BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP010F07 432 bp,:Filtered

Length=432
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAK27969.1|AF242373_1  cysteine protease                             174   1e-49   Ipomoea batatas [batate]
gb|AAF40415.1|AF216784_1  papain-like cysteine proteinase isoform II    174   1e-49   Ipomoea batatas [batate]
gb|AAF40414.1|AF216783_1  papain-like cysteine proteinase isoform I     174   1e-49   Ipomoea batatas [batate]
gb|AAF61440.1|AF138264_1  papain-like cysteine proteinase isoform I     174   1e-49   Ipomoea batatas [batate]
gb|AAF61441.1|AF138265_1  papain-like cysteine proteinase isoform II    173   2e-49   Ipomoea batatas [batate]
gb|AAF40416.1|AF216785_1  papain-like cysteine proteinase isoform...    173   2e-49   Ipomoea batatas [batate]
gb|KDP41743.1|  hypothetical protein JCGZ_26761                         169   1e-47   Jatropha curcas
ref|XP_002512963.1|  cysteine protease, putative                        168   2e-47   Ricinus communis
sp|P05993.1|PAPA5_CARPA  RecName: Full=Cysteine proteinase; AltNa...    160   2e-47   Carica papaya [mamon]
gb|KHG24064.1|  Cysteinease RD19a -like protein                         167   4e-47   Gossypium arboreum [tree cotton]
gb|AAX19661.1|  cysteine proteinase                                     167   6e-47   Populus tomentosa [Chinese white poplar]
gb|AIB06024.1|  CP2                                                     167   6e-47   Hevea brasiliensis [jebe]
gb|ABK96252.1|  unknown                                                 160   8e-47   Populus trichocarpa x Populus deltoides
ref|XP_011047717.1|  PREDICTED: cysteine proteinase RD19a               166   9e-47   Populus euphratica
gb|KJB32561.1|  hypothetical protein B456_005G247000                    166   9e-47   Gossypium raimondii
gb|ABQ10201.1|  cysteine protease Cp3                                   166   1e-46   Actinidia deliciosa [Chinese gooseberry]
gb|KJB79047.1|  hypothetical protein B456_013G033800                    166   2e-46   Gossypium raimondii
emb|CAE54306.1|  putative papain-like cysteine proteinase               166   2e-46   Gossypium hirsutum [American cotton]
emb|CDP20652.1|  unnamed protein product                                166   2e-46   Coffea canephora [robusta coffee]
gb|KHG15253.1|  Cysteinease RD19a -like protein                         165   2e-46   Gossypium arboreum [tree cotton]
ref|XP_002313770.1|  cysteine proteinase A494 precursor                 165   3e-46   Populus trichocarpa [western balsam poplar]
gb|ABK92536.1|  unknown                                                 165   3e-46   Populus trichocarpa [western balsam poplar]
ref|NP_001267989.1|  cysteine protease precursor                        165   4e-46   Vitis vinifera
ref|XP_007042077.1|  Papain family cysteine protease                    165   6e-46   Theobroma cacao [chocolate]
ref|XP_003606998.1|  Cysteine proteinase                                164   7e-46   Medicago truncatula
gb|KDO49483.1|  hypothetical protein CISIN_1g017318mg                   164   7e-46   Citrus sinensis [apfelsine]
ref|XP_006487337.1|  PREDICTED: cysteine proteinase RD19a-like          164   7e-46   Citrus sinensis [apfelsine]
ref|XP_009351218.1|  PREDICTED: cysteine proteinase RD19a-like          162   7e-46   Pyrus x bretschneideri [bai li]
ref|XP_009373025.1|  PREDICTED: cysteine proteinase RD19a-like          164   7e-46   Pyrus x bretschneideri [bai li]
gb|KHN39817.1|  Cysteine proteinase RD19a                               163   7e-46   Glycine soja [wild soybean]
ref|XP_009373000.1|  PREDICTED: cysteine proteinase RD19a               164   1e-45   Pyrus x bretschneideri [bai li]
ref|XP_004290288.1|  PREDICTED: probable cysteine proteinase A494       164   1e-45   Fragaria vesca subsp. vesca
ref|XP_003539008.1|  PREDICTED: cysteine proteinase RD19a-like          163   1e-45   Glycine max [soybeans]
ref|XP_010271520.1|  PREDICTED: cysteine proteinase RD19a-like          163   1e-45   Nelumbo nucifera [Indian lotus]
ref|XP_008382317.1|  PREDICTED: cysteine proteinase RD19a               163   1e-45   Malus domestica [apple tree]
ref|XP_008236965.1|  PREDICTED: cysteine proteinase RD19a               163   1e-45   Prunus mume [ume]
gb|ACI04578.1|  cysteine protease-like protein                          162   1e-45   Robinia pseudoacacia [black locust]
ref|XP_006423403.1|  hypothetical protein CICLE_v10028670mg             163   1e-45   Citrus clementina
ref|XP_007201310.1|  hypothetical protein PRUPE_ppa007454mg             163   2e-45   Prunus persica
ref|XP_010028631.1|  PREDICTED: cysteine proteinase RD19a-like          163   2e-45   Eucalyptus grandis [rose gum]
ref|XP_011088458.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    163   2e-45   Sesamum indicum [beniseed]
ref|XP_011037175.1|  PREDICTED: cysteine proteinase RD19a-like          162   2e-45   Populus euphratica
gb|AAL69389.1|AF462226_1  putative cysteine proteinase                  156   2e-45   Narcissus pseudonarcissus
ref|XP_004507484.1|  PREDICTED: cysteine proteinase RD19a-like          162   2e-45   Cicer arietinum [garbanzo]
ref|XP_011028940.1|  PREDICTED: cysteine proteinase 15A-like            162   3e-45   Populus euphratica
ref|XP_002305451.2|  cysteine proteinase A494 precursor                 162   3e-45   Populus trichocarpa [western balsam poplar]
gb|AAR92156.1|  putative cysteine protease 3                            160   4e-45   Iris x hollandica [Dutch iris]
ref|XP_010066197.1|  PREDICTED: probable cysteine proteinase A494       162   5e-45   Eucalyptus grandis [rose gum]
ref|XP_011092831.1|  PREDICTED: cysteine proteinase RD19a-like          162   5e-45   Sesamum indicum [beniseed]
gb|ABK96580.1|  unknown                                                 161   5e-45   Populus trichocarpa x Populus deltoides
ref|XP_009406357.1|  PREDICTED: cysteine proteinase 1-like              162   6e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002302004.2|  hypothetical protein POPTR_0002s03020g             161   6e-45   Populus trichocarpa [western balsam poplar]
gb|ABK94801.1|  unknown                                                 161   7e-45   Populus trichocarpa [western balsam poplar]
ref|XP_009376976.1|  PREDICTED: cysteine proteinase RD19a-like          162   8e-45   Pyrus x bretschneideri [bai li]
gb|ABK93575.1|  unknown                                                 155   1e-44   Populus trichocarpa [western balsam poplar]
ref|XP_009376977.1|  PREDICTED: cysteine proteinase RD19a-like          162   1e-44   Pyrus x bretschneideri [bai li]
ref|XP_007131787.1|  hypothetical protein PHAVU_011G041600g             160   2e-44   Phaseolus vulgaris [French bean]
gb|AAU81591.1|  cysteine proteinase                                     155   3e-44   Petunia x hybrida [garden petunia]
ref|XP_010061009.1|  PREDICTED: cysteine proteinase RD19a-like          160   3e-44   Eucalyptus grandis [rose gum]
dbj|BAD94010.1|  drought-inducible cysteine proteinase RD19A prec...    151   3e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002510469.1|  cysteine protease, putative                        159   3e-44   Ricinus communis
ref|XP_004148554.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    160   4e-44   
ref|XP_004165230.1|  PREDICTED: cysteine proteinase RD19a-like          160   4e-44   
gb|KGN43159.1|  Papain-like cysteine proteinase isoform I               160   4e-44   Cucumis sativus [cucumbers]
ref|XP_003540987.1|  PREDICTED: cysteine proteinase RD19a-like          159   4e-44   Glycine max [soybeans]
emb|CDQ51995.1|  Cysteine proteinase                                    154   4e-44   Fagus sylvatica
gb|AJP16692.1|  cysteine protease                                       153   5e-44   Striga hermonthica [purple witchweed]
ref|XP_010268619.1|  PREDICTED: cysteine proteinase RD19a-like          159   6e-44   Nelumbo nucifera [Indian lotus]
gb|AAU81589.1|  cysteine proteinase                                     155   1e-43   Petunia x hybrida [garden petunia]
gb|ABF46642.1|  papain-like cysteine proteinase                         158   1e-43   Pachysandra terminalis
ref|XP_003523684.1|  PREDICTED: cysteine proteinase 15A-like            158   1e-43   Glycine max [soybeans]
ref|XP_004150061.1|  PREDICTED: cysteine proteinase RD19a-like          158   2e-43   Cucumis sativus [cucumbers]
ref|NP_001241450.1|  uncharacterized protein LOC100778716 precursor     157   2e-43   Glycine max [soybeans]
gb|KHN45894.1|  Cysteine proteinase RD19a                               157   2e-43   Glycine soja [wild soybean]
dbj|BAJ53178.1|  JHL18I08.12                                            157   2e-43   Jatropha curcas
ref|XP_010531457.1|  PREDICTED: probable cysteine proteinase A494       157   2e-43   Tarenaya hassleriana [spider flower]
ref|XP_010530325.1|  PREDICTED: cysteine proteinase RD19a               157   2e-43   Tarenaya hassleriana [spider flower]
gb|KHN25410.1|  Cysteine proteinase RD19a                               157   3e-43   Glycine soja [wild soybean]
ref|XP_010910124.1|  PREDICTED: cysteine proteinase 1-like              157   3e-43   Elaeis guineensis
ref|XP_008775532.1|  PREDICTED: cysteine proteinase 1-like              157   3e-43   Phoenix dactylifera
ref|XP_009392632.1|  PREDICTED: cysteine proteinase 1-like              157   3e-43   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAC41322.1|  hypothetical protein                                   156   4e-43   Lotus japonicus
ref|XP_011045161.1|  PREDICTED: cysteine proteinase 15A-like            157   4e-43   Populus euphratica
gb|EYU37835.1|  hypothetical protein MIMGU_mgv1a008237mg                157   4e-43   Erythranthe guttata [common monkey flower]
ref|XP_009602233.1|  PREDICTED: cysteine proteinase RD19a-like          156   5e-43   Nicotiana tomentosiformis
ref|XP_009109502.1|  PREDICTED: cysteine proteinase RD19a-like          156   5e-43   Brassica rapa
ref|XP_008448073.1|  PREDICTED: cysteine proteinase RD19a-like          157   5e-43   Cucumis melo [Oriental melon]
gb|AAL05851.1|AF411121_1  cysteine proteinase precursor                 156   5e-43   Sandersonia aurantiaca [Chinese-lantern lily]
ref|XP_002306900.1|  hypothetical protein POPTR_0005s25540g             156   5e-43   Populus trichocarpa [western balsam poplar]
gb|EYU42593.1|  hypothetical protein MIMGU_mgv1a008336mg                156   6e-43   Erythranthe guttata [common monkey flower]
emb|CAE45588.1|  papain-like cysteine proteinase-like protein 1         156   6e-43   Lotus japonicus
ref|XP_008460996.1|  PREDICTED: cysteine proteinase RD19a-like          156   7e-43   Cucumis melo [Oriental melon]
ref|XP_002275759.1|  PREDICTED: cysteine proteinase RD19a               156   7e-43   Vitis vinifera
dbj|BAF98584.1|  CM0216.500.nc                                          155   7e-43   Lotus japonicus
gb|AAB62937.1|  stress-induced cysteine proteinase                      150   7e-43   Lavatera thuringiaca
gb|KHN12668.1|  Cysteine proteinase 15A                                 150   8e-43   Glycine soja [wild soybean]
gb|KHN22211.1|  Cysteine proteinase 15A                                 156   8e-43   Glycine soja [wild soybean]
gb|KJB07487.1|  hypothetical protein B456_001G026600                    156   8e-43   Gossypium raimondii
ref|XP_002280798.2|  PREDICTED: cysteine proteinase 15A                 156   8e-43   Vitis vinifera
gb|AGV54334.1|  cysteine proteinase RD19a-like protein                  155   1e-42   Phaseolus vulgaris [French bean]
gb|AAM65162.1|  cysteine proteinase RD19A                               155   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007136047.1|  hypothetical protein PHAVU_009G013600g             155   1e-42   Phaseolus vulgaris [French bean]
ref|XP_006362019.1|  PREDICTED: cysteine proteinase RD19a-like          155   1e-42   Solanum tuberosum [potatoes]
ref|XP_004291404.1|  PREDICTED: cysteine proteinase 15A-like            155   1e-42   Fragaria vesca subsp. vesca
ref|XP_004230928.1|  PREDICTED: cysteine proteinase RD19a               155   1e-42   Solanum lycopersicum
ref|XP_010105270.1|  Cysteine proteinase 15A                            155   1e-42   Morus notabilis
ref|XP_006473584.1|  PREDICTED: cysteine proteinase 15A-like            155   1e-42   Citrus sinensis [apfelsine]
ref|NP_568052.1|  cysteine proteinase RD19a                             155   1e-42   Arabidopsis thaliana [mouse-ear cress]
emb|CAE45589.1|  papain-like cysteine proteinase-like protein 2         155   1e-42   Lotus japonicus
dbj|BAF98585.1|  CM0216.510.nc                                          155   2e-42   Lotus japonicus
gb|AIB06025.1|  CP3                                                     155   2e-42   Hevea brasiliensis [jebe]
emb|CDY71205.1|  BnaCnng71840D                                          155   2e-42   Brassica napus [oilseed rape]
gb|KDO84720.1|  hypothetical protein CISIN_1g017548mg                   155   2e-42   Citrus sinensis [apfelsine]
gb|AAL60581.1|AF454959_1  senescence-associated cysteine protease       155   2e-42   Brassica oleracea
ref|XP_006411706.1|  hypothetical protein EUTSA_v10025494mg             155   2e-42   Eutrema salsugineum
ref|XP_006435090.1|  hypothetical protein CICLE_v10001559mg             154   3e-42   Citrus clementina
ref|XP_007017672.1|  Papain family cysteine protease                    155   3e-42   Theobroma cacao [chocolate]
gb|KFK30492.1|  hypothetical protein AALP_AA7G268600                    154   3e-42   Arabis alpina [alpine rockcress]
ref|XP_006828787.1|  hypothetical protein AMTR_s00001p00114210          154   3e-42   Amborella trichopoda
ref|XP_009146338.1|  PREDICTED: cysteine proteinase 15A-like            154   3e-42   Brassica rapa
emb|CDY34441.1|  BnaC01g21920D                                          154   3e-42   Brassica napus [oilseed rape]
ref|XP_006283963.1|  hypothetical protein CARUB_v10005086mg             154   4e-42   Capsella rubella
ref|XP_008387995.1|  PREDICTED: cysteine proteinase 15A                 154   5e-42   Malus domestica [apple tree]
dbj|BAF46302.1|  cysteine proteinase precursor                          153   7e-42   Ipomoea nil [qian niu]
ref|XP_002868883.1|  hypothetical protein ARALYDRAFT_490677             153   7e-42   Arabidopsis lyrata subsp. lyrata
ref|XP_007160702.1|  hypothetical protein PHAVU_001G009900g             153   7e-42   Phaseolus vulgaris [French bean]
dbj|BAF03553.1|  cysteine proteinase CP2                                153   9e-42   Phaseolus vulgaris [French bean]
gb|ACX54787.2|  cysteine protease                                       153   9e-42   Arachis diogoi
emb|CDY41960.1|  BnaA01g05320D                                          153   1e-41   Brassica napus [oilseed rape]
emb|CAB53397.1|  cysteine protease                                      149   1e-41   Medicago sativa [alfalfa]
ref|XP_010446443.1|  PREDICTED: cysteine proteinase RD19a               152   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010431862.1|  PREDICTED: cysteine proteinase RD19a               152   1e-41   Camelina sativa [gold-of-pleasure]
emb|CAA52403.1|  putative thiol protease                                151   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437007.1|  PREDICTED: cysteine proteinase RD19a-like          152   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_006665032.1|  PREDICTED: cysteine proteinase 1-like              148   2e-41   
dbj|BAA92495.1|  cysteine protease                                      152   2e-41   Vigna mungo [urad dal]
ref|XP_010440192.1|  PREDICTED: cysteine proteinase RD19a-like          152   2e-41   Camelina sativa [gold-of-pleasure]
gb|ACK57563.1|  cysteine protease-like protein                          152   2e-41   Arachis hypogaea [goober]
ref|XP_010449835.1|  PREDICTED: cysteine proteinase 15A-like            152   2e-41   Camelina sativa [gold-of-pleasure]
dbj|BAD43619.1|  putative cysteine proteinase                           152   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009150026.1|  PREDICTED: cysteine proteinase RD19a               152   2e-41   Brassica rapa
ref|NP_565512.1|  Papain family cysteine protease                       152   3e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010434865.1|  PREDICTED: cysteine proteinase 15A-like            152   3e-41   Camelina sativa [gold-of-pleasure]
ref|XP_003550405.2|  PREDICTED: cysteine proteinase 15A                 152   3e-41   
ref|XP_003545051.1|  PREDICTED: cysteine proteinase 15A-like            151   4e-41   Glycine max [soybeans]
ref|XP_008775280.1|  PREDICTED: cysteine proteinase 1-like              151   4e-41   Phoenix dactylifera
emb|CDY09707.1|  BnaC07g33540D                                          151   4e-41   Brassica napus [oilseed rape]
ref|XP_011083631.1|  PREDICTED: cysteine proteinase 15A-like            151   4e-41   Sesamum indicum [beniseed]
gb|ACM80348.1|  cysteine proteinase                                     151   4e-41   Solanum lycopersicum
emb|CDP07452.1|  unnamed protein product                                151   6e-41   Coffea canephora [robusta coffee]
ref|XP_006653265.1|  PREDICTED: cysteine proteinase 1-like              151   6e-41   
ref|XP_010943608.1|  PREDICTED: cysteine proteinase 1-like              150   7e-41   Elaeis guineensis
ref|XP_002880378.1|  hypothetical protein ARALYDRAFT_481008             150   8e-41   Arabidopsis lyrata subsp. lyrata
ref|XP_010672379.1|  PREDICTED: cysteine proteinase RD19a-like          150   9e-41   Beta vulgaris subsp. vulgaris [field beet]
gb|AAQ81938.1|  cysteine proteinase precursor                           150   9e-41   Ipomoea batatas [batate]
ref|XP_003589348.1|  Cysteine proteinase                                150   9e-41   Medicago truncatula
ref|XP_009335626.1|  PREDICTED: cysteine proteinase 15A                 150   1e-40   Pyrus x bretschneideri [bai li]
emb|CAB17075.1|  cysteine proteinase precursor                          150   1e-40   Phaseolus vulgaris [French bean]
ref|XP_008221329.1|  PREDICTED: cysteine proteinase 15A-like            150   1e-40   Prunus mume [ume]
gb|AAD29084.1|AF082181_1  cysteine proteinase precursor                 150   1e-40   Solanum melongena [aubergine]
gb|AGS43121.1|  cysteine protease 1                                     142   1e-40   Zea mays [maize]
gb|KJB29611.1|  hypothetical protein B456_005G110200                    150   1e-40   Gossypium raimondii
emb|CAA57675.1|  cysteine proteinase                                    144   2e-40   Zea mays [maize]
ref|XP_006283974.1|  hypothetical protein CARUB_v10005098mg             149   2e-40   Capsella rubella
ref|XP_002280808.2|  PREDICTED: cysteine proteinase 15A                 149   2e-40   Vitis vinifera
ref|XP_009136751.1|  PREDICTED: cysteine proteinase RD19a-like          149   2e-40   Brassica rapa
emb|CDX99593.1|  BnaC04g33500D                                          149   2e-40   Brassica napus [oilseed rape]
ref|XP_007223351.1|  hypothetical protein PRUPE_ppa007441mg             149   2e-40   Prunus persica
emb|CDX90537.1|  BnaA03g42440D                                          149   2e-40   Brassica napus [oilseed rape]
sp|P25804.1|CYSP_PEA  RecName: Full=Cysteine proteinase 15A; AltN...    149   3e-40   Pisum sativum [garden pea]
emb|CAD40319.2|  OSJNBb0054B09.3                                        149   3e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006414378.1|  hypothetical protein EUTSA_v10025521mg             149   3e-40   Eutrema salsugineum
ref|XP_006404590.1|  hypothetical protein EUTSA_v10000210mg             149   3e-40   Eutrema salsugineum
gb|EAY93546.1|  hypothetical protein OsI_15336                          149   3e-40   Oryza sativa Indica Group [Indian rice]
gb|EMT16425.1|  Cysteine proteinase 1                                   149   3e-40   Aegilops tauschii
ref|XP_002452058.1|  hypothetical protein SORBIDRAFT_04g017830          149   3e-40   Sorghum bicolor [broomcorn]
gb|KHG15062.1|  Cysteinease RD19a -like protein                         149   3e-40   Gossypium arboreum [tree cotton]
gb|EEE60725.1|  hypothetical protein OsJ_14236                          149   3e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009140277.1|  PREDICTED: probable cysteine proteinase A494       149   4e-40   Brassica rapa
gb|AAB67878.1|  pre-pro-cysteine proteinase                             149   4e-40   Vicia faba [broad bean]
gb|AAO11786.1|  pre-pro cysteine proteinase                             149   4e-40   Vicia faba [broad bean]
emb|CDY15894.1|  BnaA04g12170D                                          149   4e-40   Brassica napus [oilseed rape]
ref|XP_004952477.1|  PREDICTED: cysteine proteinase 1-like              149   5e-40   Setaria italica
ref|XP_003579573.2|  PREDICTED: cysteine proteinase 1-like              149   5e-40   Brachypodium distachyon [annual false brome]
gb|KJB58164.1|  hypothetical protein B456_009G197400                    149   5e-40   Gossypium raimondii
ref|XP_009611293.1|  PREDICTED: cysteine proteinase 15A-like            148   6e-40   Nicotiana tomentosiformis
ref|NP_001052440.1|  Os04g0311400                                       149   6e-40   
gb|AAK07731.1|  CPR2-like cysteine proteinase                           148   6e-40   Nicotiana tabacum [American tobacco]
gb|AJA74415.1|  cysteine protease                                       148   6e-40   Cicer arietinum [garbanzo]
ref|NP_001266121.1|  uncharacterized protein LOC101501911 precursor     148   6e-40   Cicer arietinum [garbanzo]
emb|CAA78365.1|  tobacco pre-pro-cysteine proteinase                    148   8e-40   Nicotiana tabacum [American tobacco]
ref|XP_009776238.1|  PREDICTED: cysteine proteinase 15A-like            148   8e-40   Nicotiana sylvestris
emb|CAA78361.1|  tobacco pre-pro-cysteine proteinase                    148   8e-40   Nicotiana tabacum [American tobacco]
gb|KFK24413.1|  hypothetical protein AALP_AAs58848U000200               148   9e-40   Arabis alpina [alpine rockcress]
ref|XP_008444769.1|  PREDICTED: cysteine proteinase RD19a-like          148   1e-39   Cucumis melo [Oriental melon]
ref|XP_002870174.1|  hypothetical protein ARALYDRAFT_915142             148   1e-39   Arabidopsis lyrata subsp. lyrata
gb|AEX97108.1|  cysteine proteinase                                     141   1e-39   Malus domestica [apple tree]
gb|EMS53996.1|  Cysteine proteinase 1                                   148   1e-39   Triticum urartu
ref|NP_567489.1|  papain family cysteine protease                       147   1e-39   Arabidopsis thaliana [mouse-ear cress]
emb|CAH59428.1|  cysteine protease 2                                    144   2e-39   Plantago major [cart-track plant]
gb|AAB16996.1|  thiol protease isoform B                                146   2e-39   Glycine max [soybeans]
emb|CAA82995.1|  cysteine proteinase                                    147   2e-39   Vicia sativa [spring vetch]
gb|ACF86683.1|  unknown                                                 147   2e-39   Zea mays [maize]
ref|XP_004975256.1|  PREDICTED: cysteine proteinase 1-like              147   2e-39   Setaria italica
ref|NP_001105685.1|  cysteine proteinase 1 precursor                    147   2e-39   Zea mays [maize]
ref|XP_003574963.1|  PREDICTED: cysteine proteinase 1-like              147   3e-39   Brachypodium distachyon [annual false brome]
ref|XP_009405542.1|  PREDICTED: cysteine proteinase 1-like              146   3e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003607110.1|  Cysteine proteinase                                145   3e-39   Medicago truncatula
gb|KEH30505.1|  papain family cysteine protease                         145   4e-39   Medicago truncatula
gb|EYU27644.1|  hypothetical protein MIMGU_mgv1a008452mg                145   8e-39   Erythranthe guttata [common monkey flower]
ref|XP_004238314.1|  PREDICTED: cysteine proteinase 15A                 145   9e-39   
ref|NP_001046828.1|  Os02g0469600                                       145   1e-38   
gb|ABK24153.1|  unknown                                                 145   1e-38   Picea sitchensis
ref|XP_006341997.1|  PREDICTED: cysteine proteinase 15A-like            145   1e-38   Solanum tuberosum [potatoes]
gb|EMS64962.1|  Cysteine proteinase 1                                   143   1e-38   Triticum urartu
ref|XP_004152668.1|  PREDICTED: cysteine proteinase RD19a-like          144   2e-38   Cucumis sativus [cucumbers]
dbj|BAG16515.1|  putative cysteine proteinase                           144   2e-38   Capsicum chinense [bonnet pepper]
tpe|CAD66657.1|  TPA: putative cysteine proteinase precursor            144   2e-38   Hordeum vulgare subsp. vulgare [barley]
gb|EMT10192.1|  Cysteine proteinase 1                                   144   3e-38   Aegilops tauschii
gb|ABK21238.1|  unknown                                                 143   4e-38   Picea sitchensis
gb|ABK24688.1|  unknown                                                 143   4e-38   Picea sitchensis
gb|AAW21813.1|  cysteine protease                                       144   4e-38   Triticum aestivum [Canadian hard winter wheat]
gb|ACN40679.1|  unknown                                                 143   4e-38   Picea sitchensis
emb|CAA78403.1|  pre-pro-cysteine proteinase                            143   5e-38   Solanum lycopersicum
gb|AES89347.2|  papain family cysteine protease                         142   6e-38   Medicago truncatula
ref|XP_003607150.1|  Cysteine proteinase                                142   6e-38   
gb|AAZ32411.1|  cysteine proteinase glycinain type                      142   7e-38   Nicotiana benthamiana
dbj|BAD10859.1|  cysteine protease                                      142   2e-37   Tripolium pannonicum [sea starwort]
gb|AAB16997.1|  thiol protease isoform A                                140   2e-37   Glycine max [soybeans]
emb|CAQ00101.1|  papain-like cysteine proteinase                        141   3e-37   Hordeum vulgare subsp. vulgare [barley]
gb|ADY04293.1|  cysteine protease                                       135   3e-37   Clarkia xantiana subsp. xantiana
ref|XP_009786000.1|  PREDICTED: cysteine proteinase RD19a-like          141   3e-37   Nicotiana sylvestris
gb|ADY04361.1|  cysteine protease                                       135   4e-37   Clarkia xantiana subsp. xantiana
ref|XP_002279862.1|  PREDICTED: cysteine proteinase RD19a               140   4e-37   Vitis vinifera
gb|ADY04414.1|  cysteine protease                                       135   4e-37   Clarkia xantiana subsp. xantiana
gb|ADY04342.1|  cysteine protease                                       135   4e-37   Clarkia xantiana subsp. xantiana
gb|ADY04336.1|  cysteine protease                                       135   4e-37   Clarkia xantiana subsp. xantiana
gb|ADY04262.1|  cysteine protease                                       135   5e-37   Clarkia xantiana subsp. xantiana
gb|ADY04457.1|  cysteine protease                                       135   5e-37   Clarkia xantiana subsp. xantiana
gb|EPS70818.1|  cysteine proteinase                                     140   5e-37   Genlisea aurea
gb|ADY04359.1|  cysteine protease                                       135   6e-37   Clarkia xantiana subsp. xantiana
dbj|BAC57957.1|  thiol protease                                         135   7e-37   Tripolium pannonicum [sea starwort]
gb|ADY04482.1|  cysteine protease                                       134   8e-37   Clarkia xantiana subsp. xantiana
gb|ADY04368.1|  cysteine protease                                       134   9e-37   Clarkia xantiana subsp. xantiana
gb|ADY04358.1|  cysteine protease                                       134   9e-37   Clarkia xantiana subsp. xantiana
gb|ADY04480.1|  cysteine protease                                       134   1e-36   Clarkia xantiana subsp. xantiana
gb|ADY04268.1|  cysteine protease                                       134   1e-36   Clarkia xantiana subsp. xantiana
gb|EPS65881.1|  cysteine proteinase                                     139   2e-36   Genlisea aurea
gb|ADY04295.1|  cysteine protease                                       133   3e-36   Clarkia xantiana subsp. xantiana
gb|AAB53103.1|  cysteine protease                                       131   3e-36   Brassica napus [oilseed rape]
ref|XP_002960585.1|  hypothetical protein SELMODRAFT_266583             134   8e-35   Selaginella moellendorffii
ref|XP_002969223.1|  hypothetical protein SELMODRAFT_91274              134   1e-34   Selaginella moellendorffii
emb|CDX98179.1|  BnaC07g09190D                                          124   2e-33   Brassica napus [oilseed rape]
emb|CCA95098.1|  putative responsive to dehydration 19                  124   1e-32   Liriodendron tulipifera
gb|ADY04490.1|  cysteine protease                                       123   2e-32   Clarkia xantiana subsp. xantiana
gb|KEH43476.1|  papain family cysteine protease                         128   2e-32   Medicago truncatula
ref|XP_010504326.1|  PREDICTED: cysteine proteinase 15A-like            128   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_006293095.1|  hypothetical protein CARUB_v10019394mg             127   3e-32   Capsella rubella
emb|CAB41090.1|  cysteine proteinase precursor-like protein             127   4e-32   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567010.5|  Papain family cysteine protease                       127   5e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876278.1|  hypothetical protein ARALYDRAFT_485911             127   5e-32   Arabidopsis lyrata subsp. lyrata
gb|EMS59778.1|  Cysteine proteinase 15A                                 123   6e-32   Triticum urartu
gb|KHN00877.1|  Cysteine proteinase 15A                                 126   6e-32   Glycine soja [wild soybean]
ref|XP_008776953.1|  PREDICTED: cysteine proteinase-like                121   7e-32   Phoenix dactylifera
gb|KFK34737.1|  hypothetical protein AALP_AA5G186400                    127   8e-32   Arabis alpina [alpine rockcress]
ref|XP_004496226.1|  PREDICTED: cysteine proteinase 15A-like            127   9e-32   Cicer arietinum [garbanzo]
ref|NP_001059639.1|  Os07g0480900                                       125   2e-31   
ref|XP_002460693.1|  hypothetical protein SORBIDRAFT_02g033270          125   3e-31   Sorghum bicolor [broomcorn]
ref|XP_008804021.1|  PREDICTED: cysteine proteinase RD19a-like          122   3e-31   Phoenix dactylifera
emb|CAB16316.1|  cysteine proteinase precursor                          125   4e-31   Vicia sativa [spring vetch]
ref|XP_010534431.1|  PREDICTED: cysteine proteinase 15A                 124   5e-31   Tarenaya hassleriana [spider flower]
gb|KHN37802.1|  Cysteine proteinase 1                                   124   5e-31   Glycine soja [wild soybean]
ref|XP_008354070.1|  PREDICTED: cysteine proteinase 15A-like            122   6e-31   Malus domestica [apple tree]
gb|AAD46920.1|AF167986_1  putative cysteine proteinase GmPM33           124   8e-31   Glycine max [soybeans]
ref|NP_001236888.1|  cysteine proteinase precursor                      124   9e-31   Glycine max [soybeans]
ref|XP_009404192.1|  PREDICTED: cysteine proteinase 15A                 124   9e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008362714.1|  PREDICTED: cysteine proteinase 15A                 123   1e-30   Malus domestica [apple tree]
ref|XP_004959670.1|  PREDICTED: cysteine proteinase 1-like              123   1e-30   Setaria italica
ref|XP_010690815.1|  PREDICTED: cysteine proteinase RD19a               123   2e-30   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX73424.1|  BnaC08g25790D                                          123   2e-30   
ref|XP_009116190.1|  PREDICTED: probable cysteine proteinase A494       123   2e-30   
emb|CDY56961.1|  BnaA09g55030D                                          123   2e-30   
ref|XP_007143764.1|  hypothetical protein PHAVU_007G099600g             123   3e-30   
tpg|DAA40800.1|  TPA: putative cysteine protease family protein         122   3e-30   
ref|XP_008802783.1|  PREDICTED: probable cysteine proteinase A494       122   3e-30   
emb|CAQ00102.1|  papain-like cysteine proteinase                        122   3e-30   
ref|XP_003560213.1|  PREDICTED: cysteine proteinase 1                   122   5e-30   
gb|ABO93617.1|  papain-like cysteine proteinase                         117   5e-30   
gb|EYU39642.1|  hypothetical protein MIMGU_mgv1a008552mg                121   7e-30   
ref|XP_001781954.1|  predicted protein                                  121   7e-30   
gb|EEC82027.1|  hypothetical protein OsI_25996                          124   9e-30   
ref|XP_007218137.1|  hypothetical protein PRUPE_ppa007240mg             120   1e-29   
ref|XP_008233261.1|  PREDICTED: cysteine proteinase 15A                 120   1e-29   
ref|XP_009117680.1|  PREDICTED: probable cysteine proteinase A494       120   1e-29   
ref|XP_010243268.1|  PREDICTED: cysteine proteinase 15A                 120   1e-29   
ref|XP_009789260.1|  PREDICTED: cysteine proteinase 15A                 120   2e-29   
ref|XP_006403513.1|  hypothetical protein EUTSA_v10010475mg             120   2e-29   
ref|XP_009617441.1|  PREDICTED: cysteine proteinase 15A                 120   2e-29   
ref|XP_001761980.1|  predicted protein                                  120   2e-29   
gb|KHG08355.1|  Cysteinease 1                                           119   3e-29   
gb|KJB73490.1|  hypothetical protein B456_011G235500                    120   3e-29   
ref|XP_004250044.1|  PREDICTED: cysteine proteinase 15A                 120   3e-29   
emb|CDY13816.1|  BnaA09g43180D                                          118   3e-29   
emb|CCA95082.1|  putative responsive to dehydration 19                  114   3e-29   
gb|AEQ54770.1|  cysteine proteinase CP1                                 120   3e-29   
emb|CAB17077.1|  cysteine proteinase precursor                          119   7e-29   
emb|CBI31400.3|  unnamed protein product                                117   7e-29   
ref|XP_011094506.1|  PREDICTED: cysteine proteinase 15A                 118   9e-29   
ref|XP_010918606.1|  PREDICTED: probable cysteine proteinase A494       118   9e-29   
emb|CDO99795.1|  unnamed protein product                                118   1e-28   
ref|XP_006850211.1|  hypothetical protein AMTR_s00022p00251800          117   1e-28   
ref|XP_011024366.1|  PREDICTED: cysteine proteinase 15A                 117   2e-28   
ref|XP_006361690.1|  PREDICTED: cysteine proteinase 15A-like            117   3e-28   
ref|XP_007510080.1|  unknown                                            117   3e-28   
ref|XP_010034320.1|  PREDICTED: cysteine proteinase 1                   116   4e-28   
gb|KDP30486.1|  hypothetical protein JCGZ_16165                         116   4e-28   
ref|XP_008446834.1|  PREDICTED: cysteine proteinase 15A                 116   4e-28   
gb|ADE76932.1|  unknown                                                 116   5e-28   
ref|XP_010688493.1|  PREDICTED: cysteine proteinase 15A                 116   5e-28   
ref|XP_006436511.1|  hypothetical protein CICLE_v10031865mg             116   6e-28   
ref|XP_004157559.1|  PREDICTED: cysteine proteinase 15A-like            116   7e-28   
ref|XP_004142497.1|  PREDICTED: cysteine proteinase 15A-like            116   7e-28   
ref|XP_002316398.1|  hypothetical protein POPTR_0010s23510g             115   7e-28   
ref|XP_002266821.1|  PREDICTED: cysteine proteinase 15A                 114   2e-27   
emb|CAN64491.1|  hypothetical protein VITISV_015725                     114   2e-27   
ref|XP_010103534.1|  putative cysteine proteinase A494                  114   3e-27   
ref|XP_002533377.1|  cysteine protease, putative                        114   4e-27   
ref|XP_007010012.1|  Papain family cysteine protease                    113   6e-27   
ref|XP_008647122.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin 7-...    110   2e-26   
ref|XP_003081549.1|  Cysteine proteinase Cathepsin F (ISS)              109   5e-26   
emb|CEF99324.1|  Cysteine peptidase, cysteine active site               110   6e-26   
gb|AFW72358.1|  putative cysteine protease family protein               111   2e-25   
ref|XP_011469621.1|  PREDICTED: cysteine proteinase 15A-like            106   3e-25   
ref|XP_001419933.1|  predicted protein                                  107   3e-25   
gb|EPS63354.1|  hypothetical protein M569_11429                         106   2e-24   
ref|XP_006658557.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    103   1e-23   
ref|XP_003057227.1|  predicted protein                                  100   3e-22   
ref|XP_011169692.1|  PREDICTED: putative cysteine proteinase CG12163    102   5e-22   
ref|XP_006608091.1|  PREDICTED: uncharacterized protein LOC102680728    101   1e-21   
gb|EFN80374.1|  Putative cysteine proteinase CG12163                    101   1e-21   
ref|XP_011145705.1|  PREDICTED: uncharacterized protein LOC105186896    101   1e-21   
emb|CAN71324.1|  hypothetical protein VITISV_013970                   99.4    1e-21   
ref|XP_003696602.1|  PREDICTED: putative cysteine proteinase CG12...    100   1e-21   
ref|XP_011203808.1|  PREDICTED: putative cysteine proteinase CG12163  99.8    3e-21   
ref|XP_004519757.1|  PREDICTED: putative cysteine proteinase CG12...  99.8    3e-21   
ref|XP_011184040.1|  PREDICTED: putative cysteine proteinase CG12163  99.8    3e-21   
ref|XP_003492760.1|  PREDICTED: hypothetical protein LOC100745708     99.4    6e-21   
ref|XP_392381.3|  PREDICTED: putative cysteine proteinase CG12163...  99.4    6e-21   
ref|XP_006567715.1|  PREDICTED: putative cysteine proteinase CG12...  99.4    6e-21   
ref|XP_011496222.1|  PREDICTED: uncharacterized protein LOC105360904  99.4    8e-21   
emb|CAN80141.1|  hypothetical protein VITISV_038978                   95.9    1e-20   
ref|XP_004519758.1|  PREDICTED: putative cysteine proteinase CG12...  97.8    1e-20   
ref|XP_002505924.1|  cysteine endopeptidase                           94.4    2e-20   
gb|EFN65613.1|  Putative cysteine proteinase CG12163                  97.4    2e-20   
ref|XP_001607324.1|  PREDICTED: uncharacterized protein LOC100123649  97.8    2e-20   
ref|XP_005184487.1|  PREDICTED: putative cysteine proteinase CG12...  97.4    3e-20   
ref|XP_005184486.1|  PREDICTED: putative cysteine proteinase CG12...  97.4    3e-20   
dbj|BAI44279.1|  cysteine proteinase inhibitor precursor              97.8    3e-20   
ref|XP_011260522.1|  PREDICTED: uncharacterized protein LOC105253881  97.4    3e-20   
gb|EGI66903.1|  Putative cysteine proteinase                          97.1    3e-20   
ref|XP_011052455.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  97.1    4e-20   
gb|KFB38327.1|  AGAP002879-PB-like protein                            97.4    4e-20   
ref|XP_008550537.1|  PREDICTED: uncharacterized protein LOC103573287  97.1    5e-20   
ref|XP_011493714.1|  AAEL017153-PA                                    97.1    5e-20   
emb|CAN81617.1|  hypothetical protein VITISV_001998                   93.6    5e-20   
ref|XP_001844355.1|  conserved hypothetical protein                   96.7    6e-20   
ref|XP_003707276.1|  PREDICTED: uncharacterized protein LOC100880620  96.3    7e-20   
ref|XP_001994049.1|  GH22731                                          95.5    9e-20   
ref|XP_002000409.1|  GI10216                                          95.1    9e-20   
emb|CAN81619.1|  hypothetical protein VITISV_002000                   92.8    1e-19   
ref|XP_002017233.1|  GL22196                                          94.7    1e-19   
gb|AJF94882.1|  C1 family cathepsin F10                               95.5    1e-19   
ref|XP_002056575.1|  GJ11017                                          94.7    1e-19   
ref|XP_002137768.1|  GA27408, isoform A                               94.7    2e-19   
emb|CBI23088.3|  unnamed protein product                              90.1    2e-19   
ref|XP_002096026.1|  GE25302                                          94.4    2e-19   
ref|NP_730901.1|  CG12163, isoform A                                  94.4    2e-19   
ref|XP_002038380.1|  GM10654                                          94.4    2e-19   
ref|XP_002988513.1|  hypothetical protein SELMODRAFT_128220           88.6    2e-19   
gb|ETN61472.1|  hypothetical protein AND_006867                       95.1    2e-19   
ref|XP_001978897.1|  GG11133                                          94.0    2e-19   
ref|XP_001955780.1|  GF16067                                          94.0    3e-19   
gb|EZA58965.1|  Putative cysteine proteinase                          94.4    3e-19   
ref|XP_003736743.1|  GA27408, isoform B                               92.8    3e-19   
gb|AFQ01139.1|  cathepsin F-like protease                             93.2    4e-19   
ref|XP_011331416.1|  PREDICTED: uncharacterized protein LOC105275911  94.4    4e-19   
ref|NP_649521.1|  CG12163, isoform B                                  92.4    4e-19   
ref|XP_312034.5|  AGAP002879-PA                                       94.4    5e-19   
ref|XP_003436277.1|  AGAP002879-PB                                    94.4    5e-19   
gb|ACR08662.1|  cathepsin F                                           89.4    5e-19   
ref|XP_008195657.1|  PREDICTED: uncharacterized protein LOC662417...  94.0    6e-19   
ref|XP_008195656.1|  PREDICTED: uncharacterized protein LOC662417...  94.0    6e-19   
ref|XP_002073772.1|  GK14287                                          92.4    9e-19   
emb|CBY11269.1|  unnamed protein product                              90.5    9e-19   
gb|ABE72973.1|  cathepsin L                                           89.7    9e-19   
gb|EHJ64782.1|  cysteine proteinase inhibitor precursor               87.4    1e-18   
ref|XP_002979143.1|  hypothetical protein SELMODRAFT_110288           89.0    1e-18   
ref|XP_003436276.1|  AGAP002879-PC                                    91.7    3e-18   
ref|XP_011309436.1|  PREDICTED: uncharacterized protein LOC105270293  91.3    4e-18   
emb|CDX82031.1|  BnaC08g35700D                                        87.0    9e-18   
gb|KDR17524.1|  Putative cysteine proteinase                          90.5    1e-17   
ref|XP_005184488.1|  PREDICTED: putative cysteine proteinase CG12...  88.6    1e-17   
ref|XP_011434326.1|  PREDICTED: uncharacterized protein LOC105333...  89.4    1e-17   
gb|EKC42097.1|  Cathepsin F                                           89.4    1e-17   
ref|XP_011434325.1|  PREDICTED: uncharacterized protein LOC105333...  89.4    1e-17   
emb|CBY31096.1|  unnamed protein product                              87.0    1e-17   
gb|ERG79645.1|  cysteine proteinase                                   83.2    2e-17   
gb|KHN72698.1|  Putative cysteine proteinase                          83.2    2e-17   
gb|ENN81374.1|  hypothetical protein YQE_02191                        89.4    2e-17   
gb|AEW08440.1|  hypothetical protein 2_9845_02                        81.3    3e-17   
ref|XP_002427787.1|  Cathepsin F precursor, putative                  86.7    5e-17   
gb|ABC48936.1|  cathepsin F like protease                             86.7    5e-17   
ref|XP_009047014.1|  hypothetical protein LOTGIDRAFT_172186           84.7    5e-17   
gb|ERL92611.1|  hypothetical protein D910_09924                       85.9    8e-17   
gb|AII16490.1|  cathepsin F                                           84.0    1e-16   
gb|AFM37363.1|  cathepsin F1                                          85.1    2e-16   
ref|XP_009029595.1|  hypothetical protein HELRODRAFT_157956           83.2    2e-16   
ref|NP_001156454.1|  cathepsin F isoform 2 precursor                  85.1    3e-16   
emb|CAC94443.1|  cysteine proteinase                                  80.5    3e-16   
gb|ELT97360.1|  hypothetical protein CAPTEDRAFT_147978                82.0    5e-16   
gb|KFM67613.1|  putative cysteine proteinase                          83.6    7e-16   
gb|EYC18288.1|  hypothetical protein Y032_0028g1777                   78.6    8e-16   
ref|XP_003115597.1|  CRE-TAG-196 protein                              83.6    8e-16   
ref|NP_505215.2|  Protein TAG-196                                     82.8    1e-15   
ref|XP_002682087.1|  predicted protein                                80.9    2e-15   
ref|NP_001156453.1|  cathepsin F isoform 1 precursor                  82.8    2e-15   
ref|XP_009161938.1|  hypothetical protein T265_00017                  79.0    4e-15   
ref|XP_002635317.1|  C. briggsae CBR-TAG-196 protein                  81.3    4e-15   
emb|CDJ26737.1|  cathepsin F-like cysteine peptidase protein          81.3    4e-15   
ref|XP_003389037.1|  PREDICTED: cathepsin L1-like                     79.7    4e-15   
gb|EGT34543.1|  hypothetical protein CAEBREN_26318                    81.3    4e-15   
dbj|GAA47436.1|  cathepsin L                                          79.0    6e-15   
emb|CDJ88889.1|  Proteinase inhibitor I25 and Proteinase inhibito...  80.9    6e-15   
gb|EGT34572.1|  hypothetical protein CAEBREN_13324                    80.9    6e-15   
emb|CDJ92562.1|  Proteinase inhibitor I25 and Proteinase inhibito...  80.9    6e-15   
gb|KIH48456.1|  cysteine proteinase family protein                    75.1    8e-15   
dbj|BAN20819.1|  cysteine-type endopeptidase                          81.3    9e-15   
ref|XP_002610214.1|  hypothetical protein BRAFLDRAFT_216923           78.6    9e-15   
emb|CAC94444.1|  cysteine proteinase                                  76.3    1e-14   
ref|XP_004351999.1|  cysteine protease                                78.6    2e-14   
gb|ABY75169.1|  cysteine protease                                     73.6    2e-14   
ref|XP_002681317.1|  cysteine protease                                78.2    2e-14   
ref|XP_003284553.1|  hypothetical protein DICPUDRAFT_96752            77.8    3e-14   
ref|XP_635374.1|  cysteine protease                                   77.8    3e-14   
gb|EFX71333.1|  hypothetical protein DAPPUDRAFT_189155                76.6    3e-14   
ref|XP_003148243.1|  hypothetical protein LOAG_12683                  75.9    4e-14   
ref|XP_635417.1|  cysteine proteinase 1                               77.4    4e-14   
emb|CAA26255.1|  cysteine proteinase I precursor                      77.4    5e-14   
gb|AAR27011.1|  cysteine protease                                     76.6    5e-14   
gb|EFO15826.2|  hypothetical protein LOAG_12683                       75.9    5e-14   
ref|XP_008472006.1|  PREDICTED: putative cysteine proteinase CG12163  74.7    8e-14   
ref|XP_001029851.1|  Papain family cysteine protease containing p...  76.3    9e-14   
ref|XP_009035714.1|  hypothetical protein AURANDRAFT_53321            76.3    9e-14   
dbj|GAM23991.1|  hypothetical protein SAMD00019534_071660             76.3    9e-14   
ref|XP_002970484.1|  hypothetical protein SELMODRAFT_93661            75.9    1e-13   
ref|XP_002978562.1|  hypothetical protein SELMODRAFT_109056           75.9    2e-13   
gb|AAF21461.1|U69120_1  cysteine proteinase PWCP1                     76.6    2e-13   
ref|XP_006268168.1|  PREDICTED: cathepsin F-like                      76.6    2e-13   
gb|AAT09103.1|  digestive cysteine proteinase                         75.5    2e-13   
ref|XP_007438969.1|  PREDICTED: cathepsin F-like                      73.6    3e-13   
ref|XP_006007112.1|  PREDICTED: cathepsin F-like                      75.9    3e-13   
ref|XP_003747496.1|  PREDICTED: cathepsin L-like                      74.7    3e-13   
dbj|BAF94154.1|  cathepsin F-like cysteine protease                   76.6    4e-13   
ref|XP_003375070.1|  viral cathepsin                                  75.9    4e-13   
emb|CAX69889.1|  Temporarily Assigned Gene name                       75.5    4e-13   
gb|AAW25775.1|  SJCHGC00511 protein                                   75.5    4e-13   
ref|XP_005305646.1|  PREDICTED: cathepsin W-like                      74.7    4e-13   
ref|XP_009064230.1|  hypothetical protein LOTGIDRAFT_204652           74.3    4e-13   
gb|AAB01769.1|  cysteine proteinase homolog                           74.7    5e-13   
ref|XP_009034680.1|  hypothetical protein AURANDRAFT_22129            74.3    5e-13   
ref|XP_006121731.1|  PREDICTED: cathepsin W-like                      73.2    5e-13   
gb|KGB33519.1|  Cathepsin L                                           73.6    6e-13   
ref|XP_002119872.3|  PREDICTED: cathepsin L-like                      75.1    7e-13   
emb|CEF63690.1|  Cathepsin F                                          73.9    8e-13   
ref|XP_006980634.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      74.7    1e-12   
ref|XP_005351748.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      74.3    1e-12   
gb|ELV09527.1|  Cathepsin F                                           74.7    1e-12   
ref|XP_004364962.1|  cysteine proteinase 7                            73.6    1e-12   
gb|ABK91811.1|  cathepsin F precursor                                 72.8    1e-12   
ref|XP_002734978.1|  PREDICTED: cathepsin F-like                      73.2    1e-12   
gb|EGW06365.1|  Cathepsin F                                           73.9    1e-12   
gb|ABC69430.1|  cysteine protease                                     72.8    1e-12   
ref|XP_008177856.1|  PREDICTED: cathepsin W-like                      69.7    1e-12   
gb|AEE62591.1|  unknown                                               73.2    2e-12   
gb|ENN81994.1|  hypothetical protein YQE_01705                        73.2    2e-12   
gb|ABC69431.1|  cysteine protease                                     72.8    2e-12   
gb|ABC69429.1|  cysteine protease                                     72.8    2e-12   
ref|XP_007648967.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      73.9    2e-12   
emb|CDP90584.1|  Protein BM-TAG-196                                   73.9    2e-12   
ref|XP_008577225.1|  PREDICTED: cathepsin F                           74.3    2e-12   
gb|ERE78742.1|  cathepsin F                                           73.6    2e-12   
ref|XP_010765827.1|  PREDICTED: cathepsin W                           73.9    2e-12   
ref|XP_008479908.1|  PREDICTED: putative cysteine proteinase CG12163  72.4    2e-12   
ref|XP_006036937.1|  PREDICTED: cathepsin F-like                      73.6    2e-12   
ref|NP_001029282.1|  cathepsin F precursor                            73.6    2e-12   
ref|XP_007056266.1|  PREDICTED: cathepsin F-like                      73.6    2e-12   
ref|XP_008479905.1|  PREDICTED: cathepsin L-like                      72.8    2e-12   
gb|EDM12431.1|  cathepsin F, isoform CRA_b                            69.7    2e-12   
ref|NP_001133678.1|  Cathepsin F precursor                            73.6    2e-12   
emb|CAB42884.1|  cathepsin F                                          73.6    2e-12   



>gb|AAK27969.1|AF242373_1 cysteine protease [Ipomoea batatas]
Length=366

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/85 (94%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKI
Sbjct  282  QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKI  341

Query  183  CRGRNICGVDSMVSTVAAVNTPTSD  257
            CRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  342  CRGRNVCGVDSMVSTVAAVSTTTSD  366



>gb|AAF40415.1|AF216784_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=368

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/85 (94%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKI
Sbjct  284  QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKI  343

Query  183  CRGRNICGVDSMVSTVAAVNTPTSD  257
            CRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  344  CRGRNVCGVDSMVSTVAAVSTTTSD  368



>gb|AAF40414.1|AF216783_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/85 (94%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKI
Sbjct  284  QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKI  343

Query  183  CRGRNICGVDSMVSTVAAVNTPTSD  257
            CRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  344  CRGRNVCGVDSMVSTVAAVSTTTSD  368



>gb|AAF61440.1|AF138264_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/85 (94%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKI
Sbjct  284  QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKI  343

Query  183  CRGRNICGVDSMVSTVAAVNTPTSD  257
            CRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  344  CRGRNVCGVDSMVSTVAAVSTTTSD  368



>gb|AAF61441.1|AF138265_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=366

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/85 (94%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKI
Sbjct  282  QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKI  341

Query  183  CRGRNICGVDSMVSTVAAVNTPTSD  257
            CRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  342  CRGRNVCGVDSMVSTVAAVSTTTSD  366



>gb|AAF40416.1|AF216785_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
 gb|AAF61442.1|AF138266_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
Length=366

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/85 (94%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKI
Sbjct  282  QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKI  341

Query  183  CRGRNICGVDSMVSTVAAVNTPTSD  257
            CRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  342  CRGRNVCGVDSMVSTVAAVSTTTSD  366



>gb|KDP41743.1| hypothetical protein JCGZ_26761 [Jatropha curcas]
Length=370

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/83 (93%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGE+WGE GYYKI
Sbjct  287  QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGETWGESGYYKI  346

Query  183  CRGRNICGVDSMVSTVAAVNTPT  251
            CRGRN+CGVDSMVSTVAAV T +
Sbjct  347  CRGRNVCGVDSMVSTVAAVQTSS  369



>ref|XP_002512963.1| cysteine protease, putative [Ricinus communis]
 gb|EEF49466.1| cysteine protease, putative [Ricinus communis]
Length=373

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGE+WGE GYYKI
Sbjct  290  QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGENWGESGYYKI  349

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRGRNICGVDSMVSTVAAV T + 
Sbjct  350  CRGRNICGVDSMVSTVAAVQTASE  373



>sp|P05993.1|PAPA5_CARPA RecName: Full=Cysteine proteinase; AltName: Full=Clone PLBPC13, 
partial [Carica papaya]
 emb|CAA27609.1| pot. cysteine proteinase [Carica papaya]
Length=96

 Score =   160 bits (404),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICS+RL+HGVLLVGYGSAGYAPIRLKEKPYW+IKNSWGE+WGE GYYKI
Sbjct  13   QTYIGGVSCPYICSRRLNHGVLLVGYGSAGYAPIRLKEKPYWVIKNSWGENWGENGYYKI  72

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRGRNICGVDSMVSTVAAV+T + 
Sbjct  73   CRGRNICGVDSMVSTVAAVHTTSQ  96



>gb|KHG24064.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=374

 Score =   167 bits (423),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/81 (94%), Positives = 80/81 (99%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLK+KPYWIIKNSWGE+WGE GYYKI
Sbjct  291  QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKDKPYWIIKNSWGETWGENGYYKI  350

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRN+CGVDS+VSTVAAVNT
Sbjct  351  CRGRNVCGVDSLVSTVAAVNT  371



>gb|AAX19661.1| cysteine proteinase [Populus tomentosa]
Length=374

 Score =   167 bits (422),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 75/83 (90%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICS+RLDHGVLLVGYGSAGYAP+R+KEKPYWIIKNSWGESWGE G+YKI
Sbjct  291  QTYIGGVSCPYICSRRLDHGVLLVGYGSAGYAPVRMKEKPYWIIKNSWGESWGENGFYKI  350

Query  183  CRGRNICGVDSMVSTVAAVNTPT  251
            CRGRNICGVDSMVSTVAAV T +
Sbjct  351  CRGRNICGVDSMVSTVAAVQTSS  373



>gb|AIB06024.1| CP2 [Hevea brasiliensis]
Length=372

 Score =   167 bits (422),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/85 (92%), Positives = 81/85 (95%), Gaps = 1/85 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAP+RLKEKPYWIIKNSWGE+WGE GYYKI
Sbjct  288  QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPVRLKEKPYWIIKNSWGENWGESGYYKI  347

Query  183  CRGRNICGVDSMVSTVAA-VNTPTS  254
            CRGRNICGVDSMVSTVAA V TP+ 
Sbjct  348  CRGRNICGVDSMVSTVAAVVQTPSQ  372



>gb|ABK96252.1| unknown [Populus trichocarpa x Populus deltoides]
Length=156

 Score =   160 bits (405),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICS+RLDHGVLLVGYGSAGY+P+R+KEKP+WIIKNSWGE WGE G+YKI
Sbjct  74   QTYIGGVSCPYICSRRLDHGVLLVGYGSAGYSPVRMKEKPFWIIKNSWGEKWGENGFYKI  133

Query  183  CRGRNICGVDSMVSTVAAVNTPT  251
            CRGRN+CGVDSMVSTVAAV T +
Sbjct  134  CRGRNVCGVDSMVSTVAAVQTSS  156



>ref|XP_011047717.1| PREDICTED: cysteine proteinase RD19a [Populus euphratica]
Length=368

 Score =   166 bits (421),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 75/81 (93%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICS+RLDHGVLLVGYGSAGYAP+R+KEKPYWIIKNSWGESWGE G+YKI
Sbjct  285  QTYIGGVSCPYICSRRLDHGVLLVGYGSAGYAPVRMKEKPYWIIKNSWGESWGENGFYKI  344

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRNICGVDSMVSTVAAV T
Sbjct  345  CRGRNICGVDSMVSTVAAVQT  365



>gb|KJB32561.1| hypothetical protein B456_005G247000 [Gossypium raimondii]
Length=374

 Score =   166 bits (421),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 75/81 (93%), Positives = 80/81 (99%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLK+KPYWIIKNSWGE+WGE G+YKI
Sbjct  291  QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKDKPYWIIKNSWGETWGENGFYKI  350

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRN+CGVDS+VSTVAAVNT
Sbjct  351  CRGRNVCGVDSLVSTVAAVNT  371



>gb|ABQ10201.1| cysteine protease Cp3 [Actinidia deliciosa]
Length=365

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE G+YKI
Sbjct  282  QTYVGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGFYKI  341

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            C+GRN+CGVDSMVSTVAAV+T ++
Sbjct  342  CQGRNVCGVDSMVSTVAAVHTTSN  365



>gb|KJB79047.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
Length=373

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/81 (91%), Positives = 80/81 (99%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAP+R+K+KPYWIIKNSWGE+WGE G+Y+I
Sbjct  290  QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGENGFYRI  349

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRNICGVDSMVSTVAAVNT
Sbjct  350  CRGRNICGVDSMVSTVAAVNT  370



>emb|CAE54306.1| putative papain-like cysteine proteinase [Gossypium hirsutum]
Length=373

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/81 (91%), Positives = 80/81 (99%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAP+R+K+KPYWIIKNSWGE+WGE G+Y+I
Sbjct  290  QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGENGFYRI  349

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRNICGVDSMVSTVAAVNT
Sbjct  350  CRGRNICGVDSMVSTVAAVNT  370



>emb|CDP20652.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/83 (92%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICSKRLDHGVLLVGYGS+GYAPIR+KEKPYWIIKNSWGE WGE GYYKI
Sbjct  290  QTYIGGVSCPYICSKRLDHGVLLVGYGSSGYAPIRMKEKPYWIIKNSWGEHWGENGYYKI  349

Query  183  CRGRNICGVDSMVSTVAAVNTPT  251
            CRG NICGVDSMVSTVAAV+T T
Sbjct  350  CRGHNICGVDSMVSTVAAVHTST  372



>gb|KHG15253.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=373

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/81 (91%), Positives = 80/81 (99%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAP+R+K+KPYWIIKNSWGE+WGE G+Y+I
Sbjct  290  QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGENGFYRI  349

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRNICGVDSMVSTVAAVNT
Sbjct  350  CRGRNICGVDSMVSTVAAVNT  370



>ref|XP_002313770.1| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE87725.1| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/81 (91%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICS+RLDHGVLLVGYGSA YAP+R+KEKPYWIIKNSWGESWGE G+YKI
Sbjct  285  QTYIGGVSCPYICSRRLDHGVLLVGYGSAAYAPVRMKEKPYWIIKNSWGESWGENGFYKI  344

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRNICGVDSMVSTVAAV T
Sbjct  345  CRGRNICGVDSMVSTVAAVQT  365



>gb|ABK92536.1| unknown [Populus trichocarpa]
Length=368

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/81 (91%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICS+RLDHGVLLVGYGSA YAP+R+KEKPYWIIKNSWGESWGE G+YKI
Sbjct  285  QTYIGGVSCPYICSRRLDHGVLLVGYGSAAYAPVRMKEKPYWIIKNSWGESWGENGFYKI  344

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRNICGVDSMVSTVAAV T
Sbjct  345  CRGRNICGVDSMVSTVAAVQT  365



>ref|NP_001267989.1| cysteine protease precursor [Vitis vinifera]
 gb|ABX79341.1| cysteine protease [Vitis vinifera]
Length=377

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+K+KPYWIIKNSWGE+WGE G+YKI
Sbjct  294  QTYVGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKDKPYWIIKNSWGENWGENGFYKI  353

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRGRN+CGVDSMVSTVAAV+T ++
Sbjct  354  CRGRNVCGVDSMVSTVAAVHTTSN  377



>ref|XP_007042077.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOX97908.1| Papain family cysteine protease [Theobroma cacao]
Length=395

 Score =   165 bits (417),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 74/81 (91%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYI GVSCPYICSKRLDHGVLLVGYGSAGYAP+R+K+KPYWIIKNSWGESWGE G+YKI
Sbjct  312  QTYIKGVSCPYICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGESWGEDGFYKI  371

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRNICGVDSMVSTVAAV+T
Sbjct  372  CRGRNICGVDSMVSTVAAVDT  392



>ref|XP_003606998.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89195.1| papain family cysteine protease [Medicago truncatula]
Length=362

 Score =   164 bits (414),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 75/83 (90%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRLDHGVLLVGYGS  Y+PIRLKEKPYWIIKNSWGE+WGE GYYKI
Sbjct  280  QTYVGGVSCPYICSKRLDHGVLLVGYGSGAYSPIRLKEKPYWIIKNSWGETWGENGYYKI  339

Query  183  CRGRNICGVDSMVSTVAAVNTPT  251
            CRGRNICGVDSMVSTVAAV+T T
Sbjct  340  CRGRNICGVDSMVSTVAAVHTTT  362



>gb|KDO49483.1| hypothetical protein CISIN_1g017318mg [Citrus sinensis]
Length=373

 Score =   164 bits (415),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 75/79 (95%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICS+RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE GYYKI
Sbjct  294  QTYIGGVSCPYICSRRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGENGYYKI  353

Query  183  CRGRNICGVDSMVSTVAAV  239
            CRGRN+CGVDSMVSTVAA 
Sbjct  354  CRGRNVCGVDSMVSTVAAA  372



>ref|XP_006487337.1| PREDICTED: cysteine proteinase RD19a-like [Citrus sinensis]
Length=373

 Score =   164 bits (415),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 75/79 (95%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICS+RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE GYYKI
Sbjct  294  QTYIGGVSCPYICSRRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGENGYYKI  353

Query  183  CRGRNICGVDSMVSTVAAV  239
            CRGRN+CGVDSMVSTVAA 
Sbjct  354  CRGRNVCGVDSMVSTVAAA  372



>ref|XP_009351218.1| PREDICTED: cysteine proteinase RD19a-like, partial [Pyrus x bretschneideri]
Length=282

 Score =   162 bits (409),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YKI
Sbjct  197  QTYVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKI  256

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRGRNICGVDSMVSTVAA +  T+
Sbjct  257  CRGRNICGVDSMVSTVAAASVKTN  280



>ref|XP_009373025.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=371

 Score =   164 bits (415),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YKI
Sbjct  286  QTYVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKI  345

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRGRNICGVDSMVSTVAA +  T+
Sbjct  346  CRGRNICGVDSMVSTVAAASVKTN  369



>gb|KHN39817.1| Cysteine proteinase RD19a [Glycine soja]
Length=332

 Score =   163 bits (412),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICS+RLDHGVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYKI
Sbjct  249  QTYIGGVSCPYICSRRLDHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKI  308

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRGRNICGVDSMVSTVAAV+T T 
Sbjct  309  CRGRNICGVDSMVSTVAAVHTTTQ  332



>ref|XP_009373000.1| PREDICTED: cysteine proteinase RD19a [Pyrus x bretschneideri]
Length=371

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YKI
Sbjct  286  QTYVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKI  345

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRGRNICGVDSMVSTVAA +  T+
Sbjct  346  CRGRNICGVDSMVSTVAAASVKTN  369



>ref|XP_004290288.1| PREDICTED: probable cysteine proteinase A494 [Fragaria vesca 
subsp. vesca]
Length=372

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/80 (91%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRLDHGVLLVGYGSAGY+P+R+KEKPYWIIKNSWGE+WGEKG+YKI
Sbjct  292  QTYVGGVSCPYICSKRLDHGVLLVGYGSAGYSPVRMKEKPYWIIKNSWGENWGEKGFYKI  351

Query  183  CRGRNICGVDSMVSTVAAVN  242
            CRGRNICGVDSMVSTVAAV 
Sbjct  352  CRGRNICGVDSMVSTVAAVE  371



>ref|XP_003539008.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=363

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICS+RLDHGVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYKI
Sbjct  280  QTYIGGVSCPYICSRRLDHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKI  339

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRGRNICGVDSMVSTVAAV+T T 
Sbjct  340  CRGRNICGVDSMVSTVAAVHTTTQ  363



>ref|XP_010271520.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=370

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICSKRLDHGVLLVGYGS GYAPIRLK+KPYWIIKNSWGE WGE GYYKI
Sbjct  287  QTYIGGVSCPYICSKRLDHGVLLVGYGSEGYAPIRLKDKPYWIIKNSWGEGWGENGYYKI  346

Query  183  CRGRNICGVDSMVSTVAAVN  242
            CRGRN+CGVDSMVSTVAAVN
Sbjct  347  CRGRNVCGVDSMVSTVAAVN  366



>ref|XP_008382317.1| PREDICTED: cysteine proteinase RD19a [Malus domestica]
Length=371

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YKI
Sbjct  286  QTYVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKI  345

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRGRNICGVDSMVSTVAA +  T+
Sbjct  346  CRGRNICGVDSMVSTVAAASVKTN  369



>ref|XP_008236965.1| PREDICTED: cysteine proteinase RD19a [Prunus mume]
Length=367

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRLDHGVLLVGYG+AGY+PIR+KEKPYWIIKNSWGE+WGEKG+YKI
Sbjct  282  QTYVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRMKEKPYWIIKNSWGENWGEKGFYKI  341

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            C+GRNICGVDSMVSTVAA +  T+
Sbjct  342  CKGRNICGVDSMVSTVAAASVETN  365



>gb|ACI04578.1| cysteine protease-like protein [Robinia pseudoacacia]
Length=335

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/81 (93%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC K LDHGVLLVGYG AGYAPIRLKEKPYWIIKNSWGESWGE GYYKI
Sbjct  252  QTYIGGVSCPYICGKNLDHGVLLVGYGKAGYAPIRLKEKPYWIIKNSWGESWGENGYYKI  311

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRN+CGVDSMVSTVAAV+T
Sbjct  312  CRGRNVCGVDSMVSTVAAVHT  332



>ref|XP_006423403.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
 gb|ESR36643.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
Length=375

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICS+RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE GYYKI
Sbjct  294  QTYIGGVSCPYICSRRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGENGYYKI  353

Query  183  CRGRNICGVDSMVSTVAAV  239
            CRGRN+CGVDSMVST+AA 
Sbjct  354  CRGRNVCGVDSMVSTIAAA  372



>ref|XP_007201310.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
 gb|EMJ02509.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
Length=367

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRLDHGVLLVGYG+AGY+PIR+KEKPYWIIKNSWGE+WGEKG+YKI
Sbjct  282  QTYVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRMKEKPYWIIKNSWGENWGEKGFYKI  341

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            C+GRNICGVDSMVSTVAA +  T+
Sbjct  342  CKGRNICGVDSMVSTVAAASVETN  365



>ref|XP_010028631.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW55393.1| hypothetical protein EUGRSUZ_I01305 [Eucalyptus grandis]
Length=370

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 80/86 (93%), Gaps = 2/86 (2%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+K+KPYWIIKNSWGE+WGE GYYKI
Sbjct  284  QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKDKPYWIIKNSWGETWGENGYYKI  343

Query  183  CRGRNICGVDSMVSTVAAV--NTPTS  254
            CRGRNICGVDSMVSTVAA    TP S
Sbjct  344  CRGRNICGVDSMVSTVAAAVHTTPGS  369



>ref|XP_011088458.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Sesamum indicum]
Length=379

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/81 (94%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCP ICSKRLDHGVLLVGYG AGYAPIR KEKPYWIIKNSWGE WGEKGYYKI
Sbjct  297  QTYIGGVSCPLICSKRLDHGVLLVGYGEAGYAPIRRKEKPYWIIKNSWGEKWGEKGYYKI  356

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRNICGVDSMVSTVAAV+T
Sbjct  357  CRGRNICGVDSMVSTVAAVST  377



>ref|XP_011037175.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
 ref|XP_011037176.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
Length=368

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/83 (87%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICS+RLDHGVLLVGYGSAGY+PIR+K+KPYWIIKNSWGE WGE G+YKI
Sbjct  285  QTYIGGVSCPYICSRRLDHGVLLVGYGSAGYSPIRMKDKPYWIIKNSWGEKWGENGFYKI  344

Query  183  CRGRNICGVDSMVSTVAAVNTPT  251
            CRGRN+CGVDSMVSTVAAV T +
Sbjct  345  CRGRNVCGVDSMVSTVAAVQTTS  367



>gb|AAL69389.1|AF462226_1 putative cysteine proteinase [Narcissus pseudonarcissus]
Length=136

 Score =   156 bits (394),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC K LDHGVLLVGYGS+G+APIR KEKPYWIIKNSWGE+WGEKGYYKI
Sbjct  52   QTYIGGVSCPYICGKHLDHGVLLVGYGSSGWAPIRFKEKPYWIIKNSWGENWGEKGYYKI  111

Query  183  CRGRNICGVDSMVSTVAAVNTPTSD  257
            C+GRN+CGVDSMVSTV A++T   D
Sbjct  112  CKGRNVCGVDSMVSTVTAIHTTPKD  136



>ref|XP_004507484.1| PREDICTED: cysteine proteinase RD19a-like [Cicer arietinum]
Length=363

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICS+RLDHGVLLVGYGS  YAPIR+KEKPYWIIKNSWGE+WGE G+YKI
Sbjct  280  QTYVGGVSCPYICSRRLDHGVLLVGYGSGAYAPIRMKEKPYWIIKNSWGENWGENGFYKI  339

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRGRNICGVDSMVSTVAAV+T T 
Sbjct  340  CRGRNICGVDSMVSTVAAVHTTTQ  363



>ref|XP_011028940.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/81 (90%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKR DHGVLLVGYGSAGYAPIR KEKP+WIIKNSWGE+WGE GYYKI
Sbjct  284  QTYVGGVSCPYICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGENWGENGYYKI  343

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRNICGVDSMVSTVAA++T
Sbjct  344  CRGRNICGVDSMVSTVAAIHT  364



>ref|XP_002305451.2| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE85962.2| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICS+RLDHGVLLVGYGSAGY+P+R+KEKP+WIIKNSWGE WGE G+YKI
Sbjct  285  QTYIGGVSCPYICSRRLDHGVLLVGYGSAGYSPVRMKEKPFWIIKNSWGEKWGENGFYKI  344

Query  183  CRGRNICGVDSMVSTVAAVNTPT  251
            CRGRN+CGVDSMVSTVAAV T +
Sbjct  345  CRGRNVCGVDSMVSTVAAVQTSS  367



>gb|AAR92156.1| putative cysteine protease 3 [Iris x hollandica]
Length=292

 Score =   160 bits (404),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 73/81 (90%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC K LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGE+WGE GYYKI
Sbjct  207  QTYIGGVSCPYICGKHLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGETWGENGYYKI  266

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRN+CGVDSMVSTV A++T
Sbjct  267  CRGRNVCGVDSMVSTVTAIHT  287



>ref|XP_010066197.1| PREDICTED: probable cysteine proteinase A494 [Eucalyptus grandis]
 gb|KCW64029.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
 gb|KCW64030.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
Length=376

 Score =   162 bits (409),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRLDHGVLLVGYGSA Y+PIR+KEKPYWIIKNSWGE+WGE G+YKI
Sbjct  293  QTYVGGVSCPYICSKRLDHGVLLVGYGSAAYSPIRMKEKPYWIIKNSWGENWGENGFYKI  352

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRNICGVDSMVSTVAA++T
Sbjct  353  CRGRNICGVDSMVSTVAAIHT  373



>ref|XP_011092831.1| PREDICTED: cysteine proteinase RD19a-like [Sesamum indicum]
Length=378

 Score =   162 bits (409),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 73/81 (90%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCP+ICSKRLDHGVLLVGYG+A YAPIRLKEKPYWIIKNSWGE+WGE GYYKI
Sbjct  296  QTYIGGVSCPFICSKRLDHGVLLVGYGAASYAPIRLKEKPYWIIKNSWGENWGENGYYKI  355

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRG N+CGVDSMVSTVAAV+T
Sbjct  356  CRGHNVCGVDSMVSTVAAVST  376



>gb|ABK96580.1| unknown [Populus trichocarpa x Populus deltoides]
Length=367

 Score =   161 bits (408),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKR DHGVLLVGYGSAGYAPIR KEKP+WIIKNSWG++WGE GYYKI
Sbjct  284  QTYVGGVSCPYICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGENGYYKI  343

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRNICGVDSMVSTVAA++T
Sbjct  344  CRGRNICGVDSMVSTVAAIHT  364



>ref|XP_009406357.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=372

 Score =   162 bits (409),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC + LDHGVLLVGYGSAGY+PIRLK+KP+WIIKNSWGE+WGEKGYYKI
Sbjct  288  QTYIGGVSCPYICGRHLDHGVLLVGYGSAGYSPIRLKQKPFWIIKNSWGETWGEKGYYKI  347

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRN+CGVDSMVSTV A+NT
Sbjct  348  CRGRNVCGVDSMVSTVTAINT  368



>ref|XP_002302004.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
 gb|ABK94746.1| unknown [Populus trichocarpa]
 gb|EEE81277.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
Length=367

 Score =   161 bits (408),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKR DHGVLLVGYGSAGYAPIR KEKP+WIIKNSWG++WGE GYYKI
Sbjct  284  QTYVGGVSCPYICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGENGYYKI  343

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRNICGVDSMVSTVAA++T
Sbjct  344  CRGRNICGVDSMVSTVAAIHT  364



>gb|ABK94801.1| unknown [Populus trichocarpa]
Length=367

 Score =   161 bits (408),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKR DHGVLLVGYGSAGYAPIR KEKP+WIIKNSWG++WGE GYYKI
Sbjct  284  QTYVGGVSCPYICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGENGYYKI  343

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRNICGVDSMVSTVAA++T
Sbjct  344  CRGRNICGVDSMVSTVAAIHT  364



>ref|XP_009376976.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=445

 Score =   162 bits (411),  Expect = 8e-45, Method: Composition-based stats.
 Identities = 71/84 (85%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVS PYICS+RLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGESW E G+YKI
Sbjct  360  QTYVGGVSYPYICSRRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGESWRESGFYKI  419

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRGRNICGVDSMVSTVAA +  T+
Sbjct  420  CRGRNICGVDSMVSTVAAASVKTN  443



>gb|ABK93575.1| unknown [Populus trichocarpa]
Length=157

 Score =   155 bits (391),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICSK  DHGVLLVGYG+AGYAPIR KEKP+WIIKNSWGE+WGE GYYKI
Sbjct  74   QTYIGGVSCPYICSKHQDHGVLLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGENGYYKI  133

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CR RNICGVDSMVSTVAA++ 
Sbjct  134  CRARNICGVDSMVSTVAAIHA  154



>ref|XP_009376977.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=447

 Score =   162 bits (410),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 71/84 (85%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVS PYICS+RLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGESW E G+YKI
Sbjct  362  QTYVGGVSYPYICSRRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGESWRESGFYKI  421

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRGRNICGVDSMVSTVAA +  T+
Sbjct  422  CRGRNICGVDSMVSTVAAASVKTN  445



>ref|XP_007131787.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
 gb|ESW03781.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
Length=361

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/83 (88%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+ GVSCPYICS+RLDHGVLLVGYGS  YAPIR+KEKPYWIIKNSWGE+WGE GYYKI
Sbjct  278  QTYMHGVSCPYICSRRLDHGVLLVGYGSGAYAPIRMKEKPYWIIKNSWGENWGENGYYKI  337

Query  183  CRGRNICGVDSMVSTVAAVNTPT  251
            CRGRNICGVDSMVSTVAAV+T T
Sbjct  338  CRGRNICGVDSMVSTVAAVHTTT  360



>gb|AAU81591.1| cysteine proteinase, partial [Petunia x hybrida]
Length=190

 Score =   155 bits (391),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/83 (87%), Positives = 78/83 (94%), Gaps = 1/83 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKR DHGVLLVGYGS G+APIR+KEKPYWIIKNSWGE WGE GYYKI
Sbjct  109  QTYVGGVSCPYICSKRQDHGVLLVGYGS-GFAPIRMKEKPYWIIKNSWGEKWGESGYYKI  167

Query  183  CRGRNICGVDSMVSTVAAVNTPT  251
            CRGRN+CGVDSMVSTVAAV+T +
Sbjct  168  CRGRNVCGVDSMVSTVAAVSTSS  190



>ref|XP_010061009.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW67908.1| hypothetical protein EUGRSUZ_F01612 [Eucalyptus grandis]
Length=369

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/81 (90%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC K LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYKI
Sbjct  286  QTYIGGVSCPYICGKHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGENGYYKI  345

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGR+ICGVDSMVSTVAA++T
Sbjct  346  CRGRDICGVDSMVSTVAAIHT  366



>dbj|BAD94010.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
Length=86

 Score =   151 bits (382),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC++RL+HGVLLVGYG+AGYAP R KEKPYWIIKNSWGE+WGE G+YKI
Sbjct  2    QTYIGGVSCPYICTRRLNHGVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYKI  61

Query  183  CRGRNICGVDSMVSTVAAVNTPTSD  257
            C+GRNICGVDSMVSTVAA  + T+ 
Sbjct  62   CKGRNICGVDSMVSTVAATVSTTAH  86



>ref|XP_002510469.1| cysteine protease, putative [Ricinus communis]
 gb|EEF52656.1| cysteine protease, putative [Ricinus communis]
Length=366

 Score =   159 bits (403),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICSKR DHGV+LVGYGSAGYAP+RLK+KP+WIIKNSWGE+WGE GYYKI
Sbjct  283  QTYIGGVSCPYICSKRQDHGVVLVGYGSAGYAPVRLKDKPFWIIKNSWGENWGENGYYKI  342

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRN+CGVD+MVSTVAA++T
Sbjct  343  CRGRNVCGVDAMVSTVAAIHT  363



>ref|XP_004148554.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Cucumis sativus]
Length=381

 Score =   160 bits (404),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/80 (90%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCP+ICSKRLDHGVLLVGYGSAGYAPIR+++K YWIIKNSWGESWGE GYYKI
Sbjct  288  QTYIGGVSCPFICSKRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGENGYYKI  347

Query  183  CRGRNICGVDSMVSTVAAVN  242
            CRGRNICGVDS+VSTVAAV+
Sbjct  348  CRGRNICGVDSLVSTVAAVH  367



>ref|XP_004165230.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
Length=387

 Score =   160 bits (404),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/80 (90%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCP+ICSKRLDHGVLLVGYGSAGYAPIR+++K YWIIKNSWGESWGE GYYKI
Sbjct  294  QTYIGGVSCPFICSKRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGENGYYKI  353

Query  183  CRGRNICGVDSMVSTVAAVN  242
            CRGRNICGVDS+VSTVAAV+
Sbjct  354  CRGRNICGVDSLVSTVAAVH  373



>gb|KGN43159.1| Papain-like cysteine proteinase isoform I [Cucumis sativus]
Length=387

 Score =   160 bits (404),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/80 (90%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCP+ICSKRLDHGVLLVGYGSAGYAPIR+++K YWIIKNSWGESWGE GYYKI
Sbjct  294  QTYIGGVSCPFICSKRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGENGYYKI  353

Query  183  CRGRNICGVDSMVSTVAAVN  242
            CRGRNICGVDS+VSTVAAV+
Sbjct  354  CRGRNICGVDSLVSTVAAVH  373



>ref|XP_003540987.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=365

 Score =   159 bits (402),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPY+CS+RL+HGVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYKI
Sbjct  282  QTYIGGVSCPYVCSRRLNHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKI  341

Query  183  CRGRNICGVDSMVSTVAAVNTPT  251
            CRGRNICGVDSMVSTVA+V+T T
Sbjct  342  CRGRNICGVDSMVSTVASVHTTT  364



>emb|CDQ51995.1| Cysteine proteinase, partial [Fagus sylvatica]
Length=165

 Score =   154 bits (388),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+ GVSCPYIC + LDHGVLLVG+GSAGYAPIRLKEKP+WIIKNSWGE+WGE GYYKI
Sbjct  85   QTYMKGVSCPYICGRHLDHGVLLVGFGSAGYAPIRLKEKPFWIIKNSWGENWGENGYYKI  144

Query  183  CRGRNICGVDSMVSTVAAVN  242
            CRGRN+CGVDSMVSTVAA+N
Sbjct  145  CRGRNVCGVDSMVSTVAAIN  164



>gb|AJP16692.1| cysteine protease, partial [Striga hermonthica]
Length=148

 Score =   153 bits (386),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 69/78 (88%), Positives = 75/78 (96%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+ GVSCPYICSKRLDHGVLLVGYG +GYAPIR+K+KPYWIIKNSWGE+WGE GYYKI
Sbjct  71   QTYMKGVSCPYICSKRLDHGVLLVGYGESGYAPIRMKDKPYWIIKNSWGENWGENGYYKI  130

Query  183  CRGRNICGVDSMVSTVAA  236
            CRGRN+CGVDSMVSTVAA
Sbjct  131  CRGRNVCGVDSMVSTVAA  148



>ref|XP_010268619.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=369

 Score =   159 bits (402),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICS+RL+HGVLLVGYGS GY+PIR+K+KPYWIIKNSWGESWGE GYYKI
Sbjct  286  QTYIGGVSCPYICSRRLNHGVLLVGYGSEGYSPIRMKDKPYWIIKNSWGESWGENGYYKI  345

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGR++CGVDSMVSTVAA++T
Sbjct  346  CRGRDVCGVDSMVSTVAAIHT  366



>gb|AAU81589.1| cysteine proteinase [Petunia x hybrida]
Length=257

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCP IC KR DHGVLLVGYGSAG+APIRLKEKPYWIIKNSWGESWGE+GYYKI
Sbjct  172  QTYVGGVSCPLICFKRQDHGVLLVGYGSAGFAPIRLKEKPYWIIKNSWGESWGEQGYYKI  231

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRNICGVD+MVSTV A +T
Sbjct  232  CRGRNICGVDAMVSTVTAAHT  252



>gb|ABF46642.1| papain-like cysteine proteinase [Pachysandra terminalis]
Length=374

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 78/84 (93%), Gaps = 2/84 (2%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRL-DHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  179
            QTYIGGVSCPYICSKRL DHGVLLVGYGSAG+APIR KEKPYWIIKNSWGESWGEKGYYK
Sbjct  290  QTYIGGVSCPYICSKRLLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGESWGEKGYYK  349

Query  180  ICRGRNICGVDSMVSTVAAVNTPT  251
            ICRGRNICG+DSMVS VAA   PT
Sbjct  350  ICRGRNICGMDSMVSAVAAA-VPT  372



>ref|XP_003523684.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=366

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC K LDHGVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYYKI
Sbjct  283  QTYIGGVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYKI  342

Query  183  CRGRNICGVDSMVSTVAAVN  242
            CRGRN+CGVDSMVSTVAA++
Sbjct  343  CRGRNVCGVDSMVSTVAAIH  362



>ref|XP_004150061.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004166953.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN61836.1| Cysteine protease [Cucumis sativus]
Length=377

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYI GVSCPYICSK LDHGVLLVGYGS GYAPIRLK+KPYWIIKNSWG +WGE GYYKI
Sbjct  294  QTYIKGVSCPYICSKHLDHGVLLVGYGSDGYAPIRLKDKPYWIIKNSWGANWGENGYYKI  353

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRGRNICGVDSMVSTVAAV+T  +
Sbjct  354  CRGRNICGVDSMVSTVAAVHTAAN  377



>ref|NP_001241450.1| uncharacterized protein LOC100778716 precursor [Glycine max]
 gb|ACU20049.1| unknown [Glycine max]
Length=366

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC K LDHGVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYYKI
Sbjct  283  QTYIGGVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYKI  342

Query  183  CRGRNICGVDSMVSTVAAVN  242
            CRGRN+CGVDSMVSTVAA++
Sbjct  343  CRGRNVCGVDSMVSTVAAIH  362



>gb|KHN45894.1| Cysteine proteinase RD19a [Glycine soja]
Length=366

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC K LDHGVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYYKI
Sbjct  283  QTYIGGVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYKI  342

Query  183  CRGRNICGVDSMVSTVAAVN  242
            CRGRN+CGVDSMVSTVAA++
Sbjct  343  CRGRNVCGVDSMVSTVAAIH  362



>dbj|BAJ53178.1| JHL18I08.12 [Jatropha curcas]
 gb|KDP38578.1| hypothetical protein JCGZ_04503 [Jatropha curcas]
Length=368

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKR DHGVLLVGYGSAGYAPIRLK+KP+WIIKNSWGESWGE GYY+I
Sbjct  284  QTYMGGVSCPYICSKRQDHGVLLVGYGSAGYAPIRLKDKPFWIIKNSWGESWGENGYYRI  343

Query  183  CRGRNICGVDSMVSTVAAVN  242
            CRGRNICGVD+MVS+VAA++
Sbjct  344  CRGRNICGVDAMVSSVAAIH  363



>ref|XP_010531457.1| PREDICTED: probable cysteine proteinase A494 [Tarenaya hassleriana]
Length=364

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/78 (90%), Positives = 77/78 (99%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICS+RL+HGVLLVGYGSAGYAP R+KEKP+WIIKNSWGE+WGEKG+YKI
Sbjct  283  QTYIGGVSCPYICSRRLNHGVLLVGYGSAGYAPARMKEKPFWIIKNSWGENWGEKGFYKI  342

Query  183  CRGRNICGVDSMVSTVAA  236
            CRGRNICGVDS+VSTVAA
Sbjct  343  CRGRNICGVDSLVSTVAA  360



>ref|XP_010530325.1| PREDICTED: cysteine proteinase RD19a [Tarenaya hassleriana]
Length=370

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICSKR DHGVLLVGYGSAGY+PIRLKEKPYWIIKNSWG +WGE+GYYKI
Sbjct  287  QTYIGGVSCPYICSKRQDHGVLLVGYGSAGYSPIRLKEKPYWIIKNSWGANWGEEGYYKI  346

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            C GRN+CG+D+MVS+VAAV+T T 
Sbjct  347  CHGRNLCGMDTMVSSVAAVHTSTQ  370



>gb|KHN25410.1| Cysteine proteinase RD19a [Glycine soja]
Length=365

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPY+CS+RL+HGVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYKI
Sbjct  282  QTYIGGVSCPYVCSRRLNHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKI  341

Query  183  CRGRNICGVDSMVSTVAAVNTPT  251
            CRGR+ICGVDSMVSTVA+V+T T
Sbjct  342  CRGRSICGVDSMVSTVASVHTTT  364



>ref|XP_010910124.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=374

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC K LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYKI
Sbjct  293  QTYIGGVSCPYICGKHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEDGYYKI  352

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            C+GRN+CGVDSMVSTV AV +
Sbjct  353  CKGRNVCGVDSMVSTVTAVRS  373



>ref|XP_008775532.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=371

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC + LDHGVLLVGYGSA YAPIR KEKPYWIIKNSWGE WGE GYYKI
Sbjct  290  QTYIGGVSCPYICGRHLDHGVLLVGYGSAAYAPIRFKEKPYWIIKNSWGEKWGENGYYKI  349

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRN+CGVDSMVSTVAAV +
Sbjct  350  CRGRNVCGVDSMVSTVAAVRS  370



>ref|XP_009392632.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=369

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC + LDHGVLLVGYGSAGY+PIRLK+KP+WIIKNSWGE+WGE GYYKI
Sbjct  285  QTYIGGVSCPYICGRHLDHGVLLVGYGSAGYSPIRLKDKPFWIIKNSWGENWGEHGYYKI  344

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRNICGVDSMVS+V+A++T
Sbjct  345  CRGRNICGVDSMVSSVSAIHT  365



>dbj|BAC41322.1| hypothetical protein [Lotus japonicus]
Length=358

 Score =   156 bits (395),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKI
Sbjct  277  QTYVGGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKI  336

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRNICGVDSMVSTVAA++T
Sbjct  337  CRGRNICGVDSMVSTVAALHT  357



>ref|XP_011045161.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICSK  DHGVLLVGYG+AGYAPIR KEKP+WIIKNSWGE+WGE GYYKI
Sbjct  284  QTYIGGVSCPYICSKHQDHGVLLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGENGYYKI  343

Query  183  CRGRNICGVDSMVSTVAAVN  242
            CR RNICGVDSMVSTVAA++
Sbjct  344  CRARNICGVDSMVSTVAAIH  363



>gb|EYU37835.1| hypothetical protein MIMGU_mgv1a008237mg [Erythranthe guttata]
Length=380

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+ GVSCPYIC+KRLDHGVLLVGYG  GY+PIR+KEKPYWIIKNSWG +WGE GYYKI
Sbjct  297  QTYMKGVSCPYICTKRLDHGVLLVGYGETGYSPIRMKEKPYWIIKNSWGPNWGEDGYYKI  356

Query  183  CRGRNICGVDSMVSTVAAVNTPT  251
            CRGRNICGVDSMVSTVAAV+T +
Sbjct  357  CRGRNICGVDSMVSTVAAVSTTS  379



>ref|XP_009602233.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana tomentosiformis]
Length=369

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 79/83 (95%), Gaps = 1/83 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRLDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKI
Sbjct  287  QTYVGGVSCPYICSKRLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGENGYYKI  345

Query  183  CRGRNICGVDSMVSTVAAVNTPT  251
            CRGRN+CGVDSMVSTVAAV+T +
Sbjct  346  CRGRNVCGVDSMVSTVAAVSTSS  368



>ref|XP_009109502.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
 emb|CDX90310.1| BnaA08g16740D [Brassica napus]
Length=369

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKI
Sbjct  285  QTYIGGVSCPYICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKI  344

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRGRN+CGVDS+VSTV A  +PT+
Sbjct  345  CRGRNVCGVDSLVSTVTAAVSPTA  368



>ref|XP_008448073.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=385

 Score =   157 bits (396),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCP+ICS RLDHGVLLVGYGSAGYAPIR+++K YWIIKNSWGE+WGE GYYKI
Sbjct  292  QTYIGGVSCPFICSNRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGENWGENGYYKI  351

Query  183  CRGRNICGVDSMVSTVAAVN  242
            CRGRNICGVDS+VSTVAAV+
Sbjct  352  CRGRNICGVDSLVSTVAAVH  371



>gb|AAL05851.1|AF411121_1 cysteine proteinase precursor [Sandersonia aurantiaca]
Length=360

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYIC K LDHGVLLVGYGSAG+APIR KEKPYWIIKNSWGE+WGE GYYKI
Sbjct  278  QTYVGGVSCPYICGKHLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGENWGENGYYKI  337

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRN+CGVDSMVS+V+A +T
Sbjct  338  CRGRNVCGVDSMVSSVSAFHT  358



>ref|XP_002306900.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
 gb|ABK92924.1| unknown [Populus trichocarpa]
 gb|EEE93896.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
Length=367

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICSK  DHGVLLVGYG+AGYAPIR KEKP+WIIKNSWGE+WGE GYYKI
Sbjct  284  QTYIGGVSCPYICSKHQDHGVLLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGENGYYKI  343

Query  183  CRGRNICGVDSMVSTVAAVN  242
            CR RNICGVDSMVSTVAA++
Sbjct  344  CRARNICGVDSMVSTVAAIH  363



>gb|EYU42593.1| hypothetical protein MIMGU_mgv1a008336mg [Erythranthe guttata]
Length=377

 Score =   156 bits (395),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCP+IC+KRLDHGVLLVGYG+  +APIR+KEKPYWIIKNSWG +WGEKGYYKI
Sbjct  296  QTYVGGVSCPFICAKRLDHGVLLVGYGAGAFAPIRMKEKPYWIIKNSWGPNWGEKGYYKI  355

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            C+GRN+CGVDSMVSTVAAV T
Sbjct  356  CQGRNLCGVDSMVSTVAAVTT  376



>emb|CAE45588.1| papain-like cysteine proteinase-like protein 1 [Lotus japonicus]
Length=359

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKI
Sbjct  278  QTYVGGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKI  337

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRNICGVDSMVSTVAA++T
Sbjct  338  CRGRNICGVDSMVSTVAALHT  358



>ref|XP_008460996.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=377

 Score =   156 bits (395),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYI GVSCPYICS+ LDHGVLLVGYGS GYAPIR+K+KPYWIIKNSWG +WGE GYYKI
Sbjct  294  QTYIRGVSCPYICSRHLDHGVLLVGYGSEGYAPIRMKDKPYWIIKNSWGANWGENGYYKI  353

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRGRNICGVDSMVSTVAAV+T  +
Sbjct  354  CRGRNICGVDSMVSTVAAVHTAAN  377



>ref|XP_002275759.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI17456.3| unnamed protein product [Vitis vinifera]
Length=367

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+ GVSCPYICS+ LDHGV+LVGYGSAGYAPIR KEKPYWIIKNSWGESWGE GYYKI
Sbjct  284  QTYMKGVSCPYICSRNLDHGVVLVGYGSAGYAPIRFKEKPYWIIKNSWGESWGEDGYYKI  343

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRG N CGVDSMVSTVAA+ T T 
Sbjct  344  CRGHNACGVDSMVSTVAAIQTTTQ  367



>dbj|BAF98584.1| CM0216.500.nc [Lotus japonicus]
Length=360

 Score =   155 bits (393),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKI
Sbjct  277  QTYVGGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKI  336

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRNICGVDSMVSTVAA++T
Sbjct  337  CRGRNICGVDSMVSTVAALHT  357



>gb|AAB62937.1| stress-induced cysteine proteinase [Lavatera thuringiaca]
Length=175

 Score =   150 bits (380),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC + LDHGVLLVGYG+AGYAP+R KEKP+WIIKNSWG +WGE GYYKI
Sbjct  92   QTYIGGVSCPYICFRSLDHGVLLVGYGAAGYAPVRFKEKPFWIIKNSWGANWGEDGYYKI  151

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRGRN+CGVDSMVS+VAA+ T + 
Sbjct  152  CRGRNVCGVDSMVSSVAALQTKSQ  175



>gb|KHN12668.1| Cysteine proteinase 15A [Glycine soja]
Length=156

 Score =   150 bits (379),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYIC K LDHGVLLVGYG   YAPIR K KPYWIIKNSWGESWGE GYYKI
Sbjct  73   QTYVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYYKI  132

Query  183  CRGRNICGVDSMVSTVAAV  239
            CRGRN+CGVDSMVSTVAA+
Sbjct  133  CRGRNVCGVDSMVSTVAAI  151



>gb|KHN22211.1| Cysteine proteinase 15A [Glycine soja]
Length=366

 Score =   156 bits (394),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC K LDHGVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYY I
Sbjct  283  QTYIGGVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYNI  342

Query  183  CRGRNICGVDSMVSTVAAVN  242
            CRGRN+CGVDSMVSTVAA++
Sbjct  343  CRGRNVCGVDSMVSTVAAIH  362



>gb|KJB07487.1| hypothetical protein B456_001G026600 [Gossypium raimondii]
Length=377

 Score =   156 bits (394),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCP+ICSK LDHGVLLVGYGSAGY+PI LK+KPYWIIKNSWGE+WGE GYYKI
Sbjct  294  QTYIGGVSCPFICSKHLDHGVLLVGYGSAGYSPIHLKDKPYWIIKNSWGENWGENGYYKI  353

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRG N+CGVDS+VSTV A+NT + 
Sbjct  354  CRGSNVCGVDSLVSTVVALNTKSQ  377



>ref|XP_002280798.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CAN73591.1| hypothetical protein VITISV_022889 [Vitis vinifera]
 emb|CBI19785.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   156 bits (394),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY  GVSCPYICS  LDHGVLLVGYGSAGY+PIR KEKPYWIIKNSWGESWGE+GYYKI
Sbjct  288  QTYKSGVSCPYICSSTLDHGVLLVGYGSAGYSPIRFKEKPYWIIKNSWGESWGEQGYYKI  347

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRG NICGVDSMVSTVAA++T
Sbjct  348  CRGHNICGVDSMVSTVAAIHT  368



>gb|AGV54334.1| cysteine proteinase RD19a-like protein [Phaseolus vulgaris]
Length=366

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC K LDHGVLLVGYG+  YAPIR KEKP+WIIKNSWGESWGE GYYKI
Sbjct  283  QTYIGGVSCPYICGKHLDHGVLLVGYGAGAYAPIRFKEKPFWIIKNSWGESWGENGYYKI  342

Query  183  CRGRNICGVDSMVSTVAAVNTPT  251
            CRG N+CGVDSMVSTVAA++T +
Sbjct  343  CRGHNVCGVDSMVSTVAAIHTSS  365



>gb|AAM65162.1| cysteine proteinase RD19A [Arabidopsis thaliana]
Length=368

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC++RL+HGVLLVGYG+AGYAP R KEKPYWIIKNSWGE+WGE G+YKI
Sbjct  284  QTYIGGVSCPYICTRRLNHGVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYKI  343

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            C+GRNICGVDSMVSTVAA  + T+
Sbjct  344  CKGRNICGVDSMVSTVAATVSTTA  367



>ref|XP_007136047.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
 gb|ESW08041.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
Length=366

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC K LDHGVLLVGYG+  YAPIR KEKP+WIIKNSWGESWGE GYYKI
Sbjct  283  QTYIGGVSCPYICGKHLDHGVLLVGYGAGAYAPIRFKEKPFWIIKNSWGESWGENGYYKI  342

Query  183  CRGRNICGVDSMVSTVAAVNTPT  251
            CRG N+CGVDSMVSTVAA++T +
Sbjct  343  CRGHNVCGVDSMVSTVAAIHTSS  365



>ref|XP_006362019.1| PREDICTED: cysteine proteinase RD19a-like [Solanum tuberosum]
Length=368

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 79/83 (95%), Gaps = 1/83 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSK+LDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKI
Sbjct  287  QTYVGGVSCPYICSKQLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGENGYYKI  345

Query  183  CRGRNICGVDSMVSTVAAVNTPT  251
            CRGRN+CGVDSMVSTVAAV+T +
Sbjct  346  CRGRNVCGVDSMVSTVAAVSTSS  368



>ref|XP_004291404.1| PREDICTED: cysteine proteinase 15A-like [Fragaria vesca subsp. 
vesca]
Length=365

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 78/82 (95%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  179
            QTYIGGVSCPYIC K  LDHGVLLVGYGS+GYAPIR KEKPYWIIKNSWG+SWGE+GYYK
Sbjct  284  QTYIGGVSCPYICGKNHLDHGVLLVGYGSSGYAPIRFKEKPYWIIKNSWGQSWGEEGYYK  343

Query  180  ICRGRNICGVDSMVSTVAAVNT  245
            ICRGRN+CGVDSMVSTVAA++T
Sbjct  344  ICRGRNVCGVDSMVSTVAAMHT  365



>ref|XP_004230928.1| PREDICTED: cysteine proteinase RD19a [Solanum lycopersicum]
Length=369

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 79/83 (95%), Gaps = 1/83 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSK+LDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKI
Sbjct  287  QTYVGGVSCPYICSKQLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGESGYYKI  345

Query  183  CRGRNICGVDSMVSTVAAVNTPT  251
            CRGRN+CGVDSMVSTVAAV+T +
Sbjct  346  CRGRNVCGVDSMVSTVAAVSTSS  368



>ref|XP_010105270.1| Cysteine proteinase 15A [Morus notabilis]
 gb|EXC04205.1| Cysteine proteinase 15A [Morus notabilis]
Length=372

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 78/81 (96%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  179
            QTYIGGVSCPYICSK  LDHGVLLVGYG+AGYAPIR K+KPYWIIKNSWGE+WGE+GYYK
Sbjct  283  QTYIGGVSCPYICSKHMLDHGVLLVGYGTAGYAPIRFKDKPYWIIKNSWGENWGEQGYYK  342

Query  180  ICRGRNICGVDSMVSTVAAVN  242
            ICRGRN+CGVDSMVSTVAA++
Sbjct  343  ICRGRNVCGVDSMVSTVAALH  363



>ref|XP_006473584.1| PREDICTED: cysteine proteinase 15A-like [Citrus sinensis]
Length=369

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC K LDHGVL+VGYGS+G+APIR KEKPYWIIKNSWGE+WGE GYYKI
Sbjct  286  QTYIGGVSCPYICGKYLDHGVLIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGENGYYKI  345

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            C GRN+CGVDSMVS+VAAV+T +S
Sbjct  346  CMGRNVCGVDSMVSSVAAVHTTSS  369



>ref|NP_568052.1| cysteine proteinase RD19a [Arabidopsis thaliana]
 sp|P43296.1|RD19A_ARATH RecName: Full=Cysteine proteinase RD19a; Short=RD19; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA02373.1| thiol protease [Arabidopsis thaliana]
 emb|CAB38829.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 emb|CAB80572.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AAL85009.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 gb|AAM91778.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 dbj|BAE98545.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AEE87016.1| cysteine proteinase RD19a [Arabidopsis thaliana]
Length=368

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC++RL+HGVLLVGYG+AGYAP R KEKPYWIIKNSWGE+WGE G+YKI
Sbjct  284  QTYIGGVSCPYICTRRLNHGVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYKI  343

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            C+GRNICGVDSMVSTVAA  + T+
Sbjct  344  CKGRNICGVDSMVSTVAATVSTTA  367



>emb|CAE45589.1| papain-like cysteine proteinase-like protein 2 [Lotus japonicus]
Length=361

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKI
Sbjct  278  QTYVGGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKI  337

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRN+CGVDSMVSTVAA++T
Sbjct  338  CRGRNVCGVDSMVSTVAALHT  358



>dbj|BAF98585.1| CM0216.510.nc [Lotus japonicus]
Length=360

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKI
Sbjct  277  QTYVGGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKI  336

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRN+CGVDSMVSTVAA++T
Sbjct  337  CRGRNVCGVDSMVSTVAALHT  357



>gb|AIB06025.1| CP3 [Hevea brasiliensis]
Length=366

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICSK  DHGVLLVGYG+AGYAPIR K+KP+WIIKNSWGE+WGE GYYKI
Sbjct  283  QTYIGGVSCPYICSKSQDHGVLLVGYGAAGYAPIRFKDKPFWIIKNSWGENWGENGYYKI  342

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRNICG+D+MVS+VAA++T
Sbjct  343  CRGRNICGMDAMVSSVAAIHT  363



>emb|CDY71205.1| BnaCnng71840D [Brassica napus]
Length=368

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKI
Sbjct  284  QTYIGGVSCPYICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEDGFYKI  343

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRGRN+CGVDS+VSTV A  +P +
Sbjct  344  CRGRNVCGVDSLVSTVTATVSPAA  367



>gb|KDO84720.1| hypothetical protein CISIN_1g017548mg [Citrus sinensis]
Length=369

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC K LDHGVL+VGYGS+G+APIR KEKPYWIIKNSWGE+WGE GYYKI
Sbjct  286  QTYIGGVSCPYICGKYLDHGVLIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGENGYYKI  345

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            C GRN+CGVDSMVS+VAA++T +S
Sbjct  346  CMGRNVCGVDSMVSSVAAIHTTSS  369



>gb|AAL60581.1|AF454959_1 senescence-associated cysteine protease [Brassica oleracea]
Length=368

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKI
Sbjct  284  QTYIGGVSCPYICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEDGFYKI  343

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRGRN+CGVDS+VSTV A  +P +
Sbjct  344  CRGRNVCGVDSLVSTVTATVSPAA  367



>ref|XP_006411706.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
 dbj|BAJ33785.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53159.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
Length=373

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGESWGE G+YKI
Sbjct  289  QTYIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGESWGENGFYKI  348

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            C+GRNICGVDS+VSTV+A  + T+
Sbjct  349  CKGRNICGVDSLVSTVSATVSTTA  372



>ref|XP_006435090.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
 gb|ESR48330.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
Length=369

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC K LDHGVL+VGYGS+G+APIR KEKPYWIIKNSWGE+WGE GYYKI
Sbjct  286  QTYIGGVSCPYICGKYLDHGVLIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGENGYYKI  345

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            C GRN+CGVDSMVS+VAA++T +S
Sbjct  346  CMGRNVCGVDSMVSSVAAIHTTSS  369



>ref|XP_007017672.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOY14897.1| Papain family cysteine protease [Theobroma cacao]
Length=401

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+ GVSCPYIC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE+GYYKI
Sbjct  318  QTYMKGVSCPYICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEEGYYKI  377

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRGRN+CGVDSMVS+VAA+ T
Sbjct  378  CRGRNVCGVDSMVSSVAALQT  398



>gb|KFK30492.1| hypothetical protein AALP_AA7G268600 [Arabis alpina]
Length=367

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKI
Sbjct  283  QTYIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKI  342

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            C+GRNICGVDS+VSTVAA  + T+
Sbjct  343  CKGRNICGVDSLVSTVAATVSTTA  366



>ref|XP_006828787.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
 gb|ERM96203.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
Length=365

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 78/82 (95%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  179
            QTYIGGVSCPYICSKR LDHGVL+VGYGSAGYAPIRLK+K YWIIKNSWGE+WGEKGYYK
Sbjct  284  QTYIGGVSCPYICSKRNLDHGVLIVGYGSAGYAPIRLKDKAYWIIKNSWGETWGEKGYYK  343

Query  180  ICRGRNICGVDSMVSTVAAVNT  245
            ICRG NICGVDSMVSTVA++ +
Sbjct  344  ICRGHNICGVDSMVSTVASIQS  365



>ref|XP_009146338.1| PREDICTED: cysteine proteinase 15A-like [Brassica rapa]
 emb|CDY32227.1| BnaA01g17570D [Brassica napus]
Length=368

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 78/85 (92%), Gaps = 1/85 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG +WGE GYYKI
Sbjct  284  QTYIGGVSCPYICSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGSTWGEDGYYKI  343

Query  183  CRGR-NICGVDSMVSTVAAVNTPTS  254
            CRGR NICG+D+MVSTVAAV+T T 
Sbjct  344  CRGRHNICGMDTMVSTVAAVHTSTQ  368



>emb|CDY34441.1| BnaC01g21920D [Brassica napus]
Length=368

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 1/84 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG +WGE GYYKI
Sbjct  284  QTYIGGVSCPYICSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGSTWGEDGYYKI  343

Query  183  CRGR-NICGVDSMVSTVAAVNTPT  251
            CRGR NICG+D+MVSTVAAV+T T
Sbjct  344  CRGRHNICGMDTMVSTVAAVHTST  367



>ref|XP_006283963.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
 gb|EOA16861.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
Length=368

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKI
Sbjct  284  QTYIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKI  343

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            C+GRNICGVDS+VSTV+A  + T+
Sbjct  344  CKGRNICGVDSLVSTVSATVSTTA  367



>ref|XP_008387995.1| PREDICTED: cysteine proteinase 15A [Malus domestica]
Length=365

 Score =   154 bits (388),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYIC KR+DHGVLLVGYGS+G+APIRLKEKPYWI+KNSWG+SWGE+GYYKI
Sbjct  282  QTYVGGVSCPYICGKRIDHGVLLVGYGSSGFAPIRLKEKPYWILKNSWGQSWGEQGYYKI  341

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRG N CGVDS+VSTVAA++T
Sbjct  342  CRGYNSCGVDSLVSTVAALHT  362



>dbj|BAF46302.1| cysteine proteinase precursor [Ipomoea nil]
Length=369

 Score =   153 bits (387),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 77/82 (94%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  179
            QTYIGGVSCPYICSKR LDHGVLLVGYG+AGYAPIR K+KPYWI+KNSWGE+WGE+GYYK
Sbjct  285  QTYIGGVSCPYICSKRNLDHGVLLVGYGAAGYAPIRFKDKPYWIVKNSWGENWGEEGYYK  344

Query  180  ICRGRNICGVDSMVSTVAAVNT  245
            ICRG NICG+DSMVSTV A +T
Sbjct  345  ICRGNNICGIDSMVSTVTAAST  366



>ref|XP_002868883.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45142.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score =   153 bits (387),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKI
Sbjct  284  QTYIGGVSCPYICTRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKI  343

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            C+GRNICGVDS+VSTV A  + T+
Sbjct  344  CKGRNICGVDSLVSTVTAAVSTTA  367



>ref|XP_007160702.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
 gb|ESW32696.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
Length=365

 Score =   153 bits (387),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYIC K LDHGVLLVGYG   YAPIR KEKPYWIIKNSWGE+WGE GYYKI
Sbjct  282  QTYVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGENGYYKI  341

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRGRN+CGVDSMVSTV A++  T 
Sbjct  342  CRGRNVCGVDSMVSTVGAIHASTQ  365



>dbj|BAF03553.1| cysteine proteinase CP2 [Phaseolus vulgaris]
Length=365

 Score =   153 bits (386),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYIC K LDHGVLLVGYG   YAPIR KEKPYWIIKNSWGE+WGE GYYKI
Sbjct  282  QTYVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGENGYYKI  341

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRGRN+CGVDSMVSTV A++  T 
Sbjct  342  CRGRNVCGVDSMVSTVGAIHASTQ  365



>gb|ACX54787.2| cysteine protease [Arachis diogoi]
Length=360

 Score =   153 bits (386),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC K LDHGVLLVGYG+AGYAPIR K+KP+WIIKNSWGESWGE GYYKI
Sbjct  275  QTYIGGVSCPYICGKNLDHGVLLVGYGAAGYAPIRFKDKPFWIIKNSWGESWGEDGYYKI  334

Query  183  CRGRNICGVDSMVSTVAAVNTPTSD  257
            CRG+N+CGVDSMVS+V A    +S+
Sbjct  335  CRGKNVCGVDSMVSSVVATTFTSSN  359



>emb|CDY41960.1| BnaA01g05320D [Brassica napus]
Length=367

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKI
Sbjct  283  QTYIGGVSCPYICTRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKI  342

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            C+GRNICGVDS+VSTV A  + T+
Sbjct  343  CKGRNICGVDSLVSTVTAAVSTTA  366



>emb|CAB53397.1| cysteine protease [Medicago sativa]
Length=209

 Score =   149 bits (375),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 77/82 (94%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  179
            QTY+ GVSCP+IC+K RLDHGVLLVG+GS GYAPIRLKEKPYWIIKNSWG++WGE+GYYK
Sbjct  128  QTYMSGVSCPHICAKARLDHGVLLVGFGSGGYAPIRLKEKPYWIIKNSWGQNWGEEGYYK  187

Query  180  ICRGRNICGVDSMVSTVAAVNT  245
            ICRGRN+CGVDSMVSTVAA  +
Sbjct  188  ICRGRNVCGVDSMVSTVAAAQS  209



>ref|XP_010446443.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKI
Sbjct  283  QTYIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKI  342

Query  183  CRGRNICGVDSMVSTVAAV  239
            C+GRNICGVDS+VSTV+A 
Sbjct  343  CKGRNICGVDSLVSTVSAT  361



>ref|XP_010431862.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKI
Sbjct  283  QTYIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKI  342

Query  183  CRGRNICGVDSMVSTVAAV  239
            C+GRNICGVDS+VSTV+A 
Sbjct  343  CKGRNICGVDSLVSTVSAT  361



>emb|CAA52403.1| putative thiol protease [Arabidopsis thaliana]
Length=313

 Score =   151 bits (382),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICS+RL+HGVLLVGYGSAG++  RLKEKPYWIIKNSWGESWGE G+YKI
Sbjct  233  QTYIGGVSCPYICSRRLNHGVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENGFYKI  292

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            C+GRNICGVDS+VSTVAA  +
Sbjct  293  CKGRNICGVDSLVSTVAATTS  313



>ref|XP_010437007.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=368

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKI
Sbjct  284  QTYIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKI  343

Query  183  CRGRNICGVDSMVSTVAAV  239
            C+GRNICGVDS+VSTV+A 
Sbjct  344  CKGRNICGVDSLVSTVSAT  362



>ref|XP_006665032.1| PREDICTED: cysteine proteinase 1-like [Oryza brachyantha]
Length=191

 Score =   148 bits (373),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 76/84 (90%), Gaps = 3/84 (4%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC K LDHGVLLVGYGS+G+APIRLK+KPYWIIKNSWGE+WGE GYYKI
Sbjct  105  QTYIGGVSCPYICGKHLDHGVLLVGYGSSGFAPIRLKDKPYWIIKNSWGENWGEHGYYKI  164

Query  183  CRGRNI---CGVDSMVSTVAAVNT  245
            CRG N+   CGVDSMVSTV A++T
Sbjct  165  CRGSNVRDKCGVDSMVSTVTAIHT  188



>dbj|BAA92495.1| cysteine protease [Vigna mungo]
Length=364

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC+KRLDHGV +VGYG +GYAPIR KEKPYWIIKNSWGESWGE GYYKI
Sbjct  281  QTYIGGVSCPYICAKRLDHGVQIVGYGESGYAPIRFKEKPYWIIKNSWGESWGENGYYKI  340

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRG+N CGVDSMVSTV A++ 
Sbjct  341  CRGQNACGVDSMVSTVGAIHA  361



>ref|XP_010440192.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=365

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 76/84 (90%), Gaps = 1/84 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPY+CSK  DHGVLLVG+GSAGYAPIRLKEKPYWIIKNSWG  WGE GYYKI
Sbjct  281  QTYIGGVSCPYVCSKSQDHGVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKI  340

Query  183  CRG-RNICGVDSMVSTVAAVNTPT  251
            CRG  N+CG+DSMVSTVAAV+T T
Sbjct  341  CRGPHNVCGMDSMVSTVAAVHTTT  364



>gb|ACK57563.1| cysteine protease-like protein [Arachis hypogaea]
Length=364

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCP+IC K LDHGVLLVGYG+ GYAPIR KEKPYWIIKNSWGE+WGE GYYKI
Sbjct  281  QTYIGGVSCPFICGKHLDHGVLLVGYGAGGYAPIRFKEKPYWIIKNSWGENWGENGYYKI  340

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRG N+CGVDSMVSTV A++T
Sbjct  341  CRGPNMCGVDSMVSTVIAIHT  361



>ref|XP_010449835.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 76/84 (90%), Gaps = 1/84 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPY+CSK  DHGVLLVG+GSAGYAPIRLKEKPYWIIKNSWG  WGE GYYKI
Sbjct  281  QTYIGGVSCPYVCSKNQDHGVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKI  340

Query  183  CRG-RNICGVDSMVSTVAAVNTPT  251
            CRG  N+CG+DSMVSTVAAV+T T
Sbjct  341  CRGPHNMCGMDSMVSTVAAVHTTT  364



>dbj|BAD43619.1| putative cysteine proteinase [Arabidopsis thaliana]
Length=361

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICS+RL+HGVLLVGYGSAG++  RLKEKPYWIIKNSWGESWGE G+YKI
Sbjct  281  QTYIGGVSCPYICSRRLNHGVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENGFYKI  340

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            C+GRNICGVDS+VSTVAA  +
Sbjct  341  CKGRNICGVDSLVSTVAATTS  361



>ref|XP_009150026.1| PREDICTED: cysteine proteinase RD19a [Brassica rapa]
Length=367

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KE+PYWIIKNSWGE+WGE G+YKI
Sbjct  283  QTYIGGVSCPYICTRRLNHGVLLVGYGSAGYAPARFKERPYWIIKNSWGETWGENGFYKI  342

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            C+GRNICGVDS+VSTV A  + T+
Sbjct  343  CKGRNICGVDSLVSTVTAAVSTTA  366



>ref|NP_565512.1| Papain family cysteine protease [Arabidopsis thaliana]
 sp|P43295.2|A494_ARATH RecName: Full=Probable cysteine proteinase A494; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD23687.1| cysteine proteinase [Arabidopsis thaliana]
 gb|ABJ98563.1| At2g21430 [Arabidopsis thaliana]
 gb|AEC07177.1| Papain family cysteine protease [Arabidopsis thaliana]
Length=361

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICS+RL+HGVLLVGYGSAG++  RLKEKPYWIIKNSWGESWGE G+YKI
Sbjct  281  QTYIGGVSCPYICSRRLNHGVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENGFYKI  340

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            C+GRNICGVDS+VSTVAA  +
Sbjct  341  CKGRNICGVDSLVSTVAATTS  361



>ref|XP_010434865.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 76/84 (90%), Gaps = 1/84 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPY+CSK  DHGVLLVG+GSAGYAPIRLKEKPYWIIKNSWG  WGE GYYKI
Sbjct  281  QTYIGGVSCPYVCSKSQDHGVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKI  340

Query  183  CRG-RNICGVDSMVSTVAAVNTPT  251
            CRG  N+CG+DSMVSTVAAV+T T
Sbjct  341  CRGPHNMCGMDSMVSTVAAVHTTT  364



>ref|XP_003550405.2| PREDICTED: cysteine proteinase 15A [Glycine max]
Length=392

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYIC K LDHGVLLVGYG   YAPIR K KPYWIIKNSWGESWGE GYYKI
Sbjct  309  QTYVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYYKI  368

Query  183  CRGRNICGVDSMVSTVAAV  239
            CRGRN+CGVDSMVSTVAA+
Sbjct  369  CRGRNVCGVDSMVSTVAAI  387



>ref|XP_003545051.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=367

 Score =   151 bits (382),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC K LDHGVL+VGYG   YAPIR K KPYWIIKNSWGESWGE GYYKI
Sbjct  284  QTYIGGVSCPYICGKHLDHGVLIVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYYKI  343

Query  183  CRGRNICGVDSMVSTVAAV  239
            CRGRN+CGVDSMVSTVAA+
Sbjct  344  CRGRNVCGVDSMVSTVAAI  362



>ref|XP_008775280.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=368

 Score =   151 bits (382),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC + LDHGVLLVGYGSAGYAPIR K+KPYWIIKNSWGE+WGE GYYKI
Sbjct  288  QTYIGGVSCPYICGRHLDHGVLLVGYGSAGYAPIRFKDKPYWIIKNSWGENWGEDGYYKI  347

Query  183  CRGRNICGVDSMVSTVAAV  239
            CRG NICGV+SMVSTV A+
Sbjct  348  CRGHNICGVESMVSTVTAI  366



>emb|CDY09707.1| BnaC07g33540D [Brassica napus]
Length=366

 Score =   151 bits (382),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 75/82 (91%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYI GVSCPY+CSK  DHGVLLVG+GSAGYAP+RL+EKPYWIIKNSWG  WGEKGYYKI
Sbjct  282  QTYIAGVSCPYVCSKNQDHGVLLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEKGYYKI  341

Query  183  CRGR-NICGVDSMVSTVAAVNT  245
            CRG  NICGVD+MVSTVAAVNT
Sbjct  342  CRGTPNICGVDTMVSTVAAVNT  363



>ref|XP_011083631.1| PREDICTED: cysteine proteinase 15A-like [Sesamum indicum]
Length=371

 Score =   151 bits (382),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 75/83 (90%), Gaps = 1/83 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC K LDHGVLLVGYG+AGYAPIRLKEKPYWIIKNSWGE+WGE GYYKI
Sbjct  288  QTYIGGVSCPYICGKHLDHGVLLVGYGAAGYAPIRLKEKPYWIIKNSWGENWGENGYYKI  347

Query  183  CRGRNICGVDSMVSTVAAVN-TP  248
            CRG N+CGV SMVSTV A + TP
Sbjct  348  CRGHNVCGVASMVSTVTAAHVTP  370



>gb|ACM80348.1| cysteine proteinase [Solanum lycopersicum]
Length=368

 Score =   151 bits (382),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 78/83 (94%), Gaps = 1/83 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSK+LDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKI
Sbjct  287  QTYVGGVSCPYICSKQLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGESGYYKI  345

Query  183  CRGRNICGVDSMVSTVAAVNTPT  251
             RGRN+CGVDSMVSTVAAV+T +
Sbjct  346  RRGRNVCGVDSMVSTVAAVSTSS  368



>emb|CDP07452.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   151 bits (382),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 76/82 (93%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICSK  DHGVLLVGYG+AGYAPIRLK+KPYWIIKNSWGE+WGE GYYK 
Sbjct  295  QTYIGGVSCPYICSKSQDHGVLLVGYGAAGYAPIRLKDKPYWIIKNSWGENWGENGYYKF  354

Query  183  CRG-RNICGVDSMVSTVAAVNT  245
            CR  RN+CGVDSMVS+VAAV+T
Sbjct  355  CRADRNLCGVDSMVSSVAAVHT  376



>ref|XP_006653265.1| PREDICTED: cysteine proteinase 1-like, partial [Oryza brachyantha]
Length=366

 Score =   151 bits (381),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 75/84 (89%), Gaps = 3/84 (4%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC K LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYKI
Sbjct  279  QTYIGGVSCPYICGKHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGENGYYKI  338

Query  183  CRG---RNICGVDSMVSTVAAVNT  245
            CRG   +N CGVDSMVSTV A++T
Sbjct  339  CRGPHVQNKCGVDSMVSTVTAIHT  362



>ref|XP_010943608.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=371

 Score =   150 bits (380),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC + LDHGVLLVGYGSAGYAPIR K+KPYWIIKNSWG +WGE GYYKI
Sbjct  290  QTYIGGVSCPYICGRHLDHGVLLVGYGSAGYAPIRFKDKPYWIIKNSWGGNWGEDGYYKI  349

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRG+NICGV+SMVSTV AV T
Sbjct  350  CRGQNICGVESMVSTVTAVRT  370



>ref|XP_002880378.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56637.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score =   150 bits (379),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICS+RL+HGVLL+GYGS+GY+  RLKEKPYWIIKNSWGESWGE G+YKI
Sbjct  280  QTYIGGVSCPYICSRRLNHGVLLMGYGSSGYSQARLKEKPYWIIKNSWGESWGENGFYKI  339

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            C+GRNICGVDS+VSTVAA  +
Sbjct  340  CKGRNICGVDSLVSTVAAATS  360



>ref|XP_010672379.1| PREDICTED: cysteine proteinase RD19a-like [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score =   150 bits (380),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCP +C + LDHGV+LVGYGSAGYAPIR KEKPYWIIKNSWG +WG++GYYKI
Sbjct  291  QTYIGGVSCPLVCLRSLDHGVVLVGYGSAGYAPIRFKEKPYWIIKNSWGPNWGDQGYYKI  350

Query  183  CRGRNICGVDSMVSTVAAVN  242
            CRG N+CGVDSMVSTVAAVN
Sbjct  351  CRGHNVCGVDSMVSTVAAVN  370



>gb|AAQ81938.1| cysteine proteinase precursor [Ipomoea batatas]
Length=371

 Score =   150 bits (380),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 77/82 (94%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  179
            QTYIGGVSCPYICSK+ LDHGVL+VGYG+AGYAPIR K+KPYWIIKNSWGE+WGE+GYYK
Sbjct  287  QTYIGGVSCPYICSKKNLDHGVLIVGYGAAGYAPIRFKDKPYWIIKNSWGENWGEEGYYK  346

Query  180  ICRGRNICGVDSMVSTVAAVNT  245
            ICRG NICGVDSMVS+V A +T
Sbjct  347  ICRGNNICGVDSMVSSVTAAST  368



>ref|XP_003589348.1| Cysteine proteinase [Medicago truncatula]
 gb|AES59599.1| papain family cysteine protease [Medicago truncatula]
Length=364

 Score =   150 bits (379),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 76/82 (93%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  179
            QTY+ GVSCPYIC+K RLDHGVLL+G+G  GYAPIRLKEKPYWIIKNSWG++WGE+GYYK
Sbjct  283  QTYMSGVSCPYICAKARLDHGVLLLGFGQGGYAPIRLKEKPYWIIKNSWGQNWGEEGYYK  342

Query  180  ICRGRNICGVDSMVSTVAAVNT  245
            ICRGRN+CGVDSMVSTVAA  +
Sbjct  343  ICRGRNVCGVDSMVSTVAAAQS  364



>ref|XP_009335626.1| PREDICTED: cysteine proteinase 15A [Pyrus x bretschneideri]
Length=366

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYIC KR+DHGVLLVGYGS+G+APIR KEKPYWI+KNSWG+SWGE+GYYKI
Sbjct  283  QTYVGGVSCPYICGKRIDHGVLLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEQGYYKI  342

Query  183  CRGRNICGVDSMVSTVAAVN  242
            CRG N CGVDS+VSTVAA++
Sbjct  343  CRGYNSCGVDSLVSTVAALH  362



>emb|CAB17075.1| cysteine proteinase precursor [Phaseolus vulgaris]
Length=365

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYIC K LDHGVLLVGYG   YAPIR KEKPYWIIKNSWGE+WG  GYYKI
Sbjct  282  QTYVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGGNGYYKI  341

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRGRN+CGVDSMVSTV A++  T 
Sbjct  342  CRGRNVCGVDSMVSTVGAIHASTQ  365



>ref|XP_008221329.1| PREDICTED: cysteine proteinase 15A-like [Prunus mume]
Length=366

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+ GVSCPYIC KR+DHGVLLVGYGS+G+APIR KEKPYWI+KNSWG+SWGE+GYYKI
Sbjct  283  QTYVKGVSCPYICGKRIDHGVLLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEEGYYKI  342

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRG N CGVDS+VSTVA+++T
Sbjct  343  CRGHNPCGVDSLVSTVASLHT  363



>gb|AAD29084.1|AF082181_1 cysteine proteinase precursor [Solanum melongena]
Length=363

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+ GVSCP IC KR DHGVLLVGYGSAG+APIRLKEKPYWIIKNSWGE+WGE GYYKI
Sbjct  278  QTYMRGVSCPLICFKRQDHGVLLVGYGSAGFAPIRLKEKPYWIIKNSWGENWGEHGYYKI  337

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRG NICGVD+MVSTV A +T
Sbjct  338  CRGHNICGVDAMVSTVTATHT  358



>gb|AGS43121.1| cysteine protease 1, partial [Zea mays]
Length=90

 Score =   142 bits (358),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 76/84 (90%), Gaps = 3/84 (4%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC + LDHGVLLVGYG++G+APIRLK+KPYWIIKNSWGE+WGE GYYKI
Sbjct  4    QTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENGYYKI  63

Query  183  CRG---RNICGVDSMVSTVAAVNT  245
            CRG   RN CGVDSMVSTV+AV+ 
Sbjct  64   CRGSNVRNKCGVDSMVSTVSAVHA  87



>gb|KJB29611.1| hypothetical protein B456_005G110200 [Gossypium raimondii]
Length=370

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYIC + LDHGVLLVGYG+AGY+PIR K+KP+WIIKNSWG +WGE GYYKI
Sbjct  287  QTYMGGVSCPYICFRTLDHGVLLVGYGAAGYSPIRFKDKPFWIIKNSWGANWGEDGYYKI  346

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRGRN+CGVDSMVS+VAA++T + 
Sbjct  347  CRGRNVCGVDSMVSSVAALHTKSQ  370



>emb|CAA57675.1| cysteine proteinase [Zea mays]
Length=145

 Score =   144 bits (362),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 76/84 (90%), Gaps = 3/84 (4%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC + LDHGVLLVGYG++G+AP+RLK+KPYWIIKNSWGE+WGE GYYKI
Sbjct  59   QTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPMRLKDKPYWIIKNSWGENWGENGYYKI  118

Query  183  CRG---RNICGVDSMVSTVAAVNT  245
            CRG   RN CGVDSMVSTV+AV+ 
Sbjct  119  CRGSNVRNKCGVDSMVSTVSAVHA  142



>ref|XP_006283974.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
 gb|EOA16872.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
Length=365

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 76/84 (90%), Gaps = 1/84 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPY+CSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE GYYKI
Sbjct  281  QTYIGGVSCPYVCSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKI  340

Query  183  CRG-RNICGVDSMVSTVAAVNTPT  251
            CRG  N+CG+D+MVSTVAAV+T T
Sbjct  341  CRGPHNMCGMDTMVSTVAAVHTTT  364



>ref|XP_002280808.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CBI19783.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            Q+Y GGVSCP+ICS  L+HGVLLVGYGSAGY+PIR KEKPYW++KNSWG++WGE GYYKI
Sbjct  283  QSYAGGVSCPFICSTSLNHGVLLVGYGSAGYSPIRFKEKPYWLLKNSWGQNWGEHGYYKI  342

Query  183  CRGRNICGVDSMVSTVAAVNTPT  251
            CRG NICGVDSMVSTVAA+ + T
Sbjct  343  CRGHNICGVDSMVSTVAAIQSAT  365



>ref|XP_009136751.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
Length=368

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 75/82 (91%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYI GVSCPY+CSK  DHGVLLVG+GSAGYAP+RL+EKPYWIIKNSWG  WGEKGYYKI
Sbjct  284  QTYIAGVSCPYVCSKNQDHGVLLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEKGYYKI  343

Query  183  CRGR-NICGVDSMVSTVAAVNT  245
            CRG  NICGVD+MVSTVAAV+T
Sbjct  344  CRGTPNICGVDTMVSTVAAVHT  365



>emb|CDX99593.1| BnaC04g33500D [Brassica napus]
Length=343

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRL+HGVLLVGYGSAG++  R KEKPYWIIKNSWGE+WGE G+YK+
Sbjct  264  QTYMGGVSCPYICSKRLNHGVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENGFYKL  323

Query  183  CRGRNICGVDSMVSTVAAV  239
            C+GRN+CGVDSMVSTVAA 
Sbjct  324  CKGRNVCGVDSMVSTVAAA  342



>ref|XP_007223351.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
 gb|EMJ24550.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
Length=367

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+ GVSCPYIC KR+DHGVLLVGYGS+G+APIR KEKPYWI+KNSWG+SWGE+G+YKI
Sbjct  284  QTYVKGVSCPYICGKRIDHGVLLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEEGFYKI  343

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRG N CGVDS+VSTVA+++T
Sbjct  344  CRGHNSCGVDSLVSTVASLHT  364



>emb|CDX90537.1| BnaA03g42440D [Brassica napus]
Length=366

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 75/82 (91%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYI GVSCPY+CSK  DHGVLLVG+GSAGYAP+RL+EKPYWIIKNSWG  WGEKGYYKI
Sbjct  282  QTYIAGVSCPYVCSKNQDHGVLLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEKGYYKI  341

Query  183  CRGR-NICGVDSMVSTVAAVNT  245
            CRG  NICGVD+MVSTVAAV+T
Sbjct  342  CRGTPNICGVDTMVSTVAAVHT  363



>sp|P25804.1|CYSP_PEA RecName: Full=Cysteine proteinase 15A; AltName: Full=Turgor-responsive 
protein 15A; Flags: Precursor [Pisum sativum]
 emb|CAA38242.1| unnamed protein product [Pisum sativum]
Length=363

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 75/82 (91%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  179
            QTY+ GVSCPY+C+K RLDHGVLLVG+G   YAPIRLKEKPYWIIKNSWG++WGE+GYYK
Sbjct  280  QTYMSGVSCPYVCAKSRLDHGVLLVGFGKGAYAPIRLKEKPYWIIKNSWGQNWGEQGYYK  339

Query  180  ICRGRNICGVDSMVSTVAAVNT  245
            ICRGRN+CGVDSMVSTVAA  +
Sbjct  340  ICRGRNVCGVDSMVSTVAAAQS  361



>emb|CAD40319.2| OSJNBb0054B09.3 [Oryza sativa Japonica Group]
 emb|CAH66180.1| OSIGBa0130O15.4 [Oryza sativa Indica Group]
 emb|CAH66205.1| OSIGBa0148D14.11 [Oryza sativa Indica Group]
Length=381

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 76/84 (90%), Gaps = 3/84 (4%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCP+IC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYKI
Sbjct  293  QTYIGGVSCPFICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKI  352

Query  183  CRG---RNICGVDSMVSTVAAVNT  245
            CRG   +N CGVDSMVS+V A++T
Sbjct  353  CRGPHDKNKCGVDSMVSSVTAIHT  376



>ref|XP_006414378.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
 gb|ESQ55831.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
Length=367

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 75/85 (88%), Gaps = 1/85 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPY+CSK  DHGVLLVG+GS+GY+PIRLKEKPYWIIKNSWG  WGE GYYKI
Sbjct  283  QTYIGGVSCPYVCSKSQDHGVLLVGFGSSGYSPIRLKEKPYWIIKNSWGSMWGEHGYYKI  342

Query  183  CRG-RNICGVDSMVSTVAAVNTPTS  254
            CRG  NICG+D+MVSTVAAV T T 
Sbjct  343  CRGSHNICGMDTMVSTVAAVQTSTQ  367



>ref|XP_006404590.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
 gb|ESQ46043.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
Length=363

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYICS+RL+HGVLLVGYGSAG+A  RLK+KPYWIIKNSWGE+WGE GYYK+
Sbjct  284  QTYIGGVSCPYICSRRLNHGVLLVGYGSAGFAQARLKKKPYWIIKNSWGETWGENGYYKL  343

Query  183  CRGRNICGVDSMVSTVA  233
            CRGRNICGVDS+VSTVA
Sbjct  344  CRGRNICGVDSLVSTVA  360



>gb|EAY93546.1| hypothetical protein OsI_15336 [Oryza sativa Indica Group]
Length=348

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 76/84 (90%), Gaps = 3/84 (4%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCP+IC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYKI
Sbjct  260  QTYIGGVSCPFICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKI  319

Query  183  CRG---RNICGVDSMVSTVAAVNT  245
            CRG   +N CGVDSMVS+V A++T
Sbjct  320  CRGPHDKNKCGVDSMVSSVTAIHT  343



>gb|EMT16425.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=379

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 75/84 (89%), Gaps = 3/84 (4%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC + LDHGVLLVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYKI
Sbjct  292  QTYIGGVSCPYICGRHLDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKI  351

Query  183  CRG---RNICGVDSMVSTVAAVNT  245
            CRG   +N CGVDSMVSTV A++T
Sbjct  352  CRGPHVKNKCGVDSMVSTVTAIHT  375



>ref|XP_002452058.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
 gb|EES05034.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
Length=371

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 76/84 (90%), Gaps = 3/84 (4%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC + LDHGVLLVGYG+AG+APIRLK+KPYWIIKNSWGE+WGE GYYKI
Sbjct  285  QTYIGGVSCPYICGRTLDHGVLLVGYGAAGFAPIRLKDKPYWIIKNSWGENWGENGYYKI  344

Query  183  CRG---RNICGVDSMVSTVAAVNT  245
            CRG   RN CGVDSMVSTV+AV T
Sbjct  345  CRGSNVRNKCGVDSMVSTVSAVRT  368



>gb|KHG15062.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=370

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYIC + LDHGVLLVGYG+AGY+PIR K+KP+WIIKNSWG +WGE GYY+I
Sbjct  287  QTYMGGVSCPYICFRTLDHGVLLVGYGAAGYSPIRFKDKPFWIIKNSWGANWGEDGYYRI  346

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRGRN+CGVDSMVS+VAA++T + 
Sbjct  347  CRGRNVCGVDSMVSSVAALHTKSQ  370



>gb|EEE60725.1| hypothetical protein OsJ_14236 [Oryza sativa Japonica Group]
Length=364

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 76/84 (90%), Gaps = 3/84 (4%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCP+IC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYKI
Sbjct  276  QTYIGGVSCPFICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKI  335

Query  183  CRG---RNICGVDSMVSTVAAVNT  245
            CRG   +N CGVDSMVS+V A++T
Sbjct  336  CRGPHDKNKCGVDSMVSSVTAIHT  359



>ref|XP_009140277.1| PREDICTED: probable cysteine proteinase A494 [Brassica rapa]
Length=362

 Score =   149 bits (375),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRL+HGVLLVGYGSAG++  R KEKPYWIIKNSWGE+WGE G+YK+
Sbjct  283  QTYMGGVSCPYICSKRLNHGVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENGFYKL  342

Query  183  CRGRNICGVDSMVSTVAAV  239
            C+GRN+CG+DSMVSTVAA 
Sbjct  343  CKGRNVCGIDSMVSTVAAA  361



>gb|AAB67878.1| pre-pro-cysteine proteinase [Vicia faba]
Length=363

 Score =   149 bits (375),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 75/82 (91%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  179
            QTY+ GVSCPY+C+K RLDHGVLLVG+G   YAPIRLKEKPYWI+KNSWG++WGE+GYYK
Sbjct  280  QTYMSGVSCPYVCAKSRLDHGVLLVGFGKGAYAPIRLKEKPYWIVKNSWGQNWGEQGYYK  339

Query  180  ICRGRNICGVDSMVSTVAAVNT  245
            ICRGRN+CGVDSMVSTVAA  +
Sbjct  340  ICRGRNVCGVDSMVSTVAAAQS  361



>gb|AAO11786.1| pre-pro cysteine proteinase [Vicia faba]
Length=363

 Score =   149 bits (375),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 75/82 (91%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  179
            QTY+ GVSCPY+C+K RLDHGVLLVG+G   YAPIRLKEKPYWI+KNSWG++WGE+GYYK
Sbjct  280  QTYMSGVSCPYVCAKSRLDHGVLLVGFGKGAYAPIRLKEKPYWIVKNSWGQNWGEQGYYK  339

Query  180  ICRGRNICGVDSMVSTVAAVNT  245
            ICRGRN+CGVDSMVSTVAA  +
Sbjct  340  ICRGRNVCGVDSMVSTVAAAQS  361



>emb|CDY15894.1| BnaA04g12170D [Brassica napus]
Length=362

 Score =   149 bits (375),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRL+HGVLLVGYGSAG++  R KEKPYWIIKNSWGE+WGE G+YK+
Sbjct  283  QTYMGGVSCPYICSKRLNHGVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENGFYKL  342

Query  183  CRGRNICGVDSMVSTVAAV  239
            C+GRN+CG+DSMVSTVAA 
Sbjct  343  CKGRNVCGIDSMVSTVAAA  361



>ref|XP_004952477.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=374

 Score =   149 bits (375),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 76/84 (90%), Gaps = 3/84 (4%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC + LDHGVLLVGYG+AG+APIRLKEKPYWIIKNSWGE+WGE GYYKI
Sbjct  287  QTYIGGVSCPYICGRHLDHGVLLVGYGAAGFAPIRLKEKPYWIIKNSWGENWGENGYYKI  346

Query  183  CRG---RNICGVDSMVSTVAAVNT  245
            CRG   RN CGVDSMVSTV+A++ 
Sbjct  347  CRGSNVRNKCGVDSMVSTVSAIHA  370



>ref|XP_003579573.2| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=399

 Score =   149 bits (376),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 76/88 (86%), Gaps = 3/88 (3%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCP+IC + LDHGVLLVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYKI
Sbjct  312  QTYIGGVSCPFICGRHLDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKI  371

Query  183  CRG---RNICGVDSMVSTVAAVNTPTSD  257
            CRG   +N CGVDSMVSTV A++T   +
Sbjct  372  CRGAHVKNKCGVDSMVSTVTAIHTSNKE  399



>gb|KJB58164.1| hypothetical protein B456_009G197400 [Gossypium raimondii]
Length=375

 Score =   149 bits (375),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYI GVSCPYIC K LDHGVLLVGYGSAGYAP+R K KPYWIIKNSWGE+WGE GYYKI
Sbjct  287  QTYIHGVSCPYICGKHLDHGVLLVGYGSAGYAPVRFKNKPYWIIKNSWGENWGENGYYKI  346

Query  183  CRGRNICGVDSMVSTVAAVN  242
            CRG N+CGVDSMVS+V+A++
Sbjct  347  CRGNNVCGVDSMVSSVSALH  366



>ref|XP_009611293.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana tomentosiformis]
 emb|CAB44983.1| putative preprocysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   148 bits (374),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKI
Sbjct  278  QTYVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKI  337

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRG NICGVD+MVSTV A +T
Sbjct  338  CRGHNICGVDAMVSTVTAAHT  358



>ref|NP_001052440.1| Os04g0311400 [Oryza sativa Japonica Group]
 dbj|BAF14354.1| Os04g0311400, partial [Oryza sativa Japonica Group]
Length=384

 Score =   149 bits (375),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 76/84 (90%), Gaps = 3/84 (4%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCP+IC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYKI
Sbjct  296  QTYIGGVSCPFICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKI  355

Query  183  CRG---RNICGVDSMVSTVAAVNT  245
            CRG   +N CGVDSMVS+V A++T
Sbjct  356  CRGPHDKNKCGVDSMVSSVTAIHT  379



>gb|AAK07731.1| CPR2-like cysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   148 bits (374),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKI
Sbjct  278  QTYVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKI  337

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRG NICGVD+MVSTV A +T
Sbjct  338  CRGHNICGVDAMVSTVTAAHT  358



>gb|AJA74415.1| cysteine protease [Cicer arietinum]
Length=358

 Score =   148 bits (373),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 79/85 (93%), Gaps = 2/85 (2%)
 Frame = +3

Query  3    QTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  179
            QTY+ GVSCPYIC+K RLDHGVLLVG+G+ G+APIRLKEKPYWIIKNSWG++WGE+GYYK
Sbjct  275  QTYMSGVSCPYICAKSRLDHGVLLVGFGN-GFAPIRLKEKPYWIIKNSWGQNWGEEGYYK  333

Query  180  ICRGRNICGVDSMVSTVAAVNTPTS  254
            ICRGRNICGVDSMVSTVAAV+   +
Sbjct  334  ICRGRNICGVDSMVSTVAAVHASNN  358



>ref|NP_001266121.1| uncharacterized protein LOC101501911 precursor [Cicer arietinum]
 emb|CAA08906.1| cysteine proteinase [Cicer arietinum]
Length=362

 Score =   148 bits (373),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 79/85 (93%), Gaps = 2/85 (2%)
 Frame = +3

Query  3    QTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  179
            QTY+ GVSCPYIC+K RLDHGVLLVG+G+ G+APIRLKEKPYWIIKNSWG++WGE+GYYK
Sbjct  279  QTYMSGVSCPYICAKSRLDHGVLLVGFGN-GFAPIRLKEKPYWIIKNSWGQNWGEEGYYK  337

Query  180  ICRGRNICGVDSMVSTVAAVNTPTS  254
            ICRGRNICGVDSMVSTVAAV+   +
Sbjct  338  ICRGRNICGVDSMVSTVAAVHASNN  362



>emb|CAA78365.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=365

 Score =   148 bits (373),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKI
Sbjct  280  QTYVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKI  339

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRG NICGVD+MVSTV A +T
Sbjct  340  CRGHNICGVDAMVSTVTAAHT  360



>ref|XP_009776238.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana sylvestris]
Length=365

 Score =   148 bits (373),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKI
Sbjct  280  QTYVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKI  339

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRG NICGVD+MVSTV A +T
Sbjct  340  CRGHNICGVDAMVSTVTAAHT  360



>emb|CAA78361.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   148 bits (373),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKI
Sbjct  278  QTYVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKI  337

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRG NICGVD+MVSTV A +T
Sbjct  338  CRGHNICGVDAMVSTVTAAHT  358



>gb|KFK24413.1| hypothetical protein AALP_AAs58848U000200 [Arabis alpina]
Length=372

 Score =   148 bits (373),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 76/84 (90%), Gaps = 2/84 (2%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPY+CSK  DHGVLLVG+G +GYAPIRLKEKPYWIIKNSWG+ WGE GYYKI
Sbjct  288  QTYIGGVSCPYVCSKSQDHGVLLVGFGESGYAPIRLKEKPYWIIKNSWGKMWGEHGYYKI  347

Query  183  CRGR-NICGVDSMVSTVAAVN-TP  248
            CRGR NICG+D+MVSTVAAV  TP
Sbjct  348  CRGRHNICGMDTMVSTVAAVQITP  371



>ref|XP_008444769.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=373

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 75/84 (89%), Gaps = 1/84 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  179
            QTY+ GVSCPYICSKR LDHGVLLVGYGSAG+APIR KEKPYWIIKNSWGE+WGE GYY 
Sbjct  290  QTYMKGVSCPYICSKRNLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGENWGENGYYF  349

Query  180  ICRGRNICGVDSMVSTVAAVNTPT  251
            IC+G+N+CG +SMVS+VAA  TP 
Sbjct  350  ICKGKNVCGSESMVSSVAAAATPN  373



>ref|XP_002870174.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46433.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
Length=373

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 75/82 (91%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPY+CSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE GYYKI
Sbjct  289  QTYIGGVSCPYVCSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGAMWGEHGYYKI  348

Query  183  CRG-RNICGVDSMVSTVAAVNT  245
            CRG  N+CG+D+MVSTVAAV+T
Sbjct  349  CRGPHNMCGMDTMVSTVAAVHT  370



>gb|AEX97108.1| cysteine proteinase, partial [Malus domestica]
Length=128

 Score =   141 bits (355),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 73/79 (92%), Gaps = 1/79 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  179
            QTYI GVSCPYICSKR LDHGVLLVGYGSAG+APIR KEKPYWIIKNSWG++WGE GYY 
Sbjct  9    QTYIKGVSCPYICSKRNLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGQNWGENGYYL  68

Query  180  ICRGRNICGVDSMVSTVAA  236
            IC+GRNICG +SMVS+VAA
Sbjct  69   ICKGRNICGSESMVSSVAA  87



>gb|EMS53996.1| Cysteine proteinase 1 [Triticum urartu]
Length=405

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 75/84 (89%), Gaps = 3/84 (4%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC + LDHGVLLVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYKI
Sbjct  318  QTYIGGVSCPYICGRHLDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKI  377

Query  183  CRG---RNICGVDSMVSTVAAVNT  245
            CRG   +N CGVDSMVSTV A++T
Sbjct  378  CRGPHVKNKCGVDSMVSTVTAIHT  401



>ref|NP_567489.1| papain family cysteine protease [Arabidopsis thaliana]
 emb|CAB10398.1| cysteine proteinase like protein [Arabidopsis thaliana]
 emb|CAB78661.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AAK62611.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM91059.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM96982.1| cysteine proteinase [Arabidopsis thaliana]
 gb|AAN31875.1| putative cysteine proteinase [Arabidopsis thaliana]
 dbj|BAE98514.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AEE83713.1| papain family cysteine protease [Arabidopsis thaliana]
Length=373

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 75/82 (91%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPY+CSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE GYYKI
Sbjct  289  QTYIGGVSCPYVCSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGAMWGEHGYYKI  348

Query  183  CRG-RNICGVDSMVSTVAAVNT  245
            CRG  N+CG+D+MVSTVAAV+T
Sbjct  349  CRGPHNMCGMDTMVSTVAAVHT  370



>emb|CAH59428.1| cysteine protease 2 [Plantago major]
Length=245

 Score =   144 bits (363),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 75/84 (89%), Gaps = 1/84 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC K LDHGVL+VGYG+ GYAP+RLK KPYWIIKNSWGESWGE GYYKI
Sbjct  163  QTYIGGVSCPYICGKSLDHGVLIVGYGT-GYAPVRLKNKPYWIIKNSWGESWGESGYYKI  221

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRGRN+CGV+SMVS+V A +  T+
Sbjct  222  CRGRNVCGVESMVSSVTAAHFTTT  245



>gb|AAB16996.1| thiol protease isoform B, partial [Glycine max]
Length=319

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYIC K LDHGVLLVGYG   YAPIR K KPYWIIKNSWGESWGE GY +I
Sbjct  236  QTYVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYDEI  295

Query  183  CRGRNICGVDSMVSTVAAV  239
            CRGRN+CGVDSMVSTVAA+
Sbjct  296  CRGRNVCGVDSMVSTVAAI  314



>emb|CAA82995.1| cysteine proteinase [Vicia sativa]
Length=358

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 74/82 (90%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  179
            Q Y+ GVSCPY+C+K RLDHGVLLVG+G   YAPIRLKEKPYWIIKNSWG++WGE+GYYK
Sbjct  275  QAYMSGVSCPYVCAKARLDHGVLLVGFGKGAYAPIRLKEKPYWIIKNSWGQNWGEQGYYK  334

Query  180  ICRGRNICGVDSMVSTVAAVNT  245
            ICRGRN+CGVDSMVSTVAA  +
Sbjct  335  ICRGRNVCGVDSMVSTVAAAQS  356



>gb|ACF86683.1| unknown [Zea mays]
 gb|AFW71402.1| cysteine protease1 [Zea mays]
Length=371

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 76/84 (90%), Gaps = 3/84 (4%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC + LDHGVLLVGYG++G+APIRLK+KPYWIIKNSWGE+WGE GYYKI
Sbjct  285  QTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENGYYKI  344

Query  183  CRG---RNICGVDSMVSTVAAVNT  245
            CRG   RN CGVDSMVSTV+AV+ 
Sbjct  345  CRGSNVRNKCGVDSMVSTVSAVHA  368



>ref|XP_004975256.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=388

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 74/83 (89%), Gaps = 3/83 (4%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYK+
Sbjct  301  QTYIGGVSCPYICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGENGYYKL  360

Query  183  CRG---RNICGVDSMVSTVAAVN  242
            CRG   +N CGVDSMVSTV A++
Sbjct  361  CRGPFVKNKCGVDSMVSTVTAIH  383



>ref|NP_001105685.1| cysteine proteinase 1 precursor [Zea mays]
 sp|Q10716.1|CYSP1_MAIZE RecName: Full=Cysteine proteinase 1; Flags: Precursor [Zea mays]
 dbj|BAA08244.1| cysteine proteinase [Zea mays]
Length=371

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 76/84 (90%), Gaps = 3/84 (4%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC + LDHGVLLVGYG++G+APIRLK+KPYWIIKNSWGE+WGE GYYKI
Sbjct  285  QTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENGYYKI  344

Query  183  CRG---RNICGVDSMVSTVAAVNT  245
            CRG   RN CGVDSMVSTV+AV+ 
Sbjct  345  CRGSNVRNKCGVDSMVSTVSAVHA  368



>ref|XP_003574963.1| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=377

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 75/84 (89%), Gaps = 3/84 (4%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC + LDHGVLLVGYG++G+AP RLK KPYW+IKNSWGE+WGEKGYYKI
Sbjct  290  QTYIGGVSCPYICGRSLDHGVLLVGYGASGFAPSRLKNKPYWVIKNSWGENWGEKGYYKI  349

Query  183  CRG---RNICGVDSMVSTVAAVNT  245
            CRG   RN CGVDSMVSTVAA +T
Sbjct  350  CRGSNVRNKCGVDSMVSTVAAAHT  373



>ref|XP_009405542.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=366

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+ GVSCPYIC K L+HGVLLVGYGSAGYAP R KEK YWIIKNSWGE+WGE GYYKI
Sbjct  286  QTYVHGVSCPYICGKHLNHGVLLVGYGSAGYAPARFKEKSYWIIKNSWGENWGENGYYKI  345

Query  183  CRGRNICGVDSMVSTVAAV  239
            CRGRNICGVDSMVS+V A+
Sbjct  346  CRGRNICGVDSMVSSVTAI  364



>ref|XP_003607110.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89307.1| papain family cysteine protease [Medicago truncatula]
Length=331

 Score =   145 bits (367),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GG+SCPYIC++RLD GVLLVGYGS   A ++ KEKPYWI+KNSWGE+WGE GYYKI
Sbjct  248  QTYVGGISCPYICTRRLDLGVLLVGYGSGAGADMKEKEKPYWIVKNSWGETWGENGYYKI  307

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRGRNICGVDSMVSTVAA +T T 
Sbjct  308  CRGRNICGVDSMVSTVAAAHTTTQ  331



>gb|KEH30505.1| papain family cysteine protease [Medicago truncatula]
Length=330

 Score =   145 bits (366),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GG+SCPYIC++RLD GVLLVGYGS   A ++ KEKPYWI+KNSWGE+WGE GYYKI
Sbjct  247  QTYVGGISCPYICTRRLDLGVLLVGYGSGAGADMKEKEKPYWIVKNSWGETWGENGYYKI  306

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRGRNICGVDSMVSTVAA +T T 
Sbjct  307  CRGRNICGVDSMVSTVAAAHTNTQ  330



>gb|EYU27644.1| hypothetical protein MIMGU_mgv1a008452mg [Erythranthe guttata]
Length=373

 Score =   145 bits (367),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 78/85 (92%), Gaps = 1/85 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  179
            QTYIGGVSCPY+C KR LDHGVLLVGYG+AGY+ IRLK KPYWI+KNSWGESWGE+GYYK
Sbjct  289  QTYIGGVSCPYVCGKRNLDHGVLLVGYGAAGYSTIRLKNKPYWIVKNSWGESWGEEGYYK  348

Query  180  ICRGRNICGVDSMVSTVAAVNTPTS  254
            IC+G N+CGV+SMVS+V A++T ++
Sbjct  349  ICKGHNVCGVESMVSSVNAIHTTSA  373



>ref|XP_004238314.1| PREDICTED: cysteine proteinase 15A [Solanum lycopersicum]
Length=363

 Score =   145 bits (366),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+ GVSCP IC KR DHGVLLVGYGS G+APIRLK KPYWIIKNSWG++WGE GYYKI
Sbjct  278  QTYVRGVSCPLICFKRQDHGVLLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEHGYYKI  337

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRG NICGVD+MVSTV A +T
Sbjct  338  CRGHNICGVDAMVSTVTATHT  358



>ref|NP_001046828.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAD19579.1| putative cysteine proteinase 1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF08742.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAG92750.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93804.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94031.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83204.1| hypothetical protein OsI_28465 [Oryza sativa Indica Group]
 gb|EEE56967.1| hypothetical protein OsJ_06681 [Oryza sativa Japonica Group]
Length=373

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 76/84 (90%), Gaps = 3/84 (4%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC + LDHGVLLVGYG++G+APIRLK+K YWIIKNSWGE+WGE GYYKI
Sbjct  287  QTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPIRLKDKAYWIIKNSWGENWGEHGYYKI  346

Query  183  CRG---RNICGVDSMVSTVAAVNT  245
            CRG   RN CGVDSMVSTV+A++T
Sbjct  347  CRGSNVRNKCGVDSMVSTVSAIHT  370



>gb|ABK24153.1| unknown [Picea sitchensis]
Length=394

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 75/86 (87%), Gaps = 1/86 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  179
            QTY+GGVSCPY+C+K+ LDHGVLLVGYG+AGYAP RLK KP+WIIKNSWG  WGE GYYK
Sbjct  308  QTYVGGVSCPYVCNKQNLDHGVLLVGYGAAGYAPGRLKNKPFWIIKNSWGPDWGEDGYYK  367

Query  180  ICRGRNICGVDSMVSTVAAVNTPTSD  257
            +CRG N+CG+++MVSTVAA N  T D
Sbjct  368  LCRGHNVCGINTMVSTVAAANIQTDD  393



>ref|XP_006341997.1| PREDICTED: cysteine proteinase 15A-like [Solanum tuberosum]
Length=376

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+ GVSCP IC KR DHGVLLVGYGS G+APIRLK KPYWIIKNSWG++WGE GYYKI
Sbjct  291  QTYVRGVSCPLICLKRQDHGVLLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEHGYYKI  350

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRG NICGVD+MVSTV A +T
Sbjct  351  CRGHNICGVDAMVSTVTATHT  371



>gb|EMS64962.1| Cysteine proteinase 1 [Triticum urartu]
Length=302

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 75/88 (85%), Gaps = 3/88 (3%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC + LDHGVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYKI
Sbjct  215  QTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKI  274

Query  183  CRG---RNICGVDSMVSTVAAVNTPTSD  257
            CRG   RN CGVDSMVSTV+A +    +
Sbjct  275  CRGSNVRNKCGVDSMVSTVSATHASKDE  302



>ref|XP_004152668.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004167370.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN62647.1| Cysteine protease [Cucumis sativus]
Length=371

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 75/80 (94%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  179
            QTY+ G+SCPYICSKR LDHGVLLVGYG+AG+APIRLKEKPYWIIKNSWGE+WGE GYY 
Sbjct  290  QTYMKGISCPYICSKRNLDHGVLLVGYGAAGFAPIRLKEKPYWIIKNSWGENWGENGYYF  349

Query  180  ICRGRNICGVDSMVSTVAAV  239
            IC+G+NICG +SMVS+VAA+
Sbjct  350  ICKGKNICGSESMVSSVAAI  369



>dbj|BAG16515.1| putative cysteine proteinase [Capsicum chinense]
Length=367

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCP +C K  DHGVLLVGYGSAG+APIRLK KPYWIIKNSWGE WGE GYYKI
Sbjct  281  QTYIGGVSCPLVCFKHQDHGVLLVGYGSAGFAPIRLKAKPYWIIKNSWGEHWGEHGYYKI  340

Query  183  CRGR-NICGVDSMVSTVAAVNT  245
            CRG+ NICGVD+MVSTV A +T
Sbjct  341  CRGQHNICGVDAMVSTVTAAHT  362



>tpe|CAD66657.1| TPA: putative cysteine proteinase precursor [Hordeum vulgare 
subsp. vulgare]
 dbj|BAJ94057.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 75/84 (89%), Gaps = 3/84 (4%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC + LDHGVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYKI
Sbjct  290  QTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKI  349

Query  183  CRG---RNICGVDSMVSTVAAVNT  245
            CRG   RN CGVDSMVSTV+A ++
Sbjct  350  CRGSNVRNKCGVDSMVSTVSATHS  373



>gb|EMT10192.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=369

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 74/84 (88%), Gaps = 3/84 (4%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC + LDHGVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYKI
Sbjct  282  QTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKI  341

Query  183  CRG---RNICGVDSMVSTVAAVNT  245
            CRG   RN CGVDSMVSTV+A + 
Sbjct  342  CRGSNVRNKCGVDSMVSTVSATHA  365



>gb|ABK21238.1| unknown [Picea sitchensis]
 gb|ABR16087.1| unknown [Picea sitchensis]
 gb|ABR17330.1| unknown [Picea sitchensis]
 gb|ABR17545.1| unknown [Picea sitchensis]
 gb|ACN40765.1| unknown [Picea sitchensis]
Length=366

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 75/80 (94%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  179
            QTY+GGVSCPY+CSKR LDHGVLLVGYG+A +APIR+K+KPYW+IKNSWG +WGE GYYK
Sbjct  287  QTYVGGVSCPYVCSKRNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENGYYK  346

Query  180  ICRGRNICGVDSMVSTVAAV  239
            +CRG N+CG+++MVSTVAA+
Sbjct  347  LCRGHNVCGINNMVSTVAAI  366



>gb|ABK24688.1| unknown [Picea sitchensis]
 gb|ACN39791.1| unknown [Picea sitchensis]
 gb|ACN40241.1| unknown [Picea sitchensis]
Length=366

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 75/80 (94%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  179
            QTY+GGVSCPY+CSKR LDHGVLLVGYG+A +APIR+K+KPYW+IKNSWG +WGE GYYK
Sbjct  287  QTYVGGVSCPYVCSKRNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENGYYK  346

Query  180  ICRGRNICGVDSMVSTVAAV  239
            +CRG N+CG+++MVSTVAA+
Sbjct  347  LCRGHNVCGINNMVSTVAAI  366



>gb|AAW21813.1| cysteine protease [Triticum aestivum]
Length=377

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 74/84 (88%), Gaps = 3/84 (4%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC + LDHGVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYKI
Sbjct  290  QTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKI  349

Query  183  CRG---RNICGVDSMVSTVAAVNT  245
            CRG   RN CGVDSMVSTV+A + 
Sbjct  350  CRGSNVRNKCGVDSMVSTVSATHA  373



>gb|ACN40679.1| unknown [Picea sitchensis]
Length=366

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 75/80 (94%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  179
            QTY+GGVSCPY+CSKR LDHGVLLVGYG+A +APIR+K+KPYW+IKNSWG +WGE GYYK
Sbjct  287  QTYVGGVSCPYVCSKRNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENGYYK  346

Query  180  ICRGRNICGVDSMVSTVAAV  239
            +CRG N+CG+++MVSTVAA+
Sbjct  347  LCRGHNVCGINNMVSTVAAI  366



>emb|CAA78403.1| pre-pro-cysteine proteinase [Solanum lycopersicum]
Length=361

 Score =   143 bits (360),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+ GVSCP IC KR DHGVLLVGYGS G+APIRLK KPYWIIKNSWG++WGE GYYKI
Sbjct  276  QTYVRGVSCPLICFKRQDHGVLLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEHGYYKI  335

Query  183  CRGRNICGVDSMVSTVAAVNT  245
            CRG +ICGVD+MVSTV A +T
Sbjct  336  CRGHHICGVDAMVSTVTATHT  356



>gb|AES89347.2| papain family cysteine protease [Medicago truncatula]
Length=327

 Score =   142 bits (358),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 71/83 (86%), Gaps = 4/83 (5%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPY C++RLDHGVLLVGYGS  Y     KEKPYWI+K+SWGE+WGE GYYKI
Sbjct  248  QTYVGGVSCPYTCTRRLDHGVLLVGYGSGAYT----KEKPYWIVKSSWGETWGENGYYKI  303

Query  183  CRGRNICGVDSMVSTVAAVNTPT  251
            CRGRNICGVDSMVSTVAA  T T
Sbjct  304  CRGRNICGVDSMVSTVAAAQTTT  326



>ref|XP_003607150.1| Cysteine proteinase [Medicago truncatula]
Length=326

 Score =   142 bits (358),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 71/83 (86%), Gaps = 4/83 (5%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPY C++RLDHGVLLVGYGS  Y     KEKPYWI+K+SWGE+WGE GYYKI
Sbjct  247  QTYVGGVSCPYTCTRRLDHGVLLVGYGSGAYT----KEKPYWIVKSSWGETWGENGYYKI  302

Query  183  CRGRNICGVDSMVSTVAAVNTPT  251
            CRGRNICGVDSMVSTVAA  T T
Sbjct  303  CRGRNICGVDSMVSTVAAAQTTT  325



>gb|AAZ32411.1| cysteine proteinase glycinain type [Nicotiana benthamiana]
Length=355

 Score =   142 bits (359),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKI
Sbjct  280  QTYVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKI  339

Query  183  CRGRNICGVDSMVSTV  230
            CRG NICGVD+MVSTV
Sbjct  340  CRGHNICGVDAMVSTV  355



>dbj|BAD10859.1| cysteine protease [Aster tripolium]
Length=363

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  179
            QTYIG VSCPYICSK ++DHGVLLVGYGSAGYAP+R KEKPYWIIKNSWGE WGE GYYK
Sbjct  282  QTYIGQVSCPYICSKTKMDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGEDWGEDGYYK  341

Query  180  ICRGRNICGVDSMVSTVAAVNT  245
            +C G N CG+D+MVS V + NT
Sbjct  342  LCSGYNACGMDTMVSAVVSTNT  363



>gb|AAB16997.1| thiol protease isoform A, partial [Glycine max]
Length=318

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 70/80 (88%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK-GYYK  179
            QTY+GGVSCPYIC K LDHGVLLVGYG   YAPIR K KPYWIIKNSWGESWGE  GY +
Sbjct  234  QTYVGGVSCPYICGKHLDHGVLLVGYGEGRYAPIRFKNKPYWIIKNSWGESWGENDGYDE  293

Query  180  ICRGRNICGVDSMVSTVAAV  239
            ICRGRN+CGVD+MVSTVAA+
Sbjct  294  ICRGRNVCGVDAMVSTVAAI  313



>emb|CAQ00101.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=381

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 73/84 (87%), Gaps = 4/84 (5%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTYIGGVSCPYIC + LDH V LVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYKI
Sbjct  295  QTYIGGVSCPYICGRHLDH-VFLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKI  353

Query  183  CRG---RNICGVDSMVSTVAAVNT  245
            CRG   +N CGVDSMVSTV A++T
Sbjct  354  CRGPHVKNKCGVDSMVSTVTAIHT  377



>gb|ADY04293.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04297.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   135 bits (341),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+RLKEKPYWIIKNSWG+ WGE+G+YKI
Sbjct  77   QTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRLKEKPYWIIKNSWGDKWGEEGFYKI  136

Query  183  CRGRNICG  206
            CRGRNICG
Sbjct  137  CRGRNICG  144



>ref|XP_009786000.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana sylvestris]
Length=370

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 69/72 (96%), Gaps = 1/72 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSK+LDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKI
Sbjct  288  QTYVGGVSCPYICSKKLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGENGYYKI  346

Query  183  CRGRNICGVDSM  218
            CRGRN+CGVDSM
Sbjct  347  CRGRNVCGVDSM  358



>gb|ADY04361.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   135 bits (340),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKI
Sbjct  77   QTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKI  136

Query  183  CRGRNICG  206
            CRGRNICG
Sbjct  137  CRGRNICG  144



>ref|XP_002279862.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI19784.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY  GVSCP++CS  LDHGVLLVGYGSAGY+PIR KEKPYWI+KNSW + WGE GYY+I
Sbjct  284  QTYTAGVSCPFLCSGELDHGVLLVGYGSAGYSPIRFKEKPYWILKNSWSKYWGEHGYYRI  343

Query  183  CRGRNICGVDSMVSTVAAVNTPTS  254
            CRG+N+CGVDSMVS+V A    TS
Sbjct  344  CRGQNMCGVDSMVSSVVAAIQTTS  367



>gb|ADY04414.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   135 bits (339),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKI
Sbjct  77   QTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKI  136

Query  183  CRGRNICG  206
            CRGRNICG
Sbjct  137  CRGRNICG  144



>gb|ADY04342.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   135 bits (339),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKI
Sbjct  77   QTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKI  136

Query  183  CRGRNICG  206
            CRGRNICG
Sbjct  137  CRGRNICG  144



>gb|ADY04336.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04343.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   135 bits (339),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKI
Sbjct  77   QTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKI  136

Query  183  CRGRNICG  206
            CRGRNICG
Sbjct  137  CRGRNICG  144



>gb|ADY04262.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04263.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04264.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04265.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04266.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04267.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04269.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04270.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04271.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04272.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04273.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04274.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04275.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04276.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04277.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04278.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04279.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04280.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04281.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04282.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04283.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04284.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04285.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04286.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04287.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04288.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04289.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04290.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04291.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04292.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04294.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04296.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04298.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04299.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04300.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04301.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04302.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04303.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04304.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04305.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04306.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04307.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04308.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04309.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04310.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04311.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04312.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04313.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04314.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04315.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04316.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04317.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04318.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04319.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04320.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04321.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04322.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04323.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04324.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04325.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04326.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04327.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04328.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04329.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04330.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04331.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04332.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04333.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04334.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04335.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04337.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04338.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04339.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04340.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04341.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04344.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04345.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04346.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04347.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04348.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04349.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04350.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04351.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04352.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04353.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04354.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04355.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04356.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04357.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04360.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04362.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04363.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04364.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04365.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04366.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04367.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04369.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04370.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04371.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04372.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04373.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04374.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04377.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04378.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04379.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04380.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04381.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04382.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04383.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04384.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04385.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04386.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04387.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04388.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04389.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04391.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04392.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04393.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04394.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04395.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04396.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04397.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04398.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04399.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04400.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04401.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04402.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04403.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04404.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04405.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04406.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04407.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04408.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04409.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04410.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04411.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04412.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04413.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04415.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04416.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04417.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04418.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04419.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04420.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04421.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04422.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04423.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04424.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04425.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04426.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04427.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04428.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04429.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04430.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04431.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04432.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04433.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04434.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04435.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04436.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04437.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04438.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04439.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04440.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04441.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04442.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04443.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04444.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04445.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04446.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04447.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04448.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04449.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04450.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04451.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04452.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04453.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04454.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04455.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04456.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04458.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04459.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04460.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04461.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04462.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04463.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04464.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04465.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04466.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04467.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04468.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04469.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04470.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04471.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04472.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04473.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04474.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04475.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04476.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04478.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04481.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04483.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04484.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04485.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04486.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04487.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04488.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04489.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04491.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04493.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04501.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04502.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04503.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04504.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04505.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04506.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04507.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04508.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04509.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04510.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04511.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04512.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04513.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04514.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04515.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04516.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04517.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04518.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   135 bits (339),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKI
Sbjct  77   QTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKI  136

Query  183  CRGRNICG  206
            CRGRNICG
Sbjct  137  CRGRNICG  144



>gb|ADY04457.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   135 bits (339),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKI
Sbjct  77   QTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKI  136

Query  183  CRGRNICG  206
            CRGRNICG
Sbjct  137  CRGRNICG  144



>gb|EPS70818.1| cysteine proteinase, partial [Genlisea aurea]
Length=355

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 74/82 (90%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  179
            QTYI GVSCP +C K  LDHGVL+VGYGS+GYAPIRLK KPYWI+KNSWG++WGEKGYYK
Sbjct  274  QTYIRGVSCPLVCGKSNLDHGVLMVGYGSSGYAPIRLKNKPYWIVKNSWGKNWGEKGYYK  333

Query  180  ICRGRNICGVDSMVSTVAAVNT  245
            ICRG NICGV+SMVSTV A+++
Sbjct  334  ICRGSNICGVESMVSTVTAIHS  355



>gb|ADY04359.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   135 bits (339),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKI
Sbjct  77   QTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDRWGEEGFYKI  136

Query  183  CRGRNICG  206
            CRGRNICG
Sbjct  137  CRGRNICG  144



>dbj|BAC57957.1| thiol protease [Aster tripolium]
Length=188

 Score =   135 bits (341),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  179
            QTYIG VSCPY+CSK+ LDHGVLLVGYGSAGYAP RLKEKPYWIIKNSWG  WGE GYYK
Sbjct  107  QTYIGKVSCPYVCSKKPLDHGVLLVGYGSAGYAPSRLKEKPYWIIKNSWGPDWGEDGYYK  166

Query  180  ICRGRNICGVDSMVSTVAAVNT  245
            IC G N+CG+D+MVS V + + 
Sbjct  167  ICSGHNLCGMDTMVSAVVSTSA  188



>gb|ADY04482.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   134 bits (338),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKI
Sbjct  77   QTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRVKEKPYWIIKNSWGDKWGEEGFYKI  136

Query  183  CRGRNICG  206
            CRGRNICG
Sbjct  137  CRGRNICG  144



>gb|ADY04368.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04375.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04376.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04390.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04477.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04479.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   134 bits (337),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG  WGE+G+YKI
Sbjct  77   QTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGNKWGEEGFYKI  136

Query  183  CRGRNICG  206
            CRGRNICG
Sbjct  137  CRGRNICG  144



>gb|ADY04358.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   134 bits (337),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRLDHGVLLVGYG++GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKI
Sbjct  77   QTYMGGVSCPYICSKRLDHGVLLVGYGTSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKI  136

Query  183  CRGRNICG  206
            CRGRNICG
Sbjct  137  CRGRNICG  144



>gb|ADY04480.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   134 bits (336),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+++KEKPYWIIKNSWG+ WGE+G+YKI
Sbjct  77   QTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVKMKEKPYWIIKNSWGDKWGEEGFYKI  136

Query  183  CRGRNICG  206
            CRGRNICG
Sbjct  137  CRGRNICG  144



>gb|ADY04268.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   134 bits (336),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKP+WIIKNSWG+ WGE+G+YKI
Sbjct  77   QTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPHWIIKNSWGDKWGEEGFYKI  136

Query  183  CRGRNICG  206
            CRGRNICG
Sbjct  137  CRGRNICG  144



>gb|EPS65881.1| cysteine proteinase, partial [Genlisea aurea]
Length=335

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 73/79 (92%), Gaps = 1/79 (1%)
 Frame = +3

Query  3    QTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  179
            QTY+ GVSCP IC K RLDHG+L+VGYG++GYAPIRLKEKPYWI+KNSWGE+WGE+GYYK
Sbjct  257  QTYVHGVSCPLICMKTRLDHGILIVGYGASGYAPIRLKEKPYWIVKNSWGENWGEQGYYK  316

Query  180  ICRGRNICGVDSMVSTVAA  236
            IC+G N+CGV+S+VSTV A
Sbjct  317  ICKGHNVCGVESLVSTVTA  335



>gb|ADY04295.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   133 bits (334),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKI  182
            QTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+ +KEKPYWIIKNSWG+ WGE+G+YKI
Sbjct  77   QTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVSMKEKPYWIIKNSWGDKWGEEGFYKI  136

Query  183  CRGRNICG  206
            CRGRNICG
Sbjct  137  CRGRNICG  144



>gb|AAB53103.1| cysteine protease, partial [Brassica napus]
Length=85

 Score =   131 bits (329),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 67/74 (91%), Gaps = 1/74 (1%)
 Frame = +3

Query  3    QTYIGGVS-CPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  179
            QTYIGGVS CPYIC +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YK
Sbjct  12   QTYIGGVSACPYICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYK  71

Query  180  ICRGRNICGVDSMV  221
            ICRGRN+CGVD  V
Sbjct  72   ICRGRNVCGVDMSV  85



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566946208800