativa [gold-of-pleasure]
dbj|BAD43619.1|  putative cysteine proteinase                           130   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565512.1|  Papain family cysteine protease                       130   2e-33   Arabidopsis thaliana [mouse-ear cress]
emb|CAA82995.1|  cysteine proteinase                                    130   2e-33   Vicia sativa [spring vetch]
gb|ACM80348.1|  cysteine proteinase                                     130   2e-33   Solanum lycopersicum
ref|XP_008775280.1|  PREDICTED: cysteine proteinase 1-like              130   2e-33   Phoenix dactylifera
gb|AAB67878.1|  pre-pro-cysteine proteinase                             130   2e-33   Vicia faba [broad bean]
ref|XP_003545051.1|  PREDICTED: cysteine proteinase 15A-like            130   2e-33   Glycine max [soybeans]
gb|AAO11786.1|  pre-pro cysteine proteinase                             130   2e-33   Vicia faba [broad bean]
ref|XP_011083631.1|  PREDICTED: cysteine proteinase 15A-like            130   2e-33   Sesamum indicum [beniseed]
ref|XP_009335626.1|  PREDICTED: cysteine proteinase 15A                 130   3e-33   Pyrus x bretschneideri [bai li]
emb|CDX90537.1|  BnaA03g42440D                                          130   3e-33   Brassica napus [oilseed rape]
ref|XP_009136751.1|  PREDICTED: cysteine proteinase RD19a-like          130   3e-33   Brassica rapa
gb|KJB58164.1|  hypothetical protein B456_009G197400                    130   3e-33   Gossypium raimondii
ref|XP_008444769.1|  PREDICTED: cysteine proteinase RD19a-like          130   3e-33   Cucumis melo [Oriental melon]
ref|XP_010672379.1|  PREDICTED: cysteine proteinase RD19a-like          130   3e-33   Beta vulgaris subsp. vulgaris [field beet]
emb|CAB17075.1|  cysteine proteinase precursor                          130   3e-33   Phaseolus vulgaris [French bean]
ref|XP_006653265.1|  PREDICTED: cysteine proteinase 1-like              130   4e-33   
gb|KJB29611.1|  hypothetical protein B456_005G110200                    130   4e-33   Gossypium raimondii
ref|XP_010943608.1|  PREDICTED: cysteine proteinase 1-like              130   4e-33   Elaeis guineensis
emb|CDP07452.1|  unnamed protein product                                130   4e-33   Coffea canephora [robusta coffee]
gb|AJA74415.1|  cysteine protease                                       129   4e-33   Cicer arietinum [garbanzo]
gb|AAQ81938.1|  cysteine proteinase precursor                           130   4e-33   Ipomoea batatas [batate]
ref|NP_001266121.1|  uncharacterized protein LOC101501911 precursor     129   4e-33   Cicer arietinum [garbanzo]
ref|XP_002880378.1|  hypothetical protein ARALYDRAFT_481008             129   5e-33   Arabidopsis lyrata subsp. lyrata
emb|CDX99593.1|  BnaC04g33500D                                          129   7e-33   Brassica napus [oilseed rape]
gb|AEX97108.1|  cysteine proteinase                                     123   8e-33   Malus domestica [apple tree]
gb|KHG15062.1|  Cysteinease RD19a -like protein                         129   9e-33   Gossypium arboreum [tree cotton]
gb|AGS43121.1|  cysteine protease 1                                     122   1e-32   Zea mays [maize]
emb|CDY15894.1|  BnaA04g12170D                                          128   1e-32   Brassica napus [oilseed rape]
ref|XP_006283974.1|  hypothetical protein CARUB_v10005098mg             128   1e-32   Capsella rubella
ref|XP_009140277.1|  PREDICTED: probable cysteine proteinase A494       128   1e-32   Brassica rapa
ref|XP_009405542.1|  PREDICTED: cysteine proteinase 1-like              128   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006414378.1|  hypothetical protein EUTSA_v10025521mg             128   1e-32   Eutrema salsugineum
emb|CAD40319.2|  OSJNBb0054B09.3                                        128   1e-32   Oryza sativa Japonica Group [Japonica rice]
gb|EEE60725.1|  hypothetical protein OsJ_14236                          128   1e-32   Oryza sativa Japonica Group [Japonica rice]
gb|EAY93546.1|  hypothetical protein OsI_15336                          128   1e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_002452058.1|  hypothetical protein SORBIDRAFT_04g017830          128   2e-32   Sorghum bicolor [broomcorn]
ref|XP_006404590.1|  hypothetical protein EUTSA_v10000210mg             128   2e-32   Eutrema salsugineum
gb|EMT16425.1|  Cysteine proteinase 1                                   128   2e-32   Aegilops tauschii
emb|CAA57675.1|  cysteine proteinase                                    123   2e-32   Zea mays [maize]
ref|XP_009611293.1|  PREDICTED: cysteine proteinase 15A-like            128   2e-32   Nicotiana tomentosiformis
gb|AAK07731.1|  CPR2-like cysteine proteinase                           127   2e-32   Nicotiana tabacum [American tobacco]
ref|XP_004238314.1|  PREDICTED: cysteine proteinase 15A                 127   2e-32   
emb|CAA78365.1|  tobacco pre-pro-cysteine proteinase                    127   2e-32   Nicotiana tabacum [American tobacco]
ref|NP_001052440.1|  Os04g0311400                                       127   3e-32   
emb|CAA78361.1|  tobacco pre-pro-cysteine proteinase                    127   3e-32   Nicotiana tabacum [American tobacco]
ref|XP_009776238.1|  PREDICTED: cysteine proteinase 15A-like            127   3e-32   Nicotiana sylvestris
ref|XP_003579573.2|  PREDICTED: cysteine proteinase 1-like              128   3e-32   Brachypodium distachyon [annual false brome]
ref|XP_004952477.1|  PREDICTED: cysteine proteinase 1-like              127   3e-32   Setaria italica
ref|XP_004152668.1|  PREDICTED: cysteine proteinase RD19a-like          127   4e-32   Cucumis sativus [cucumbers]
gb|KFK24413.1|  hypothetical protein AALP_AAs58848U000200               127   4e-32   Arabis alpina [alpine rockcress]
ref|XP_006341997.1|  PREDICTED: cysteine proteinase 15A-like            127   4e-32   Solanum tuberosum [potatoes]
gb|AAB16996.1|  thiol protease isoform B                                126   4e-32   Glycine max [soybeans]
ref|NP_567489.1|  papain family cysteine protease                       127   5e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870174.1|  hypothetical protein ARALYDRAFT_915142             127   6e-32   Arabidopsis lyrata subsp. lyrata
emb|CAH59428.1|  cysteine protease 2                                    124   8e-32   Plantago major [cart-track plant]
ref|XP_004975256.1|  PREDICTED: cysteine proteinase 1-like              126   8e-32   Setaria italica
ref|XP_003607110.1|  Cysteine proteinase                                125   1e-31   Medicago truncatula
emb|CAA78403.1|  pre-pro-cysteine proteinase                            125   1e-31   Solanum lycopersicum
gb|ACF86683.1|  unknown                                                 125   1e-31   Zea mays [maize]
ref|NP_001105685.1|  cysteine proteinase 1 precursor                    125   1e-31   Zea mays [maize]
gb|KEH30505.1|  papain family cysteine protease                         125   1e-31   Medicago truncatula
ref|XP_003574963.1|  PREDICTED: cysteine proteinase 1-like              125   1e-31   Brachypodium distachyon [annual false brome]
gb|ABK24153.1|  unknown                                                 125   3e-31   Picea sitchensis
gb|EYU27644.1|  hypothetical protein MIMGU_mgv1a008452mg                124   4e-31   Erythranthe guttata [common monkey flower]
ref|NP_001046828.1|  Os02g0469600                                       124   6e-31   
dbj|BAG16515.1|  putative cysteine proteinase                           124   7e-31   Capsicum chinense [bonnet pepper]
tpe|CAD66657.1|  TPA: putative cysteine proteinase precursor            123   9e-31   Hordeum vulgare subsp. vulgare [barley]
ref|XP_002279862.1|  PREDICTED: cysteine proteinase RD19a               123   9e-31   Vitis vinifera
dbj|BAD10859.1|  cysteine protease                                      123   9e-31   Tripolium pannonicum [sea starwort]
gb|EMS64962.1|  Cysteine proteinase 1                                   122   9e-31   Triticum urartu
gb|ABK24688.1|  unknown                                                 123   1e-30   Picea sitchensis
gb|ACN40679.1|  unknown                                                 123   1e-30   Picea sitchensis
gb|ABK21238.1|  unknown                                                 123   1e-30   Picea sitchensis
gb|EMT10192.1|  Cysteine proteinase 1                                   122   2e-30   Aegilops tauschii
gb|EPS70818.1|  cysteine proteinase                                     122   2e-30   Genlisea aurea
gb|AAW21813.1|  cysteine protease                                       122   2e-30   Triticum aestivum [Canadian hard winter wheat]
gb|AAZ32411.1|  cysteine proteinase glycinain type                      122   2e-30   Nicotiana benthamiana
ref|XP_003607150.1|  Cysteine proteinase                                121   2e-30   
gb|AES89347.2|  papain family cysteine protease                         121   3e-30   Medicago truncatula
gb|AAB53103.1|  cysteine protease                                       115   3e-30   Brassica napus [oilseed rape]
dbj|BAC57957.1|  thiol protease                                         118   4e-30   Tripolium pannonicum [sea starwort]
gb|EPS65881.1|  cysteine proteinase                                     121   5e-30   Genlisea aurea
gb|AAB16997.1|  thiol protease isoform A                                120   7e-30   Glycine max [soybeans]
ref|XP_009786000.1|  PREDICTED: cysteine proteinase RD19a-like          120   8e-30   Nicotiana sylvestris
gb|ADY04293.1|  cysteine protease                                       115   1e-29   Clarkia xantiana subsp. xantiana
emb|CAQ00101.1|  papain-like cysteine proteinase                        120   1e-29   Hordeum vulgare subsp. vulgare [barley]
gb|ADY04361.1|  cysteine protease                                       115   1e-29   Clarkia xantiana subsp. xantiana
gb|ADY04342.1|  cysteine protease                                       115   2e-29   Clarkia xantiana subsp. xantiana
gb|ADY04336.1|  cysteine protease                                       115   2e-29   Clarkia xantiana subsp. xantiana
gb|ADY04262.1|  cysteine protease                                       115   2e-29   Clarkia xantiana subsp. xantiana
gb|ADY04414.1|  cysteine protease                                       115   2e-29   Clarkia xantiana subsp. xantiana
gb|ADY04457.1|  cysteine protease                                       115   2e-29   Clarkia xantiana subsp. xantiana
gb|ADY04359.1|  cysteine protease                                       115   2e-29   Clarkia xantiana subsp. xantiana
gb|ADY04482.1|  cysteine protease                                       114   3e-29   Clarkia xantiana subsp. xantiana
gb|ADY04358.1|  cysteine protease                                       114   3e-29   Clarkia xantiana subsp. xantiana
gb|ADY04368.1|  cysteine protease                                       114   3e-29   Clarkia xantiana subsp. xantiana
gb|ADY04480.1|  cysteine protease                                       114   5e-29   Clarkia xantiana subsp. xantiana
gb|ADY04268.1|  cysteine protease                                       114   6e-29   Clarkia xantiana subsp. xantiana
gb|ADY04295.1|  cysteine protease                                       113   1e-28   Clarkia xantiana subsp. xantiana
ref|XP_010690815.1|  PREDICTED: cysteine proteinase RD19a               116   6e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002960585.1|  hypothetical protein SELMODRAFT_266583             114   2e-27   Selaginella moellendorffii
ref|XP_002969223.1|  hypothetical protein SELMODRAFT_91274              114   2e-27   Selaginella moellendorffii
ref|XP_008776953.1|  PREDICTED: cysteine proteinase-like                104   3e-25   Phoenix dactylifera
gb|KEH43476.1|  papain family cysteine protease                         107   6e-25   Medicago truncatula
ref|XP_008804021.1|  PREDICTED: cysteine proteinase RD19a-like          105   7e-25   Phoenix dactylifera
gb|ADY04490.1|  cysteine protease                                       103   8e-25   Clarkia xantiana subsp. xantiana
ref|XP_010504326.1|  PREDICTED: cysteine proteinase 15A-like            107   9e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006293095.1|  hypothetical protein CARUB_v10019394mg             107   1e-24   Capsella rubella
emb|CCA95098.1|  putative responsive to dehydration 19                  103   1e-24   Liriodendron tulipifera
emb|CAB41090.1|  cysteine proteinase precursor-like protein             106   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567010.5|  Papain family cysteine protease                       106   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876278.1|  hypothetical protein ARALYDRAFT_485911             106   1e-24   Arabidopsis lyrata subsp. lyrata
ref|XP_009404192.1|  PREDICTED: cysteine proteinase 15A                 106   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS59778.1|  Cysteine proteinase 15A                                 103   2e-24   Triticum urartu
ref|NP_001059639.1|  Os07g0480900                                       106   2e-24   
gb|KHN00877.1|  Cysteine proteinase 15A                                 105   2e-24   Glycine soja [wild soybean]
ref|XP_002460693.1|  hypothetical protein SORBIDRAFT_02g033270          105   2e-24   Sorghum bicolor [broomcorn]
ref|XP_004496226.1|  PREDICTED: cysteine proteinase 15A-like            105   2e-24   Cicer arietinum [garbanzo]
gb|KFK34737.1|  hypothetical protein AALP_AA5G186400                    105   3e-24   Arabis alpina [alpine rockcress]
ref|XP_008802783.1|  PREDICTED: probable cysteine proteinase A494       105   4e-24   Phoenix dactylifera
emb|CAB16316.1|  cysteine proteinase precursor                          104   6e-24   Vicia sativa [spring vetch]
ref|XP_009117680.1|  PREDICTED: probable cysteine proteinase A494       104   7e-24   Brassica rapa
ref|XP_006658557.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    103   9e-24   Oryza brachyantha
gb|KHN37802.1|  Cysteine proteinase 1                                   103   1e-23   Glycine soja [wild soybean]
ref|XP_010534431.1|  PREDICTED: cysteine proteinase 15A                 103   1e-23   Tarenaya hassleriana [spider flower]
ref|XP_004959670.1|  PREDICTED: cysteine proteinase 1-like              103   1e-23   Setaria italica
gb|ABO93617.1|  papain-like cysteine proteinase                         100   1e-23   Vitis vinifera
ref|XP_001781954.1|  predicted protein                                  103   1e-23   
ref|NP_001236888.1|  cysteine proteinase precursor                      103   2e-23   
gb|AAD46920.1|AF167986_1  putative cysteine proteinase GmPM33           103   2e-23   
ref|XP_008354070.1|  PREDICTED: cysteine proteinase 15A-like            102   2e-23   
emb|CDY13816.1|  BnaA09g43180D                                          102   2e-23   
ref|XP_008362714.1|  PREDICTED: cysteine proteinase 15A                 103   2e-23   
tpg|DAA40800.1|  TPA: putative cysteine protease family protein         102   3e-23   
emb|CAQ00102.1|  papain-like cysteine proteinase                        102   4e-23   
ref|XP_003560213.1|  PREDICTED: cysteine proteinase 1                   102   5e-23   
emb|CDY56961.1|  BnaA09g55030D                                          102   6e-23   
ref|XP_009116190.1|  PREDICTED: probable cysteine proteinase A494       102   6e-23   
emb|CDX73424.1|  BnaC08g25790D                                          102   6e-23   
ref|XP_004157559.1|  PREDICTED: cysteine proteinase 15A-like            101   7e-23   
gb|EEC82027.1|  hypothetical protein OsI_25996                          103   8e-23   
ref|XP_004142497.1|  PREDICTED: cysteine proteinase 15A-like            101   8e-23   
ref|XP_001761980.1|  predicted protein                                  101   8e-23   
gb|ADE76932.1|  unknown                                                 101   8e-23   
ref|XP_010918606.1|  PREDICTED: probable cysteine proteinase A494       100   1e-22   
ref|XP_007143764.1|  hypothetical protein PHAVU_007G099600g             101   1e-22   
gb|EYU39642.1|  hypothetical protein MIMGU_mgv1a008552mg                100   2e-22   
ref|XP_010243268.1|  PREDICTED: cysteine proteinase 15A                 100   2e-22   
ref|XP_008233261.1|  PREDICTED: cysteine proteinase 15A                 100   3e-22   
ref|XP_007218137.1|  hypothetical protein PRUPE_ppa007240mg             100   3e-22   
ref|XP_009789260.1|  PREDICTED: cysteine proteinase 15A                 100   3e-22   
ref|XP_009617441.1|  PREDICTED: cysteine proteinase 15A               99.8    3e-22   
ref|XP_006403513.1|  hypothetical protein EUTSA_v10010475mg           99.8    4e-22   
gb|KJB73490.1|  hypothetical protein B456_011G235500                  99.8    4e-22   
ref|XP_004250044.1|  PREDICTED: cysteine proteinase 15A               99.4    5e-22   
gb|KHG08355.1|  Cysteinease 1                                         99.0    5e-22   
gb|AEQ54770.1|  cysteine proteinase CP1                               99.0    7e-22   
emb|CAB17077.1|  cysteine proteinase precursor                        98.2    1e-21   
ref|XP_011094506.1|  PREDICTED: cysteine proteinase 15A               98.2    1e-21   
emb|CBI31400.3|  unnamed protein product                              96.7    2e-21   
emb|CCA95082.1|  putative responsive to dehydration 19                94.0    2e-21   
emb|CDO99795.1|  unnamed protein product                              97.4    3e-21   
ref|XP_011024366.1|  PREDICTED: cysteine proteinase 15A               97.1    3e-21   
ref|XP_006850211.1|  hypothetical protein AMTR_s00022p00251800        96.7    3e-21   
ref|XP_007510080.1|  unknown                                          97.8    4e-21   
ref|XP_006361690.1|  PREDICTED: cysteine proteinase 15A-like          96.7    5e-21   
ref|XP_010034320.1|  PREDICTED: cysteine proteinase 1                 96.3    6e-21   
ref|XP_010688493.1|  PREDICTED: cysteine proteinase 15A               95.9    7e-21   
gb|KDP30486.1|  hypothetical protein JCGZ_16165                       95.9    8e-21   
ref|XP_008446834.1|  PREDICTED: cysteine proteinase 15A               95.5    9e-21   
ref|XP_008647122.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin 7-...  95.1    1e-20   
ref|XP_006436511.1|  hypothetical protein CICLE_v10031865mg           95.5    1e-20   
ref|XP_002316398.1|  hypothetical protein POPTR_0010s23510g           94.7    2e-20   
ref|XP_002266821.1|  PREDICTED: cysteine proteinase 15A               94.4    3e-20   
emb|CAN64491.1|  hypothetical protein VITISV_015725                   93.6    3e-20   
ref|XP_010103534.1|  putative cysteine proteinase A494                93.6    4e-20   
ref|XP_002533377.1|  cysteine protease, putative                      93.6    6e-20   
ref|XP_007010012.1|  Papain family cysteine protease                  93.2    8e-20   
gb|AFW72358.1|  putative cysteine protease family protein             94.7    1e-19   
ref|XP_003081549.1|  Cysteine proteinase Cathepsin F (ISS)            90.9    4e-19   
emb|CEF99324.1|  Cysteine peptidase, cysteine active site             91.3    4e-19   
ref|XP_011169692.1|  PREDICTED: putative cysteine proteinase CG12163  93.2    6e-19   
gb|EPS63354.1|  hypothetical protein M569_11429                       89.7    9e-19   
ref|XP_001419933.1|  predicted protein                                89.4    9e-19   
gb|EFN80374.1|  Putative cysteine proteinase CG12163                  92.0    1e-18   
ref|XP_011145705.1|  PREDICTED: uncharacterized protein LOC105186896  92.0    1e-18   
ref|XP_004519757.1|  PREDICTED: putative cysteine proteinase CG12...  91.3    2e-18   
ref|XP_011184040.1|  PREDICTED: putative cysteine proteinase CG12163  91.3    2e-18   
ref|XP_011203808.1|  PREDICTED: putative cysteine proteinase CG12163  91.3    2e-18   
ref|XP_006608091.1|  PREDICTED: uncharacterized protein LOC102680728  90.9    3e-18   
ref|XP_003492760.1|  PREDICTED: hypothetical protein LOC100745708     90.5    4e-18   
ref|XP_003696602.1|  PREDICTED: putative cysteine proteinase CG12...  90.5    5e-18   
ref|XP_003057227.1|  predicted protein                                87.0    8e-18   
ref|XP_011469621.1|  PREDICTED: cysteine proteinase 15A-like          85.9    1e-17   
ref|XP_011496222.1|  PREDICTED: uncharacterized protein LOC105360904  89.7    1e-17   
gb|KFB38327.1|  AGAP002879-PB-like protein                            89.4    2e-17   
ref|XP_011493714.1|  AAEL017153-PA                                    89.4    2e-17   
ref|XP_392381.3|  PREDICTED: putative cysteine proteinase CG12163...  89.0    2e-17   
ref|XP_006567715.1|  PREDICTED: putative cysteine proteinase CG12...  89.0    2e-17   
ref|XP_005184486.1|  PREDICTED: putative cysteine proteinase CG12...  88.6    2e-17   
ref|XP_005184487.1|  PREDICTED: putative cysteine proteinase CG12...  88.6    2e-17   
gb|EGI66903.1|  Putative cysteine proteinase                          88.6    2e-17   
ref|XP_011052455.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  88.6    2e-17   
ref|XP_001844355.1|  conserved hypothetical protein                   89.0    2e-17   
ref|XP_001607324.1|  PREDICTED: uncharacterized protein LOC100123649  88.6    3e-17   
gb|AEW08440.1|  hypothetical protein 2_9845_02                        81.3    3e-17   
dbj|BAI44279.1|  cysteine proteinase inhibitor precursor              88.6    3e-17   
emb|CAN71324.1|  hypothetical protein VITISV_013970                   86.7    4e-17   
gb|EFN65613.1|  Putative cysteine proteinase CG12163                  87.8    5e-17   
ref|XP_008550537.1|  PREDICTED: uncharacterized protein LOC103573287  87.8    5e-17   
ref|XP_003707276.1|  PREDICTED: uncharacterized protein LOC100880620  87.4    6e-17   
ref|XP_011260522.1|  PREDICTED: uncharacterized protein LOC105253881  87.8    6e-17   
ref|XP_001994049.1|  GH22731                                          86.7    7e-17   
ref|XP_002000409.1|  GI10216                                          86.7    7e-17   
gb|ETN61472.1|  hypothetical protein AND_006867                       87.0    1e-16   
ref|XP_002017233.1|  GL22196                                          86.3    1e-16   
ref|XP_002056575.1|  GJ11017                                          86.3    1e-16   
ref|XP_002137768.1|  GA27408, isoform A                               86.3    1e-16   
gb|ABE72973.1|  cathepsin L                                           83.2    1e-16   
ref|XP_002096026.1|  GE25302                                          85.5    2e-16   
ref|XP_312034.5|  AGAP002879-PA                                       86.3    2e-16   
ref|XP_003436277.1|  AGAP002879-PB                                    86.3    2e-16   
gb|ACR08662.1|  cathepsin F                                           82.0    2e-16   
ref|NP_730901.1|  CG12163, isoform A                                  85.5    2e-16   
ref|XP_002038380.1|  GM10654                                          85.5    2e-16   
ref|XP_001955780.1|  GF16067                                          85.5    2e-16   
ref|XP_001978897.1|  GG11133                                          85.1    2e-16   
gb|ERG79645.1|  cysteine proteinase                                   79.7    2e-16   
ref|XP_003736743.1|  GA27408, isoform B                               84.7    2e-16   
gb|KHN72698.1|  Putative cysteine proteinase                          79.7    3e-16   
emb|CBY11269.1|  unnamed protein product                              83.2    3e-16   
ref|NP_649521.1|  CG12163, isoform B                                  83.6    5e-16   
gb|AJF94882.1|  C1 family cathepsin F10                               84.7    6e-16   
emb|CAN80141.1|  hypothetical protein VITISV_038978                   82.8    6e-16   
ref|XP_002073772.1|  GK14287                                          84.0    6e-16   
ref|XP_004519758.1|  PREDICTED: putative cysteine proteinase CG12...  84.0    7e-16   
ref|XP_008195657.1|  PREDICTED: uncharacterized protein LOC662417...  84.7    7e-16   
ref|XP_008195656.1|  PREDICTED: uncharacterized protein LOC662417...  84.7    7e-16   
ref|XP_003436276.1|  AGAP002879-PC                                    84.0    9e-16   
gb|EHJ64782.1|  cysteine proteinase inhibitor precursor               79.3    9e-16   
gb|EZA58965.1|  Putative cysteine proteinase                          84.0    9e-16   
gb|AFQ01139.1|  cathepsin F-like protease                             82.8    1e-15   
ref|XP_011331416.1|  PREDICTED: uncharacterized protein LOC105275911  84.0    1e-15   
gb|AFM37363.1|  cathepsin F1                                          82.0    2e-15   
emb|CAN81617.1|  hypothetical protein VITISV_001998                   80.1    2e-15   
ref|XP_003115597.1|  CRE-TAG-196 protein                              81.6    2e-15   
ref|XP_005184488.1|  PREDICTED: putative cysteine proteinase CG12...  81.6    3e-15   
ref|XP_011309436.1|  PREDICTED: uncharacterized protein LOC105270293  82.4    3e-15   
emb|CAN81619.1|  hypothetical protein VITISV_002000                   79.3    4e-15   
ref|NP_505215.2|  Protein TAG-196                                     80.9    4e-15   
ref|XP_011434326.1|  PREDICTED: uncharacterized protein LOC105333...  81.6    5e-15   
ref|XP_011434325.1|  PREDICTED: uncharacterized protein LOC105333...  81.6    5e-15   
gb|EKC42097.1|  Cathepsin F                                           81.6    5e-15   
emb|CBY31096.1|  unnamed protein product                              79.7    6e-15   
ref|XP_009047014.1|  hypothetical protein LOTGIDRAFT_172186           78.6    6e-15   
gb|KIH48456.1|  cysteine proteinase family protein                    75.1    6e-15   
gb|EYC18288.1|  hypothetical protein Y032_0028g1777                   75.5    8e-15   
gb|ABC48936.1|  cathepsin F like protease                             80.1    1e-14   
ref|XP_002635317.1|  C. briggsae CBR-TAG-196 protein                  80.1    1e-14   
emb|CBI23088.3|  unnamed protein product                              76.6    1e-14   
gb|KDR17524.1|  Putative cysteine proteinase                          81.3    1e-14   
gb|EGT34543.1|  hypothetical protein CAEBREN_26318                    79.7    1e-14   
gb|ABY75169.1|  cysteine protease                                     73.9    1e-14   
gb|EGT34572.1|  hypothetical protein CAEBREN_13324                    79.7    1e-14   
gb|ENN81374.1|  hypothetical protein YQE_02191                        80.5    2e-14   
ref|XP_002988513.1|  hypothetical protein SELMODRAFT_128220           75.1    2e-14   
emb|CDJ92562.1|  Proteinase inhibitor I25 and Proteinase inhibito...  77.8    6e-14   
emb|CDJ88889.1|  Proteinase inhibitor I25 and Proteinase inhibito...  77.4    7e-14   
gb|ERL92611.1|  hypothetical protein D910_09924                       77.4    8e-14   
gb|AII16490.1|  cathepsin F                                           75.5    8e-14   
ref|XP_002979143.1|  hypothetical protein SELMODRAFT_110288           75.1    8e-14   
gb|KFM67613.1|  putative cysteine proteinase                          77.0    1e-13   
ref|XP_002505924.1|  cysteine endopeptidase                           75.1    1e-13   
ref|NP_001156454.1|  cathepsin F isoform 2 precursor                  76.3    2e-13   
gb|ELT97360.1|  hypothetical protein CAPTEDRAFT_147978                73.9    3e-13   
ref|XP_009029595.1|  hypothetical protein HELRODRAFT_157956           74.3    3e-13   
ref|XP_003148243.1|  hypothetical protein LOAG_12683                  72.8    4e-13   
ref|XP_004351999.1|  cysteine protease                                74.3    4e-13   
gb|EFO15826.2|  hypothetical protein LOAG_12683                       72.8    4e-13   
emb|CDJ26737.1|  cathepsin F-like cysteine peptidase protein          74.7    7e-13   
ref|XP_003284553.1|  hypothetical protein DICPUDRAFT_96752            73.6    9e-13   
ref|XP_006268168.1|  PREDICTED: cathepsin F-like                      74.3    9e-13   
ref|XP_635374.1|  cysteine protease                                   73.2    1e-12   
ref|XP_003375070.1|  viral cathepsin                                  74.3    1e-12   
gb|EFX71333.1|  hypothetical protein DAPPUDRAFT_189155                72.0    1e-12   
ref|XP_006036937.1|  PREDICTED: cathepsin F-like                      73.6    1e-12   
ref|XP_002427787.1|  Cathepsin F precursor, putative                  73.6    1e-12   
ref|XP_002682087.1|  predicted protein                                72.8    2e-12   
ref|NP_001156453.1|  cathepsin F isoform 1 precursor                  73.9    2e-12   
ref|XP_009161938.1|  hypothetical protein T265_00017                  70.9    2e-12   
ref|XP_003389037.1|  PREDICTED: cathepsin L1-like                     72.4    2e-12   
dbj|GAA47436.1|  cathepsin L                                          70.9    2e-12   
ref|XP_002610214.1|  hypothetical protein BRAFLDRAFT_216923           71.2    3e-12   
ref|XP_635417.1|  cysteine proteinase 1                               72.0    3e-12   
emb|CAA26255.1|  cysteine proteinase I precursor                      72.0    3e-12   
ref|XP_002119872.3|  PREDICTED: cathepsin L-like                      72.8    3e-12   
ref|XP_006121731.1|  PREDICTED: cathepsin W-like                      70.5    3e-12   
ref|XP_005351748.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      72.8    3e-12   
ref|XP_003747496.1|  PREDICTED: cathepsin L-like                      71.6    4e-12   
gb|AAF21461.1|U69120_1  cysteine proteinase PWCP1                     72.4    4e-12   
ref|XP_007438969.1|  PREDICTED: cathepsin F-like                      70.1    4e-12   
ref|XP_006980634.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      72.4    4e-12   
gb|ELV09527.1|  Cathepsin F                                           72.8    5e-12   
dbj|GAM23991.1|  hypothetical protein SAMD00019534_071660             71.2    5e-12   
ref|XP_003386471.1|  PREDICTED: cysteine proteinase 1-like            71.6    5e-12   
gb|ELW65130.1|  Cathepsin W                                           72.0    6e-12   
ref|XP_007648967.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      72.0    6e-12   
ref|XP_006827472.1|  hypothetical protein AMTR_s00009p00129100        71.2    6e-12   
gb|EGW06365.1|  Cathepsin F                                           72.0    6e-12   
ref|XP_001894882.1|  cathepsin F-like cysteine proteinase             68.9    6e-12   
gb|AAT07059.1|  cathepsin F-like cysteine proteinase                  71.6    7e-12   
emb|CDQ07779.1|  Protein Bm12113, isoform a                           67.8    7e-12   
gb|ERE78742.1|  cathepsin F                                           71.6    8e-12   
ref|XP_011406938.1|  PREDICTED: silicatein-like                       68.9    9e-12   
ref|NP_001133678.1|  Cathepsin F precursor                            71.6    9e-12   
ref|XP_006007112.1|  PREDICTED: cathepsin F-like                      71.2    9e-12   
ref|XP_004596891.1|  PREDICTED: cathepsin F                           71.2    1e-11   
ref|XP_005064094.1|  PREDICTED: cathepsin F                           71.2    1e-11   
ref|XP_008821074.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      71.2    1e-11   
ref|XP_009064230.1|  hypothetical protein LOTGIDRAFT_204652           70.1    1e-11   
ref|XP_002117255.1|  hypothetical protein TRIADDRAFT_61245            70.5    1e-11   
ref|XP_001898698.1|  fibroinase precursor                             68.6    1e-11   
emb|CDQ05036.1|  Protein Bm9835                                       68.2    1e-11   
gb|AAW25775.1|  SJCHGC00511 protein                                   70.9    1e-11   
emb|CEF63690.1|  Cathepsin F                                          70.5    1e-11   
emb|CAX69889.1|  Temporarily Assigned Gene name                       70.9    1e-11   
dbj|BAN20819.1|  cysteine-type endopeptidase                          71.6    1e-11   
ref|XP_006276364.1|  PREDICTED: uncharacterized protein LOC102558525  71.2    2e-11   
gb|ABI13158.1|  putative cysteine protease                            68.9    2e-11   
emb|CDX82031.1|  BnaC08g35700D                                        68.9    2e-11   
ref|XP_005305646.1|  PREDICTED: cathepsin W-like                      69.7    2e-11   
ref|XP_008577225.1|  PREDICTED: cathepsin F                           70.9    2e-11   
emb|CDQ79130.1|  unnamed protein product                              70.5    2e-11   
ref|XP_010896687.1|  PREDICTED: cathepsin F                           70.5    2e-11   
ref|XP_006171430.1|  PREDICTED: cathepsin F                           70.5    2e-11   
ref|XP_004563245.1|  PREDICTED: cathepsin F-like                      70.5    2e-11   
ref|XP_003777749.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      70.5    2e-11   
gb|KGB33519.1|  Cathepsin L                                           69.3    2e-11   
gb|ACN10907.1|  Cathepsin F precursor                                 70.5    2e-11   
gb|AAV38405.1|  cathepsin F                                           70.5    2e-11   
ref|XP_004051670.1|  PREDICTED: cathepsin F                           70.5    2e-11   
ref|NP_001029282.1|  cathepsin F precursor                            70.5    2e-11   
ref|NP_063914.1|  cathepsin F precursor                               70.5    2e-11   
ref|NP_003784.2|  cathepsin F precursor                               70.5    2e-11   
ref|XP_002755611.1|  PREDICTED: cathepsin F                           70.5    2e-11   
gb|AAF13146.1|AF136279_1  cathepsin F precursor                       70.5    2e-11   
ref|XP_005333611.1|  PREDICTED: cathepsin F                           70.1    2e-11   
ref|XP_007942912.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      70.1    2e-11   



>gb|AAK27969.1|AF242373_1 cysteine protease [Ipomoea batatas]
Length=366

 Score =   153 bits (386),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/75 (93%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN+CGVD
Sbjct  292  YICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVD  351

Query  181  SMVSTVAAVNTPTSD  225
            SMVSTVAAV+T TSD
Sbjct  352  SMVSTVAAVSTTTSD  366



>gb|AAF61440.1|AF138264_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/75 (93%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN+CGVD
Sbjct  294  YICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVD  353

Query  181  SMVSTVAAVNTPTSD  225
            SMVSTVAAV+T TSD
Sbjct  354  SMVSTVAAVSTTTSD  368



>gb|AAF40415.1|AF216784_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=368

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/75 (93%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN+CGVD
Sbjct  294  YICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVD  353

Query  181  SMVSTVAAVNTPTSD  225
            SMVSTVAAV+T TSD
Sbjct  354  SMVSTVAAVSTTTSD  368



>gb|AAF40414.1|AF216783_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/75 (93%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN+CGVD
Sbjct  294  YICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVD  353

Query  181  SMVSTVAAVNTPTSD  225
            SMVSTVAAV+T TSD
Sbjct  354  SMVSTVAAVSTTTSD  368



>gb|AAF61441.1|AF138265_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=366

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/75 (93%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN+CGVD
Sbjct  292  YICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVD  351

Query  181  SMVSTVAAVNTPTSD  225
            SMVSTVAAV+T TSD
Sbjct  352  SMVSTVAAVSTTTSD  366



>gb|AAF40416.1|AF216785_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
 gb|AAF61442.1|AF138266_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
Length=366

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/75 (93%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN+CGVD
Sbjct  292  YICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVD  351

Query  181  SMVSTVAAVNTPTSD  225
            SMVSTVAAV+T TSD
Sbjct  352  SMVSTVAAVSTTTSD  366



>gb|KDP41743.1| hypothetical protein JCGZ_26761 [Jatropha curcas]
Length=370

 Score =   147 bits (372),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 67/74 (91%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGE+WGE GYYKICRGRN+CGVD
Sbjct  297  YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGETWGESGYYKICRGRNVCGVD  356

Query  181  SMVSTVAAVNTPTS  222
            SMVSTVAAV T + 
Sbjct  357  SMVSTVAAVQTSSQ  370



>sp|P05993.1|PAPA5_CARPA RecName: Full=Cysteine proteinase; AltName: Full=Clone PLBPC13, 
partial [Carica papaya]
 emb|CAA27609.1| pot. cysteine proteinase [Carica papaya]
Length=96

 Score =   139 bits (351),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICS+RL+HGVLLVGYGSAGYAPIRLKEKPYW+IKNSWGE+WGE GYYKICRGRNICGVD
Sbjct  23   YICSRRLNHGVLLVGYGSAGYAPIRLKEKPYWVIKNSWGENWGENGYYKICRGRNICGVD  82

Query  181  SMVSTVAAVNTPTS  222
            SMVSTVAAV+T + 
Sbjct  83   SMVSTVAAVHTTSQ  96



>ref|XP_002512963.1| cysteine protease, putative [Ricinus communis]
 gb|EEF49466.1| cysteine protease, putative [Ricinus communis]
Length=373

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/73 (92%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGE+WGE GYYKICRGRNICGVD
Sbjct  300  YICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGENWGESGYYKICRGRNICGVD  359

Query  181  SMVSTVAAVNTPT  219
            SMVSTVAAV T +
Sbjct  360  SMVSTVAAVQTAS  372



>gb|KHG24064.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=374

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYGSAGYAPIRLK+KPYWIIKNSWGE+WGE GYYKICRGRN+CGVD
Sbjct  301  YICSKRLDHGVLLVGYGSAGYAPIRLKDKPYWIIKNSWGETWGENGYYKICRGRNVCGVD  360

Query  181  SMVSTVAAVNT  213
            S+VSTVAAVNT
Sbjct  361  SLVSTVAAVNT  371



>gb|AIB06024.1| CP2 [Hevea brasiliensis]
Length=372

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/75 (91%), Positives = 71/75 (95%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYGSAGYAP+RLKEKPYWIIKNSWGE+WGE GYYKICRGRNICGVD
Sbjct  298  YICSKRLDHGVLLVGYGSAGYAPVRLKEKPYWIIKNSWGENWGESGYYKICRGRNICGVD  357

Query  181  SMVSTVAA-VNTPTS  222
            SMVSTVAA V TP+ 
Sbjct  358  SMVSTVAAVVQTPSQ  372



>ref|XP_007042077.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOX97908.1| Papain family cysteine protease [Theobroma cacao]
Length=395

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYGSAGYAP+R+K+KPYWIIKNSWGESWGE G+YKICRGRNICGVD
Sbjct  322  YICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGESWGEDGFYKICRGRNICGVD  381

Query  181  SMVSTVAAVNT  213
            SMVSTVAAV+T
Sbjct  382  SMVSTVAAVDT  392



>gb|AAX19661.1| cysteine proteinase [Populus tomentosa]
Length=374

 Score =   145 bits (367),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 65/73 (89%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICS+RLDHGVLLVGYGSAGYAP+R+KEKPYWIIKNSWGESWGE G+YKICRGRNICGVD
Sbjct  301  YICSRRLDHGVLLVGYGSAGYAPVRMKEKPYWIIKNSWGESWGENGFYKICRGRNICGVD  360

Query  181  SMVSTVAAVNTPT  219
            SMVSTVAAV T +
Sbjct  361  SMVSTVAAVQTSS  373



>gb|KJB32561.1| hypothetical protein B456_005G247000 [Gossypium raimondii]
Length=374

 Score =   145 bits (367),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYGSAGYAPIRLK+KPYWIIKNSWGE+WGE G+YKICRGRN+CGVD
Sbjct  301  YICSKRLDHGVLLVGYGSAGYAPIRLKDKPYWIIKNSWGETWGENGFYKICRGRNVCGVD  360

Query  181  SMVSTVAAVNT  213
            S+VSTVAAVNT
Sbjct  361  SLVSTVAAVNT  371



>gb|ABQ10201.1| cysteine protease Cp3 [Actinidia deliciosa]
Length=365

 Score =   145 bits (366),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE G+YKIC+GRN+CGVD
Sbjct  292  YICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGFYKICQGRNVCGVD  351

Query  181  SMVSTVAAVNTPTS  222
            SMVSTVAAV+T ++
Sbjct  352  SMVSTVAAVHTTSN  365



>ref|XP_011047717.1| PREDICTED: cysteine proteinase RD19a [Populus euphratica]
Length=368

 Score =   145 bits (366),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICS+RLDHGVLLVGYGSAGYAP+R+KEKPYWIIKNSWGESWGE G+YKICRGRNICGVD
Sbjct  295  YICSRRLDHGVLLVGYGSAGYAPVRMKEKPYWIIKNSWGESWGENGFYKICRGRNICGVD  354

Query  181  SMVSTVAAVNT  213
            SMVSTVAAV T
Sbjct  355  SMVSTVAAVQT  365



>gb|ABK96252.1| unknown [Populus trichocarpa x Populus deltoides]
Length=156

 Score =   139 bits (351),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICS+RLDHGVLLVGYGSAGY+P+R+KEKP+WIIKNSWGE WGE G+YKICRGRN+CGVD
Sbjct  84   YICSRRLDHGVLLVGYGSAGYSPVRMKEKPFWIIKNSWGEKWGENGFYKICRGRNVCGVD  143

Query  181  SMVSTVAAVNTPT  219
            SMVSTVAAV T +
Sbjct  144  SMVSTVAAVQTSS  156



>gb|KJB79047.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
Length=373

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYGSAGYAP+R+K+KPYWIIKNSWGE+WGE G+Y+ICRGRNICGVD
Sbjct  300  YICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGENGFYRICRGRNICGVD  359

Query  181  SMVSTVAAVNT  213
            SMVSTVAAVNT
Sbjct  360  SMVSTVAAVNT  370



>emb|CAE54306.1| putative papain-like cysteine proteinase [Gossypium hirsutum]
Length=373

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYGSAGYAP+R+K+KPYWIIKNSWGE+WGE G+Y+ICRGRNICGVD
Sbjct  300  YICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGENGFYRICRGRNICGVD  359

Query  181  SMVSTVAAVNT  213
            SMVSTVAAVNT
Sbjct  360  SMVSTVAAVNT  370



>emb|CDP20652.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/73 (90%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYGS+GYAPIR+KEKPYWIIKNSWGE WGE GYYKICRG NICGVD
Sbjct  300  YICSKRLDHGVLLVGYGSSGYAPIRMKEKPYWIIKNSWGEHWGENGYYKICRGHNICGVD  359

Query  181  SMVSTVAAVNTPT  219
            SMVSTVAAV+T T
Sbjct  360  SMVSTVAAVHTST  372



>gb|KHG15253.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=373

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYGSAGYAP+R+K+KPYWIIKNSWGE+WGE G+Y+ICRGRNICGVD
Sbjct  300  YICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGENGFYRICRGRNICGVD  359

Query  181  SMVSTVAAVNT  213
            SMVSTVAAVNT
Sbjct  360  SMVSTVAAVNT  370



>ref|NP_001267989.1| cysteine protease precursor [Vitis vinifera]
 gb|ABX79341.1| cysteine protease [Vitis vinifera]
Length=377

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYGSAGYAPIR+K+KPYWIIKNSWGE+WGE G+YKICRGRN+CGVD
Sbjct  304  YICSKRLDHGVLLVGYGSAGYAPIRMKDKPYWIIKNSWGENWGENGFYKICRGRNVCGVD  363

Query  181  SMVSTVAAVNTPTS  222
            SMVSTVAAV+T ++
Sbjct  364  SMVSTVAAVHTTSN  377



>ref|XP_009376976.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=445

 Score =   145 bits (365),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 63/74 (85%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICS+RLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGESW E G+YKICRGRNICGVD
Sbjct  370  YICSRRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGESWRESGFYKICRGRNICGVD  429

Query  181  SMVSTVAAVNTPTS  222
            SMVSTVAA +  T+
Sbjct  430  SMVSTVAAASVKTN  443



>ref|XP_002313770.1| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE87725.1| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICS+RLDHGVLLVGYGSA YAP+R+KEKPYWIIKNSWGESWGE G+YKICRGRNICGVD
Sbjct  295  YICSRRLDHGVLLVGYGSAAYAPVRMKEKPYWIIKNSWGESWGENGFYKICRGRNICGVD  354

Query  181  SMVSTVAAVNT  213
            SMVSTVAAV T
Sbjct  355  SMVSTVAAVQT  365



>gb|ABK92536.1| unknown [Populus trichocarpa]
Length=368

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICS+RLDHGVLLVGYGSA YAP+R+KEKPYWIIKNSWGESWGE G+YKICRGRNICGVD
Sbjct  295  YICSRRLDHGVLLVGYGSAAYAPVRMKEKPYWIIKNSWGESWGENGFYKICRGRNICGVD  354

Query  181  SMVSTVAAVNT  213
            SMVSTVAAV T
Sbjct  355  SMVSTVAAVQT  365



>ref|XP_003606998.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89195.1| papain family cysteine protease [Medicago truncatula]
Length=362

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/73 (90%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYGS  Y+PIRLKEKPYWIIKNSWGE+WGE GYYKICRGRNICGVD
Sbjct  290  YICSKRLDHGVLLVGYGSGAYSPIRLKEKPYWIIKNSWGETWGENGYYKICRGRNICGVD  349

Query  181  SMVSTVAAVNTPT  219
            SMVSTVAAV+T T
Sbjct  350  SMVSTVAAVHTTT  362



>ref|XP_007017672.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOY14897.1| Papain family cysteine protease [Theobroma cacao]
Length=401

 Score =   144 bits (363),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE+GYYKICRGRN+CGVD
Sbjct  328  YICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEEGYYKICRGRNVCGVD  387

Query  181  SMVSTVAAVNTPT  219
            SMVS+VAA+ T +
Sbjct  388  SMVSSVAALQTKS  400



>ref|XP_009376977.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=447

 Score =   144 bits (364),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 63/74 (85%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICS+RLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGESW E G+YKICRGRNICGVD
Sbjct  372  YICSRRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGESWRESGFYKICRGRNICGVD  431

Query  181  SMVSTVAAVNTPTS  222
            SMVSTVAA +  T+
Sbjct  432  SMVSTVAAASVKTN  445



>ref|XP_009351218.1| PREDICTED: cysteine proteinase RD19a-like, partial [Pyrus x bretschneideri]
Length=282

 Score =   141 bits (356),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YKICRGRNICGVD
Sbjct  207  YICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKICRGRNICGVD  266

Query  181  SMVSTVAAVNTPTS  222
            SMVSTVAA +  T+
Sbjct  267  SMVSTVAAASVKTN  280



>ref|XP_009373025.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=371

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YKICRGRNICGVD
Sbjct  296  YICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKICRGRNICGVD  355

Query  181  SMVSTVAAVNTPTS  222
            SMVSTVAA +  T+
Sbjct  356  SMVSTVAAASVKTN  369



>ref|XP_004290288.1| PREDICTED: probable cysteine proteinase A494 [Fragaria vesca 
subsp. vesca]
Length=372

 Score =   143 bits (360),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYGSAGY+P+R+KEKPYWIIKNSWGE+WGEKG+YKICRGRNICGVD
Sbjct  302  YICSKRLDHGVLLVGYGSAGYSPVRMKEKPYWIIKNSWGENWGEKGFYKICRGRNICGVD  361

Query  181  SMVSTVAAVN  210
            SMVSTVAAV 
Sbjct  362  SMVSTVAAVE  371



>ref|XP_007131787.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
 gb|ESW03781.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
Length=361

 Score =   142 bits (359),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/73 (89%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICS+RLDHGVLLVGYGS  YAPIR+KEKPYWIIKNSWGE+WGE GYYKICRGRNICGVD
Sbjct  288  YICSRRLDHGVLLVGYGSGAYAPIRMKEKPYWIIKNSWGENWGENGYYKICRGRNICGVD  347

Query  181  SMVSTVAAVNTPT  219
            SMVSTVAAV+T T
Sbjct  348  SMVSTVAAVHTTT  360



>ref|XP_006487337.1| PREDICTED: cysteine proteinase RD19a-like [Citrus sinensis]
Length=373

 Score =   142 bits (359),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICS+RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE GYYKICRGRN+CGVD
Sbjct  304  YICSRRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVD  363

Query  181  SMVSTVAAV  207
            SMVSTVAA 
Sbjct  364  SMVSTVAAA  372



>gb|KDO49483.1| hypothetical protein CISIN_1g017318mg [Citrus sinensis]
Length=373

 Score =   142 bits (359),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICS+RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE GYYKICRGRN+CGVD
Sbjct  304  YICSRRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVD  363

Query  181  SMVSTVAAV  207
            SMVSTVAA 
Sbjct  364  SMVSTVAAA  372



>gb|KHN39817.1| Cysteine proteinase RD19a [Glycine soja]
Length=332

 Score =   142 bits (357),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICS+RLDHGVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYKICRGRNICGVD
Sbjct  259  YICSRRLDHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKICRGRNICGVD  318

Query  181  SMVSTVAAVNTPTS  222
            SMVSTVAAV+T T 
Sbjct  319  SMVSTVAAVHTTTQ  332



>ref|XP_009373000.1| PREDICTED: cysteine proteinase RD19a [Pyrus x bretschneideri]
Length=371

 Score =   142 bits (359),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YKICRGRNICGVD
Sbjct  296  YICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKICRGRNICGVD  355

Query  181  SMVSTVAAVNTPTS  222
            SMVSTVAA +  T+
Sbjct  356  SMVSTVAAASVKTN  369



>ref|XP_008382317.1| PREDICTED: cysteine proteinase RD19a [Malus domestica]
Length=371

 Score =   142 bits (359),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YKICRGRNICGVD
Sbjct  296  YICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKICRGRNICGVD  355

Query  181  SMVSTVAAVNTPTS  222
            SMVSTVAA +  T+
Sbjct  356  SMVSTVAAASVKTN  369



>ref|XP_008236965.1| PREDICTED: cysteine proteinase RD19a [Prunus mume]
Length=367

 Score =   142 bits (359),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYG+AGY+PIR+KEKPYWIIKNSWGE+WGEKG+YKIC+GRNICGVD
Sbjct  292  YICSKRLDHGVLLVGYGAAGYSPIRMKEKPYWIIKNSWGENWGEKGFYKICKGRNICGVD  351

Query  181  SMVSTVAAVNTPTS  222
            SMVSTVAA +  T+
Sbjct  352  SMVSTVAAASVETN  365



>ref|XP_003539008.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=363

 Score =   142 bits (358),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICS+RLDHGVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYKICRGRNICGVD
Sbjct  290  YICSRRLDHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKICRGRNICGVD  349

Query  181  SMVSTVAAVNTPTS  222
            SMVSTVAAV+T T 
Sbjct  350  SMVSTVAAVHTTTQ  363



>ref|XP_007201310.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
 gb|EMJ02509.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
Length=367

 Score =   142 bits (358),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYG+AGY+PIR+KEKPYWIIKNSWGE+WGEKG+YKIC+GRNICGVD
Sbjct  292  YICSKRLDHGVLLVGYGAAGYSPIRMKEKPYWIIKNSWGENWGEKGFYKICKGRNICGVD  351

Query  181  SMVSTVAAVNTPTS  222
            SMVSTVAA +  T+
Sbjct  352  SMVSTVAAASVETN  365



>ref|XP_010271520.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=370

 Score =   142 bits (359),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYGS GYAPIRLK+KPYWIIKNSWGE WGE GYYKICRGRN+CGVD
Sbjct  297  YICSKRLDHGVLLVGYGSEGYAPIRLKDKPYWIIKNSWGEGWGENGYYKICRGRNVCGVD  356

Query  181  SMVSTVAAVN  210
            SMVSTVAAVN
Sbjct  357  SMVSTVAAVN  366



>gb|ACI04578.1| cysteine protease-like protein [Robinia pseudoacacia]
Length=335

 Score =   141 bits (356),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC K LDHGVLLVGYG AGYAPIRLKEKPYWIIKNSWGESWGE GYYKICRGRN+CGVD
Sbjct  262  YICGKNLDHGVLLVGYGKAGYAPIRLKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVD  321

Query  181  SMVSTVAAVNT  213
            SMVSTVAAV+T
Sbjct  322  SMVSTVAAVHT  332



>ref|XP_004507484.1| PREDICTED: cysteine proteinase RD19a-like [Cicer arietinum]
Length=363

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICS+RLDHGVLLVGYGS  YAPIR+KEKPYWIIKNSWGE+WGE G+YKICRGRNICGVD
Sbjct  290  YICSRRLDHGVLLVGYGSGAYAPIRMKEKPYWIIKNSWGENWGENGFYKICRGRNICGVD  349

Query  181  SMVSTVAAVNTPTS  222
            SMVSTVAAV+T T 
Sbjct  350  SMVSTVAAVHTTTQ  363



>ref|XP_010028631.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW55393.1| hypothetical protein EUGRSUZ_I01305 [Eucalyptus grandis]
Length=370

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 70/76 (92%), Gaps = 2/76 (3%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYGSAGYAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRNICGVD
Sbjct  294  YICSKRLDHGVLLVGYGSAGYAPIRMKDKPYWIIKNSWGETWGENGYYKICRGRNICGVD  353

Query  181  SMVSTVAAV--NTPTS  222
            SMVSTVAA    TP S
Sbjct  354  SMVSTVAAAVHTTPGS  369



>ref|XP_011028940.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKR DHGVLLVGYGSAGYAPIR KEKP+WIIKNSWGE+WGE GYYKICRGRNICGVD
Sbjct  294  YICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGENWGENGYYKICRGRNICGVD  353

Query  181  SMVSTVAAVNT  213
            SMVSTVAA++T
Sbjct  354  SMVSTVAAIHT  364



>ref|XP_006423403.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
 gb|ESR36643.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
Length=375

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICS+RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE GYYKICRGRN+CGVD
Sbjct  304  YICSRRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVD  363

Query  181  SMVSTVAAV  207
            SMVST+AA 
Sbjct  364  SMVSTIAAA  372



>ref|XP_011088458.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Sesamum indicum]
Length=379

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  4    ICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDS  183
            ICSKRLDHGVLLVGYG AGYAPIR KEKPYWIIKNSWGE WGEKGYYKICRGRNICGVDS
Sbjct  308  ICSKRLDHGVLLVGYGEAGYAPIRRKEKPYWIIKNSWGEKWGEKGYYKICRGRNICGVDS  367

Query  184  MVSTVAAVNT  213
            MVSTVAAV+T
Sbjct  368  MVSTVAAVST  377



>emb|CDQ51995.1| Cysteine proteinase, partial [Fagus sylvatica]
Length=165

 Score =   136 bits (343),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC + LDHGVLLVG+GSAGYAPIRLKEKP+WIIKNSWGE+WGE GYYKICRGRN+CGVD
Sbjct  95   YICGRHLDHGVLLVGFGSAGYAPIRLKEKPFWIIKNSWGENWGENGYYKICRGRNVCGVD  154

Query  181  SMVSTVAAVN  210
            SMVSTVAA+N
Sbjct  155  SMVSTVAAIN  164



>gb|AAL69389.1|AF462226_1 putative cysteine proteinase [Narcissus pseudonarcissus]
Length=136

 Score =   135 bits (340),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC K LDHGVLLVGYGS+G+APIR KEKPYWIIKNSWGE+WGEKGYYKIC+GRN+CGVD
Sbjct  62   YICGKHLDHGVLLVGYGSSGWAPIRFKEKPYWIIKNSWGENWGEKGYYKICKGRNVCGVD  121

Query  181  SMVSTVAAVNTPTSD  225
            SMVSTV A++T   D
Sbjct  122  SMVSTVTAIHTTPKD  136



>ref|XP_011037175.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
 ref|XP_011037176.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
Length=368

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICS+RLDHGVLLVGYGSAGY+PIR+K+KPYWIIKNSWGE WGE G+YKICRGRN+CGVD
Sbjct  295  YICSRRLDHGVLLVGYGSAGYSPIRMKDKPYWIIKNSWGEKWGENGFYKICRGRNVCGVD  354

Query  181  SMVSTVAAVNTPTS  222
            SMVSTVAAV T + 
Sbjct  355  SMVSTVAAVQTTSQ  368



>gb|AAR92156.1| putative cysteine protease 3 [Iris x hollandica]
Length=292

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC K LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGE+WGE GYYKICRGRN+CGVD
Sbjct  217  YICGKHLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGETWGENGYYKICRGRNVCGVD  276

Query  181  SMVSTVAAVNT  213
            SMVSTV A++T
Sbjct  277  SMVSTVTAIHT  287



>ref|XP_010066197.1| PREDICTED: probable cysteine proteinase A494 [Eucalyptus grandis]
 gb|KCW64029.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
 gb|KCW64030.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
Length=376

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYGSA Y+PIR+KEKPYWIIKNSWGE+WGE G+YKICRGRNICGVD
Sbjct  303  YICSKRLDHGVLLVGYGSAAYSPIRMKEKPYWIIKNSWGENWGENGFYKICRGRNICGVD  362

Query  181  SMVSTVAAVNT  213
            SMVSTVAA++T
Sbjct  363  SMVSTVAAIHT  373



>ref|XP_002305451.2| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE85962.2| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICS+RLDHGVLLVGYGSAGY+P+R+KEKP+WIIKNSWGE WGE G+YKICRGRN+CGVD
Sbjct  295  YICSRRLDHGVLLVGYGSAGYSPVRMKEKPFWIIKNSWGEKWGENGFYKICRGRNVCGVD  354

Query  181  SMVSTVAAVNTPTS  222
            SMVSTVAAV T + 
Sbjct  355  SMVSTVAAVQTSSQ  368



>gb|ABK96580.1| unknown [Populus trichocarpa x Populus deltoides]
Length=367

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKR DHGVLLVGYGSAGYAPIR KEKP+WIIKNSWG++WGE GYYKICRGRNICGVD
Sbjct  294  YICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGENGYYKICRGRNICGVD  353

Query  181  SMVSTVAAVNT  213
            SMVSTVAA++T
Sbjct  354  SMVSTVAAIHT  364



>gb|AJP16692.1| cysteine protease, partial [Striga hermonthica]
Length=148

 Score =   135 bits (341),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYG +GYAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRN+CGVD
Sbjct  81   YICSKRLDHGVLLVGYGESGYAPIRMKDKPYWIIKNSWGENWGENGYYKICRGRNVCGVD  140

Query  181  SMVSTVAA  204
            SMVSTVAA
Sbjct  141  SMVSTVAA  148



>ref|XP_002302004.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
 gb|ABK94746.1| unknown [Populus trichocarpa]
 gb|EEE81277.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
Length=367

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKR DHGVLLVGYGSAGYAPIR KEKP+WIIKNSWG++WGE GYYKICRGRNICGVD
Sbjct  294  YICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGENGYYKICRGRNICGVD  353

Query  181  SMVSTVAAVNT  213
            SMVSTVAA++T
Sbjct  354  SMVSTVAAIHT  364



>gb|ABK94801.1| unknown [Populus trichocarpa]
Length=367

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKR DHGVLLVGYGSAGYAPIR KEKP+WIIKNSWG++WGE GYYKICRGRNICGVD
Sbjct  294  YICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGENGYYKICRGRNICGVD  353

Query  181  SMVSTVAAVNT  213
            SMVSTVAA++T
Sbjct  354  SMVSTVAAIHT  364



>ref|XP_009406357.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=372

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC + LDHGVLLVGYGSAGY+PIRLK+KP+WIIKNSWGE+WGEKGYYKICRGRN+CGVD
Sbjct  298  YICGRHLDHGVLLVGYGSAGYSPIRLKQKPFWIIKNSWGETWGEKGYYKICRGRNVCGVD  357

Query  181  SMVSTVAAVNT  213
            SMVSTV A+NT
Sbjct  358  SMVSTVTAINT  368



>ref|XP_011092831.1| PREDICTED: cysteine proteinase RD19a-like [Sesamum indicum]
Length=378

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            +ICSKRLDHGVLLVGYG+A YAPIRLKEKPYWIIKNSWGE+WGE GYYKICRG N+CGVD
Sbjct  306  FICSKRLDHGVLLVGYGAASYAPIRLKEKPYWIIKNSWGENWGENGYYKICRGHNVCGVD  365

Query  181  SMVSTVAAVNT  213
            SMVSTVAAV+T
Sbjct  366  SMVSTVAAVST  376



>ref|XP_002280798.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CAN73591.1| hypothetical protein VITISV_022889 [Vitis vinifera]
 emb|CBI19785.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   140 bits (352),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICS  LDHGVLLVGYGSAGY+PIR KEKPYWIIKNSWGESWGE+GYYKICRG NICGVD
Sbjct  298  YICSSTLDHGVLLVGYGSAGYSPIRFKEKPYWIIKNSWGESWGEQGYYKICRGHNICGVD  357

Query  181  SMVSTVAAVNT  213
            SMVSTVAA++T
Sbjct  358  SMVSTVAAIHT  368



>ref|XP_004150061.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004166953.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN61836.1| Cysteine protease [Cucumis sativus]
Length=377

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSK LDHGVLLVGYGS GYAPIRLK+KPYWIIKNSWG +WGE GYYKICRGRNICGVD
Sbjct  304  YICSKHLDHGVLLVGYGSDGYAPIRLKDKPYWIIKNSWGANWGENGYYKICRGRNICGVD  363

Query  181  SMVSTVAAVNT  213
            SMVSTVAAV+T
Sbjct  364  SMVSTVAAVHT  374



>gb|ABK93575.1| unknown [Populus trichocarpa]
Length=157

 Score =   134 bits (336),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSK  DHGVLLVGYG+AGYAPIR KEKP+WIIKNSWGE+WGE GYYKICR RNICGVD
Sbjct  84   YICSKHQDHGVLLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGENGYYKICRARNICGVD  143

Query  181  SMVSTVAAVNT  213
            SMVSTVAA++ 
Sbjct  144  SMVSTVAAIHA  154



>ref|XP_010061009.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW67908.1| hypothetical protein EUGRSUZ_F01612 [Eucalyptus grandis]
Length=369

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC K LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYKICRGR+ICGVD
Sbjct  296  YICGKHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGRDICGVD  355

Query  181  SMVSTVAAVNT  213
            SMVSTVAA++T
Sbjct  356  SMVSTVAAIHT  366



>gb|AAU81591.1| cysteine proteinase, partial [Petunia x hybrida]
Length=190

 Score =   134 bits (338),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 68/73 (93%), Gaps = 1/73 (1%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKR DHGVLLVGYGS G+APIR+KEKPYWIIKNSWGE WGE GYYKICRGRN+CGVD
Sbjct  119  YICSKRQDHGVLLVGYGS-GFAPIRMKEKPYWIIKNSWGEKWGESGYYKICRGRNVCGVD  177

Query  181  SMVSTVAAVNTPT  219
            SMVSTVAAV+T +
Sbjct  178  SMVSTVAAVSTSS  190



>gb|EYU37835.1| hypothetical protein MIMGU_mgv1a008237mg [Erythranthe guttata]
Length=380

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC+KRLDHGVLLVGYG  GY+PIR+KEKPYWIIKNSWG +WGE GYYKICRGRNICGVD
Sbjct  307  YICTKRLDHGVLLVGYGETGYSPIRMKEKPYWIIKNSWGPNWGEDGYYKICRGRNICGVD  366

Query  181  SMVSTVAAVNTPT  219
            SMVSTVAAV+T +
Sbjct  367  SMVSTVAAVSTTS  379



>ref|XP_002275759.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI17456.3| unnamed protein product [Vitis vinifera]
Length=367

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICS+ LDHGV+LVGYGSAGYAPIR KEKPYWIIKNSWGESWGE GYYKICRG N CGVD
Sbjct  294  YICSRNLDHGVVLVGYGSAGYAPIRFKEKPYWIIKNSWGESWGEDGYYKICRGHNACGVD  353

Query  181  SMVSTVAAVNTPTS  222
            SMVSTVAA+ T T 
Sbjct  354  SMVSTVAAIQTTTQ  367



>ref|XP_002510469.1| cysteine protease, putative [Ricinus communis]
 gb|EEF52656.1| cysteine protease, putative [Ricinus communis]
Length=366

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKR DHGV+LVGYGSAGYAP+RLK+KP+WIIKNSWGE+WGE GYYKICRGRN+CGVD
Sbjct  293  YICSKRQDHGVVLVGYGSAGYAPVRLKDKPFWIIKNSWGENWGENGYYKICRGRNVCGVD  352

Query  181  SMVSTVAAVNT  213
            +MVSTVAA++T
Sbjct  353  AMVSTVAAIHT  363



>dbj|BAD94010.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
Length=86

 Score =   131 bits (329),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC++RL+HGVLLVGYG+AGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVD
Sbjct  12   YICTRRLNHGVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVD  71

Query  181  SMVSTVAAVNTPTSD  225
            SMVSTVAA  + T+ 
Sbjct  72   SMVSTVAATVSTTAH  86



>ref|XP_003540987.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=365

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            Y+CS+RL+HGVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYKICRGRNICGVD
Sbjct  292  YVCSRRLNHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKICRGRNICGVD  351

Query  181  SMVSTVAAVNTPTS  222
            SMVSTVA+V+T T 
Sbjct  352  SMVSTVASVHTTTQ  365



>ref|XP_004148554.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Cucumis sativus]
Length=381

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            +ICSKRLDHGVLLVGYGSAGYAPIR+++K YWIIKNSWGESWGE GYYKICRGRNICGVD
Sbjct  298  FICSKRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGENGYYKICRGRNICGVD  357

Query  181  SMVSTVAAVN  210
            S+VSTVAAV+
Sbjct  358  SLVSTVAAVH  367



>gb|KGN43159.1| Papain-like cysteine proteinase isoform I [Cucumis sativus]
Length=387

 Score =   138 bits (348),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            +ICSKRLDHGVLLVGYGSAGYAPIR+++K YWIIKNSWGESWGE GYYKICRGRNICGVD
Sbjct  304  FICSKRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGENGYYKICRGRNICGVD  363

Query  181  SMVSTVAAVN  210
            S+VSTVAAV+
Sbjct  364  SLVSTVAAVH  373



>ref|XP_004165230.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
Length=387

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            +ICSKRLDHGVLLVGYGSAGYAPIR+++K YWIIKNSWGESWGE GYYKICRGRNICGVD
Sbjct  304  FICSKRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGENGYYKICRGRNICGVD  363

Query  181  SMVSTVAAVN  210
            S+VSTVAAV+
Sbjct  364  SLVSTVAAVH  373



>gb|AAU81589.1| cysteine proteinase [Petunia x hybrida]
Length=257

 Score =   135 bits (340),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  4    ICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDS  183
            IC KR DHGVLLVGYGSAG+APIRLKEKPYWIIKNSWGESWGE+GYYKICRGRNICGVD+
Sbjct  183  ICFKRQDHGVLLVGYGSAGFAPIRLKEKPYWIIKNSWGESWGEQGYYKICRGRNICGVDA  242

Query  184  MVSTVAAVNT  213
            MVSTV A +T
Sbjct  243  MVSTVTAAHT  252



>ref|XP_010268619.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=369

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICS+RL+HGVLLVGYGS GY+PIR+K+KPYWIIKNSWGESWGE GYYKICRGR++CGVD
Sbjct  296  YICSRRLNHGVLLVGYGSEGYSPIRMKDKPYWIIKNSWGESWGENGYYKICRGRDVCGVD  355

Query  181  SMVSTVAAVNT  213
            SMVSTVAA++T
Sbjct  356  SMVSTVAAIHT  366



>ref|XP_008460996.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=377

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICS+ LDHGVLLVGYGS GYAPIR+K+KPYWIIKNSWG +WGE GYYKICRGRNICGVD
Sbjct  304  YICSRHLDHGVLLVGYGSEGYAPIRMKDKPYWIIKNSWGANWGENGYYKICRGRNICGVD  363

Query  181  SMVSTVAAVNT  213
            SMVSTVAAV+T
Sbjct  364  SMVSTVAAVHT  374



>dbj|BAJ53178.1| JHL18I08.12 [Jatropha curcas]
 gb|KDP38578.1| hypothetical protein JCGZ_04503 [Jatropha curcas]
Length=368

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKR DHGVLLVGYGSAGYAPIRLK+KP+WIIKNSWGESWGE GYY+ICRGRNICGVD
Sbjct  294  YICSKRQDHGVLLVGYGSAGYAPIRLKDKPFWIIKNSWGESWGENGYYRICRGRNICGVD  353

Query  181  SMVSTVAAVN  210
            +MVS+VAA++
Sbjct  354  AMVSSVAAIH  363



>gb|ABF46642.1| papain-like cysteine proteinase [Pachysandra terminalis]
Length=374

 Score =   137 bits (344),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 68/74 (92%), Gaps = 2/74 (3%)
 Frame = +1

Query  1    YICSKRL-DHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGV  177
            YICSKRL DHGVLLVGYGSAG+APIR KEKPYWIIKNSWGESWGEKGYYKICRGRNICG+
Sbjct  300  YICSKRLLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGESWGEKGYYKICRGRNICGM  359

Query  178  DSMVSTVAAVNTPT  219
            DSMVS VAA   PT
Sbjct  360  DSMVSAVAAA-VPT  372



>ref|NP_001241450.1| uncharacterized protein LOC100778716 precursor [Glycine max]
 gb|ACU20049.1| unknown [Glycine max]
Length=366

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC K LDHGVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYYKICRGRN+CGVD
Sbjct  293  YICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYKICRGRNVCGVD  352

Query  181  SMVSTVAAVN  210
            SMVSTVAA++
Sbjct  353  SMVSTVAAIH  362



>ref|XP_003523684.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=366

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC K LDHGVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYYKICRGRN+CGVD
Sbjct  293  YICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYKICRGRNVCGVD  352

Query  181  SMVSTVAAVN  210
            SMVSTVAA++
Sbjct  353  SMVSTVAAIH  362



>gb|KHN45894.1| Cysteine proteinase RD19a [Glycine soja]
Length=366

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC K LDHGVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYYKICRGRN+CGVD
Sbjct  293  YICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYKICRGRNVCGVD  352

Query  181  SMVSTVAAVN  210
            SMVSTVAA++
Sbjct  353  SMVSTVAAIH  362



>ref|XP_010530325.1| PREDICTED: cysteine proteinase RD19a [Tarenaya hassleriana]
Length=370

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKR DHGVLLVGYGSAGY+PIRLKEKPYWIIKNSWG +WGE+GYYKIC GRN+CG+D
Sbjct  297  YICSKRQDHGVLLVGYGSAGYSPIRLKEKPYWIIKNSWGANWGEEGYYKICHGRNLCGMD  356

Query  181  SMVSTVAAVNTPTS  222
            +MVS+VAAV+T T 
Sbjct  357  TMVSSVAAVHTSTQ  370



>gb|KHN25410.1| Cysteine proteinase RD19a [Glycine soja]
Length=365

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            Y+CS+RL+HGVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYKICRGR+ICGVD
Sbjct  292  YVCSRRLNHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKICRGRSICGVD  351

Query  181  SMVSTVAAVNTPTS  222
            SMVSTVA+V+T T 
Sbjct  352  SMVSTVASVHTTTQ  365



>ref|XP_010531457.1| PREDICTED: probable cysteine proteinase A494 [Tarenaya hassleriana]
Length=364

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICS+RL+HGVLLVGYGSAGYAP R+KEKP+WIIKNSWGE+WGEKG+YKICRGRNICGVD
Sbjct  293  YICSRRLNHGVLLVGYGSAGYAPARMKEKPFWIIKNSWGENWGEKGFYKICRGRNICGVD  352

Query  181  SMVSTVAA  204
            S+VSTVAA
Sbjct  353  SLVSTVAA  360



>dbj|BAC41322.1| hypothetical protein [Lotus japonicus]
Length=358

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            Y+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRNICGVD
Sbjct  287  YVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICRGRNICGVD  346

Query  181  SMVSTVAAVNT  213
            SMVSTVAA++T
Sbjct  347  SMVSTVAALHT  357



>ref|XP_010910124.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=374

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC K LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYKIC+GRN+CGVD
Sbjct  303  YICGKHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEDGYYKICKGRNVCGVD  362

Query  181  SMVSTVAAVNT  213
            SMVSTV AV +
Sbjct  363  SMVSTVTAVRS  373



>gb|EYU42593.1| hypothetical protein MIMGU_mgv1a008336mg [Erythranthe guttata]
Length=377

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            +IC+KRLDHGVLLVGYG+  +APIR+KEKPYWIIKNSWG +WGEKGYYKIC+GRN+CGVD
Sbjct  306  FICAKRLDHGVLLVGYGAGAFAPIRMKEKPYWIIKNSWGPNWGEKGYYKICQGRNLCGVD  365

Query  181  SMVSTVAAVNT  213
            SMVSTVAAV T
Sbjct  366  SMVSTVAAVTT  376



>gb|AAL05851.1|AF411121_1 cysteine proteinase precursor [Sandersonia aurantiaca]
Length=360

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC K LDHGVLLVGYGSAG+APIR KEKPYWIIKNSWGE+WGE GYYKICRGRN+CGVD
Sbjct  288  YICGKHLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGENWGENGYYKICRGRNVCGVD  347

Query  181  SMVSTVAAVNT  213
            SMVS+V+A +T
Sbjct  348  SMVSSVSAFHT  358



>ref|XP_009602233.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana tomentosiformis]
Length=369

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 69/73 (95%), Gaps = 1/73 (1%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRLDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKICRGRN+CGVD
Sbjct  297  YICSKRLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGENGYYKICRGRNVCGVD  355

Query  181  SMVSTVAAVNTPT  219
            SMVSTVAAV+T +
Sbjct  356  SMVSTVAAVSTSS  368



>emb|CAE45588.1| papain-like cysteine proteinase-like protein 1 [Lotus japonicus]
Length=359

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            Y+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRNICGVD
Sbjct  288  YVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICRGRNICGVD  347

Query  181  SMVSTVAAVNT  213
            SMVSTVAA++T
Sbjct  348  SMVSTVAALHT  358



>ref|XP_008775532.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=371

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC + LDHGVLLVGYGSA YAPIR KEKPYWIIKNSWGE WGE GYYKICRGRN+CGVD
Sbjct  300  YICGRHLDHGVLLVGYGSAAYAPIRFKEKPYWIIKNSWGEKWGENGYYKICRGRNVCGVD  359

Query  181  SMVSTVAAVNT  213
            SMVSTVAAV +
Sbjct  360  SMVSTVAAVRS  370



>ref|XP_009392632.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=369

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC + LDHGVLLVGYGSAGY+PIRLK+KP+WIIKNSWGE+WGE GYYKICRGRNICGVD
Sbjct  295  YICGRHLDHGVLLVGYGSAGYSPIRLKDKPFWIIKNSWGENWGEHGYYKICRGRNICGVD  354

Query  181  SMVSTVAAVNT  213
            SMVS+V+A++T
Sbjct  355  SMVSSVSAIHT  365



>dbj|BAF98584.1| CM0216.500.nc [Lotus japonicus]
Length=360

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            Y+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRNICGVD
Sbjct  287  YVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICRGRNICGVD  346

Query  181  SMVSTVAAVNT  213
            SMVSTVAA++T
Sbjct  347  SMVSTVAALHT  357



>ref|XP_011045161.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSK  DHGVLLVGYG+AGYAPIR KEKP+WIIKNSWGE+WGE GYYKICR RNICGVD
Sbjct  294  YICSKHQDHGVLLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGENGYYKICRARNICGVD  353

Query  181  SMVSTVAAVN  210
            SMVSTVAA++
Sbjct  354  SMVSTVAAIH  363



>ref|XP_009109502.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
 emb|CDX90310.1| BnaA08g16740D [Brassica napus]
Length=369

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKICRGRN+CGVD
Sbjct  295  YICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICRGRNVCGVD  354

Query  181  SMVSTVAAVNTPTS  222
            S+VSTV A  +PT+
Sbjct  355  SLVSTVTAAVSPTA  368



>gb|KHN12668.1| Cysteine proteinase 15A [Glycine soja]
Length=156

 Score =   130 bits (327),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC K LDHGVLLVGYG   YAPIR K KPYWIIKNSWGESWGE GYYKICRGRN+CGVD
Sbjct  83   YICGKHLDHGVLLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYYKICRGRNVCGVD  142

Query  181  SMVSTVAAV  207
            SMVSTVAA+
Sbjct  143  SMVSTVAAI  151



>ref|XP_002306900.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
 gb|ABK92924.1| unknown [Populus trichocarpa]
 gb|EEE93896.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
Length=367

 Score =   135 bits (340),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSK  DHGVLLVGYG+AGYAPIR KEKP+WIIKNSWGE+WGE GYYKICR RNICGVD
Sbjct  294  YICSKHQDHGVLLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGENGYYKICRARNICGVD  353

Query  181  SMVSTVAAVN  210
            SMVSTVAA++
Sbjct  354  SMVSTVAAIH  363



>ref|XP_008448073.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=385

 Score =   135 bits (340),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            +ICS RLDHGVLLVGYGSAGYAPIR+++K YWIIKNSWGE+WGE GYYKICRGRNICGVD
Sbjct  302  FICSNRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGENWGENGYYKICRGRNICGVD  361

Query  181  SMVSTVAAVN  210
            S+VSTVAAV+
Sbjct  362  SLVSTVAAVH  371



>emb|CAE45589.1| papain-like cysteine proteinase-like protein 2 [Lotus japonicus]
Length=361

 Score =   135 bits (339),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            Y+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRN+CGVD
Sbjct  288  YVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICRGRNVCGVD  347

Query  181  SMVSTVAAVNT  213
            SMVSTVAA++T
Sbjct  348  SMVSTVAALHT  358



>ref|XP_006362019.1| PREDICTED: cysteine proteinase RD19a-like [Solanum tuberosum]
Length=368

 Score =   135 bits (339),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 1/73 (1%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSK+LDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKICRGRN+CGVD
Sbjct  297  YICSKQLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGENGYYKICRGRNVCGVD  355

Query  181  SMVSTVAAVNTPT  219
            SMVSTVAAV+T +
Sbjct  356  SMVSTVAAVSTSS  368



>gb|KHN22211.1| Cysteine proteinase 15A [Glycine soja]
Length=366

 Score =   135 bits (339),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC K LDHGVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYY ICRGRN+CGVD
Sbjct  293  YICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYNICRGRNVCGVD  352

Query  181  SMVSTVAAVN  210
            SMVSTVAA++
Sbjct  353  SMVSTVAAIH  362



>ref|XP_004230928.1| PREDICTED: cysteine proteinase RD19a [Solanum lycopersicum]
Length=369

 Score =   135 bits (339),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 1/73 (1%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSK+LDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKICRGRN+CGVD
Sbjct  297  YICSKQLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGESGYYKICRGRNVCGVD  355

Query  181  SMVSTVAAVNTPT  219
            SMVSTVAAV+T +
Sbjct  356  SMVSTVAAVSTSS  368



>emb|CAB53397.1| cysteine protease [Medicago sativa]
Length=209

 Score =   131 bits (329),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 68/72 (94%), Gaps = 1/72 (1%)
 Frame = +1

Query  1    YICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGV  177
            +IC+K RLDHGVLLVG+GS GYAPIRLKEKPYWIIKNSWG++WGE+GYYKICRGRN+CGV
Sbjct  138  HICAKARLDHGVLLVGFGSGGYAPIRLKEKPYWIIKNSWGQNWGEEGYYKICRGRNVCGV  197

Query  178  DSMVSTVAAVNT  213
            DSMVSTVAA  +
Sbjct  198  DSMVSTVAAAQS  209



>gb|AAB62937.1| stress-induced cysteine proteinase [Lavatera thuringiaca]
Length=175

 Score =   130 bits (327),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC + LDHGVLLVGYG+AGYAP+R KEKP+WIIKNSWG +WGE GYYKICRGRN+CGVD
Sbjct  102  YICFRSLDHGVLLVGYGAAGYAPVRFKEKPFWIIKNSWGANWGEDGYYKICRGRNVCGVD  161

Query  181  SMVSTVAAVNTPTS  222
            SMVS+VAA+ T + 
Sbjct  162  SMVSSVAALQTKSQ  175



>ref|XP_004291404.1| PREDICTED: cysteine proteinase 15A-like [Fragaria vesca subsp. 
vesca]
Length=365

 Score =   134 bits (338),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 1/72 (1%)
 Frame = +1

Query  1    YICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGV  177
            YIC K  LDHGVLLVGYGS+GYAPIR KEKPYWIIKNSWG+SWGE+GYYKICRGRN+CGV
Sbjct  294  YICGKNHLDHGVLLVGYGSSGYAPIRFKEKPYWIIKNSWGQSWGEEGYYKICRGRNVCGV  353

Query  178  DSMVSTVAAVNT  213
            DSMVSTVAA++T
Sbjct  354  DSMVSTVAAMHT  365



>gb|KJB07487.1| hypothetical protein B456_001G026600 [Gossypium raimondii]
Length=377

 Score =   135 bits (339),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            +ICSK LDHGVLLVGYGSAGY+PI LK+KPYWIIKNSWGE+WGE GYYKICRG N+CGVD
Sbjct  304  FICSKHLDHGVLLVGYGSAGYSPIHLKDKPYWIIKNSWGENWGENGYYKICRGSNVCGVD  363

Query  181  SMVSTVAAVNT  213
            S+VSTV A+NT
Sbjct  364  SLVSTVVALNT  374



>dbj|BAF98585.1| CM0216.510.nc [Lotus japonicus]
Length=360

 Score =   134 bits (338),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            Y+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRN+CGVD
Sbjct  287  YVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICRGRNVCGVD  346

Query  181  SMVSTVAAVNT  213
            SMVSTVAA++T
Sbjct  347  SMVSTVAALHT  357



>ref|XP_007136047.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
 gb|ESW08041.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
Length=366

 Score =   134 bits (338),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC K LDHGVLLVGYG+  YAPIR KEKP+WIIKNSWGESWGE GYYKICRG N+CGVD
Sbjct  293  YICGKHLDHGVLLVGYGAGAYAPIRFKEKPFWIIKNSWGESWGENGYYKICRGHNVCGVD  352

Query  181  SMVSTVAAVNT  213
            SMVSTVAA++T
Sbjct  353  SMVSTVAAIHT  363



>gb|AGV54334.1| cysteine proteinase RD19a-like protein [Phaseolus vulgaris]
Length=366

 Score =   134 bits (338),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC K LDHGVLLVGYG+  YAPIR KEKP+WIIKNSWGESWGE GYYKICRG N+CGVD
Sbjct  293  YICGKHLDHGVLLVGYGAGAYAPIRFKEKPFWIIKNSWGESWGENGYYKICRGHNVCGVD  352

Query  181  SMVSTVAAVNT  213
            SMVSTVAA++T
Sbjct  353  SMVSTVAAIHT  363



>gb|AAM65162.1| cysteine proteinase RD19A [Arabidopsis thaliana]
Length=368

 Score =   134 bits (338),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC++RL+HGVLLVGYG+AGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVD
Sbjct  294  YICTRRLNHGVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVD  353

Query  181  SMVSTVAAVNTPTS  222
            SMVSTVAA  + T+
Sbjct  354  SMVSTVAATVSTTA  367



>ref|NP_568052.1| cysteine proteinase RD19a [Arabidopsis thaliana]
 sp|P43296.1|RD19A_ARATH RecName: Full=Cysteine proteinase RD19a; Short=RD19; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA02373.1| thiol protease [Arabidopsis thaliana]
 emb|CAB38829.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 emb|CAB80572.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AAL85009.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 gb|AAM91778.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 dbj|BAE98545.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AEE87016.1| cysteine proteinase RD19a [Arabidopsis thaliana]
Length=368

 Score =   134 bits (338),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC++RL+HGVLLVGYG+AGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVD
Sbjct  294  YICTRRLNHGVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVD  353

Query  181  SMVSTVAAVNTPTS  222
            SMVSTVAA  + T+
Sbjct  354  SMVSTVAATVSTTA  367



>ref|XP_006473584.1| PREDICTED: cysteine proteinase 15A-like [Citrus sinensis]
Length=369

 Score =   134 bits (338),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC K LDHGVL+VGYGS+G+APIR KEKPYWIIKNSWGE+WGE GYYKIC GRN+CGVD
Sbjct  296  YICGKYLDHGVLIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGENGYYKICMGRNVCGVD  355

Query  181  SMVSTVAAVNTPTS  222
            SMVS+VAAV+T +S
Sbjct  356  SMVSSVAAVHTTSS  369



>ref|XP_010105270.1| Cysteine proteinase 15A [Morus notabilis]
 gb|EXC04205.1| Cysteine proteinase 15A [Morus notabilis]
Length=372

 Score =   134 bits (337),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 1/71 (1%)
 Frame = +1

Query  1    YICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGV  177
            YICSK  LDHGVLLVGYG+AGYAPIR K+KPYWIIKNSWGE+WGE+GYYKICRGRN+CGV
Sbjct  293  YICSKHMLDHGVLLVGYGTAGYAPIRFKDKPYWIIKNSWGENWGEQGYYKICRGRNVCGV  352

Query  178  DSMVSTVAAVN  210
            DSMVSTVAA++
Sbjct  353  DSMVSTVAALH  363



>gb|AIB06025.1| CP3 [Hevea brasiliensis]
Length=366

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSK  DHGVLLVGYG+AGYAPIR K+KP+WIIKNSWGE+WGE GYYKICRGRNICG+D
Sbjct  293  YICSKSQDHGVLLVGYGAAGYAPIRFKDKPFWIIKNSWGENWGENGYYKICRGRNICGMD  352

Query  181  SMVSTVAAVNT  213
            +MVS+VAA++T
Sbjct  353  AMVSSVAAIHT  363



>ref|XP_006435090.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
 gb|ESR48330.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
Length=369

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC K LDHGVL+VGYGS+G+APIR KEKPYWIIKNSWGE+WGE GYYKIC GRN+CGVD
Sbjct  296  YICGKYLDHGVLIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGENGYYKICMGRNVCGVD  355

Query  181  SMVSTVAAVNTPTS  222
            SMVS+VAA++T +S
Sbjct  356  SMVSSVAAIHTTSS  369



>gb|KDO84720.1| hypothetical protein CISIN_1g017548mg [Citrus sinensis]
Length=369

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC K LDHGVL+VGYGS+G+APIR KEKPYWIIKNSWGE+WGE GYYKIC GRN+CGVD
Sbjct  296  YICGKYLDHGVLIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGENGYYKICMGRNVCGVD  355

Query  181  SMVSTVAAVNTPTS  222
            SMVS+VAA++T +S
Sbjct  356  SMVSSVAAIHTTSS  369



>gb|AAL60581.1|AF454959_1 senescence-associated cysteine protease [Brassica oleracea]
Length=368

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKICRGRN+CGVD
Sbjct  294  YICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEDGFYKICRGRNVCGVD  353

Query  181  SMVSTVAAVNTPTS  222
            S+VSTV A  +P +
Sbjct  354  SLVSTVTATVSPAA  367



>emb|CDY71205.1| BnaCnng71840D [Brassica napus]
Length=368

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKICRGRN+CGVD
Sbjct  294  YICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEDGFYKICRGRNVCGVD  353

Query  181  SMVSTVAAVNTPTS  222
            S+VSTV A  +P +
Sbjct  354  SLVSTVTATVSPAA  367



>ref|XP_006411706.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
 dbj|BAJ33785.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53159.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
Length=373

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGESWGE G+YKIC+GRNICGVD
Sbjct  299  YICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGESWGENGFYKICKGRNICGVD  358

Query  181  SMVSTVAAVNTPTS  222
            S+VSTV+A  + T+
Sbjct  359  SLVSTVSATVSTTA  372



>ref|XP_008387995.1| PREDICTED: cysteine proteinase 15A [Malus domestica]
Length=365

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC KR+DHGVLLVGYGS+G+APIRLKEKPYWI+KNSWG+SWGE+GYYKICRG N CGVD
Sbjct  292  YICGKRIDHGVLLVGYGSSGFAPIRLKEKPYWILKNSWGQSWGEQGYYKICRGYNSCGVD  351

Query  181  SMVSTVAAVNT  213
            S+VSTVAA++T
Sbjct  352  SLVSTVAALHT  362



>gb|KFK30492.1| hypothetical protein AALP_AA7G268600 [Arabis alpina]
Length=367

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVD
Sbjct  293  YICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVD  352

Query  181  SMVSTVAAVNTPTS  222
            S+VSTVAA  + T+
Sbjct  353  SLVSTVAATVSTTA  366



>ref|XP_006828787.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
 gb|ERM96203.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
Length=365

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 1/72 (1%)
 Frame = +1

Query  1    YICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGV  177
            YICSKR LDHGVL+VGYGSAGYAPIRLK+K YWIIKNSWGE+WGEKGYYKICRG NICGV
Sbjct  294  YICSKRNLDHGVLIVGYGSAGYAPIRLKDKAYWIIKNSWGETWGEKGYYKICRGHNICGV  353

Query  178  DSMVSTVAAVNT  213
            DSMVSTVA++ +
Sbjct  354  DSMVSTVASIQS  365



>ref|XP_009146338.1| PREDICTED: cysteine proteinase 15A-like [Brassica rapa]
 emb|CDY32227.1| BnaA01g17570D [Brassica napus]
Length=368

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 68/75 (91%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR-NICGV  177
            YICSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG +WGE GYYKICRGR NICG+
Sbjct  294  YICSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGSTWGEDGYYKICRGRHNICGM  353

Query  178  DSMVSTVAAVNTPTS  222
            D+MVSTVAAV+T T 
Sbjct  354  DTMVSTVAAVHTSTQ  368



>ref|XP_007160702.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
 gb|ESW32696.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
Length=365

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC K LDHGVLLVGYG   YAPIR KEKPYWIIKNSWGE+WGE GYYKICRGRN+CGVD
Sbjct  292  YICGKHLDHGVLLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGRNVCGVD  351

Query  181  SMVSTVAAVNTPTS  222
            SMVSTV A++  T 
Sbjct  352  SMVSTVGAIHASTQ  365



>emb|CDY34441.1| BnaC01g21920D [Brassica napus]
Length=368

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 1/74 (1%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR-NICGV  177
            YICSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG +WGE GYYKICRGR NICG+
Sbjct  294  YICSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGSTWGEDGYYKICRGRHNICGM  353

Query  178  DSMVSTVAAVNTPT  219
            D+MVSTVAAV+T T
Sbjct  354  DTMVSTVAAVHTST  367



>gb|AAD29084.1|AF082181_1 cysteine proteinase precursor [Solanum melongena]
Length=363

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +1

Query  4    ICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDS  183
            IC KR DHGVLLVGYGSAG+APIRLKEKPYWIIKNSWGE+WGE GYYKICRG NICGVD+
Sbjct  289  ICFKRQDHGVLLVGYGSAGFAPIRLKEKPYWIIKNSWGENWGEHGYYKICRGHNICGVDA  348

Query  184  MVSTVAAVNT  213
            MVSTV A +T
Sbjct  349  MVSTVTATHT  358



>dbj|BAF03553.1| cysteine proteinase CP2 [Phaseolus vulgaris]
Length=365

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC K LDHGVLLVGYG   YAPIR KEKPYWIIKNSWGE+WGE GYYKICRGRN+CGVD
Sbjct  292  YICGKHLDHGVLLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGRNVCGVD  351

Query  181  SMVSTVAAVNTPTS  222
            SMVSTV A++  T 
Sbjct  352  SMVSTVGAIHASTQ  365



>ref|XP_006283963.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
 gb|EOA16861.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
Length=368

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVD
Sbjct  294  YICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVD  353

Query  181  SMVSTVAAVNTPTS  222
            S+VSTV+A  + T+
Sbjct  354  SLVSTVSATVSTTA  367



>ref|XP_008221329.1| PREDICTED: cysteine proteinase 15A-like [Prunus mume]
Length=366

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC KR+DHGVLLVGYGS+G+APIR KEKPYWI+KNSWG+SWGE+GYYKICRG N CGVD
Sbjct  293  YICGKRIDHGVLLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEEGYYKICRGHNPCGVD  352

Query  181  SMVSTVAAVNT  213
            S+VSTVA+++T
Sbjct  353  SLVSTVASLHT  363



>dbj|BAF46302.1| cysteine proteinase precursor [Ipomoea nil]
Length=369

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 67/72 (93%), Gaps = 1/72 (1%)
 Frame = +1

Query  1    YICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGV  177
            YICSKR LDHGVLLVGYG+AGYAPIR K+KPYWI+KNSWGE+WGE+GYYKICRG NICG+
Sbjct  295  YICSKRNLDHGVLLVGYGAAGYAPIRFKDKPYWIVKNSWGENWGEEGYYKICRGNNICGI  354

Query  178  DSMVSTVAAVNT  213
            DSMVSTV A +T
Sbjct  355  DSMVSTVTAAST  366



>ref|XP_002868883.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45142.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score =   132 bits (333),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVD
Sbjct  294  YICTRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVD  353

Query  181  SMVSTVAAVNTPTS  222
            S+VSTV A  + T+
Sbjct  354  SLVSTVTAAVSTTA  367



>ref|XP_003589348.1| Cysteine proteinase [Medicago truncatula]
 gb|AES59599.1| papain family cysteine protease [Medicago truncatula]
Length=364

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 67/72 (93%), Gaps = 1/72 (1%)
 Frame = +1

Query  1    YICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGV  177
            YIC+K RLDHGVLL+G+G  GYAPIRLKEKPYWIIKNSWG++WGE+GYYKICRGRN+CGV
Sbjct  293  YICAKARLDHGVLLLGFGQGGYAPIRLKEKPYWIIKNSWGQNWGEEGYYKICRGRNVCGV  352

Query  178  DSMVSTVAAVNT  213
            DSMVSTVAA  +
Sbjct  353  DSMVSTVAAAQS  364



>emb|CDY09707.1| BnaC07g33540D [Brassica napus]
Length=366

 Score =   132 bits (332),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 66/72 (92%), Gaps = 1/72 (1%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR-NICGV  177
            Y+CSK  DHGVLLVG+GSAGYAP+RL+EKPYWIIKNSWG  WGEKGYYKICRG  NICGV
Sbjct  292  YVCSKNQDHGVLLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEKGYYKICRGTPNICGV  351

Query  178  DSMVSTVAAVNT  213
            D+MVSTVAAVNT
Sbjct  352  DTMVSTVAAVNT  363



>gb|ACX54787.2| cysteine protease [Arachis diogoi]
Length=360

 Score =   132 bits (331),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC K LDHGVLLVGYG+AGYAPIR K+KP+WIIKNSWGESWGE GYYKICRG+N+CGVD
Sbjct  285  YICGKNLDHGVLLVGYGAAGYAPIRFKDKPFWIIKNSWGESWGEDGYYKICRGKNVCGVD  344

Query  181  SMVSTVAAVNTPTSD  225
            SMVS+V A    +S+
Sbjct  345  SMVSSVVATTFTSSN  359



>emb|CDY41960.1| BnaA01g05320D [Brassica napus]
Length=367

 Score =   132 bits (331),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVD
Sbjct  293  YICTRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVD  352

Query  181  SMVSTVAAVNTPTS  222
            S+VSTV A  + T+
Sbjct  353  SLVSTVTAAVSTTA  366



>ref|XP_002280808.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CBI19783.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   132 bits (331),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            +ICS  L+HGVLLVGYGSAGY+PIR KEKPYW++KNSWG++WGE GYYKICRG NICGVD
Sbjct  293  FICSTSLNHGVLLVGYGSAGYSPIRFKEKPYWLLKNSWGQNWGEHGYYKICRGHNICGVD  352

Query  181  SMVSTVAAVNTPT  219
            SMVSTVAA+ + T
Sbjct  353  SMVSTVAAIQSAT  365



>ref|XP_003550405.2| PREDICTED: cysteine proteinase 15A [Glycine max]
Length=392

 Score =   132 bits (332),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC K LDHGVLLVGYG   YAPIR K KPYWIIKNSWGESWGE GYYKICRGRN+CGVD
Sbjct  319  YICGKHLDHGVLLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYYKICRGRNVCGVD  378

Query  181  SMVSTVAAV  207
            SMVSTVAA+
Sbjct  379  SMVSTVAAI  387



>gb|EMS53996.1| Cysteine proteinase 1 [Triticum urartu]
Length=405

 Score =   132 bits (332),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 59/74 (80%), Positives = 65/74 (88%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNIC  171
            YIC + LDHGVLLVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYKICRG   +N C
Sbjct  328  YICGRHLDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKICRGPHVKNKC  387

Query  172  GVDSMVSTVAAVNT  213
            GVDSMVSTV A++T
Sbjct  388  GVDSMVSTVTAIHT  401



>ref|XP_007223351.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
 gb|EMJ24550.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
Length=367

 Score =   132 bits (331),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC KR+DHGVLLVGYGS+G+APIR KEKPYWI+KNSWG+SWGE+G+YKICRG N CGVD
Sbjct  294  YICGKRIDHGVLLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEEGFYKICRGHNSCGVD  353

Query  181  SMVSTVAAVNT  213
            S+VSTVA+++T
Sbjct  354  SLVSTVASLHT  364



>dbj|BAA92495.1| cysteine protease [Vigna mungo]
Length=364

 Score =   131 bits (330),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC+KRLDHGV +VGYG +GYAPIR KEKPYWIIKNSWGESWGE GYYKICRG+N CGVD
Sbjct  291  YICAKRLDHGVQIVGYGESGYAPIRFKEKPYWIIKNSWGESWGENGYYKICRGQNACGVD  350

Query  181  SMVSTVAAVNT  213
            SMVSTV A++ 
Sbjct  351  SMVSTVGAIHA  361



>ref|XP_010446443.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score =   131 bits (330),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVD
Sbjct  293  YICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVD  352

Query  181  SMVSTVAAV  207
            S+VSTV+A 
Sbjct  353  SLVSTVSAT  361



>ref|XP_010431862.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score =   131 bits (330),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVD
Sbjct  293  YICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVD  352

Query  181  SMVSTVAAV  207
            S+VSTV+A 
Sbjct  353  SLVSTVSAT  361



>ref|XP_010437007.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=368

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVD
Sbjct  294  YICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVD  353

Query  181  SMVSTVAAV  207
            S+VSTV+A 
Sbjct  354  SLVSTVSAT  362



>gb|ACK57563.1| cysteine protease-like protein [Arachis hypogaea]
Length=364

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            +IC K LDHGVLLVGYG+ GYAPIR KEKPYWIIKNSWGE+WGE GYYKICRG N+CGVD
Sbjct  291  FICGKHLDHGVLLVGYGAGGYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGPNMCGVD  350

Query  181  SMVSTVAAVNT  213
            SMVSTV A++T
Sbjct  351  SMVSTVIAIHT  361



>ref|XP_010440192.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=365

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-RNICGV  177
            Y+CSK  DHGVLLVG+GSAGYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  N+CG+
Sbjct  291  YVCSKSQDHGVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGPHNVCGM  350

Query  178  DSMVSTVAAVNTPT  219
            DSMVSTVAAV+T T
Sbjct  351  DSMVSTVAAVHTTT  364



>emb|CAA52403.1| putative thiol protease [Arabidopsis thaliana]
Length=313

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICS+RL+HGVLLVGYGSAG++  RLKEKPYWIIKNSWGESWGE G+YKIC+GRNICGVD
Sbjct  243  YICSRRLNHGVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENGFYKICKGRNICGVD  302

Query  181  SMVSTVAAVNT  213
            S+VSTVAA  +
Sbjct  303  SLVSTVAATTS  313



>ref|XP_006665032.1| PREDICTED: cysteine proteinase 1-like [Oryza brachyantha]
Length=191

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 66/74 (89%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNI---C  171
            YIC K LDHGVLLVGYGS+G+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG N+   C
Sbjct  115  YICGKHLDHGVLLVGYGSSGFAPIRLKDKPYWIIKNSWGENWGEHGYYKICRGSNVRDKC  174

Query  172  GVDSMVSTVAAVNT  213
            GVDSMVSTV A++T
Sbjct  175  GVDSMVSTVTAIHT  188



>ref|XP_010449835.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-RNICGV  177
            Y+CSK  DHGVLLVG+GSAGYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  N+CG+
Sbjct  291  YVCSKNQDHGVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGPHNMCGM  350

Query  178  DSMVSTVAAVNTPT  219
            DSMVSTVAAV+T T
Sbjct  351  DSMVSTVAAVHTTT  364



>emb|CDX98179.1| BnaC07g09190D [Brassica napus]
Length=72

 Score =   123 bits (309),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +1

Query  13   KRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVS  192
            +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKICRGRN+CGVDS+VS
Sbjct  2    RRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEDGFYKICRGRNVCGVDSLVS  61

Query  193  TVAAVNTPTS  222
            TV A  +P +
Sbjct  62   TVTATVSPAA  71



>sp|P25804.1|CYSP_PEA RecName: Full=Cysteine proteinase 15A; AltName: Full=Turgor-responsive 
protein 15A; Flags: Precursor [Pisum sativum]
 emb|CAA38242.1| unnamed protein product [Pisum sativum]
Length=363

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 66/72 (92%), Gaps = 1/72 (1%)
 Frame = +1

Query  1    YICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGV  177
            Y+C+K RLDHGVLLVG+G   YAPIRLKEKPYWIIKNSWG++WGE+GYYKICRGRN+CGV
Sbjct  290  YVCAKSRLDHGVLLVGFGKGAYAPIRLKEKPYWIIKNSWGQNWGEQGYYKICRGRNVCGV  349

Query  178  DSMVSTVAAVNT  213
            DSMVSTVAA  +
Sbjct  350  DSMVSTVAAAQS  361



>ref|XP_009150026.1| PREDICTED: cysteine proteinase RD19a [Brassica rapa]
Length=367

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC++RL+HGVLLVGYGSAGYAP R KE+PYWIIKNSWGE+WGE G+YKIC+GRNICGVD
Sbjct  293  YICTRRLNHGVLLVGYGSAGYAPARFKERPYWIIKNSWGETWGENGFYKICKGRNICGVD  352

Query  181  SMVSTVAAVNTPTS  222
            S+VSTV A  + T+
Sbjct  353  SLVSTVTAAVSTTA  366



>ref|XP_010434865.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-RNICGV  177
            Y+CSK  DHGVLLVG+GSAGYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  N+CG+
Sbjct  291  YVCSKSQDHGVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGPHNMCGM  350

Query  178  DSMVSTVAAVNTPT  219
            DSMVSTVAAV+T T
Sbjct  351  DSMVSTVAAVHTTT  364



>dbj|BAD43619.1| putative cysteine proteinase [Arabidopsis thaliana]
Length=361

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICS+RL+HGVLLVGYGSAG++  RLKEKPYWIIKNSWGESWGE G+YKIC+GRNICGVD
Sbjct  291  YICSRRLNHGVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENGFYKICKGRNICGVD  350

Query  181  SMVSTVAAVNT  213
            S+VSTVAA  +
Sbjct  351  SLVSTVAATTS  361



>ref|NP_565512.1| Papain family cysteine protease [Arabidopsis thaliana]
 sp|P43295.2|A494_ARATH RecName: Full=Probable cysteine proteinase A494; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD23687.1| cysteine proteinase [Arabidopsis thaliana]
 gb|ABJ98563.1| At2g21430 [Arabidopsis thaliana]
 gb|AEC07177.1| Papain family cysteine protease [Arabidopsis thaliana]
Length=361

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICS+RL+HGVLLVGYGSAG++  RLKEKPYWIIKNSWGESWGE G+YKIC+GRNICGVD
Sbjct  291  YICSRRLNHGVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENGFYKICKGRNICGVD  350

Query  181  SMVSTVAAVNT  213
            S+VSTVAA  +
Sbjct  351  SLVSTVAATTS  361



>emb|CAA82995.1| cysteine proteinase [Vicia sativa]
Length=358

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 66/72 (92%), Gaps = 1/72 (1%)
 Frame = +1

Query  1    YICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGV  177
            Y+C+K RLDHGVLLVG+G   YAPIRLKEKPYWIIKNSWG++WGE+GYYKICRGRN+CGV
Sbjct  285  YVCAKARLDHGVLLVGFGKGAYAPIRLKEKPYWIIKNSWGQNWGEQGYYKICRGRNVCGV  344

Query  178  DSMVSTVAAVNT  213
            DSMVSTVAA  +
Sbjct  345  DSMVSTVAAAQS  356



>gb|ACM80348.1| cysteine proteinase [Solanum lycopersicum]
Length=368

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 68/73 (93%), Gaps = 1/73 (1%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSK+LDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKI RGRN+CGVD
Sbjct  297  YICSKQLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGESGYYKIRRGRNVCGVD  355

Query  181  SMVSTVAAVNTPT  219
            SMVSTVAAV+T +
Sbjct  356  SMVSTVAAVSTSS  368



>ref|XP_008775280.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=368

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC + LDHGVLLVGYGSAGYAPIR K+KPYWIIKNSWGE+WGE GYYKICRG NICGV+
Sbjct  298  YICGRHLDHGVLLVGYGSAGYAPIRFKDKPYWIIKNSWGENWGEDGYYKICRGHNICGVE  357

Query  181  SMVSTVAAV  207
            SMVSTV A+
Sbjct  358  SMVSTVTAI  366



>gb|AAB67878.1| pre-pro-cysteine proteinase [Vicia faba]
Length=363

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 66/72 (92%), Gaps = 1/72 (1%)
 Frame = +1

Query  1    YICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGV  177
            Y+C+K RLDHGVLLVG+G   YAPIRLKEKPYWI+KNSWG++WGE+GYYKICRGRN+CGV
Sbjct  290  YVCAKSRLDHGVLLVGFGKGAYAPIRLKEKPYWIVKNSWGQNWGEQGYYKICRGRNVCGV  349

Query  178  DSMVSTVAAVNT  213
            DSMVSTVAA  +
Sbjct  350  DSMVSTVAAAQS  361



>ref|XP_003545051.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=367

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC K LDHGVL+VGYG   YAPIR K KPYWIIKNSWGESWGE GYYKICRGRN+CGVD
Sbjct  294  YICGKHLDHGVLIVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYYKICRGRNVCGVD  353

Query  181  SMVSTVAAV  207
            SMVSTVAA+
Sbjct  354  SMVSTVAAI  362



>gb|AAO11786.1| pre-pro cysteine proteinase [Vicia faba]
Length=363

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 66/72 (92%), Gaps = 1/72 (1%)
 Frame = +1

Query  1    YICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGV  177
            Y+C+K RLDHGVLLVG+G   YAPIRLKEKPYWI+KNSWG++WGE+GYYKICRGRN+CGV
Sbjct  290  YVCAKSRLDHGVLLVGFGKGAYAPIRLKEKPYWIVKNSWGQNWGEQGYYKICRGRNVCGV  349

Query  178  DSMVSTVAAVNT  213
            DSMVSTVAA  +
Sbjct  350  DSMVSTVAAAQS  361



>ref|XP_011083631.1| PREDICTED: cysteine proteinase 15A-like [Sesamum indicum]
Length=371

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC K LDHGVLLVGYG+AGYAPIRLKEKPYWIIKNSWGE+WGE GYYKICRG N+CGV 
Sbjct  298  YICGKHLDHGVLLVGYGAAGYAPIRLKEKPYWIIKNSWGENWGENGYYKICRGHNVCGVA  357

Query  181  SMVSTVAAVN-TP  216
            SMVSTV A + TP
Sbjct  358  SMVSTVTAAHVTP  370



>ref|XP_009335626.1| PREDICTED: cysteine proteinase 15A [Pyrus x bretschneideri]
Length=366

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC KR+DHGVLLVGYGS+G+APIR KEKPYWI+KNSWG+SWGE+GYYKICRG N CGVD
Sbjct  293  YICGKRIDHGVLLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEQGYYKICRGYNSCGVD  352

Query  181  SMVSTVAAVN  210
            S+VSTVAA++
Sbjct  353  SLVSTVAALH  362



>emb|CDX90537.1| BnaA03g42440D [Brassica napus]
Length=366

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 66/72 (92%), Gaps = 1/72 (1%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR-NICGV  177
            Y+CSK  DHGVLLVG+GSAGYAP+RL+EKPYWIIKNSWG  WGEKGYYKICRG  NICGV
Sbjct  292  YVCSKNQDHGVLLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEKGYYKICRGTPNICGV  351

Query  178  DSMVSTVAAVNT  213
            D+MVSTVAAV+T
Sbjct  352  DTMVSTVAAVHT  363



>ref|XP_009136751.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
Length=368

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 66/72 (92%), Gaps = 1/72 (1%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR-NICGV  177
            Y+CSK  DHGVLLVG+GSAGYAP+RL+EKPYWIIKNSWG  WGEKGYYKICRG  NICGV
Sbjct  294  YVCSKNQDHGVLLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEKGYYKICRGTPNICGV  353

Query  178  DSMVSTVAAVNT  213
            D+MVSTVAAV+T
Sbjct  354  DTMVSTVAAVHT  365



>gb|KJB58164.1| hypothetical protein B456_009G197400 [Gossypium raimondii]
Length=375

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC K LDHGVLLVGYGSAGYAP+R K KPYWIIKNSWGE+WGE GYYKICRG N+CGVD
Sbjct  297  YICGKHLDHGVLLVGYGSAGYAPVRFKNKPYWIIKNSWGENWGENGYYKICRGNNVCGVD  356

Query  181  SMVSTVAAVN  210
            SMVS+V+A++
Sbjct  357  SMVSSVSALH  366



>ref|XP_008444769.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=373

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +1

Query  1    YICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGV  177
            YICSKR LDHGVLLVGYGSAG+APIR KEKPYWIIKNSWGE+WGE GYY IC+G+N+CG 
Sbjct  300  YICSKRNLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGENWGENGYYFICKGKNVCGS  359

Query  178  DSMVSTVAAVNTPT  219
            +SMVS+VAA  TP 
Sbjct  360  ESMVSSVAAAATPN  373



>ref|XP_010672379.1| PREDICTED: cysteine proteinase RD19a-like [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +1

Query  4    ICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDS  183
            +C + LDHGV+LVGYGSAGYAPIR KEKPYWIIKNSWG +WG++GYYKICRG N+CGVDS
Sbjct  302  VCLRSLDHGVVLVGYGSAGYAPIRFKEKPYWIIKNSWGPNWGDQGYYKICRGHNVCGVDS  361

Query  184  MVSTVAAVN  210
            MVSTVAAVN
Sbjct  362  MVSTVAAVN  370



>emb|CAB17075.1| cysteine proteinase precursor [Phaseolus vulgaris]
Length=365

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC K LDHGVLLVGYG   YAPIR KEKPYWIIKNSWGE+WG  GYYKICRGRN+CGVD
Sbjct  292  YICGKHLDHGVLLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGGNGYYKICRGRNVCGVD  351

Query  181  SMVSTVAAVNTPTS  222
            SMVSTV A++  T 
Sbjct  352  SMVSTVGAIHASTQ  365



>ref|XP_006653265.1| PREDICTED: cysteine proteinase 1-like, partial [Oryza brachyantha]
Length=366

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 65/74 (88%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNIC  171
            YIC K LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYKICRG   +N C
Sbjct  289  YICGKHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGPHVQNKC  348

Query  172  GVDSMVSTVAAVNT  213
            GVDSMVSTV A++T
Sbjct  349  GVDSMVSTVTAIHT  362



>gb|KJB29611.1| hypothetical protein B456_005G110200 [Gossypium raimondii]
Length=370

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC + LDHGVLLVGYG+AGY+PIR K+KP+WIIKNSWG +WGE GYYKICRGRN+CGVD
Sbjct  297  YICFRTLDHGVLLVGYGAAGYSPIRFKDKPFWIIKNSWGANWGEDGYYKICRGRNVCGVD  356

Query  181  SMVSTVAAVNTPTS  222
            SMVS+VAA++T + 
Sbjct  357  SMVSSVAALHTKSQ  370



>ref|XP_010943608.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=371

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC + LDHGVLLVGYGSAGYAPIR K+KPYWIIKNSWG +WGE GYYKICRG+NICGV+
Sbjct  300  YICGRHLDHGVLLVGYGSAGYAPIRFKDKPYWIIKNSWGGNWGEDGYYKICRGQNICGVE  359

Query  181  SMVSTVAAVNT  213
            SMVSTV AV T
Sbjct  360  SMVSTVTAVRT  370



>emb|CDP07452.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 66/72 (92%), Gaps = 1/72 (1%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-RNICGV  177
            YICSK  DHGVLLVGYG+AGYAPIRLK+KPYWIIKNSWGE+WGE GYYK CR  RN+CGV
Sbjct  305  YICSKSQDHGVLLVGYGAAGYAPIRLKDKPYWIIKNSWGENWGENGYYKFCRADRNLCGV  364

Query  178  DSMVSTVAAVNT  213
            DSMVS+VAAV+T
Sbjct  365  DSMVSSVAAVHT  376



>gb|AJA74415.1| cysteine protease [Cicer arietinum]
Length=358

 Score =   129 bits (325),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 69/71 (97%), Gaps = 2/71 (3%)
 Frame = +1

Query  1    YICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGV  177
            YIC+K RLDHGVLLVG+G+ G+APIRLKEKPYWIIKNSWG++WGE+GYYKICRGRNICGV
Sbjct  285  YICAKSRLDHGVLLVGFGN-GFAPIRLKEKPYWIIKNSWGQNWGEEGYYKICRGRNICGV  343

Query  178  DSMVSTVAAVN  210
            DSMVSTVAAV+
Sbjct  344  DSMVSTVAAVH  354



>gb|AAQ81938.1| cysteine proteinase precursor [Ipomoea batatas]
Length=371

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 67/72 (93%), Gaps = 1/72 (1%)
 Frame = +1

Query  1    YICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGV  177
            YICSK+ LDHGVL+VGYG+AGYAPIR K+KPYWIIKNSWGE+WGE+GYYKICRG NICGV
Sbjct  297  YICSKKNLDHGVLIVGYGAAGYAPIRFKDKPYWIIKNSWGENWGEEGYYKICRGNNICGV  356

Query  178  DSMVSTVAAVNT  213
            DSMVS+V A +T
Sbjct  357  DSMVSSVTAAST  368



>ref|NP_001266121.1| uncharacterized protein LOC101501911 precursor [Cicer arietinum]
 emb|CAA08906.1| cysteine proteinase [Cicer arietinum]
Length=362

 Score =   129 bits (325),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 69/71 (97%), Gaps = 2/71 (3%)
 Frame = +1

Query  1    YICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGV  177
            YIC+K RLDHGVLLVG+G+ G+APIRLKEKPYWIIKNSWG++WGE+GYYKICRGRNICGV
Sbjct  289  YICAKSRLDHGVLLVGFGN-GFAPIRLKEKPYWIIKNSWGQNWGEEGYYKICRGRNICGV  347

Query  178  DSMVSTVAAVN  210
            DSMVSTVAAV+
Sbjct  348  DSMVSTVAAVH  358



>ref|XP_002880378.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56637.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score =   129 bits (325),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICS+RL+HGVLL+GYGS+GY+  RLKEKPYWIIKNSWGESWGE G+YKIC+GRNICGVD
Sbjct  290  YICSRRLNHGVLLMGYGSSGYSQARLKEKPYWIIKNSWGESWGENGFYKICKGRNICGVD  349

Query  181  SMVSTVAAVNT  213
            S+VSTVAA  +
Sbjct  350  SLVSTVAAATS  360



>emb|CDX99593.1| BnaC04g33500D [Brassica napus]
Length=343

 Score =   129 bits (323),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRL+HGVLLVGYGSAG++  R KEKPYWIIKNSWGE+WGE G+YK+C+GRN+CGVD
Sbjct  274  YICSKRLNHGVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENGFYKLCKGRNVCGVD  333

Query  181  SMVSTVAAV  207
            SMVSTVAA 
Sbjct  334  SMVSTVAAA  342



>gb|AEX97108.1| cysteine proteinase, partial [Malus domestica]
Length=128

 Score =   123 bits (309),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 66/74 (89%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    YICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGV  177
            YICSKR LDHGVLLVGYGSAG+APIR KEKPYWIIKNSWG++WGE GYY IC+GRNICG 
Sbjct  19   YICSKRNLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGQNWGENGYYLICKGRNICGS  78

Query  178  DSMVSTVAAVNTPT  219
            +SMVS+VAA  TP 
Sbjct  79   ESMVSSVAA--TPN  90



>gb|KHG15062.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=370

 Score =   129 bits (323),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC + LDHGVLLVGYG+AGY+PIR K+KP+WIIKNSWG +WGE GYY+ICRGRN+CGVD
Sbjct  297  YICFRTLDHGVLLVGYGAAGYSPIRFKDKPFWIIKNSWGANWGEDGYYRICRGRNVCGVD  356

Query  181  SMVSTVAAVNTPTS  222
            SMVS+VAA++T + 
Sbjct  357  SMVSSVAALHTKSQ  370



>gb|AGS43121.1| cysteine protease 1, partial [Zea mays]
Length=90

 Score =   122 bits (305),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 66/74 (89%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNIC  171
            YIC + LDHGVLLVGYG++G+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG   RN C
Sbjct  14   YICGRHLDHGVLLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKC  73

Query  172  GVDSMVSTVAAVNT  213
            GVDSMVSTV+AV+ 
Sbjct  74   GVDSMVSTVSAVHA  87



>emb|CDY15894.1| BnaA04g12170D [Brassica napus]
Length=362

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRL+HGVLLVGYGSAG++  R KEKPYWIIKNSWGE+WGE G+YK+C+GRN+CG+D
Sbjct  293  YICSKRLNHGVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENGFYKLCKGRNVCGID  352

Query  181  SMVSTVAAV  207
            SMVSTVAA 
Sbjct  353  SMVSTVAAA  361



>ref|XP_006283974.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
 gb|EOA16872.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
Length=365

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-RNICGV  177
            Y+CSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  N+CG+
Sbjct  291  YVCSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGPHNMCGM  350

Query  178  DSMVSTVAAVNTPT  219
            D+MVSTVAAV+T T
Sbjct  351  DTMVSTVAAVHTTT  364



>ref|XP_009140277.1| PREDICTED: probable cysteine proteinase A494 [Brassica rapa]
Length=362

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSKRL+HGVLLVGYGSAG++  R KEKPYWIIKNSWGE+WGE G+YK+C+GRN+CG+D
Sbjct  293  YICSKRLNHGVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENGFYKLCKGRNVCGID  352

Query  181  SMVSTVAAV  207
            SMVSTVAA 
Sbjct  353  SMVSTVAAA  361



>ref|XP_009405542.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=366

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC K L+HGVLLVGYGSAGYAP R KEK YWIIKNSWGE+WGE GYYKICRGRNICGVD
Sbjct  296  YICGKHLNHGVLLVGYGSAGYAPARFKEKSYWIIKNSWGENWGENGYYKICRGRNICGVD  355

Query  181  SMVSTVAAV  207
            SMVS+V A+
Sbjct  356  SMVSSVTAI  364



>ref|XP_006414378.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
 gb|ESQ55831.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
Length=367

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-RNICGV  177
            Y+CSK  DHGVLLVG+GS+GY+PIRLKEKPYWIIKNSWG  WGE GYYKICRG  NICG+
Sbjct  293  YVCSKSQDHGVLLVGFGSSGYSPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGSHNICGM  352

Query  178  DSMVSTVAAVNTPTS  222
            D+MVSTVAAV T T 
Sbjct  353  DTMVSTVAAVQTSTQ  367



>emb|CAD40319.2| OSJNBb0054B09.3 [Oryza sativa Japonica Group]
 emb|CAH66180.1| OSIGBa0130O15.4 [Oryza sativa Indica Group]
 emb|CAH66205.1| OSIGBa0148D14.11 [Oryza sativa Indica Group]
Length=381

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 66/74 (89%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNIC  171
            +IC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYKICRG   +N C
Sbjct  303  FICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKICRGPHDKNKC  362

Query  172  GVDSMVSTVAAVNT  213
            GVDSMVS+V A++T
Sbjct  363  GVDSMVSSVTAIHT  376



>gb|EEE60725.1| hypothetical protein OsJ_14236 [Oryza sativa Japonica Group]
Length=364

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 66/74 (89%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNIC  171
            +IC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYKICRG   +N C
Sbjct  286  FICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKICRGPHDKNKC  345

Query  172  GVDSMVSTVAAVNT  213
            GVDSMVS+V A++T
Sbjct  346  GVDSMVSSVTAIHT  359



>gb|EAY93546.1| hypothetical protein OsI_15336 [Oryza sativa Indica Group]
Length=348

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 66/74 (89%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNIC  171
            +IC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYKICRG   +N C
Sbjct  270  FICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKICRGPHDKNKC  329

Query  172  GVDSMVSTVAAVNT  213
            GVDSMVS+V A++T
Sbjct  330  GVDSMVSSVTAIHT  343



>ref|XP_002452058.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
 gb|EES05034.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
Length=371

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 66/74 (89%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNIC  171
            YIC + LDHGVLLVGYG+AG+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG   RN C
Sbjct  295  YICGRTLDHGVLLVGYGAAGFAPIRLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKC  354

Query  172  GVDSMVSTVAAVNT  213
            GVDSMVSTV+AV T
Sbjct  355  GVDSMVSTVSAVRT  368



>ref|XP_006404590.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
 gb|ESQ46043.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
Length=363

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICS+RL+HGVLLVGYGSAG+A  RLK+KPYWIIKNSWGE+WGE GYYK+CRGRNICGVD
Sbjct  294  YICSRRLNHGVLLVGYGSAGFAQARLKKKPYWIIKNSWGETWGENGYYKLCRGRNICGVD  353

Query  181  SMVSTVA  201
            S+VSTVA
Sbjct  354  SLVSTVA  360



>gb|EMT16425.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=379

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 65/74 (88%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNIC  171
            YIC + LDHGVLLVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYKICRG   +N C
Sbjct  302  YICGRHLDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKICRGPHVKNKC  361

Query  172  GVDSMVSTVAAVNT  213
            GVDSMVSTV A++T
Sbjct  362  GVDSMVSTVTAIHT  375



>emb|CAA57675.1| cysteine proteinase [Zea mays]
Length=145

 Score =   123 bits (308),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 66/74 (89%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNIC  171
            YIC + LDHGVLLVGYG++G+AP+RLK+KPYWIIKNSWGE+WGE GYYKICRG   RN C
Sbjct  69   YICGRHLDHGVLLVGYGASGFAPMRLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKC  128

Query  172  GVDSMVSTVAAVNT  213
            GVDSMVSTV+AV+ 
Sbjct  129  GVDSMVSTVSAVHA  142



>ref|XP_009611293.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana tomentosiformis]
 emb|CAB44983.1| putative preprocysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +1

Query  4    ICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDS  183
            IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG NICGVD+
Sbjct  289  ICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDA  348

Query  184  MVSTVAAVNT  213
            MVSTV A +T
Sbjct  349  MVSTVTAAHT  358



>gb|AAK07731.1| CPR2-like cysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +1

Query  4    ICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDS  183
            IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG NICGVD+
Sbjct  289  ICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDA  348

Query  184  MVSTVAAVNT  213
            MVSTV A +T
Sbjct  349  MVSTVTAAHT  358



>ref|XP_004238314.1| PREDICTED: cysteine proteinase 15A [Solanum lycopersicum]
Length=363

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +1

Query  4    ICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDS  183
            IC KR DHGVLLVGYGS G+APIRLK KPYWIIKNSWG++WGE GYYKICRG NICGVD+
Sbjct  289  ICFKRQDHGVLLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEHGYYKICRGHNICGVDA  348

Query  184  MVSTVAAVNT  213
            MVSTV A +T
Sbjct  349  MVSTVTATHT  358



>emb|CAA78365.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=365

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +1

Query  4    ICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDS  183
            IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG NICGVD+
Sbjct  291  ICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDA  350

Query  184  MVSTVAAVNT  213
            MVSTV A +T
Sbjct  351  MVSTVTAAHT  360



>ref|NP_001052440.1| Os04g0311400 [Oryza sativa Japonica Group]
 dbj|BAF14354.1| Os04g0311400, partial [Oryza sativa Japonica Group]
Length=384

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 66/74 (89%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNIC  171
            +IC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYKICRG   +N C
Sbjct  306  FICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKICRGPHDKNKC  365

Query  172  GVDSMVSTVAAVNT  213
            GVDSMVS+V A++T
Sbjct  366  GVDSMVSSVTAIHT  379



>emb|CAA78361.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +1

Query  4    ICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDS  183
            IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG NICGVD+
Sbjct  289  ICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDA  348

Query  184  MVSTVAAVNT  213
            MVSTV A +T
Sbjct  349  MVSTVTAAHT  358



>ref|XP_009776238.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana sylvestris]
Length=365

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +1

Query  4    ICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDS  183
            IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG NICGVD+
Sbjct  291  ICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDA  350

Query  184  MVSTVAAVNT  213
            MVSTV A +T
Sbjct  351  MVSTVTAAHT  360



>ref|XP_003579573.2| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=399

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 66/78 (85%), Gaps = 3/78 (4%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNIC  171
            +IC + LDHGVLLVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYKICRG   +N C
Sbjct  322  FICGRHLDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKICRGAHVKNKC  381

Query  172  GVDSMVSTVAAVNTPTSD  225
            GVDSMVSTV A++T   +
Sbjct  382  GVDSMVSTVTAIHTSNKE  399



>ref|XP_004952477.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=374

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 66/74 (89%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNIC  171
            YIC + LDHGVLLVGYG+AG+APIRLKEKPYWIIKNSWGE+WGE GYYKICRG   RN C
Sbjct  297  YICGRHLDHGVLLVGYGAAGFAPIRLKEKPYWIIKNSWGENWGENGYYKICRGSNVRNKC  356

Query  172  GVDSMVSTVAAVNT  213
            GVDSMVSTV+A++ 
Sbjct  357  GVDSMVSTVSAIHA  370



>ref|XP_004152668.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004167370.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN62647.1| Cysteine protease [Cucumis sativus]
Length=371

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 66/70 (94%), Gaps = 1/70 (1%)
 Frame = +1

Query  1    YICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGV  177
            YICSKR LDHGVLLVGYG+AG+APIRLKEKPYWIIKNSWGE+WGE GYY IC+G+NICG 
Sbjct  300  YICSKRNLDHGVLLVGYGAAGFAPIRLKEKPYWIIKNSWGENWGENGYYFICKGKNICGS  359

Query  178  DSMVSTVAAV  207
            +SMVS+VAA+
Sbjct  360  ESMVSSVAAI  369



>gb|KFK24413.1| hypothetical protein AALP_AAs58848U000200 [Arabis alpina]
Length=372

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR-NICGV  177
            Y+CSK  DHGVLLVG+G +GYAPIRLKEKPYWIIKNSWG+ WGE GYYKICRGR NICG+
Sbjct  298  YVCSKSQDHGVLLVGFGESGYAPIRLKEKPYWIIKNSWGKMWGEHGYYKICRGRHNICGM  357

Query  178  DSMVSTVAAVN-TP  216
            D+MVSTVAAV  TP
Sbjct  358  DTMVSTVAAVQITP  371



>ref|XP_006341997.1| PREDICTED: cysteine proteinase 15A-like [Solanum tuberosum]
Length=376

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +1

Query  4    ICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDS  183
            IC KR DHGVLLVGYGS G+APIRLK KPYWIIKNSWG++WGE GYYKICRG NICGVD+
Sbjct  302  ICLKRQDHGVLLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEHGYYKICRGHNICGVDA  361

Query  184  MVSTVAAVNT  213
            MVSTV A +T
Sbjct  362  MVSTVTATHT  371



>gb|AAB16996.1| thiol protease isoform B, partial [Glycine max]
Length=319

 Score =   126 bits (316),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC K LDHGVLLVGYG   YAPIR K KPYWIIKNSWGESWGE GY +ICRGRN+CGVD
Sbjct  246  YICGKHLDHGVLLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYDEICRGRNVCGVD  305

Query  181  SMVSTVAAV  207
            SMVSTVAA+
Sbjct  306  SMVSTVAAI  314



>ref|NP_567489.1| papain family cysteine protease [Arabidopsis thaliana]
 emb|CAB10398.1| cysteine proteinase like protein [Arabidopsis thaliana]
 emb|CAB78661.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AAK62611.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM91059.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM96982.1| cysteine proteinase [Arabidopsis thaliana]
 gb|AAN31875.1| putative cysteine proteinase [Arabidopsis thaliana]
 dbj|BAE98514.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AEE83713.1| papain family cysteine protease [Arabidopsis thaliana]
Length=373

 Score =   127 bits (318),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-RNICGV  177
            Y+CSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  N+CG+
Sbjct  299  YVCSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGAMWGEHGYYKICRGPHNMCGM  358

Query  178  DSMVSTVAAVNT  213
            D+MVSTVAAV+T
Sbjct  359  DTMVSTVAAVHT  370



>ref|XP_002870174.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46433.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
Length=373

 Score =   127 bits (318),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-RNICGV  177
            Y+CSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  N+CG+
Sbjct  299  YVCSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGAMWGEHGYYKICRGPHNMCGM  358

Query  178  DSMVSTVAAVNT  213
            D+MVSTVAAV+T
Sbjct  359  DTMVSTVAAVHT  370



>emb|CAH59428.1| cysteine protease 2 [Plantago major]
Length=245

 Score =   124 bits (310),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC K LDHGVL+VGYG+ GYAP+RLK KPYWIIKNSWGESWGE GYYKICRGRN+CGV+
Sbjct  173  YICGKSLDHGVLIVGYGT-GYAPVRLKNKPYWIIKNSWGESWGESGYYKICRGRNVCGVE  231

Query  181  SMVSTVAAVNTPTS  222
            SMVS+V A +  T+
Sbjct  232  SMVSSVTAAHFTTT  245



>ref|XP_004975256.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=388

 Score =   126 bits (317),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 64/73 (88%), Gaps = 3/73 (4%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNIC  171
            YIC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYK+CRG   +N C
Sbjct  311  YICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGENGYYKLCRGPFVKNKC  370

Query  172  GVDSMVSTVAAVN  210
            GVDSMVSTV A++
Sbjct  371  GVDSMVSTVTAIH  383



>ref|XP_003607110.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89307.1| papain family cysteine protease [Medicago truncatula]
Length=331

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC++RLD GVLLVGYGS   A ++ KEKPYWI+KNSWGE+WGE GYYKICRGRNICGVD
Sbjct  258  YICTRRLDLGVLLVGYGSGAGADMKEKEKPYWIVKNSWGETWGENGYYKICRGRNICGVD  317

Query  181  SMVSTVAAVNTPTS  222
            SMVSTVAA +T T 
Sbjct  318  SMVSTVAAAHTTTQ  331



>emb|CAA78403.1| pre-pro-cysteine proteinase [Solanum lycopersicum]
Length=361

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +1

Query  4    ICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDS  183
            IC KR DHGVLLVGYGS G+APIRLK KPYWIIKNSWG++WGE GYYKICRG +ICGVD+
Sbjct  287  ICFKRQDHGVLLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEHGYYKICRGHHICGVDA  346

Query  184  MVSTVAAVNT  213
            MVSTV A +T
Sbjct  347  MVSTVTATHT  356



>gb|ACF86683.1| unknown [Zea mays]
 gb|AFW71402.1| cysteine protease1 [Zea mays]
Length=371

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 66/74 (89%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNIC  171
            YIC + LDHGVLLVGYG++G+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG   RN C
Sbjct  295  YICGRHLDHGVLLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKC  354

Query  172  GVDSMVSTVAAVNT  213
            GVDSMVSTV+AV+ 
Sbjct  355  GVDSMVSTVSAVHA  368



>ref|NP_001105685.1| cysteine proteinase 1 precursor [Zea mays]
 sp|Q10716.1|CYSP1_MAIZE RecName: Full=Cysteine proteinase 1; Flags: Precursor [Zea mays]
 dbj|BAA08244.1| cysteine proteinase [Zea mays]
Length=371

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 66/74 (89%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNIC  171
            YIC + LDHGVLLVGYG++G+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG   RN C
Sbjct  295  YICGRHLDHGVLLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKC  354

Query  172  GVDSMVSTVAAVNT  213
            GVDSMVSTV+AV+ 
Sbjct  355  GVDSMVSTVSAVHA  368



>gb|KEH30505.1| papain family cysteine protease [Medicago truncatula]
Length=330

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC++RLD GVLLVGYGS   A ++ KEKPYWI+KNSWGE+WGE GYYKICRGRNICGVD
Sbjct  257  YICTRRLDLGVLLVGYGSGAGADMKEKEKPYWIVKNSWGETWGENGYYKICRGRNICGVD  316

Query  181  SMVSTVAAVNTPTS  222
            SMVSTVAA +T T 
Sbjct  317  SMVSTVAAAHTNTQ  330



>ref|XP_003574963.1| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=377

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 65/74 (88%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNIC  171
            YIC + LDHGVLLVGYG++G+AP RLK KPYW+IKNSWGE+WGEKGYYKICRG   RN C
Sbjct  300  YICGRSLDHGVLLVGYGASGFAPSRLKNKPYWVIKNSWGENWGEKGYYKICRGSNVRNKC  359

Query  172  GVDSMVSTVAAVNT  213
            GVDSMVSTVAA +T
Sbjct  360  GVDSMVSTVAAAHT  373



>gb|ABK24153.1| unknown [Picea sitchensis]
Length=394

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    YICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGV  177
            Y+C+K+ LDHGVLLVGYG+AGYAP RLK KP+WIIKNSWG  WGE GYYK+CRG N+CG+
Sbjct  318  YVCNKQNLDHGVLLVGYGAAGYAPGRLKNKPFWIIKNSWGPDWGEDGYYKLCRGHNVCGI  377

Query  178  DSMVSTVAAVNTPTSD  225
            ++MVSTVAA N  T D
Sbjct  378  NTMVSTVAAANIQTDD  393



>gb|EYU27644.1| hypothetical protein MIMGU_mgv1a008452mg [Erythranthe guttata]
Length=373

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 68/75 (91%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    YICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGV  177
            Y+C KR LDHGVLLVGYG+AGY+ IRLK KPYWI+KNSWGESWGE+GYYKIC+G N+CGV
Sbjct  299  YVCGKRNLDHGVLLVGYGAAGYSTIRLKNKPYWIVKNSWGESWGEEGYYKICKGHNVCGV  358

Query  178  DSMVSTVAAVNTPTS  222
            +SMVS+V A++T ++
Sbjct  359  ESMVSSVNAIHTTSA  373



>ref|NP_001046828.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAD19579.1| putative cysteine proteinase 1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF08742.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAG92750.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93804.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94031.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83204.1| hypothetical protein OsI_28465 [Oryza sativa Indica Group]
 gb|EEE56967.1| hypothetical protein OsJ_06681 [Oryza sativa Japonica Group]
Length=373

 Score =   124 bits (310),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 66/74 (89%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNIC  171
            YIC + LDHGVLLVGYG++G+APIRLK+K YWIIKNSWGE+WGE GYYKICRG   RN C
Sbjct  297  YICGRHLDHGVLLVGYGASGFAPIRLKDKAYWIIKNSWGENWGEHGYYKICRGSNVRNKC  356

Query  172  GVDSMVSTVAAVNT  213
            GVDSMVSTV+A++T
Sbjct  357  GVDSMVSTVSAIHT  370



>dbj|BAG16515.1| putative cysteine proteinase [Capsicum chinense]
Length=367

 Score =   124 bits (310),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 62/71 (87%), Gaps = 1/71 (1%)
 Frame = +1

Query  4    ICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR-NICGVD  180
            +C K  DHGVLLVGYGSAG+APIRLK KPYWIIKNSWGE WGE GYYKICRG+ NICGVD
Sbjct  292  VCFKHQDHGVLLVGYGSAGFAPIRLKAKPYWIIKNSWGEHWGEHGYYKICRGQHNICGVD  351

Query  181  SMVSTVAAVNT  213
            +MVSTV A +T
Sbjct  352  AMVSTVTAAHT  362



>tpe|CAD66657.1| TPA: putative cysteine proteinase precursor [Hordeum vulgare 
subsp. vulgare]
 dbj|BAJ94057.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   123 bits (309),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 65/74 (88%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNIC  171
            YIC + LDHGVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYKICRG   RN C
Sbjct  300  YICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKC  359

Query  172  GVDSMVSTVAAVNT  213
            GVDSMVSTV+A ++
Sbjct  360  GVDSMVSTVSATHS  373



>ref|XP_002279862.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI19784.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   123 bits (309),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            ++CS  LDHGVLLVGYGSAGY+PIR KEKPYWI+KNSW + WGE GYY+ICRG+N+CGVD
Sbjct  294  FLCSGELDHGVLLVGYGSAGYSPIRFKEKPYWILKNSWSKYWGEHGYYRICRGQNMCGVD  353

Query  181  SMVSTVAAVNTPTS  222
            SMVS+V A    TS
Sbjct  354  SMVSSVVAAIQTTS  367



>dbj|BAD10859.1| cysteine protease [Aster tripolium]
Length=363

 Score =   123 bits (309),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 62/72 (86%), Gaps = 1/72 (1%)
 Frame = +1

Query  1    YICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGV  177
            YICSK ++DHGVLLVGYGSAGYAP+R KEKPYWIIKNSWGE WGE GYYK+C G N CG+
Sbjct  292  YICSKTKMDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGEDWGEDGYYKLCSGYNACGM  351

Query  178  DSMVSTVAAVNT  213
            D+MVS V + NT
Sbjct  352  DTMVSAVVSTNT  363



>gb|EMS64962.1| Cysteine proteinase 1 [Triticum urartu]
Length=302

 Score =   122 bits (306),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 64/74 (86%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNIC  171
            YIC + LDHGVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYKICRG   RN C
Sbjct  225  YICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKC  284

Query  172  GVDSMVSTVAAVNT  213
            GVDSMVSTV+A + 
Sbjct  285  GVDSMVSTVSATHA  298



>gb|ABK24688.1| unknown [Picea sitchensis]
 gb|ACN39791.1| unknown [Picea sitchensis]
 gb|ACN40241.1| unknown [Picea sitchensis]
Length=366

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 65/70 (93%), Gaps = 1/70 (1%)
 Frame = +1

Query  1    YICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGV  177
            Y+CSKR LDHGVLLVGYG+A +APIR+K+KPYW+IKNSWG +WGE GYYK+CRG N+CG+
Sbjct  297  YVCSKRNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENGYYKLCRGHNVCGI  356

Query  178  DSMVSTVAAV  207
            ++MVSTVAA+
Sbjct  357  NNMVSTVAAI  366



>gb|ACN40679.1| unknown [Picea sitchensis]
Length=366

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 65/70 (93%), Gaps = 1/70 (1%)
 Frame = +1

Query  1    YICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGV  177
            Y+CSKR LDHGVLLVGYG+A +APIR+K+KPYW+IKNSWG +WGE GYYK+CRG N+CG+
Sbjct  297  YVCSKRNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENGYYKLCRGHNVCGI  356

Query  178  DSMVSTVAAV  207
            ++MVSTVAA+
Sbjct  357  NNMVSTVAAI  366



>gb|ABK21238.1| unknown [Picea sitchensis]
 gb|ABR16087.1| unknown [Picea sitchensis]
 gb|ABR17330.1| unknown [Picea sitchensis]
 gb|ABR17545.1| unknown [Picea sitchensis]
 gb|ACN40765.1| unknown [Picea sitchensis]
Length=366

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 65/70 (93%), Gaps = 1/70 (1%)
 Frame = +1

Query  1    YICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGV  177
            Y+CSKR LDHGVLLVGYG+A +APIR+K+KPYW+IKNSWG +WGE GYYK+CRG N+CG+
Sbjct  297  YVCSKRNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENGYYKLCRGHNVCGI  356

Query  178  DSMVSTVAAV  207
            ++MVSTVAA+
Sbjct  357  NNMVSTVAAI  366



>gb|EMT10192.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=369

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 64/74 (86%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNIC  171
            YIC + LDHGVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYKICRG   RN C
Sbjct  292  YICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKC  351

Query  172  GVDSMVSTVAAVNT  213
            GVDSMVSTV+A + 
Sbjct  352  GVDSMVSTVSATHA  365



>gb|EPS70818.1| cysteine proteinase, partial [Genlisea aurea]
Length=355

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 65/71 (92%), Gaps = 1/71 (1%)
 Frame = +1

Query  4    ICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            +C K  LDHGVL+VGYGS+GYAPIRLK KPYWI+KNSWG++WGEKGYYKICRG NICGV+
Sbjct  285  VCGKSNLDHGVLMVGYGSSGYAPIRLKNKPYWIVKNSWGKNWGEKGYYKICRGSNICGVE  344

Query  181  SMVSTVAAVNT  213
            SMVSTV A+++
Sbjct  345  SMVSTVTAIHS  355



>gb|AAW21813.1| cysteine protease [Triticum aestivum]
Length=377

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 64/74 (86%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNIC  171
            YIC + LDHGVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYKICRG   RN C
Sbjct  300  YICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKC  359

Query  172  GVDSMVSTVAAVNT  213
            GVDSMVSTV+A + 
Sbjct  360  GVDSMVSTVSATHA  373



>gb|AAZ32411.1| cysteine proteinase glycinain type [Nicotiana benthamiana]
Length=355

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    ICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDS  183
            IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG NICGVD+
Sbjct  291  ICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDA  350

Query  184  MVSTV  198
            MVSTV
Sbjct  351  MVSTV  355



>ref|XP_003607150.1| Cysteine proteinase [Medicago truncatula]
Length=326

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 61/73 (84%), Gaps = 4/73 (5%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            Y C++RLDHGVLLVGYGS  Y     KEKPYWI+K+SWGE+WGE GYYKICRGRNICGVD
Sbjct  257  YTCTRRLDHGVLLVGYGSGAYT----KEKPYWIVKSSWGETWGENGYYKICRGRNICGVD  312

Query  181  SMVSTVAAVNTPT  219
            SMVSTVAA  T T
Sbjct  313  SMVSTVAAAQTTT  325



>gb|AES89347.2| papain family cysteine protease [Medicago truncatula]
Length=327

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 61/73 (84%), Gaps = 4/73 (5%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            Y C++RLDHGVLLVGYGS  Y     KEKPYWI+K+SWGE+WGE GYYKICRGRNICGVD
Sbjct  258  YTCTRRLDHGVLLVGYGSGAYT----KEKPYWIVKSSWGETWGENGYYKICRGRNICGVD  313

Query  181  SMVSTVAAVNTPT  219
            SMVSTVAA  T T
Sbjct  314  SMVSTVAAAQTTT  326



>gb|AAB53103.1| cysteine protease, partial [Brassica napus]
Length=85

 Score =   115 bits (288),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YIC +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKICRGRN+CGVD
Sbjct  23   YICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICRGRNVCGVD  82

Query  181  SMV  189
              V
Sbjct  83   MSV  85



>dbj|BAC57957.1| thiol protease [Aster tripolium]
Length=188

 Score =   118 bits (295),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 61/72 (85%), Gaps = 1/72 (1%)
 Frame = +1

Query  1    YICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGV  177
            Y+CSK+ LDHGVLLVGYGSAGYAP RLKEKPYWIIKNSWG  WGE GYYKIC G N+CG+
Sbjct  117  YVCSKKPLDHGVLLVGYGSAGYAPSRLKEKPYWIIKNSWGPDWGEDGYYKICSGHNLCGM  176

Query  178  DSMVSTVAAVNT  213
            D+MVS V + + 
Sbjct  177  DTMVSAVVSTSA  188



>gb|EPS65881.1| cysteine proteinase, partial [Genlisea aurea]
Length=335

 Score =   121 bits (303),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 64/68 (94%), Gaps = 1/68 (1%)
 Frame = +1

Query  4    ICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            IC K RLDHG+L+VGYG++GYAPIRLKEKPYWI+KNSWGE+WGE+GYYKIC+G N+CGV+
Sbjct  268  ICMKTRLDHGILIVGYGASGYAPIRLKEKPYWIVKNSWGENWGEQGYYKICKGHNVCGVE  327

Query  181  SMVSTVAA  204
            S+VSTV A
Sbjct  328  SLVSTVTA  335



>gb|AAB16997.1| thiol protease isoform A, partial [Glycine max]
Length=318

 Score =   120 bits (301),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 60/70 (86%), Gaps = 1/70 (1%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK-GYYKICRGRNICGV  177
            YIC K LDHGVLLVGYG   YAPIR K KPYWIIKNSWGESWGE  GY +ICRGRN+CGV
Sbjct  244  YICGKHLDHGVLLVGYGEGRYAPIRFKNKPYWIIKNSWGESWGENDGYDEICRGRNVCGV  303

Query  178  DSMVSTVAAV  207
            D+MVSTVAA+
Sbjct  304  DAMVSTVAAI  313



>ref|XP_009786000.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana sylvestris]
Length=370

 Score =   120 bits (302),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVD  180
            YICSK+LDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKICRGRN+CGVD
Sbjct  298  YICSKKLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGENGYYKICRGRNVCGVD  356

Query  181  SM  186
            SM
Sbjct  357  SM  358



>gb|ADY04293.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04297.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   115 bits (289),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICG  174
            YICSKRLDHGVLLVGYGS+GY+P+RLKEKPYWIIKNSWG+ WGE+G+YKICRGRNICG
Sbjct  87   YICSKRLDHGVLLVGYGSSGYSPVRLKEKPYWIIKNSWGDKWGEEGFYKICRGRNICG  144



>emb|CAQ00101.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=381

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 63/74 (85%), Gaps = 4/74 (5%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNIC  171
            YIC + LDH V LVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYKICRG   +N C
Sbjct  305  YICGRHLDH-VFLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKICRGPHVKNKC  363

Query  172  GVDSMVSTVAAVNT  213
            GVDSMVSTV A++T
Sbjct  364  GVDSMVSTVTAIHT  377



>gb|ADY04361.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   115 bits (288),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICG  174
            YICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICRGRNICG
Sbjct  87   YICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKICRGRNICG  144



>gb|ADY04342.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICG  174
            YICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICRGRNICG
Sbjct  87   YICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKICRGRNICG  144



>gb|ADY04336.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04343.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICG  174
            YICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICRGRNICG
Sbjct  87   YICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKICRGRNICG  144



>gb|ADY04262.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04263.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04264.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04265.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04266.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04267.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04269.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04270.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04271.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04272.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04273.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04274.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04275.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04276.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04277.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04278.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04279.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04280.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04281.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04282.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04283.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04284.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04285.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04286.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04287.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04288.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04289.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04290.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04291.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04292.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04294.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04296.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04298.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04299.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04300.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04301.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04302.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04303.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04304.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04305.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04306.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04307.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04308.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04309.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04310.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04311.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04312.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04313.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04314.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04315.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04316.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04317.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04318.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04319.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04320.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04321.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04322.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04323.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04324.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04325.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04326.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04327.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04328.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04329.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04330.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04331.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04332.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04333.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04334.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04335.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04337.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04338.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04339.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04340.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04341.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04344.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04345.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04346.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04347.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04348.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04349.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04350.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04351.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04352.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04353.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04354.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04355.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04356.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04357.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04360.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04362.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04363.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04364.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04365.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04366.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04367.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04369.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04370.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04371.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04372.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04373.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04374.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04377.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04378.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04379.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04380.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04381.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04382.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04383.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04384.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04385.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04386.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04387.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04388.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04389.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04391.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04392.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04393.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04394.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04395.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04396.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04397.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04398.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04399.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04400.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04401.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04402.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04403.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04404.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04405.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04406.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04407.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04408.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04409.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04410.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04411.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04412.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04413.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04415.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04416.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04417.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04418.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04419.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04420.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04421.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04422.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04423.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04424.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04425.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04426.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04427.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04428.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04429.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04430.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04431.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04432.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04433.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04434.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04435.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04436.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04437.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04438.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04439.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04440.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04441.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04442.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04443.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04444.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04445.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04446.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04447.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04448.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04449.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04450.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04451.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04452.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04453.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04454.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04455.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04456.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04458.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04459.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04460.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04461.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04462.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04463.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04464.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04465.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04466.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04467.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04468.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04469.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04470.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04471.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04472.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04473.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04474.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04475.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04476.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04478.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04481.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04483.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04484.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04485.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04486.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04487.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04488.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04489.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04491.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04493.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04501.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04502.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04503.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04504.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04505.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04506.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04507.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04508.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04509.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04510.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04511.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04512.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04513.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04514.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04515.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04516.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04517.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04518.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   115 bits (287),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICG  174
            YICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICRGRNICG
Sbjct  87   YICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKICRGRNICG  144



>gb|ADY04414.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   115 bits (287),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICG  174
            YICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICRGRNICG
Sbjct  87   YICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKICRGRNICG  144



>gb|ADY04457.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   115 bits (287),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICG  174
            YICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICRGRNICG
Sbjct  87   YICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKICRGRNICG  144



>gb|ADY04359.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   115 bits (287),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICG  174
            YICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICRGRNICG
Sbjct  87   YICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDRWGEEGFYKICRGRNICG  144



>gb|ADY04482.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   114 bits (286),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICG  174
            YICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICRGRNICG
Sbjct  87   YICSKRLDHGVLLVGYGSSGYSPVRVKEKPYWIIKNSWGDKWGEEGFYKICRGRNICG  144



>gb|ADY04358.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   114 bits (286),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICG  174
            YICSKRLDHGVLLVGYG++GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICRGRNICG
Sbjct  87   YICSKRLDHGVLLVGYGTSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKICRGRNICG  144



>gb|ADY04368.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04375.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04376.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04390.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04477.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04479.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   114 bits (285),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICG  174
            YICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG  WGE+G+YKICRGRNICG
Sbjct  87   YICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGNKWGEEGFYKICRGRNICG  144



>gb|ADY04480.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   114 bits (284),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICG  174
            YICSKRLDHGVLLVGYGS+GY+P+++KEKPYWIIKNSWG+ WGE+G+YKICRGRNICG
Sbjct  87   YICSKRLDHGVLLVGYGSSGYSPVKMKEKPYWIIKNSWGDKWGEEGFYKICRGRNICG  144



>gb|ADY04268.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   114 bits (284),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    YICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICG  174
            YICSKRLDHGVLLVGYGS+GY+P+R+KEKP+WIIKNSWG+ WGE+G+YKICRGRNICG
Sbjct  87   YICSKRLDHGVLLVGYGSSGYSPVRMKEKPHWIIKNSWGDKWGEEGFYKICRGRNICG  144



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554820161530