BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP010F05 415 bp,:Filtered

Length=415
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAK27969.1|AF242373_1  cysteine protease                             164   8e-46   Ipomoea batatas [batate]
gb|AAF61440.1|AF138264_1  papain-like cysteine proteinase isoform I     163   1e-45   Ipomoea batatas [batate]
gb|AAF40414.1|AF216783_1  papain-like cysteine proteinase isoform I     163   1e-45   Ipomoea batatas [batate]
gb|AAF40415.1|AF216784_1  papain-like cysteine proteinase isoform II    163   1e-45   Ipomoea batatas [batate]
gb|AAF61441.1|AF138265_1  papain-like cysteine proteinase isoform II    163   1e-45   Ipomoea batatas [batate]
gb|AAF40416.1|AF216785_1  papain-like cysteine proteinase isoform...    163   1e-45   Ipomoea batatas [batate]
gb|KDP41743.1|  hypothetical protein JCGZ_26761                         158   8e-44   Jatropha curcas
ref|XP_002512963.1|  cysteine protease, putative                        158   1e-43   Ricinus communis
sp|P05993.1|PAPA5_CARPA  RecName: Full=Cysteine proteinase; AltNa...    150   1e-43   Carica papaya [mamon]
gb|KHG24064.1|  Cysteinease RD19a -like protein                         157   3e-43   Gossypium arboreum [tree cotton]
gb|AIB06024.1|  CP2                                                     156   5e-43   Hevea brasiliensis [jebe]
gb|AAX19661.1|  cysteine proteinase                                     156   5e-43   Populus tomentosa [Chinese white poplar]
ref|XP_007042077.1|  Papain family cysteine protease                    156   6e-43   Theobroma cacao [chocolate]
gb|ABQ10201.1|  cysteine protease Cp3                                   156   6e-43   Actinidia deliciosa [Chinese gooseberry]
ref|XP_011047717.1|  PREDICTED: cysteine proteinase RD19a               156   6e-43   Populus euphratica
gb|KJB32561.1|  hypothetical protein B456_005G247000                    156   7e-43   Gossypium raimondii
gb|ABK96252.1|  unknown                                                 150   7e-43   Populus trichocarpa x Populus deltoides
emb|CDP20652.1|  unnamed protein product                                155   1e-42   Coffea canephora [robusta coffee]
gb|KJB79047.1|  hypothetical protein B456_013G033800                    155   1e-42   Gossypium raimondii
emb|CAE54306.1|  putative papain-like cysteine proteinase               155   1e-42   Gossypium hirsutum [American cotton]
ref|NP_001267989.1|  cysteine protease precursor                        155   2e-42   Vitis vinifera
gb|KHG15253.1|  Cysteinease RD19a -like protein                         155   2e-42   Gossypium arboreum [tree cotton]
ref|XP_002313770.1|  cysteine proteinase A494 precursor                 154   2e-42   Populus trichocarpa [western balsam poplar]
gb|ABK92536.1|  unknown                                                 154   3e-42   Populus trichocarpa [western balsam poplar]
ref|XP_003606998.1|  Cysteine proteinase                                154   3e-42   Medicago truncatula
ref|XP_009351218.1|  PREDICTED: cysteine proteinase RD19a-like          152   3e-42   Pyrus x bretschneideri [bai li]
ref|XP_009373025.1|  PREDICTED: cysteine proteinase RD19a-like          154   4e-42   Pyrus x bretschneideri [bai li]
ref|XP_009373000.1|  PREDICTED: cysteine proteinase RD19a               154   6e-42   Pyrus x bretschneideri [bai li]
gb|KHN39817.1|  Cysteine proteinase RD19a                               152   6e-42   Glycine soja [wild soybean]
ref|XP_007131787.1|  hypothetical protein PHAVU_011G041600g             153   6e-42   Phaseolus vulgaris [French bean]
ref|XP_008236965.1|  PREDICTED: cysteine proteinase RD19a               153   6e-42   Prunus mume [ume]
ref|XP_006487337.1|  PREDICTED: cysteine proteinase RD19a-like          153   7e-42   Citrus sinensis [apfelsine]
gb|KDO49483.1|  hypothetical protein CISIN_1g017318mg                   153   7e-42   Citrus sinensis [apfelsine]
ref|XP_008382317.1|  PREDICTED: cysteine proteinase RD19a               153   7e-42   Malus domestica [apple tree]
ref|XP_004290288.1|  PREDICTED: probable cysteine proteinase A494       153   7e-42   Fragaria vesca subsp. vesca
ref|XP_003539008.1|  PREDICTED: cysteine proteinase RD19a-like          153   7e-42   Glycine max [soybeans]
ref|XP_007201310.1|  hypothetical protein PRUPE_ppa007454mg             153   7e-42   Prunus persica
gb|ACI04578.1|  cysteine protease-like protein                          152   1e-41   Robinia pseudoacacia [black locust]
ref|XP_010271520.1|  PREDICTED: cysteine proteinase RD19a-like          153   1e-41   Nelumbo nucifera [Indian lotus]
ref|XP_004507484.1|  PREDICTED: cysteine proteinase RD19a-like          152   1e-41   Cicer arietinum [garbanzo]
ref|XP_006423403.1|  hypothetical protein CICLE_v10028670mg             153   1e-41   Citrus clementina
ref|XP_011028940.1|  PREDICTED: cysteine proteinase 15A-like            152   1e-41   Populus euphratica
ref|XP_010028631.1|  PREDICTED: cysteine proteinase RD19a-like          152   1e-41   Eucalyptus grandis [rose gum]
emb|CDQ51995.1|  Cysteine proteinase                                    147   1e-41   Fagus sylvatica
ref|XP_011037175.1|  PREDICTED: cysteine proteinase RD19a-like          152   2e-41   Populus euphratica
ref|XP_011088458.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    152   2e-41   Sesamum indicum [beniseed]
gb|AAL69389.1|AF462226_1  putative cysteine proteinase                  145   2e-41   Narcissus pseudonarcissus
gb|AJP16692.1|  cysteine protease                                       146   2e-41   Striga hermonthica [purple witchweed]
gb|AAR92156.1|  putative cysteine protease 3                            150   2e-41   Iris x hollandica [Dutch iris]
gb|ABK96580.1|  unknown                                                 152   2e-41   Populus trichocarpa x Populus deltoides
ref|XP_010066197.1|  PREDICTED: probable cysteine proteinase A494       152   2e-41   Eucalyptus grandis [rose gum]
ref|XP_002305451.2|  cysteine proteinase A494 precursor                 152   2e-41   Populus trichocarpa [western balsam poplar]
ref|XP_002302004.2|  hypothetical protein POPTR_0002s03020g             152   3e-41   Populus trichocarpa [western balsam poplar]
gb|ABK94801.1|  unknown                                                 152   3e-41   Populus trichocarpa [western balsam poplar]
ref|XP_009406357.1|  PREDICTED: cysteine proteinase 1-like              151   3e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011092831.1|  PREDICTED: cysteine proteinase RD19a-like          151   5e-41   Sesamum indicum [beniseed]
ref|XP_009376976.1|  PREDICTED: cysteine proteinase RD19a-like          152   6e-41   Pyrus x bretschneideri [bai li]
ref|XP_009376977.1|  PREDICTED: cysteine proteinase RD19a-like          152   8e-41   Pyrus x bretschneideri [bai li]
ref|XP_002280798.2|  PREDICTED: cysteine proteinase 15A                 150   8e-41   Vitis vinifera
gb|ABK93575.1|  unknown                                                 144   1e-40   Populus trichocarpa [western balsam poplar]
ref|XP_004150061.1|  PREDICTED: cysteine proteinase RD19a-like          150   1e-40   Cucumis sativus [cucumbers]
gb|AAU81591.1|  cysteine proteinase                                     145   1e-40   Petunia x hybrida [garden petunia]
gb|EYU37835.1|  hypothetical protein MIMGU_mgv1a008237mg                150   1e-40   Erythranthe guttata [common monkey flower]
ref|XP_002275759.1|  PREDICTED: cysteine proteinase RD19a               149   2e-40   Vitis vinifera
ref|XP_010061009.1|  PREDICTED: cysteine proteinase RD19a-like          149   2e-40   Eucalyptus grandis [rose gum]
dbj|BAD94010.1|  drought-inducible cysteine proteinase RD19A prec...    141   2e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002510469.1|  cysteine protease, putative                        149   2e-40   Ricinus communis
gb|KGN43159.1|  Papain-like cysteine proteinase isoform I               149   3e-40   Cucumis sativus [cucumbers]
ref|XP_004148554.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    149   3e-40   
ref|XP_003540987.1|  PREDICTED: cysteine proteinase RD19a-like          149   3e-40   Glycine max [soybeans]
ref|XP_004165230.1|  PREDICTED: cysteine proteinase RD19a-like          149   3e-40   
ref|XP_008460996.1|  PREDICTED: cysteine proteinase RD19a-like          149   4e-40   Cucumis melo [Oriental melon]
ref|XP_010268619.1|  PREDICTED: cysteine proteinase RD19a-like          148   4e-40   Nelumbo nucifera [Indian lotus]
gb|AAU81589.1|  cysteine proteinase                                     145   5e-40   Petunia x hybrida [garden petunia]
dbj|BAJ53178.1|  JHL18I08.12                                            148   5e-40   Jatropha curcas
ref|XP_007017672.1|  Papain family cysteine protease                    149   7e-40   Theobroma cacao [chocolate]
ref|XP_003523684.1|  PREDICTED: cysteine proteinase 15A-like            147   1e-39   Glycine max [soybeans]
gb|ABF46642.1|  papain-like cysteine proteinase                         147   1e-39   Pachysandra terminalis
ref|NP_001241450.1|  uncharacterized protein LOC100778716 precursor     147   1e-39   Glycine max [soybeans]
gb|KHN45894.1|  Cysteine proteinase RD19a                               147   1e-39   Glycine soja [wild soybean]
ref|XP_010530325.1|  PREDICTED: cysteine proteinase RD19a               147   1e-39   Tarenaya hassleriana [spider flower]
dbj|BAC41322.1|  hypothetical protein                                   147   2e-39   Lotus japonicus
ref|XP_010531457.1|  PREDICTED: probable cysteine proteinase A494       147   2e-39   Tarenaya hassleriana [spider flower]
gb|KHN25410.1|  Cysteine proteinase RD19a                               147   2e-39   Glycine soja [wild soybean]
ref|XP_010910124.1|  PREDICTED: cysteine proteinase 1-like              147   2e-39   Elaeis guineensis
ref|XP_009392632.1|  PREDICTED: cysteine proteinase 1-like              147   2e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008775532.1|  PREDICTED: cysteine proteinase 1-like              147   2e-39   Phoenix dactylifera
ref|XP_009602233.1|  PREDICTED: cysteine proteinase RD19a-like          147   2e-39   Nicotiana tomentosiformis
gb|AAL05851.1|AF411121_1  cysteine proteinase precursor                 146   2e-39   Sandersonia aurantiaca [Chinese-lantern lily]
emb|CAE45588.1|  papain-like cysteine proteinase-like protein 1         146   2e-39   Lotus japonicus
gb|EYU42593.1|  hypothetical protein MIMGU_mgv1a008336mg                147   2e-39   Erythranthe guttata [common monkey flower]
ref|XP_011045161.1|  PREDICTED: cysteine proteinase 15A-like            146   3e-39   Populus euphratica
gb|KHN12668.1|  Cysteine proteinase 15A                                 140   3e-39   Glycine soja [wild soybean]
dbj|BAF98584.1|  CM0216.500.nc                                          146   3e-39   Lotus japonicus
ref|XP_002306900.1|  hypothetical protein POPTR_0005s25540g             146   4e-39   Populus trichocarpa [western balsam poplar]
ref|XP_008448073.1|  PREDICTED: cysteine proteinase RD19a-like          146   4e-39   Cucumis melo [Oriental melon]
ref|XP_009109502.1|  PREDICTED: cysteine proteinase RD19a-like          146   4e-39   Brassica rapa
gb|AAB62937.1|  stress-induced cysteine proteinase                      141   4e-39   Lavatera thuringiaca
ref|XP_006362019.1|  PREDICTED: cysteine proteinase RD19a-like          145   5e-39   Solanum tuberosum [potatoes]
emb|CAE45589.1|  papain-like cysteine proteinase-like protein 2         145   5e-39   Lotus japonicus
gb|KJB07487.1|  hypothetical protein B456_001G026600                    145   6e-39   Gossypium raimondii
gb|KHN22211.1|  Cysteine proteinase 15A                                 145   6e-39   Glycine soja [wild soybean]
ref|XP_004230928.1|  PREDICTED: cysteine proteinase RD19a               145   6e-39   Solanum lycopersicum
emb|CAB53397.1|  cysteine protease                                      141   6e-39   Medicago sativa [alfalfa]
dbj|BAF98585.1|  CM0216.510.nc                                          145   7e-39   Lotus japonicus
ref|XP_004291404.1|  PREDICTED: cysteine proteinase 15A-like            145   7e-39   Fragaria vesca subsp. vesca
gb|AGV54334.1|  cysteine proteinase RD19a-like protein                  145   7e-39   Phaseolus vulgaris [French bean]
gb|AAM65162.1|  cysteine proteinase RD19A                               145   8e-39   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568052.1|  cysteine proteinase RD19a                             145   8e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010105270.1|  Cysteine proteinase 15A                            145   8e-39   Morus notabilis
ref|XP_007136047.1|  hypothetical protein PHAVU_009G013600g             145   8e-39   Phaseolus vulgaris [French bean]
ref|XP_006473584.1|  PREDICTED: cysteine proteinase 15A-like            145   8e-39   Citrus sinensis [apfelsine]
gb|AIB06025.1|  CP3                                                     144   1e-38   Hevea brasiliensis [jebe]
gb|KDO84720.1|  hypothetical protein CISIN_1g017548mg                   144   1e-38   Citrus sinensis [apfelsine]
ref|XP_006435090.1|  hypothetical protein CICLE_v10001559mg             144   1e-38   Citrus clementina
ref|XP_006828787.1|  hypothetical protein AMTR_s00001p00114210          144   2e-38   Amborella trichopoda
emb|CDY71205.1|  BnaCnng71840D                                          144   2e-38   Brassica napus [oilseed rape]
gb|AAL60581.1|AF454959_1  senescence-associated cysteine protease       144   2e-38   Brassica oleracea
ref|XP_006411706.1|  hypothetical protein EUTSA_v10025494mg             144   2e-38   Eutrema salsugineum
gb|KFK30492.1|  hypothetical protein AALP_AA7G268600                    144   2e-38   Arabis alpina [alpine rockcress]
ref|XP_009146338.1|  PREDICTED: cysteine proteinase 15A-like            144   2e-38   Brassica rapa
ref|XP_008387995.1|  PREDICTED: cysteine proteinase 15A                 144   2e-38   Malus domestica [apple tree]
ref|XP_007160702.1|  hypothetical protein PHAVU_001G009900g             144   2e-38   Phaseolus vulgaris [French bean]
emb|CDY34441.1|  BnaC01g21920D                                          144   2e-38   Brassica napus [oilseed rape]
ref|XP_006283963.1|  hypothetical protein CARUB_v10005086mg             144   3e-38   Capsella rubella
dbj|BAF03553.1|  cysteine proteinase CP2                                144   3e-38   Phaseolus vulgaris [French bean]
gb|AAD29084.1|AF082181_1  cysteine proteinase precursor                 143   3e-38   Solanum melongena [aubergine]
dbj|BAF46302.1|  cysteine proteinase precursor                          143   4e-38   Ipomoea nil [qian niu]
ref|XP_002868883.1|  hypothetical protein ARALYDRAFT_490677             143   4e-38   Arabidopsis lyrata subsp. lyrata
ref|XP_003589348.1|  Cysteine proteinase                                143   4e-38   Medicago truncatula
ref|XP_008221329.1|  PREDICTED: cysteine proteinase 15A-like            143   6e-38   Prunus mume [ume]
emb|CDY09707.1|  BnaC07g33540D                                          143   6e-38   Brassica napus [oilseed rape]
gb|ACX54787.2|  cysteine protease                                       142   6e-38   Arachis diogoi
ref|XP_002280808.2|  PREDICTED: cysteine proteinase 15A                 142   7e-38   Vitis vinifera
emb|CDY41960.1|  BnaA01g05320D                                          142   7e-38   Brassica napus [oilseed rape]
emb|CAA52403.1|  putative thiol protease                                141   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003550405.2|  PREDICTED: cysteine proteinase 15A                 142   1e-37   
dbj|BAA92495.1|  cysteine protease                                      142   1e-37   Vigna mungo [urad dal]
ref|XP_010431862.1|  PREDICTED: cysteine proteinase RD19a               142   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_007223351.1|  hypothetical protein PRUPE_ppa007441mg             142   1e-37   Prunus persica
ref|XP_010446443.1|  PREDICTED: cysteine proteinase RD19a               142   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010440192.1|  PREDICTED: cysteine proteinase RD19a-like          142   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010437007.1|  PREDICTED: cysteine proteinase RD19a-like          142   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006665032.1|  PREDICTED: cysteine proteinase 1-like              137   1e-37   
ref|XP_010449835.1|  PREDICTED: cysteine proteinase 15A-like            142   1e-37   Camelina sativa [gold-of-pleasure]
gb|ACK57563.1|  cysteine protease-like protein                          142   1e-37   Arachis hypogaea [goober]
sp|P25804.1|CYSP_PEA  RecName: Full=Cysteine proteinase 15A; AltN...    142   1e-37   Pisum sativum [garden pea]
emb|CAA82995.1|  cysteine proteinase                                    142   1e-37   Vicia sativa [spring vetch]
gb|ACM80348.1|  cysteine proteinase                                     142   1e-37   Solanum lycopersicum
ref|XP_010434865.1|  PREDICTED: cysteine proteinase 15A-like            142   2e-37   Camelina sativa [gold-of-pleasure]
dbj|BAD43619.1|  putative cysteine proteinase                           141   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009150026.1|  PREDICTED: cysteine proteinase RD19a               142   2e-37   Brassica rapa
ref|NP_565512.1|  Papain family cysteine protease                       141   2e-37   Arabidopsis thaliana [mouse-ear cress]
gb|AAB67878.1|  pre-pro-cysteine proteinase                             141   2e-37   Vicia faba [broad bean]
gb|AAO11786.1|  pre-pro cysteine proteinase                             141   2e-37   Vicia faba [broad bean]
ref|XP_008775280.1|  PREDICTED: cysteine proteinase 1-like              141   2e-37   Phoenix dactylifera
ref|XP_003545051.1|  PREDICTED: cysteine proteinase 15A-like            141   2e-37   Glycine max [soybeans]
ref|XP_011083631.1|  PREDICTED: cysteine proteinase 15A-like            141   3e-37   Sesamum indicum [beniseed]
ref|XP_009136751.1|  PREDICTED: cysteine proteinase RD19a-like          141   3e-37   Brassica rapa
emb|CDX90537.1|  BnaA03g42440D                                          141   3e-37   Brassica napus [oilseed rape]
ref|XP_006653265.1|  PREDICTED: cysteine proteinase 1-like              140   3e-37   
ref|NP_001266121.1|  uncharacterized protein LOC101501911 precursor     140   4e-37   Cicer arietinum [garbanzo]
gb|AJA74415.1|  cysteine protease                                       140   4e-37   Cicer arietinum [garbanzo]
ref|XP_009335626.1|  PREDICTED: cysteine proteinase 15A                 140   4e-37   Pyrus x bretschneideri [bai li]
gb|KJB58164.1|  hypothetical protein B456_009G197400                    140   4e-37   Gossypium raimondii
gb|KJB29611.1|  hypothetical protein B456_005G110200                    140   4e-37   Gossypium raimondii
ref|XP_008444769.1|  PREDICTED: cysteine proteinase RD19a-like          140   4e-37   Cucumis melo [Oriental melon]
emb|CAB17075.1|  cysteine proteinase precursor                          140   4e-37   Phaseolus vulgaris [French bean]
ref|XP_010943608.1|  PREDICTED: cysteine proteinase 1-like              140   4e-37   Elaeis guineensis
emb|CDP07452.1|  unnamed protein product                                140   4e-37   Coffea canephora [robusta coffee]
gb|AAQ81938.1|  cysteine proteinase precursor                           140   5e-37   Ipomoea batatas [batate]
ref|XP_002880378.1|  hypothetical protein ARALYDRAFT_481008             140   5e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_010672379.1|  PREDICTED: cysteine proteinase RD19a-like          140   6e-37   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX99593.1|  BnaC04g33500D                                          139   7e-37   Brassica napus [oilseed rape]
gb|AEX97108.1|  cysteine proteinase                                     134   8e-37   Malus domestica [apple tree]
gb|KHG15062.1|  Cysteinease RD19a -like protein                         140   9e-37   Gossypium arboreum [tree cotton]
ref|XP_009405542.1|  PREDICTED: cysteine proteinase 1-like              139   1e-36   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGS43121.1|  cysteine protease 1                                     132   1e-36   Zea mays [maize]
ref|XP_006283974.1|  hypothetical protein CARUB_v10005098mg             139   1e-36   Capsella rubella
ref|XP_009140277.1|  PREDICTED: probable cysteine proteinase A494       139   1e-36   Brassica rapa
emb|CDY15894.1|  BnaA04g12170D                                          139   1e-36   Brassica napus [oilseed rape]
ref|XP_006414378.1|  hypothetical protein EUTSA_v10025521mg             139   1e-36   Eutrema salsugineum
ref|XP_006404590.1|  hypothetical protein EUTSA_v10000210mg             139   2e-36   Eutrema salsugineum
emb|CAD40319.2|  OSJNBb0054B09.3                                        139   2e-36   Oryza sativa Japonica Group [Japonica rice]
emb|CAA57675.1|  cysteine proteinase                                    133   2e-36   Zea mays [maize]
ref|XP_002452058.1|  hypothetical protein SORBIDRAFT_04g017830          139   2e-36   Sorghum bicolor [broomcorn]
gb|EAY93546.1|  hypothetical protein OsI_15336                          138   2e-36   Oryza sativa Indica Group [Indian rice]
gb|EEE60725.1|  hypothetical protein OsJ_14236                          139   2e-36   Oryza sativa Japonica Group [Japonica rice]
gb|EMT16425.1|  Cysteine proteinase 1                                   139   2e-36   Aegilops tauschii
ref|XP_009611293.1|  PREDICTED: cysteine proteinase 15A-like            139   2e-36   Nicotiana tomentosiformis
gb|AAK07731.1|  CPR2-like cysteine proteinase                           138   2e-36   Nicotiana tabacum [American tobacco]
ref|XP_004238314.1|  PREDICTED: cysteine proteinase 15A                 138   3e-36   
emb|CAA78361.1|  tobacco pre-pro-cysteine proteinase                    138   3e-36   Nicotiana tabacum [American tobacco]
emb|CAA78365.1|  tobacco pre-pro-cysteine proteinase                    138   3e-36   Nicotiana tabacum [American tobacco]
ref|XP_003579573.2|  PREDICTED: cysteine proteinase 1-like              139   3e-36   Brachypodium distachyon [annual false brome]
ref|XP_009776238.1|  PREDICTED: cysteine proteinase 15A-like            138   3e-36   Nicotiana sylvestris
ref|XP_004952477.1|  PREDICTED: cysteine proteinase 1-like              138   4e-36   Setaria italica
ref|NP_001052440.1|  Os04g0311400                                       138   4e-36   
ref|XP_006341997.1|  PREDICTED: cysteine proteinase 15A-like            138   5e-36   Solanum tuberosum [potatoes]
gb|KFK24413.1|  hypothetical protein AALP_AAs58848U000200               137   5e-36   Arabis alpina [alpine rockcress]
ref|XP_004152668.1|  PREDICTED: cysteine proteinase RD19a-like          137   6e-36   Cucumis sativus [cucumbers]
gb|AAB16996.1|  thiol protease isoform B                                136   6e-36   Glycine max [soybeans]
gb|EMS53996.1|  Cysteine proteinase 1                                   138   7e-36   Triticum urartu
ref|NP_567489.1|  papain family cysteine protease                       137   7e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870174.1|  hypothetical protein ARALYDRAFT_915142             137   8e-36   Arabidopsis lyrata subsp. lyrata
emb|CAH59428.1|  cysteine protease 2                                    134   1e-35   Plantago major [cart-track plant]
ref|XP_003607110.1|  Cysteine proteinase                                136   1e-35   Medicago truncatula
ref|XP_004975256.1|  PREDICTED: cysteine proteinase 1-like              137   1e-35   Setaria italica
gb|ACF86683.1|  unknown                                                 137   1e-35   Zea mays [maize]
ref|NP_001105685.1|  cysteine proteinase 1 precursor                    136   1e-35   Zea mays [maize]
emb|CAA78403.1|  pre-pro-cysteine proteinase                            136   1e-35   Solanum lycopersicum
gb|KEH30505.1|  papain family cysteine protease                         135   2e-35   Medicago truncatula
ref|XP_003574963.1|  PREDICTED: cysteine proteinase 1-like              136   2e-35   Brachypodium distachyon [annual false brome]
gb|ABK24153.1|  unknown                                                 135   4e-35   Picea sitchensis
gb|EYU27644.1|  hypothetical protein MIMGU_mgv1a008452mg                135   4e-35   Erythranthe guttata [common monkey flower]
ref|NP_001046828.1|  Os02g0469600                                       135   6e-35   
ref|XP_002279862.1|  PREDICTED: cysteine proteinase RD19a               134   1e-34   Vitis vinifera
dbj|BAG16515.1|  putative cysteine proteinase                           134   1e-34   Capsicum chinense [bonnet pepper]
gb|EMS64962.1|  Cysteine proteinase 1                                   133   1e-34   Triticum urartu
tpe|CAD66657.1|  TPA: putative cysteine proteinase precursor            134   1e-34   Hordeum vulgare subsp. vulgare [barley]
gb|AES89347.2|  papain family cysteine protease                         132   2e-34   Medicago truncatula
gb|ACN40679.1|  unknown                                                 133   2e-34   Picea sitchensis
gb|ABK21238.1|  unknown                                                 133   2e-34   Picea sitchensis
gb|EMT10192.1|  Cysteine proteinase 1                                   133   2e-34   Aegilops tauschii
ref|XP_003607150.1|  Cysteine proteinase                                132   2e-34   
gb|ABK24688.1|  unknown                                                 133   2e-34   Picea sitchensis
gb|AAW21813.1|  cysteine protease                                       133   3e-34   Triticum aestivum [Canadian hard winter wheat]
gb|AAZ32411.1|  cysteine proteinase glycinain type                      133   3e-34   Nicotiana benthamiana
gb|EPS70818.1|  cysteine proteinase                                     132   3e-34   Genlisea aurea
dbj|BAD10859.1|  cysteine protease                                      132   7e-34   Tripolium pannonicum [sea starwort]
gb|EPS65881.1|  cysteine proteinase                                     131   7e-34   Genlisea aurea
gb|AAB16997.1|  thiol protease isoform A                                130   8e-34   Glycine max [soybeans]
gb|ADY04293.1|  cysteine protease                                       126   9e-34   Clarkia xantiana subsp. xantiana
ref|XP_009786000.1|  PREDICTED: cysteine proteinase RD19a-like          131   1e-33   Nicotiana sylvestris
gb|ADY04361.1|  cysteine protease                                       126   1e-33   Clarkia xantiana subsp. xantiana
gb|ADY04342.1|  cysteine protease                                       125   1e-33   Clarkia xantiana subsp. xantiana
gb|ADY04336.1|  cysteine protease                                       125   1e-33   Clarkia xantiana subsp. xantiana
emb|CAQ00101.1|  papain-like cysteine proteinase                        131   1e-33   Hordeum vulgare subsp. vulgare [barley]
gb|ADY04262.1|  cysteine protease                                       125   1e-33   Clarkia xantiana subsp. xantiana
gb|ADY04457.1|  cysteine protease                                       125   2e-33   Clarkia xantiana subsp. xantiana
gb|ADY04414.1|  cysteine protease                                       125   2e-33   Clarkia xantiana subsp. xantiana
emb|CDX98179.1|  BnaC07g09190D                                          123   2e-33   Brassica napus [oilseed rape]
gb|ADY04359.1|  cysteine protease                                       125   2e-33   Clarkia xantiana subsp. xantiana
gb|ADY04482.1|  cysteine protease                                       125   2e-33   Clarkia xantiana subsp. xantiana
dbj|BAC57957.1|  thiol protease                                         126   3e-33   Tripolium pannonicum [sea starwort]
gb|ADY04358.1|  cysteine protease                                       125   3e-33   Clarkia xantiana subsp. xantiana
gb|ADY04368.1|  cysteine protease                                       125   3e-33   Clarkia xantiana subsp. xantiana
gb|ADY04480.1|  cysteine protease                                       124   4e-33   Clarkia xantiana subsp. xantiana
gb|ADY04268.1|  cysteine protease                                       124   5e-33   Clarkia xantiana subsp. xantiana
gb|ADY04295.1|  cysteine protease                                       124   1e-32   Clarkia xantiana subsp. xantiana
gb|AAB53103.1|  cysteine protease                                       121   1e-32   Brassica napus [oilseed rape]
ref|XP_002960585.1|  hypothetical protein SELMODRAFT_266583             124   4e-31   Selaginella moellendorffii
ref|XP_002969223.1|  hypothetical protein SELMODRAFT_91274              124   5e-31   Selaginella moellendorffii
ref|XP_008776953.1|  PREDICTED: cysteine proteinase-like                115   2e-29   Phoenix dactylifera
ref|XP_010690815.1|  PREDICTED: cysteine proteinase RD19a               119   6e-29   Beta vulgaris subsp. vulgaris [field beet]
gb|ADY04490.1|  cysteine protease                                       114   6e-29   Clarkia xantiana subsp. xantiana
ref|XP_008804021.1|  PREDICTED: cysteine proteinase RD19a-like          115   8e-29   Phoenix dactylifera
emb|CCA95098.1|  putative responsive to dehydration 19                  114   8e-29   Liriodendron tulipifera
gb|KEH43476.1|  papain family cysteine protease                         118   1e-28   Medicago truncatula
ref|XP_010504326.1|  PREDICTED: cysteine proteinase 15A-like            117   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_006293095.1|  hypothetical protein CARUB_v10019394mg             117   2e-28   Capsella rubella
emb|CAB41090.1|  cysteine proteinase precursor-like protein             117   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876278.1|  hypothetical protein ARALYDRAFT_485911             117   2e-28   Arabidopsis lyrata subsp. lyrata
ref|NP_567010.5|  Papain family cysteine protease                       117   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009404192.1|  PREDICTED: cysteine proteinase 15A                 117   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS59778.1|  Cysteine proteinase 15A                                 114   2e-28   Triticum urartu
gb|KHN00877.1|  Cysteine proteinase 15A                                 116   3e-28   Glycine soja [wild soybean]
ref|XP_004496226.1|  PREDICTED: cysteine proteinase 15A-like            116   3e-28   Cicer arietinum [garbanzo]
gb|KFK34737.1|  hypothetical protein AALP_AA5G186400                    116   4e-28   Arabis alpina [alpine rockcress]
ref|NP_001059639.1|  Os07g0480900                                       116   6e-28   
ref|XP_008802783.1|  PREDICTED: probable cysteine proteinase A494       115   7e-28   Phoenix dactylifera
ref|XP_002460693.1|  hypothetical protein SORBIDRAFT_02g033270          115   8e-28   Sorghum bicolor [broomcorn]
emb|CAB16316.1|  cysteine proteinase precursor                          115   1e-27   Vicia sativa [spring vetch]
gb|ABO93617.1|  papain-like cysteine proteinase                         110   2e-27   Vitis vinifera
ref|XP_010534431.1|  PREDICTED: cysteine proteinase 15A                 114   2e-27   Tarenaya hassleriana [spider flower]
gb|KHN37802.1|  Cysteine proteinase 1                                   114   2e-27   Glycine soja [wild soybean]
ref|XP_008354070.1|  PREDICTED: cysteine proteinase 15A-like            112   3e-27   Malus domestica [apple tree]
ref|NP_001236888.1|  cysteine proteinase precursor                      114   3e-27   Glycine max [soybeans]
gb|AAD46920.1|AF167986_1  putative cysteine proteinase GmPM33           114   3e-27   Glycine max [soybeans]
ref|XP_004959670.1|  PREDICTED: cysteine proteinase 1-like              114   4e-27   
ref|XP_001781954.1|  predicted protein                                  113   4e-27   
ref|XP_008362714.1|  PREDICTED: cysteine proteinase 15A                 113   5e-27   
ref|XP_009116190.1|  PREDICTED: probable cysteine proteinase A494       112   8e-27   
tpg|DAA40800.1|  TPA: putative cysteine protease family protein         112   8e-27   
emb|CDY56961.1|  BnaA09g55030D                                          112   9e-27   
ref|XP_009117680.1|  PREDICTED: probable cysteine proteinase A494       112   9e-27   
emb|CDX73424.1|  BnaC08g25790D                                          112   9e-27   
emb|CAQ00102.1|  papain-like cysteine proteinase                        112   1e-26   
ref|XP_007143764.1|  hypothetical protein PHAVU_007G099600g             112   1e-26   
ref|XP_003560213.1|  PREDICTED: cysteine proteinase 1                   112   1e-26   
emb|CDY13816.1|  BnaA09g43180D                                          110   2e-26   
ref|XP_001761980.1|  predicted protein                                  111   2e-26   
gb|EYU39642.1|  hypothetical protein MIMGU_mgv1a008552mg                111   3e-26   
ref|XP_010918606.1|  PREDICTED: probable cysteine proteinase A494       111   3e-26   
gb|EEC82027.1|  hypothetical protein OsI_25996                          113   4e-26   
ref|XP_010243268.1|  PREDICTED: cysteine proteinase 15A                 110   5e-26   
ref|XP_008233261.1|  PREDICTED: cysteine proteinase 15A                 110   5e-26   
ref|XP_007218137.1|  hypothetical protein PRUPE_ppa007240mg             110   5e-26   
ref|XP_009789260.1|  PREDICTED: cysteine proteinase 15A                 110   5e-26   
ref|XP_009617441.1|  PREDICTED: cysteine proteinase 15A                 110   6e-26   
ref|XP_006403513.1|  hypothetical protein EUTSA_v10010475mg             110   7e-26   
gb|KJB73490.1|  hypothetical protein B456_011G235500                    110   9e-26   
ref|XP_004250044.1|  PREDICTED: cysteine proteinase 15A                 110   9e-26   
gb|AEQ54770.1|  cysteine proteinase CP1                                 110   1e-25   
gb|KHG08355.1|  Cysteinease 1                                           109   1e-25   
emb|CCA95082.1|  putative responsive to dehydration 19                  104   2e-25   
emb|CAB17077.1|  cysteine proteinase precursor                          108   2e-25   
ref|XP_011094506.1|  PREDICTED: cysteine proteinase 15A                 108   3e-25   
emb|CBI31400.3|  unnamed protein product                                107   3e-25   
emb|CDO99795.1|  unnamed protein product                                108   4e-25   
ref|XP_007510080.1|  unknown                                            108   4e-25   
ref|XP_011024366.1|  PREDICTED: cysteine proteinase 15A                 107   6e-25   
ref|XP_006850211.1|  hypothetical protein AMTR_s00022p00251800          107   6e-25   
ref|XP_006361690.1|  PREDICTED: cysteine proteinase 15A-like            107   1e-24   
ref|XP_010034320.1|  PREDICTED: cysteine proteinase 1                   106   1e-24   
gb|KDP30486.1|  hypothetical protein JCGZ_16165                         106   1e-24   
ref|XP_010688493.1|  PREDICTED: cysteine proteinase 15A                 106   1e-24   
ref|XP_008446834.1|  PREDICTED: cysteine proteinase 15A                 106   1e-24   
gb|ADE76932.1|  unknown                                                 106   2e-24   
ref|XP_006436511.1|  hypothetical protein CICLE_v10031865mg             106   2e-24   
ref|XP_004157559.1|  PREDICTED: cysteine proteinase 15A-like            106   2e-24   
ref|XP_004142497.1|  PREDICTED: cysteine proteinase 15A-like            106   2e-24   
ref|XP_002316398.1|  hypothetical protein POPTR_0010s23510g             105   3e-24   
ref|XP_002266821.1|  PREDICTED: cysteine proteinase 15A                 104   7e-24   
emb|CAN64491.1|  hypothetical protein VITISV_015725                     104   7e-24   
ref|XP_010103534.1|  putative cysteine proteinase A494                  104   9e-24   
ref|XP_002533377.1|  cysteine protease, putative                        104   1e-23   
ref|XP_008647122.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin 7-...    103   1e-23   
ref|XP_006658557.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    103   1e-23   
ref|XP_007010012.1|  Papain family cysteine protease                    103   2e-23   
gb|AFW72358.1|  putative cysteine protease family protein               103   9e-23   
gb|EPS63354.1|  hypothetical protein M569_11429                         100   2e-22   
emb|CEF99324.1|  Cysteine peptidase, cysteine active site               100   2e-22   
ref|XP_003081549.1|  Cysteine proteinase Cathepsin F (ISS)            99.8    2e-22   
ref|XP_001419933.1|  predicted protein                                98.2    7e-22   
ref|XP_011469621.1|  PREDICTED: cysteine proteinase 15A-like          96.7    1e-21   
ref|XP_003057227.1|  predicted protein                                97.1    3e-21   
ref|XP_011169692.1|  PREDICTED: putative cysteine proteinase CG12163  95.5    1e-19   
ref|XP_011203808.1|  PREDICTED: putative cysteine proteinase CG12163  94.7    2e-19   
ref|XP_004519757.1|  PREDICTED: putative cysteine proteinase CG12...  94.7    2e-19   
ref|XP_011184040.1|  PREDICTED: putative cysteine proteinase CG12163  94.7    2e-19   
gb|EFN80374.1|  Putative cysteine proteinase CG12163                  94.7    3e-19   
ref|XP_011145705.1|  PREDICTED: uncharacterized protein LOC105186896  94.7    3e-19   
ref|XP_006608091.1|  PREDICTED: uncharacterized protein LOC102680728  93.6    6e-19   
ref|XP_003492760.1|  PREDICTED: hypothetical protein LOC100745708     93.2    8e-19   
ref|XP_004519758.1|  PREDICTED: putative cysteine proteinase CG12...  92.4    8e-19   
ref|XP_003696602.1|  PREDICTED: putative cysteine proteinase CG12...  92.8    8e-19   
ref|XP_011496222.1|  PREDICTED: uncharacterized protein LOC105360904  93.2    9e-19   
emb|CAN71324.1|  hypothetical protein VITISV_013970                   91.7    9e-19   
ref|XP_005184487.1|  PREDICTED: putative cysteine proteinase CG12...  92.0    1e-18   
ref|XP_005184486.1|  PREDICTED: putative cysteine proteinase CG12...  92.0    1e-18   
gb|KFB38327.1|  AGAP002879-PB-like protein                            92.4    2e-18   
ref|XP_011493714.1|  AAEL017153-PA                                    92.0    2e-18   
ref|XP_001844355.1|  conserved hypothetical protein                   91.7    3e-18   
ref|XP_392381.3|  PREDICTED: putative cysteine proteinase CG12163...  91.3    3e-18   
ref|XP_006567715.1|  PREDICTED: putative cysteine proteinase CG12...  91.3    3e-18   
ref|XP_001994049.1|  GH22731                                          90.1    5e-18   
ref|XP_002000409.1|  GI10216                                          90.1    5e-18   
ref|XP_001607324.1|  PREDICTED: uncharacterized protein LOC100123649  90.9    5e-18   
dbj|BAI44279.1|  cysteine proteinase inhibitor precursor              90.9    6e-18   
ref|XP_002017233.1|  GL22196                                          89.7    6e-18   
gb|EGI66903.1|  Putative cysteine proteinase                          90.1    7e-18   
ref|XP_002056575.1|  GJ11017                                          89.7    7e-18   
ref|XP_002137768.1|  GA27408, isoform A                               89.7    8e-18   
ref|XP_011052455.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  90.1    8e-18   
gb|EFN65613.1|  Putative cysteine proteinase CG12163                  90.1    8e-18   
ref|XP_008550537.1|  PREDICTED: uncharacterized protein LOC103573287  90.1    9e-18   
ref|XP_002096026.1|  GE25302                                          89.4    9e-18   
ref|XP_003707276.1|  PREDICTED: uncharacterized protein LOC100880620  89.7    1e-17   
ref|XP_011260522.1|  PREDICTED: uncharacterized protein LOC105253881  90.1    1e-17   
ref|NP_730901.1|  CG12163, isoform A                                  89.4    1e-17   
ref|XP_002038380.1|  GM10654                                          89.0    1e-17   
gb|ETN61472.1|  hypothetical protein AND_006867                       90.1    1e-17   
ref|XP_001978897.1|  GG11133                                          89.0    1e-17   
ref|XP_001955780.1|  GF16067                                          89.0    1e-17   
emb|CAN80141.1|  hypothetical protein VITISV_038978                   87.4    1e-17   
ref|XP_003736743.1|  GA27408, isoform B                               88.2    1e-17   
ref|XP_002988513.1|  hypothetical protein SELMODRAFT_128220           83.6    2e-17   
ref|NP_649521.1|  CG12163, isoform B                                  87.4    2e-17   
ref|XP_312034.5|  AGAP002879-PA                                       89.0    3e-17   
ref|XP_003436277.1|  AGAP002879-PB                                    89.0    3e-17   
gb|ACR08662.1|  cathepsin F                                           84.3    3e-17   
gb|AJF94882.1|  C1 family cathepsin F10                               88.6    3e-17   
gb|AEW08440.1|  hypothetical protein 2_9845_02                        81.3    3e-17   
ref|XP_002073772.1|  GK14287                                          87.4    4e-17   
emb|CAN81617.1|  hypothetical protein VITISV_001998                   85.1    4e-17   
gb|ABE72973.1|  cathepsin L                                           84.7    5e-17   
ref|XP_002505924.1|  cysteine endopeptidase                           84.7    5e-17   
emb|CBY11269.1|  unnamed protein product                              85.5    6e-17   
emb|CAN81619.1|  hypothetical protein VITISV_002000                   84.3    9e-17   
ref|XP_002979143.1|  hypothetical protein SELMODRAFT_110288           83.6    9e-17   
ref|XP_008195657.1|  PREDICTED: uncharacterized protein LOC662417...  87.0    1e-16   
ref|XP_008195656.1|  PREDICTED: uncharacterized protein LOC662417...  87.0    1e-16   
gb|AFQ01139.1|  cathepsin F-like protease                             85.9    1e-16   
gb|ERG79645.1|  cysteine proteinase                                   80.5    1e-16   
gb|KHN72698.1|  Putative cysteine proteinase                          80.9    1e-16   
ref|XP_003436276.1|  AGAP002879-PC                                    86.3    2e-16   
gb|EZA58965.1|  Putative cysteine proteinase                          86.3    2e-16   
emb|CBI23088.3|  unnamed protein product                              81.6    2e-16   
ref|XP_011331416.1|  PREDICTED: uncharacterized protein LOC105275911  86.3    2e-16   
gb|EHJ64782.1|  cysteine proteinase inhibitor precursor               80.9    3e-16   
ref|XP_005184488.1|  PREDICTED: putative cysteine proteinase CG12...  84.0    5e-16   
gb|AFM37363.1|  cathepsin F1                                          83.2    7e-16   
ref|XP_011309436.1|  PREDICTED: uncharacterized protein LOC105270293  84.3    8e-16   
emb|CBY31096.1|  unnamed protein product                              82.0    8e-16   
ref|XP_003115597.1|  CRE-TAG-196 protein                              82.4    1e-15   
gb|KDR17524.1|  Putative cysteine proteinase                          83.6    2e-15   
gb|EKC42097.1|  Cathepsin F                                           82.8    2e-15   
ref|XP_011434326.1|  PREDICTED: uncharacterized protein LOC105333...  82.8    2e-15   
ref|XP_011434325.1|  PREDICTED: uncharacterized protein LOC105333...  82.8    2e-15   
gb|ABC48936.1|  cathepsin F like protease                             82.0    2e-15   
ref|NP_505215.2|  Protein TAG-196                                     82.0    3e-15   
gb|ENN81374.1|  hypothetical protein YQE_02191                        83.2    3e-15   
gb|EYC18288.1|  hypothetical protein Y032_0028g1777                   76.3    6e-15   
ref|XP_002635317.1|  C. briggsae CBR-TAG-196 protein                  80.5    7e-15   
gb|EGT34543.1|  hypothetical protein CAEBREN_26318                    80.5    7e-15   
gb|KIH48456.1|  cysteine proteinase family protein                    75.1    7e-15   
ref|XP_009047014.1|  hypothetical protein LOTGIDRAFT_172186           78.6    8e-15   
gb|EGT34572.1|  hypothetical protein CAEBREN_13324                    80.1    1e-14   
gb|ERL92611.1|  hypothetical protein D910_09924                       79.7    1e-14   
ref|XP_002427787.1|  Cathepsin F precursor, putative                  79.7    1e-14   
emb|CDX82031.1|  BnaC08g35700D                                        77.4    2e-14   
gb|AII16490.1|  cathepsin F                                           77.8    2e-14   
gb|ABY75169.1|  cysteine protease                                     73.6    2e-14   
ref|XP_002682087.1|  predicted protein                                78.2    2e-14   
emb|CDJ26737.1|  cathepsin F-like cysteine peptidase protein          79.0    2e-14   
gb|KFM67613.1|  putative cysteine proteinase                          78.6    3e-14   
emb|CDJ92562.1|  Proteinase inhibitor I25 and Proteinase inhibito...  78.2    4e-14   
emb|CDJ88889.1|  Proteinase inhibitor I25 and Proteinase inhibito...  78.2    5e-14   
ref|XP_009029595.1|  hypothetical protein HELRODRAFT_157956           76.3    6e-14   
ref|NP_001156454.1|  cathepsin F isoform 2 precursor                  78.2    7e-14   
gb|ELT97360.1|  hypothetical protein CAPTEDRAFT_147978                75.5    8e-14   
ref|XP_003389037.1|  PREDICTED: cathepsin L1-like                     75.9    1e-13   
ref|XP_003148243.1|  hypothetical protein LOAG_12683                  73.9    2e-13   
gb|EFO15826.2|  hypothetical protein LOAG_12683                       73.9    2e-13   
emb|CAC94443.1|  cysteine proteinase                                  72.0    4e-13   
ref|NP_001156453.1|  cathepsin F isoform 1 precursor                  75.9    5e-13   
ref|XP_009035714.1|  hypothetical protein AURANDRAFT_53321            73.9    5e-13   
ref|XP_009161938.1|  hypothetical protein T265_00017                  72.8    6e-13   
ref|XP_003375070.1|  viral cathepsin                                  75.1    6e-13   
dbj|GAA47436.1|  cathepsin L                                          72.8    6e-13   
gb|AAT07059.1|  cathepsin F-like cysteine proteinase                  75.1    6e-13   
ref|XP_004351999.1|  cysteine protease                                73.9    6e-13   
ref|XP_006121731.1|  PREDICTED: cathepsin W-like                      72.4    7e-13   
gb|EFX71333.1|  hypothetical protein DAPPUDRAFT_189155                72.4    9e-13   
ref|XP_003284553.1|  hypothetical protein DICPUDRAFT_96752            73.6    9e-13   
ref|XP_006268168.1|  PREDICTED: cathepsin F-like                      74.3    9e-13   
ref|XP_002119872.3|  PREDICTED: cathepsin L-like                      74.3    1e-12   
gb|AAF21461.1|U69120_1  cysteine proteinase PWCP1                     73.9    1e-12   
ref|XP_635374.1|  cysteine protease                                   73.2    1e-12   
ref|XP_002610214.1|  hypothetical protein BRAFLDRAFT_216923           72.0    1e-12   
ref|XP_006036937.1|  PREDICTED: cathepsin F-like                      73.6    1e-12   
gb|AAW25775.1|  SJCHGC00511 protein                                   73.9    2e-12   
emb|CAX69889.1|  Temporarily Assigned Gene name                       73.6    2e-12   
gb|AAT09103.1|  digestive cysteine proteinase                         73.2    2e-12   
ref|XP_005305646.1|  PREDICTED: cathepsin W-like                      72.8    2e-12   
ref|XP_007438969.1|  PREDICTED: cathepsin F-like                      71.2    2e-12   
emb|CDP90584.1|  Protein BM-TAG-196                                   73.6    2e-12   
ref|XP_635417.1|  cysteine proteinase 1                               72.4    2e-12   
emb|CAA26255.1|  cysteine proteinase I precursor                      72.4    2e-12   
ref|XP_006007112.1|  PREDICTED: cathepsin F-like                      73.2    2e-12   
ref|XP_004364962.1|  cysteine proteinase 7                            72.4    3e-12   
dbj|BAN20819.1|  cysteine-type endopeptidase                          73.6    3e-12   
emb|CAC94444.1|  cysteine proteinase                                  69.7    3e-12   
ref|XP_002681317.1|  cysteine protease                                72.0    4e-12   
gb|KGB33519.1|  Cathepsin L                                           71.2    4e-12   
ref|XP_009064230.1|  hypothetical protein LOTGIDRAFT_204652           71.2    5e-12   
ref|XP_006980634.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      72.4    5e-12   
ref|XP_005351748.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      72.4    5e-12   
ref|XP_003747496.1|  PREDICTED: cathepsin L-like                      71.2    5e-12   
ref|XP_001894882.1|  cathepsin F-like cysteine proteinase             68.9    6e-12   
ref|XP_003386471.1|  PREDICTED: cysteine proteinase 1-like            71.6    6e-12   
emb|CEF63690.1|  Cathepsin F                                          71.6    6e-12   
emb|CDQ07779.1|  Protein Bm12113, isoform a                           68.2    6e-12   
gb|ELV09527.1|  Cathepsin F                                           72.4    6e-12   
gb|AEE62591.1|  unknown                                               71.2    7e-12   
gb|ENN81994.1|  hypothetical protein YQE_01705                        71.2    7e-12   
ref|XP_006827472.1|  hypothetical protein AMTR_s00009p00129100        70.9    7e-12   
ref|XP_007648967.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      72.0    7e-12   
gb|EGW06365.1|  Cathepsin F                                           72.0    7e-12   
ref|XP_008177856.1|  PREDICTED: cathepsin W-like                      67.8    7e-12   
gb|ELW65130.1|  Cathepsin W                                           72.0    8e-12   
gb|AAB01769.1|  cysteine proteinase homolog                           70.9    8e-12   
dbj|GAM23991.1|  hypothetical protein SAMD00019534_071660             70.9    8e-12   
gb|ERE78742.1|  cathepsin F                                           71.6    8e-12   
gb|AAR27011.1|  cysteine protease                                     70.1    9e-12   
ref|XP_002970484.1|  hypothetical protein SELMODRAFT_93661            70.9    9e-12   
ref|XP_001029851.1|  Papain family cysteine protease containing p...  70.5    9e-12   
ref|XP_010765827.1|  PREDICTED: cathepsin W                           72.0    9e-12   
ref|NP_001029282.1|  cathepsin F precursor                            71.6    1e-11   
ref|XP_007056266.1|  PREDICTED: cathepsin F-like                      71.6    1e-11   
ref|XP_002978562.1|  hypothetical protein SELMODRAFT_109056           70.5    1e-11   
ref|XP_008577225.1|  PREDICTED: cathepsin F                           71.6    1e-11   
ref|XP_011406938.1|  PREDICTED: silicatein-like                       68.9    1e-11   
ref|XP_004596891.1|  PREDICTED: cathepsin F                           71.2    1e-11   
ref|XP_005064094.1|  PREDICTED: cathepsin F                           71.2    1e-11   
ref|NP_001133678.1|  Cathepsin F precursor                            71.2    1e-11   
ref|XP_008472006.1|  PREDICTED: putative cysteine proteinase CG12163  68.6    1e-11   
ref|XP_001898698.1|  fibroinase precursor                             68.6    1e-11   
emb|CDQ05036.1|  Protein Bm9835                                       68.6    1e-11   



>gb|AAK27969.1|AF242373_1 cysteine protease [Ipomoea batatas]
Length=366

 Score =   164 bits (414),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN
Sbjct  287  GVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRN  346

Query  181  ICGVDSMVSTVAAVNTPTSD  240
            +CGVDSMVSTVAAV+T TSD
Sbjct  347  VCGVDSMVSTVAAVSTTTSD  366



>gb|AAF61440.1|AF138264_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN
Sbjct  289  GVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRN  348

Query  181  ICGVDSMVSTVAAVNTPTSD  240
            +CGVDSMVSTVAAV+T TSD
Sbjct  349  VCGVDSMVSTVAAVSTTTSD  368



>gb|AAF40414.1|AF216783_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN
Sbjct  289  GVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRN  348

Query  181  ICGVDSMVSTVAAVNTPTSD  240
            +CGVDSMVSTVAAV+T TSD
Sbjct  349  VCGVDSMVSTVAAVSTTTSD  368



>gb|AAF40415.1|AF216784_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=368

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN
Sbjct  289  GVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRN  348

Query  181  ICGVDSMVSTVAAVNTPTSD  240
            +CGVDSMVSTVAAV+T TSD
Sbjct  349  VCGVDSMVSTVAAVSTTTSD  368



>gb|AAF61441.1|AF138265_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=366

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN
Sbjct  287  GVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRN  346

Query  181  ICGVDSMVSTVAAVNTPTSD  240
            +CGVDSMVSTVAAV+T TSD
Sbjct  347  VCGVDSMVSTVAAVSTTTSD  366



>gb|AAF40416.1|AF216785_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
 gb|AAF61442.1|AF138266_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
Length=366

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN
Sbjct  287  GVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRN  346

Query  181  ICGVDSMVSTVAAVNTPTSD  240
            +CGVDSMVSTVAAV+T TSD
Sbjct  347  VCGVDSMVSTVAAVSTTTSD  366



>gb|KDP41743.1| hypothetical protein JCGZ_26761 [Jatropha curcas]
Length=370

 Score =   158 bits (400),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 72/79 (91%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGE+WGE GYYKICRGRN
Sbjct  292  GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGETWGESGYYKICRGRN  351

Query  181  ICGVDSMVSTVAAVNTPTS  237
            +CGVDSMVSTVAAV T + 
Sbjct  352  VCGVDSMVSTVAAVQTSSQ  370



>ref|XP_002512963.1| cysteine protease, putative [Ricinus communis]
 gb|EEF49466.1| cysteine protease, putative [Ricinus communis]
Length=373

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/79 (91%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGE+WGE GYYKICRGRN
Sbjct  295  GVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGENWGESGYYKICRGRN  354

Query  181  ICGVDSMVSTVAAVNTPTS  237
            ICGVDSMVSTVAAV T + 
Sbjct  355  ICGVDSMVSTVAAVQTASE  373



>sp|P05993.1|PAPA5_CARPA RecName: Full=Cysteine proteinase; AltName: Full=Clone PLBPC13, 
partial [Carica papaya]
 emb|CAA27609.1| pot. cysteine proteinase [Carica papaya]
Length=96

 Score =   150 bits (378),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/79 (89%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICS+RL+HGVLLVGYGSAGYAPIRLKEKPYW+IKNSWGE+WGE GYYKICRGRN
Sbjct  18   GVSCPYICSRRLNHGVLLVGYGSAGYAPIRLKEKPYWVIKNSWGENWGENGYYKICRGRN  77

Query  181  ICGVDSMVSTVAAVNTPTS  237
            ICGVDSMVSTVAAV+T + 
Sbjct  78   ICGVDSMVSTVAAVHTTSQ  96



>gb|KHG24064.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=374

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/76 (93%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLK+KPYWIIKNSWGE+WGE GYYKICRGRN
Sbjct  296  GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKDKPYWIIKNSWGETWGENGYYKICRGRN  355

Query  181  ICGVDSMVSTVAAVNT  228
            +CGVDS+VSTVAAVNT
Sbjct  356  VCGVDSLVSTVAAVNT  371



>gb|AIB06024.1| CP2 [Hevea brasiliensis]
Length=372

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/80 (91%), Positives = 76/80 (95%), Gaps = 1/80 (1%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGSAGYAP+RLKEKPYWIIKNSWGE+WGE GYYKICRGRN
Sbjct  293  GVSCPYICSKRLDHGVLLVGYGSAGYAPVRLKEKPYWIIKNSWGENWGESGYYKICRGRN  352

Query  181  ICGVDSMVSTVAA-VNTPTS  237
            ICGVDSMVSTVAA V TP+ 
Sbjct  353  ICGVDSMVSTVAAVVQTPSQ  372



>gb|AAX19661.1| cysteine proteinase [Populus tomentosa]
Length=374

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 70/78 (90%), Positives = 75/78 (96%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICS+RLDHGVLLVGYGSAGYAP+R+KEKPYWIIKNSWGESWGE G+YKICRGRN
Sbjct  296  GVSCPYICSRRLDHGVLLVGYGSAGYAPVRMKEKPYWIIKNSWGESWGENGFYKICRGRN  355

Query  181  ICGVDSMVSTVAAVNTPT  234
            ICGVDSMVSTVAAV T +
Sbjct  356  ICGVDSMVSTVAAVQTSS  373



>ref|XP_007042077.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOX97908.1| Papain family cysteine protease [Theobroma cacao]
Length=395

 Score =   156 bits (395),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGSAGYAP+R+K+KPYWIIKNSWGESWGE G+YKICRGRN
Sbjct  317  GVSCPYICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGESWGEDGFYKICRGRN  376

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVDSMVSTVAAV+T
Sbjct  377  ICGVDSMVSTVAAVDT  392



>gb|ABQ10201.1| cysteine protease Cp3 [Actinidia deliciosa]
Length=365

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 70/79 (89%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE G+YKIC+GRN
Sbjct  287  GVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGFYKICQGRN  346

Query  181  ICGVDSMVSTVAAVNTPTS  237
            +CGVDSMVSTVAAV+T ++
Sbjct  347  VCGVDSMVSTVAAVHTTSN  365



>ref|XP_011047717.1| PREDICTED: cysteine proteinase RD19a [Populus euphratica]
Length=368

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICS+RLDHGVLLVGYGSAGYAP+R+KEKPYWIIKNSWGESWGE G+YKICRGRN
Sbjct  290  GVSCPYICSRRLDHGVLLVGYGSAGYAPVRMKEKPYWIIKNSWGESWGENGFYKICRGRN  349

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVDSMVSTVAAV T
Sbjct  350  ICGVDSMVSTVAAVQT  365



>gb|KJB32561.1| hypothetical protein B456_005G247000 [Gossypium raimondii]
Length=374

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLK+KPYWIIKNSWGE+WGE G+YKICRGRN
Sbjct  296  GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKDKPYWIIKNSWGETWGENGFYKICRGRN  355

Query  181  ICGVDSMVSTVAAVNT  228
            +CGVDS+VSTVAAVNT
Sbjct  356  VCGVDSLVSTVAAVNT  371



>gb|ABK96252.1| unknown [Populus trichocarpa x Populus deltoides]
Length=156

 Score =   150 bits (378),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICS+RLDHGVLLVGYGSAGY+P+R+KEKP+WIIKNSWGE WGE G+YKICRGRN
Sbjct  79   GVSCPYICSRRLDHGVLLVGYGSAGYSPVRMKEKPFWIIKNSWGEKWGENGFYKICRGRN  138

Query  181  ICGVDSMVSTVAAVNTPT  234
            +CGVDSMVSTVAAV T +
Sbjct  139  VCGVDSMVSTVAAVQTSS  156



>emb|CDP20652.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/78 (91%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGS+GYAPIR+KEKPYWIIKNSWGE WGE GYYKICRG N
Sbjct  295  GVSCPYICSKRLDHGVLLVGYGSSGYAPIRMKEKPYWIIKNSWGEHWGENGYYKICRGHN  354

Query  181  ICGVDSMVSTVAAVNTPT  234
            ICGVDSMVSTVAAV+T T
Sbjct  355  ICGVDSMVSTVAAVHTST  372



>gb|KJB79047.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
Length=373

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGSAGYAP+R+K+KPYWIIKNSWGE+WGE G+Y+ICRGRN
Sbjct  295  GVSCPYICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGENGFYRICRGRN  354

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVDSMVSTVAAVNT
Sbjct  355  ICGVDSMVSTVAAVNT  370



>emb|CAE54306.1| putative papain-like cysteine proteinase [Gossypium hirsutum]
Length=373

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGSAGYAP+R+K+KPYWIIKNSWGE+WGE G+Y+ICRGRN
Sbjct  295  GVSCPYICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGENGFYRICRGRN  354

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVDSMVSTVAAVNT
Sbjct  355  ICGVDSMVSTVAAVNT  370



>ref|NP_001267989.1| cysteine protease precursor [Vitis vinifera]
 gb|ABX79341.1| cysteine protease [Vitis vinifera]
Length=377

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGSAGYAPIR+K+KPYWIIKNSWGE+WGE G+YKICRGRN
Sbjct  299  GVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKDKPYWIIKNSWGENWGENGFYKICRGRN  358

Query  181  ICGVDSMVSTVAAVNTPTS  237
            +CGVDSMVSTVAAV+T ++
Sbjct  359  VCGVDSMVSTVAAVHTTSN  377



>gb|KHG15253.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=373

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGSAGYAP+R+K+KPYWIIKNSWGE+WGE G+Y+ICRGRN
Sbjct  295  GVSCPYICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGENGFYRICRGRN  354

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVDSMVSTVAAVNT
Sbjct  355  ICGVDSMVSTVAAVNT  370



>ref|XP_002313770.1| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE87725.1| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICS+RLDHGVLLVGYGSA YAP+R+KEKPYWIIKNSWGESWGE G+YKICRGRN
Sbjct  290  GVSCPYICSRRLDHGVLLVGYGSAAYAPVRMKEKPYWIIKNSWGESWGENGFYKICRGRN  349

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVDSMVSTVAAV T
Sbjct  350  ICGVDSMVSTVAAVQT  365



>gb|ABK92536.1| unknown [Populus trichocarpa]
Length=368

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICS+RLDHGVLLVGYGSA YAP+R+KEKPYWIIKNSWGESWGE G+YKICRGRN
Sbjct  290  GVSCPYICSRRLDHGVLLVGYGSAAYAPVRMKEKPYWIIKNSWGESWGENGFYKICRGRN  349

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVDSMVSTVAAV T
Sbjct  350  ICGVDSMVSTVAAVQT  365



>ref|XP_003606998.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89195.1| papain family cysteine protease [Medicago truncatula]
Length=362

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/78 (91%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGS  Y+PIRLKEKPYWIIKNSWGE+WGE GYYKICRGRN
Sbjct  285  GVSCPYICSKRLDHGVLLVGYGSGAYSPIRLKEKPYWIIKNSWGETWGENGYYKICRGRN  344

Query  181  ICGVDSMVSTVAAVNTPT  234
            ICGVDSMVSTVAAV+T T
Sbjct  345  ICGVDSMVSTVAAVHTTT  362



>ref|XP_009351218.1| PREDICTED: cysteine proteinase RD19a-like, partial [Pyrus x bretschneideri]
Length=282

 Score =   152 bits (383),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YKICRGRN
Sbjct  202  GVSCPYICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKICRGRN  261

Query  181  ICGVDSMVSTVAAVNTPTS  237
            ICGVDSMVSTVAA +  T+
Sbjct  262  ICGVDSMVSTVAAASVKTN  280



>ref|XP_009373025.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=371

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YKICRGRN
Sbjct  291  GVSCPYICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKICRGRN  350

Query  181  ICGVDSMVSTVAAVNTPTS  237
            ICGVDSMVSTVAA +  T+
Sbjct  351  ICGVDSMVSTVAAASVKTN  369



>ref|XP_009373000.1| PREDICTED: cysteine proteinase RD19a [Pyrus x bretschneideri]
Length=371

 Score =   154 bits (388),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YKICRGRN
Sbjct  291  GVSCPYICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKICRGRN  350

Query  181  ICGVDSMVSTVAAVNTPTS  237
            ICGVDSMVSTVAA +  T+
Sbjct  351  ICGVDSMVSTVAAASVKTN  369



>gb|KHN39817.1| Cysteine proteinase RD19a [Glycine soja]
Length=332

 Score =   152 bits (385),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICS+RLDHGVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYKICRGRN
Sbjct  254  GVSCPYICSRRLDHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKICRGRN  313

Query  181  ICGVDSMVSTVAAVNTPTS  237
            ICGVDSMVSTVAAV+T T 
Sbjct  314  ICGVDSMVSTVAAVHTTTQ  332



>ref|XP_007131787.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
 gb|ESW03781.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
Length=361

 Score =   153 bits (387),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 70/78 (90%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICS+RLDHGVLLVGYGS  YAPIR+KEKPYWIIKNSWGE+WGE GYYKICRGRN
Sbjct  283  GVSCPYICSRRLDHGVLLVGYGSGAYAPIRMKEKPYWIIKNSWGENWGENGYYKICRGRN  342

Query  181  ICGVDSMVSTVAAVNTPT  234
            ICGVDSMVSTVAAV+T T
Sbjct  343  ICGVDSMVSTVAAVHTTT  360



>ref|XP_008236965.1| PREDICTED: cysteine proteinase RD19a [Prunus mume]
Length=367

 Score =   153 bits (387),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYG+AGY+PIR+KEKPYWIIKNSWGE+WGEKG+YKIC+GRN
Sbjct  287  GVSCPYICSKRLDHGVLLVGYGAAGYSPIRMKEKPYWIIKNSWGENWGEKGFYKICKGRN  346

Query  181  ICGVDSMVSTVAAVNTPTS  237
            ICGVDSMVSTVAA +  T+
Sbjct  347  ICGVDSMVSTVAAASVETN  365



>ref|XP_006487337.1| PREDICTED: cysteine proteinase RD19a-like [Citrus sinensis]
Length=373

 Score =   153 bits (387),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/74 (95%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICS+RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE GYYKICRGRN
Sbjct  299  GVSCPYICSRRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGENGYYKICRGRN  358

Query  181  ICGVDSMVSTVAAV  222
            +CGVDSMVSTVAA 
Sbjct  359  VCGVDSMVSTVAAA  372



>gb|KDO49483.1| hypothetical protein CISIN_1g017318mg [Citrus sinensis]
Length=373

 Score =   153 bits (387),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/74 (95%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICS+RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE GYYKICRGRN
Sbjct  299  GVSCPYICSRRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGENGYYKICRGRN  358

Query  181  ICGVDSMVSTVAAV  222
            +CGVDSMVSTVAA 
Sbjct  359  VCGVDSMVSTVAAA  372



>ref|XP_008382317.1| PREDICTED: cysteine proteinase RD19a [Malus domestica]
Length=371

 Score =   153 bits (387),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YKICRGRN
Sbjct  291  GVSCPYICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKICRGRN  350

Query  181  ICGVDSMVSTVAAVNTPTS  237
            ICGVDSMVSTVAA +  T+
Sbjct  351  ICGVDSMVSTVAAASVKTN  369



>ref|XP_004290288.1| PREDICTED: probable cysteine proteinase A494 [Fragaria vesca 
subsp. vesca]
Length=372

 Score =   153 bits (387),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/75 (92%), Positives = 74/75 (99%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGSAGY+P+R+KEKPYWIIKNSWGE+WGEKG+YKICRGRN
Sbjct  297  GVSCPYICSKRLDHGVLLVGYGSAGYSPVRMKEKPYWIIKNSWGENWGEKGFYKICRGRN  356

Query  181  ICGVDSMVSTVAAVN  225
            ICGVDSMVSTVAAV 
Sbjct  357  ICGVDSMVSTVAAVE  371



>ref|XP_003539008.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=363

 Score =   153 bits (386),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICS+RLDHGVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYKICRGRN
Sbjct  285  GVSCPYICSRRLDHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKICRGRN  344

Query  181  ICGVDSMVSTVAAVNTPTS  237
            ICGVDSMVSTVAAV+T T 
Sbjct  345  ICGVDSMVSTVAAVHTTTQ  363



>ref|XP_007201310.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
 gb|EMJ02509.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
Length=367

 Score =   153 bits (386),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYG+AGY+PIR+KEKPYWIIKNSWGE+WGEKG+YKIC+GRN
Sbjct  287  GVSCPYICSKRLDHGVLLVGYGAAGYSPIRMKEKPYWIIKNSWGENWGEKGFYKICKGRN  346

Query  181  ICGVDSMVSTVAAVNTPTS  237
            ICGVDSMVSTVAA +  T+
Sbjct  347  ICGVDSMVSTVAAASVETN  365



>gb|ACI04578.1| cysteine protease-like protein [Robinia pseudoacacia]
Length=335

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC K LDHGVLLVGYG AGYAPIRLKEKPYWIIKNSWGESWGE GYYKICRGRN
Sbjct  257  GVSCPYICGKNLDHGVLLVGYGKAGYAPIRLKEKPYWIIKNSWGESWGENGYYKICRGRN  316

Query  181  ICGVDSMVSTVAAVNT  228
            +CGVDSMVSTVAAV+T
Sbjct  317  VCGVDSMVSTVAAVHT  332



>ref|XP_010271520.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=370

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/75 (93%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGS GYAPIRLK+KPYWIIKNSWGE WGE GYYKICRGRN
Sbjct  292  GVSCPYICSKRLDHGVLLVGYGSEGYAPIRLKDKPYWIIKNSWGEGWGENGYYKICRGRN  351

Query  181  ICGVDSMVSTVAAVN  225
            +CGVDSMVSTVAAVN
Sbjct  352  VCGVDSMVSTVAAVN  366



>ref|XP_004507484.1| PREDICTED: cysteine proteinase RD19a-like [Cicer arietinum]
Length=363

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICS+RLDHGVLLVGYGS  YAPIR+KEKPYWIIKNSWGE+WGE G+YKICRGRN
Sbjct  285  GVSCPYICSRRLDHGVLLVGYGSGAYAPIRMKEKPYWIIKNSWGENWGENGFYKICRGRN  344

Query  181  ICGVDSMVSTVAAVNTPTS  237
            ICGVDSMVSTVAAV+T T 
Sbjct  345  ICGVDSMVSTVAAVHTTTQ  363



>ref|XP_006423403.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
 gb|ESR36643.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
Length=375

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/74 (93%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICS+RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE GYYKICRGRN
Sbjct  299  GVSCPYICSRRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGENGYYKICRGRN  358

Query  181  ICGVDSMVSTVAAV  222
            +CGVDSMVST+AA 
Sbjct  359  VCGVDSMVSTIAAA  372



>ref|XP_011028940.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKR DHGVLLVGYGSAGYAPIR KEKP+WIIKNSWGE+WGE GYYKICRGRN
Sbjct  289  GVSCPYICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGENWGENGYYKICRGRN  348

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVDSMVSTVAA++T
Sbjct  349  ICGVDSMVSTVAAIHT  364



>ref|XP_010028631.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW55393.1| hypothetical protein EUGRSUZ_I01305 [Eucalyptus grandis]
Length=370

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 75/81 (93%), Gaps = 2/81 (2%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGSAGYAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRN
Sbjct  289  GVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKDKPYWIIKNSWGETWGENGYYKICRGRN  348

Query  181  ICGVDSMVSTVAAV--NTPTS  237
            ICGVDSMVSTVAA    TP S
Sbjct  349  ICGVDSMVSTVAAAVHTTPGS  369



>emb|CDQ51995.1| Cysteine proteinase, partial [Fagus sylvatica]
Length=165

 Score =   147 bits (371),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 66/75 (88%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC + LDHGVLLVG+GSAGYAPIRLKEKP+WIIKNSWGE+WGE GYYKICRGRN
Sbjct  90   GVSCPYICGRHLDHGVLLVGFGSAGYAPIRLKEKPFWIIKNSWGENWGENGYYKICRGRN  149

Query  181  ICGVDSMVSTVAAVN  225
            +CGVDSMVSTVAA+N
Sbjct  150  VCGVDSMVSTVAAIN  164



>ref|XP_011037175.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
 ref|XP_011037176.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
Length=368

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICS+RLDHGVLLVGYGSAGY+PIR+K+KPYWIIKNSWGE WGE G+YKICRGRN
Sbjct  290  GVSCPYICSRRLDHGVLLVGYGSAGYSPIRMKDKPYWIIKNSWGEKWGENGFYKICRGRN  349

Query  181  ICGVDSMVSTVAAVNTPTS  237
            +CGVDSMVSTVAAV T + 
Sbjct  350  VCGVDSMVSTVAAVQTTSQ  368



>ref|XP_011088458.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Sesamum indicum]
Length=379

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/76 (93%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCP ICSKRLDHGVLLVGYG AGYAPIR KEKPYWIIKNSWGE WGEKGYYKICRGRN
Sbjct  302  GVSCPLICSKRLDHGVLLVGYGEAGYAPIRRKEKPYWIIKNSWGEKWGEKGYYKICRGRN  361

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVDSMVSTVAAV+T
Sbjct  362  ICGVDSMVSTVAAVST  377



>gb|AAL69389.1|AF462226_1 putative cysteine proteinase [Narcissus pseudonarcissus]
Length=136

 Score =   145 bits (367),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC K LDHGVLLVGYGS+G+APIR KEKPYWIIKNSWGE+WGEKGYYKIC+GRN
Sbjct  57   GVSCPYICGKHLDHGVLLVGYGSSGWAPIRFKEKPYWIIKNSWGENWGEKGYYKICKGRN  116

Query  181  ICGVDSMVSTVAAVNTPTSD  240
            +CGVDSMVSTV A++T   D
Sbjct  117  VCGVDSMVSTVTAIHTTPKD  136



>gb|AJP16692.1| cysteine protease, partial [Striga hermonthica]
Length=148

 Score =   146 bits (368),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/73 (90%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYG +GYAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRN
Sbjct  76   GVSCPYICSKRLDHGVLLVGYGESGYAPIRMKDKPYWIIKNSWGENWGENGYYKICRGRN  135

Query  181  ICGVDSMVSTVAA  219
            +CGVDSMVSTVAA
Sbjct  136  VCGVDSMVSTVAA  148



>gb|AAR92156.1| putative cysteine protease 3 [Iris x hollandica]
Length=292

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC K LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGE+WGE GYYKICRGRN
Sbjct  212  GVSCPYICGKHLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGETWGENGYYKICRGRN  271

Query  181  ICGVDSMVSTVAAVNT  228
            +CGVDSMVSTV A++T
Sbjct  272  VCGVDSMVSTVTAIHT  287



>gb|ABK96580.1| unknown [Populus trichocarpa x Populus deltoides]
Length=367

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKR DHGVLLVGYGSAGYAPIR KEKP+WIIKNSWG++WGE GYYKICRGRN
Sbjct  289  GVSCPYICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGENGYYKICRGRN  348

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVDSMVSTVAA++T
Sbjct  349  ICGVDSMVSTVAAIHT  364



>ref|XP_010066197.1| PREDICTED: probable cysteine proteinase A494 [Eucalyptus grandis]
 gb|KCW64029.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
 gb|KCW64030.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
Length=376

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGSA Y+PIR+KEKPYWIIKNSWGE+WGE G+YKICRGRN
Sbjct  298  GVSCPYICSKRLDHGVLLVGYGSAAYSPIRMKEKPYWIIKNSWGENWGENGFYKICRGRN  357

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVDSMVSTVAA++T
Sbjct  358  ICGVDSMVSTVAAIHT  373



>ref|XP_002305451.2| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE85962.2| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICS+RLDHGVLLVGYGSAGY+P+R+KEKP+WIIKNSWGE WGE G+YKICRGRN
Sbjct  290  GVSCPYICSRRLDHGVLLVGYGSAGYSPVRMKEKPFWIIKNSWGEKWGENGFYKICRGRN  349

Query  181  ICGVDSMVSTVAAVNTPTS  237
            +CGVDSMVSTVAAV T + 
Sbjct  350  VCGVDSMVSTVAAVQTSSQ  368



>ref|XP_002302004.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
 gb|ABK94746.1| unknown [Populus trichocarpa]
 gb|EEE81277.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
Length=367

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKR DHGVLLVGYGSAGYAPIR KEKP+WIIKNSWG++WGE GYYKICRGRN
Sbjct  289  GVSCPYICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGENGYYKICRGRN  348

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVDSMVSTVAA++T
Sbjct  349  ICGVDSMVSTVAAIHT  364



>gb|ABK94801.1| unknown [Populus trichocarpa]
Length=367

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKR DHGVLLVGYGSAGYAPIR KEKP+WIIKNSWG++WGE GYYKICRGRN
Sbjct  289  GVSCPYICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGENGYYKICRGRN  348

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVDSMVSTVAA++T
Sbjct  349  ICGVDSMVSTVAAIHT  364



>ref|XP_009406357.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=372

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC + LDHGVLLVGYGSAGY+PIRLK+KP+WIIKNSWGE+WGEKGYYKICRGRN
Sbjct  293  GVSCPYICGRHLDHGVLLVGYGSAGYSPIRLKQKPFWIIKNSWGETWGEKGYYKICRGRN  352

Query  181  ICGVDSMVSTVAAVNT  228
            +CGVDSMVSTV A+NT
Sbjct  353  VCGVDSMVSTVTAINT  368



>ref|XP_011092831.1| PREDICTED: cysteine proteinase RD19a-like [Sesamum indicum]
Length=378

 Score =   151 bits (382),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCP+ICSKRLDHGVLLVGYG+A YAPIRLKEKPYWIIKNSWGE+WGE GYYKICRG N
Sbjct  301  GVSCPFICSKRLDHGVLLVGYGAASYAPIRLKEKPYWIIKNSWGENWGENGYYKICRGHN  360

Query  181  ICGVDSMVSTVAAVNT  228
            +CGVDSMVSTVAAV+T
Sbjct  361  VCGVDSMVSTVAAVST  376



>ref|XP_009376976.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=445

 Score =   152 bits (384),  Expect = 6e-41, Method: Composition-based stats.
 Identities = 67/79 (85%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVS PYICS+RLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGESW E G+YKICRGRN
Sbjct  365  GVSYPYICSRRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGESWRESGFYKICRGRN  424

Query  181  ICGVDSMVSTVAAVNTPTS  237
            ICGVDSMVSTVAA +  T+
Sbjct  425  ICGVDSMVSTVAAASVKTN  443



>ref|XP_009376977.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=447

 Score =   152 bits (383),  Expect = 8e-41, Method: Composition-based stats.
 Identities = 67/79 (85%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVS PYICS+RLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGESW E G+YKICRGRN
Sbjct  367  GVSYPYICSRRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGESWRESGFYKICRGRN  426

Query  181  ICGVDSMVSTVAAVNTPTS  237
            ICGVDSMVSTVAA +  T+
Sbjct  427  ICGVDSMVSTVAAASVKTN  445



>ref|XP_002280798.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CAN73591.1| hypothetical protein VITISV_022889 [Vitis vinifera]
 emb|CBI19785.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   150 bits (380),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICS  LDHGVLLVGYGSAGY+PIR KEKPYWIIKNSWGESWGE+GYYKICRG N
Sbjct  293  GVSCPYICSSTLDHGVLLVGYGSAGYSPIRFKEKPYWIIKNSWGESWGEQGYYKICRGHN  352

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVDSMVSTVAA++T
Sbjct  353  ICGVDSMVSTVAAIHT  368



>gb|ABK93575.1| unknown [Populus trichocarpa]
Length=157

 Score =   144 bits (364),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSK  DHGVLLVGYG+AGYAPIR KEKP+WIIKNSWGE+WGE GYYKICR RN
Sbjct  79   GVSCPYICSKHQDHGVLLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGENGYYKICRARN  138

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVDSMVSTVAA++ 
Sbjct  139  ICGVDSMVSTVAAIHA  154



>ref|XP_004150061.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004166953.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN61836.1| Cysteine protease [Cucumis sativus]
Length=377

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSK LDHGVLLVGYGS GYAPIRLK+KPYWIIKNSWG +WGE GYYKICRGRN
Sbjct  299  GVSCPYICSKHLDHGVLLVGYGSDGYAPIRLKDKPYWIIKNSWGANWGENGYYKICRGRN  358

Query  181  ICGVDSMVSTVAAVNTPTS  237
            ICGVDSMVSTVAAV+T  +
Sbjct  359  ICGVDSMVSTVAAVHTAAN  377



>gb|AAU81591.1| cysteine proteinase, partial [Petunia x hybrida]
Length=190

 Score =   145 bits (366),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 73/78 (94%), Gaps = 1/78 (1%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKR DHGVLLVGYGS G+APIR+KEKPYWIIKNSWGE WGE GYYKICRGRN
Sbjct  114  GVSCPYICSKRQDHGVLLVGYGS-GFAPIRMKEKPYWIIKNSWGEKWGESGYYKICRGRN  172

Query  181  ICGVDSMVSTVAAVNTPT  234
            +CGVDSMVSTVAAV+T +
Sbjct  173  VCGVDSMVSTVAAVSTSS  190



>gb|EYU37835.1| hypothetical protein MIMGU_mgv1a008237mg [Erythranthe guttata]
Length=380

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC+KRLDHGVLLVGYG  GY+PIR+KEKPYWIIKNSWG +WGE GYYKICRGRN
Sbjct  302  GVSCPYICTKRLDHGVLLVGYGETGYSPIRMKEKPYWIIKNSWGPNWGEDGYYKICRGRN  361

Query  181  ICGVDSMVSTVAAVNTPT  234
            ICGVDSMVSTVAAV+T +
Sbjct  362  ICGVDSMVSTVAAVSTTS  379



>ref|XP_002275759.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI17456.3| unnamed protein product [Vitis vinifera]
Length=367

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICS+ LDHGV+LVGYGSAGYAPIR KEKPYWIIKNSWGESWGE GYYKICRG N
Sbjct  289  GVSCPYICSRNLDHGVVLVGYGSAGYAPIRFKEKPYWIIKNSWGESWGEDGYYKICRGHN  348

Query  181  ICGVDSMVSTVAAVNTPTS  237
             CGVDSMVSTVAA+ T T 
Sbjct  349  ACGVDSMVSTVAAIQTTTQ  367



>ref|XP_010061009.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW67908.1| hypothetical protein EUGRSUZ_F01612 [Eucalyptus grandis]
Length=369

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC K LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYKICRGR+
Sbjct  291  GVSCPYICGKHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGRD  350

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVDSMVSTVAA++T
Sbjct  351  ICGVDSMVSTVAAIHT  366



>dbj|BAD94010.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
Length=86

 Score =   141 bits (356),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC++RL+HGVLLVGYG+AGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRN
Sbjct  7    GVSCPYICTRRLNHGVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRN  66

Query  181  ICGVDSMVSTVAAVNTPTSD  240
            ICGVDSMVSTVAA  + T+ 
Sbjct  67   ICGVDSMVSTVAATVSTTAH  86



>ref|XP_002510469.1| cysteine protease, putative [Ricinus communis]
 gb|EEF52656.1| cysteine protease, putative [Ricinus communis]
Length=366

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKR DHGV+LVGYGSAGYAP+RLK+KP+WIIKNSWGE+WGE GYYKICRGRN
Sbjct  288  GVSCPYICSKRQDHGVVLVGYGSAGYAPVRLKDKPFWIIKNSWGENWGENGYYKICRGRN  347

Query  181  ICGVDSMVSTVAAVNT  228
            +CGVD+MVSTVAA++T
Sbjct  348  VCGVDAMVSTVAAIHT  363



>gb|KGN43159.1| Papain-like cysteine proteinase isoform I [Cucumis sativus]
Length=387

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/75 (89%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCP+ICSKRLDHGVLLVGYGSAGYAPIR+++K YWIIKNSWGESWGE GYYKICRGRN
Sbjct  299  GVSCPFICSKRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGENGYYKICRGRN  358

Query  181  ICGVDSMVSTVAAVN  225
            ICGVDS+VSTVAAV+
Sbjct  359  ICGVDSLVSTVAAVH  373



>ref|XP_004148554.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Cucumis sativus]
Length=381

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/75 (89%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCP+ICSKRLDHGVLLVGYGSAGYAPIR+++K YWIIKNSWGESWGE GYYKICRGRN
Sbjct  293  GVSCPFICSKRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGENGYYKICRGRN  352

Query  181  ICGVDSMVSTVAAVN  225
            ICGVDS+VSTVAAV+
Sbjct  353  ICGVDSLVSTVAAVH  367



>ref|XP_003540987.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=365

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPY+CS+RL+HGVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYKICRGRN
Sbjct  287  GVSCPYVCSRRLNHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKICRGRN  346

Query  181  ICGVDSMVSTVAAVNTPTS  237
            ICGVDSMVSTVA+V+T T 
Sbjct  347  ICGVDSMVSTVASVHTTTQ  365



>ref|XP_004165230.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
Length=387

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/75 (89%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCP+ICSKRLDHGVLLVGYGSAGYAPIR+++K YWIIKNSWGESWGE GYYKICRGRN
Sbjct  299  GVSCPFICSKRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGENGYYKICRGRN  358

Query  181  ICGVDSMVSTVAAVN  225
            ICGVDS+VSTVAAV+
Sbjct  359  ICGVDSLVSTVAAVH  373



>ref|XP_008460996.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=377

 Score =   149 bits (375),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICS+ LDHGVLLVGYGS GYAPIR+K+KPYWIIKNSWG +WGE GYYKICRGRN
Sbjct  299  GVSCPYICSRHLDHGVLLVGYGSEGYAPIRMKDKPYWIIKNSWGANWGENGYYKICRGRN  358

Query  181  ICGVDSMVSTVAAVNTPTS  237
            ICGVDSMVSTVAAV+T  +
Sbjct  359  ICGVDSMVSTVAAVHTAAN  377



>ref|XP_010268619.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=369

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICS+RL+HGVLLVGYGS GY+PIR+K+KPYWIIKNSWGESWGE GYYKICRGR+
Sbjct  291  GVSCPYICSRRLNHGVLLVGYGSEGYSPIRMKDKPYWIIKNSWGESWGENGYYKICRGRD  350

Query  181  ICGVDSMVSTVAAVNT  228
            +CGVDSMVSTVAA++T
Sbjct  351  VCGVDSMVSTVAAIHT  366



>gb|AAU81589.1| cysteine proteinase [Petunia x hybrida]
Length=257

 Score =   145 bits (367),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCP IC KR DHGVLLVGYGSAG+APIRLKEKPYWIIKNSWGESWGE+GYYKICRGRN
Sbjct  177  GVSCPLICFKRQDHGVLLVGYGSAGFAPIRLKEKPYWIIKNSWGESWGEQGYYKICRGRN  236

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVD+MVSTV A +T
Sbjct  237  ICGVDAMVSTVTAAHT  252



>dbj|BAJ53178.1| JHL18I08.12 [Jatropha curcas]
 gb|KDP38578.1| hypothetical protein JCGZ_04503 [Jatropha curcas]
Length=368

 Score =   148 bits (374),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 66/75 (88%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKR DHGVLLVGYGSAGYAPIRLK+KP+WIIKNSWGESWGE GYY+ICRGRN
Sbjct  289  GVSCPYICSKRQDHGVLLVGYGSAGYAPIRLKDKPFWIIKNSWGESWGENGYYRICRGRN  348

Query  181  ICGVDSMVSTVAAVN  225
            ICGVD+MVS+VAA++
Sbjct  349  ICGVDAMVSSVAAIH  363



>ref|XP_007017672.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOY14897.1| Papain family cysteine protease [Theobroma cacao]
Length=401

 Score =   149 bits (375),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE+GYYKICRGRN
Sbjct  323  GVSCPYICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEEGYYKICRGRN  382

Query  181  ICGVDSMVSTVAAVNTPTS  237
            +CGVDSMVS+VAA+ T + 
Sbjct  383  VCGVDSMVSSVAALQTKSQ  401



>ref|XP_003523684.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=366

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/75 (88%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC K LDHGVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYYKICRGRN
Sbjct  288  GVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYKICRGRN  347

Query  181  ICGVDSMVSTVAAVN  225
            +CGVDSMVSTVAA++
Sbjct  348  VCGVDSMVSTVAAIH  362



>gb|ABF46642.1| papain-like cysteine proteinase [Pachysandra terminalis]
Length=374

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/79 (90%), Positives = 73/79 (92%), Gaps = 2/79 (3%)
 Frame = +1

Query  1    GVSCPYICSKRL-DHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  177
            GVSCPYICSKRL DHGVLLVGYGSAG+APIR KEKPYWIIKNSWGESWGEKGYYKICRGR
Sbjct  295  GVSCPYICSKRLLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGESWGEKGYYKICRGR  354

Query  178  NICGVDSMVSTVAAVNTPT  234
            NICG+DSMVS VAA   PT
Sbjct  355  NICGMDSMVSAVAAA-VPT  372



>ref|NP_001241450.1| uncharacterized protein LOC100778716 precursor [Glycine max]
 gb|ACU20049.1| unknown [Glycine max]
Length=366

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/75 (88%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC K LDHGVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYYKICRGRN
Sbjct  288  GVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYKICRGRN  347

Query  181  ICGVDSMVSTVAAVN  225
            +CGVDSMVSTVAA++
Sbjct  348  VCGVDSMVSTVAAIH  362



>gb|KHN45894.1| Cysteine proteinase RD19a [Glycine soja]
Length=366

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/75 (88%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC K LDHGVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYYKICRGRN
Sbjct  288  GVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYKICRGRN  347

Query  181  ICGVDSMVSTVAAVN  225
            +CGVDSMVSTVAA++
Sbjct  348  VCGVDSMVSTVAAIH  362



>ref|XP_010530325.1| PREDICTED: cysteine proteinase RD19a [Tarenaya hassleriana]
Length=370

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKR DHGVLLVGYGSAGY+PIRLKEKPYWIIKNSWG +WGE+GYYKIC GRN
Sbjct  292  GVSCPYICSKRQDHGVLLVGYGSAGYSPIRLKEKPYWIIKNSWGANWGEEGYYKICHGRN  351

Query  181  ICGVDSMVSTVAAVNTPTS  237
            +CG+D+MVS+VAAV+T T 
Sbjct  352  LCGMDTMVSSVAAVHTSTQ  370



>dbj|BAC41322.1| hypothetical protein [Lotus japonicus]
Length=358

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRN
Sbjct  282  GVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICRGRN  341

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVDSMVSTVAA++T
Sbjct  342  ICGVDSMVSTVAALHT  357



>ref|XP_010531457.1| PREDICTED: probable cysteine proteinase A494 [Tarenaya hassleriana]
Length=364

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/73 (89%), Positives = 72/73 (99%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICS+RL+HGVLLVGYGSAGYAP R+KEKP+WIIKNSWGE+WGEKG+YKICRGRN
Sbjct  288  GVSCPYICSRRLNHGVLLVGYGSAGYAPARMKEKPFWIIKNSWGENWGEKGFYKICRGRN  347

Query  181  ICGVDSMVSTVAA  219
            ICGVDS+VSTVAA
Sbjct  348  ICGVDSLVSTVAA  360



>gb|KHN25410.1| Cysteine proteinase RD19a [Glycine soja]
Length=365

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPY+CS+RL+HGVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYKICRGR+
Sbjct  287  GVSCPYVCSRRLNHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKICRGRS  346

Query  181  ICGVDSMVSTVAAVNTPTS  237
            ICGVDSMVSTVA+V+T T 
Sbjct  347  ICGVDSMVSTVASVHTTTQ  365



>ref|XP_010910124.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=374

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC K LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYKIC+GRN
Sbjct  298  GVSCPYICGKHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEDGYYKICKGRN  357

Query  181  ICGVDSMVSTVAAVNT  228
            +CGVDSMVSTV AV +
Sbjct  358  VCGVDSMVSTVTAVRS  373



>ref|XP_009392632.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=369

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC + LDHGVLLVGYGSAGY+PIRLK+KP+WIIKNSWGE+WGE GYYKICRGRN
Sbjct  290  GVSCPYICGRHLDHGVLLVGYGSAGYSPIRLKDKPFWIIKNSWGENWGEHGYYKICRGRN  349

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVDSMVS+V+A++T
Sbjct  350  ICGVDSMVSSVSAIHT  365



>ref|XP_008775532.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=371

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC + LDHGVLLVGYGSA YAPIR KEKPYWIIKNSWGE WGE GYYKICRGRN
Sbjct  295  GVSCPYICGRHLDHGVLLVGYGSAAYAPIRFKEKPYWIIKNSWGEKWGENGYYKICRGRN  354

Query  181  ICGVDSMVSTVAAVNT  228
            +CGVDSMVSTVAAV +
Sbjct  355  VCGVDSMVSTVAAVRS  370



>ref|XP_009602233.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana tomentosiformis]
Length=369

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 74/78 (95%), Gaps = 1/78 (1%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKICRGRN
Sbjct  292  GVSCPYICSKRLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGENGYYKICRGRN  350

Query  181  ICGVDSMVSTVAAVNTPT  234
            +CGVDSMVSTVAAV+T +
Sbjct  351  VCGVDSMVSTVAAVSTSS  368



>gb|AAL05851.1|AF411121_1 cysteine proteinase precursor [Sandersonia aurantiaca]
Length=360

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC K LDHGVLLVGYGSAG+APIR KEKPYWIIKNSWGE+WGE GYYKICRGRN
Sbjct  283  GVSCPYICGKHLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGENWGENGYYKICRGRN  342

Query  181  ICGVDSMVSTVAAVNT  228
            +CGVDSMVS+V+A +T
Sbjct  343  VCGVDSMVSSVSAFHT  358



>emb|CAE45588.1| papain-like cysteine proteinase-like protein 1 [Lotus japonicus]
Length=359

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRN
Sbjct  283  GVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICRGRN  342

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVDSMVSTVAA++T
Sbjct  343  ICGVDSMVSTVAALHT  358



>gb|EYU42593.1| hypothetical protein MIMGU_mgv1a008336mg [Erythranthe guttata]
Length=377

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCP+IC+KRLDHGVLLVGYG+  +APIR+KEKPYWIIKNSWG +WGEKGYYKIC+GRN
Sbjct  301  GVSCPFICAKRLDHGVLLVGYGAGAFAPIRMKEKPYWIIKNSWGPNWGEKGYYKICQGRN  360

Query  181  ICGVDSMVSTVAAVNT  228
            +CGVDSMVSTVAAV T
Sbjct  361  LCGVDSMVSTVAAVTT  376



>ref|XP_011045161.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSK  DHGVLLVGYG+AGYAPIR KEKP+WIIKNSWGE+WGE GYYKICR RN
Sbjct  289  GVSCPYICSKHQDHGVLLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGENGYYKICRARN  348

Query  181  ICGVDSMVSTVAAVN  225
            ICGVDSMVSTVAA++
Sbjct  349  ICGVDSMVSTVAAIH  363



>gb|KHN12668.1| Cysteine proteinase 15A [Glycine soja]
Length=156

 Score =   140 bits (354),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC K LDHGVLLVGYG   YAPIR K KPYWIIKNSWGESWGE GYYKICRGRN
Sbjct  78   GVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYYKICRGRN  137

Query  181  ICGVDSMVSTVAAV  222
            +CGVDSMVSTVAA+
Sbjct  138  VCGVDSMVSTVAAI  151



>dbj|BAF98584.1| CM0216.500.nc [Lotus japonicus]
Length=360

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRN
Sbjct  282  GVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICRGRN  341

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVDSMVSTVAA++T
Sbjct  342  ICGVDSMVSTVAALHT  357



>ref|XP_002306900.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
 gb|ABK92924.1| unknown [Populus trichocarpa]
 gb|EEE93896.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
Length=367

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSK  DHGVLLVGYG+AGYAPIR KEKP+WIIKNSWGE+WGE GYYKICR RN
Sbjct  289  GVSCPYICSKHQDHGVLLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGENGYYKICRARN  348

Query  181  ICGVDSMVSTVAAVN  225
            ICGVDSMVSTVAA++
Sbjct  349  ICGVDSMVSTVAAIH  363



>ref|XP_008448073.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=385

 Score =   146 bits (369),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCP+ICS RLDHGVLLVGYGSAGYAPIR+++K YWIIKNSWGE+WGE GYYKICRGRN
Sbjct  297  GVSCPFICSNRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGENWGENGYYKICRGRN  356

Query  181  ICGVDSMVSTVAAVN  225
            ICGVDS+VSTVAAV+
Sbjct  357  ICGVDSLVSTVAAVH  371



>ref|XP_009109502.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
 emb|CDX90310.1| BnaA08g16740D [Brassica napus]
Length=369

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKICRGRN
Sbjct  290  GVSCPYICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICRGRN  349

Query  181  ICGVDSMVSTVAAVNTPTS  237
            +CGVDS+VSTV A  +PT+
Sbjct  350  VCGVDSLVSTVTAAVSPTA  368



>gb|AAB62937.1| stress-induced cysteine proteinase [Lavatera thuringiaca]
Length=175

 Score =   141 bits (355),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC + LDHGVLLVGYG+AGYAP+R KEKP+WIIKNSWG +WGE GYYKICRGRN
Sbjct  97   GVSCPYICFRSLDHGVLLVGYGAAGYAPVRFKEKPFWIIKNSWGANWGEDGYYKICRGRN  156

Query  181  ICGVDSMVSTVAAVNTPTS  237
            +CGVDSMVS+VAA+ T + 
Sbjct  157  VCGVDSMVSSVAALQTKSQ  175



>ref|XP_006362019.1| PREDICTED: cysteine proteinase RD19a-like [Solanum tuberosum]
Length=368

 Score =   145 bits (367),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 74/78 (95%), Gaps = 1/78 (1%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSK+LDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKICRGRN
Sbjct  292  GVSCPYICSKQLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGENGYYKICRGRN  350

Query  181  ICGVDSMVSTVAAVNTPT  234
            +CGVDSMVSTVAAV+T +
Sbjct  351  VCGVDSMVSTVAAVSTSS  368



>emb|CAE45589.1| papain-like cysteine proteinase-like protein 2 [Lotus japonicus]
Length=361

 Score =   145 bits (367),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRN
Sbjct  283  GVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICRGRN  342

Query  181  ICGVDSMVSTVAAVNT  228
            +CGVDSMVSTVAA++T
Sbjct  343  VCGVDSMVSTVAALHT  358



>gb|KJB07487.1| hypothetical protein B456_001G026600 [Gossypium raimondii]
Length=377

 Score =   145 bits (367),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCP+ICSK LDHGVLLVGYGSAGY+PI LK+KPYWIIKNSWGE+WGE GYYKICRG N
Sbjct  299  GVSCPFICSKHLDHGVLLVGYGSAGYSPIHLKDKPYWIIKNSWGENWGENGYYKICRGSN  358

Query  181  ICGVDSMVSTVAAVNTPTS  237
            +CGVDS+VSTV A+NT + 
Sbjct  359  VCGVDSLVSTVVALNTKSQ  377



>gb|KHN22211.1| Cysteine proteinase 15A [Glycine soja]
Length=366

 Score =   145 bits (367),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC K LDHGVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYY ICRGRN
Sbjct  288  GVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYNICRGRN  347

Query  181  ICGVDSMVSTVAAVN  225
            +CGVDSMVSTVAA++
Sbjct  348  VCGVDSMVSTVAAIH  362



>ref|XP_004230928.1| PREDICTED: cysteine proteinase RD19a [Solanum lycopersicum]
Length=369

 Score =   145 bits (367),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 74/78 (95%), Gaps = 1/78 (1%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSK+LDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKICRGRN
Sbjct  292  GVSCPYICSKQLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGESGYYKICRGRN  350

Query  181  ICGVDSMVSTVAAVNTPT  234
            +CGVDSMVSTVAAV+T +
Sbjct  351  VCGVDSMVSTVAAVSTSS  368



>emb|CAB53397.1| cysteine protease [Medicago sativa]
Length=209

 Score =   141 bits (356),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 73/77 (95%), Gaps = 1/77 (1%)
 Frame = +1

Query  1    GVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  177
            GVSCP+IC+K RLDHGVLLVG+GS GYAPIRLKEKPYWIIKNSWG++WGE+GYYKICRGR
Sbjct  133  GVSCPHICAKARLDHGVLLVGFGSGGYAPIRLKEKPYWIIKNSWGQNWGEEGYYKICRGR  192

Query  178  NICGVDSMVSTVAAVNT  228
            N+CGVDSMVSTVAA  +
Sbjct  193  NVCGVDSMVSTVAAAQS  209



>dbj|BAF98585.1| CM0216.510.nc [Lotus japonicus]
Length=360

 Score =   145 bits (366),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRN
Sbjct  282  GVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICRGRN  341

Query  181  ICGVDSMVSTVAAVNT  228
            +CGVDSMVSTVAA++T
Sbjct  342  VCGVDSMVSTVAALHT  357



>ref|XP_004291404.1| PREDICTED: cysteine proteinase 15A-like [Fragaria vesca subsp. 
vesca]
Length=365

 Score =   145 bits (366),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 73/77 (95%), Gaps = 1/77 (1%)
 Frame = +1

Query  1    GVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  177
            GVSCPYIC K  LDHGVLLVGYGS+GYAPIR KEKPYWIIKNSWG+SWGE+GYYKICRGR
Sbjct  289  GVSCPYICGKNHLDHGVLLVGYGSSGYAPIRFKEKPYWIIKNSWGQSWGEEGYYKICRGR  348

Query  178  NICGVDSMVSTVAAVNT  228
            N+CGVDSMVSTVAA++T
Sbjct  349  NVCGVDSMVSTVAAMHT  365



>gb|AGV54334.1| cysteine proteinase RD19a-like protein [Phaseolus vulgaris]
Length=366

 Score =   145 bits (366),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC K LDHGVLLVGYG+  YAPIR KEKP+WIIKNSWGESWGE GYYKICRG N
Sbjct  288  GVSCPYICGKHLDHGVLLVGYGAGAYAPIRFKEKPFWIIKNSWGESWGENGYYKICRGHN  347

Query  181  ICGVDSMVSTVAAVNTPT  234
            +CGVDSMVSTVAA++T +
Sbjct  348  VCGVDSMVSTVAAIHTSS  365



>gb|AAM65162.1| cysteine proteinase RD19A [Arabidopsis thaliana]
Length=368

 Score =   145 bits (366),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC++RL+HGVLLVGYG+AGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRN
Sbjct  289  GVSCPYICTRRLNHGVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRN  348

Query  181  ICGVDSMVSTVAAVNTPTS  237
            ICGVDSMVSTVAA  + T+
Sbjct  349  ICGVDSMVSTVAATVSTTA  367



>ref|NP_568052.1| cysteine proteinase RD19a [Arabidopsis thaliana]
 sp|P43296.1|RD19A_ARATH RecName: Full=Cysteine proteinase RD19a; Short=RD19; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA02373.1| thiol protease [Arabidopsis thaliana]
 emb|CAB38829.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 emb|CAB80572.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AAL85009.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 gb|AAM91778.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 dbj|BAE98545.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AEE87016.1| cysteine proteinase RD19a [Arabidopsis thaliana]
Length=368

 Score =   145 bits (366),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC++RL+HGVLLVGYG+AGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRN
Sbjct  289  GVSCPYICTRRLNHGVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRN  348

Query  181  ICGVDSMVSTVAAVNTPTS  237
            ICGVDSMVSTVAA  + T+
Sbjct  349  ICGVDSMVSTVAATVSTTA  367



>ref|XP_010105270.1| Cysteine proteinase 15A [Morus notabilis]
 gb|EXC04205.1| Cysteine proteinase 15A [Morus notabilis]
Length=372

 Score =   145 bits (366),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 73/76 (96%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    GVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  177
            GVSCPYICSK  LDHGVLLVGYG+AGYAPIR K+KPYWIIKNSWGE+WGE+GYYKICRGR
Sbjct  288  GVSCPYICSKHMLDHGVLLVGYGTAGYAPIRFKDKPYWIIKNSWGENWGEQGYYKICRGR  347

Query  178  NICGVDSMVSTVAAVN  225
            N+CGVDSMVSTVAA++
Sbjct  348  NVCGVDSMVSTVAALH  363



>ref|XP_007136047.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
 gb|ESW08041.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
Length=366

 Score =   145 bits (366),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC K LDHGVLLVGYG+  YAPIR KEKP+WIIKNSWGESWGE GYYKICRG N
Sbjct  288  GVSCPYICGKHLDHGVLLVGYGAGAYAPIRFKEKPFWIIKNSWGESWGENGYYKICRGHN  347

Query  181  ICGVDSMVSTVAAVNTPT  234
            +CGVDSMVSTVAA++T +
Sbjct  348  VCGVDSMVSTVAAIHTSS  365



>ref|XP_006473584.1| PREDICTED: cysteine proteinase 15A-like [Citrus sinensis]
Length=369

 Score =   145 bits (366),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC K LDHGVL+VGYGS+G+APIR KEKPYWIIKNSWGE+WGE GYYKIC GRN
Sbjct  291  GVSCPYICGKYLDHGVLIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGENGYYKICMGRN  350

Query  181  ICGVDSMVSTVAAVNTPTS  237
            +CGVDSMVS+VAAV+T +S
Sbjct  351  VCGVDSMVSSVAAVHTTSS  369



>gb|AIB06025.1| CP3 [Hevea brasiliensis]
Length=366

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSK  DHGVLLVGYG+AGYAPIR K+KP+WIIKNSWGE+WGE GYYKICRGRN
Sbjct  288  GVSCPYICSKSQDHGVLLVGYGAAGYAPIRFKDKPFWIIKNSWGENWGENGYYKICRGRN  347

Query  181  ICGVDSMVSTVAAVNT  228
            ICG+D+MVS+VAA++T
Sbjct  348  ICGMDAMVSSVAAIHT  363



>gb|KDO84720.1| hypothetical protein CISIN_1g017548mg [Citrus sinensis]
Length=369

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC K LDHGVL+VGYGS+G+APIR KEKPYWIIKNSWGE+WGE GYYKIC GRN
Sbjct  291  GVSCPYICGKYLDHGVLIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGENGYYKICMGRN  350

Query  181  ICGVDSMVSTVAAVNTPTS  237
            +CGVDSMVS+VAA++T +S
Sbjct  351  VCGVDSMVSSVAAIHTTSS  369



>ref|XP_006435090.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
 gb|ESR48330.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
Length=369

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC K LDHGVL+VGYGS+G+APIR KEKPYWIIKNSWGE+WGE GYYKIC GRN
Sbjct  291  GVSCPYICGKYLDHGVLIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGENGYYKICMGRN  350

Query  181  ICGVDSMVSTVAAVNTPTS  237
            +CGVDSMVS+VAA++T +S
Sbjct  351  VCGVDSMVSSVAAIHTTSS  369



>ref|XP_006828787.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
 gb|ERM96203.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
Length=365

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 73/77 (95%), Gaps = 1/77 (1%)
 Frame = +1

Query  1    GVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  177
            GVSCPYICSKR LDHGVL+VGYGSAGYAPIRLK+K YWIIKNSWGE+WGEKGYYKICRG 
Sbjct  289  GVSCPYICSKRNLDHGVLIVGYGSAGYAPIRLKDKAYWIIKNSWGETWGEKGYYKICRGH  348

Query  178  NICGVDSMVSTVAAVNT  228
            NICGVDSMVSTVA++ +
Sbjct  349  NICGVDSMVSTVASIQS  365



>emb|CDY71205.1| BnaCnng71840D [Brassica napus]
Length=368

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKICRGRN
Sbjct  289  GVSCPYICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEDGFYKICRGRN  348

Query  181  ICGVDSMVSTVAAVNTPTS  237
            +CGVDS+VSTV A  +P +
Sbjct  349  VCGVDSLVSTVTATVSPAA  367



>gb|AAL60581.1|AF454959_1 senescence-associated cysteine protease [Brassica oleracea]
Length=368

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKICRGRN
Sbjct  289  GVSCPYICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEDGFYKICRGRN  348

Query  181  ICGVDSMVSTVAAVNTPTS  237
            +CGVDS+VSTV A  +P +
Sbjct  349  VCGVDSLVSTVTATVSPAA  367



>ref|XP_006411706.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
 dbj|BAJ33785.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53159.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
Length=373

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGESWGE G+YKIC+GRN
Sbjct  294  GVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGESWGENGFYKICKGRN  353

Query  181  ICGVDSMVSTVAAVNTPTS  237
            ICGVDS+VSTV+A  + T+
Sbjct  354  ICGVDSLVSTVSATVSTTA  372



>gb|KFK30492.1| hypothetical protein AALP_AA7G268600 [Arabis alpina]
Length=367

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRN
Sbjct  288  GVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRN  347

Query  181  ICGVDSMVSTVAAVNTPTS  237
            ICGVDS+VSTVAA  + T+
Sbjct  348  ICGVDSLVSTVAATVSTTA  366



>ref|XP_009146338.1| PREDICTED: cysteine proteinase 15A-like [Brassica rapa]
 emb|CDY32227.1| BnaA01g17570D [Brassica napus]
Length=368

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 73/80 (91%), Gaps = 1/80 (1%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR-  177
            GVSCPYICSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG +WGE GYYKICRGR 
Sbjct  289  GVSCPYICSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGSTWGEDGYYKICRGRH  348

Query  178  NICGVDSMVSTVAAVNTPTS  237
            NICG+D+MVSTVAAV+T T 
Sbjct  349  NICGMDTMVSTVAAVHTSTQ  368



>ref|XP_008387995.1| PREDICTED: cysteine proteinase 15A [Malus domestica]
Length=365

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC KR+DHGVLLVGYGS+G+APIRLKEKPYWI+KNSWG+SWGE+GYYKICRG N
Sbjct  287  GVSCPYICGKRIDHGVLLVGYGSSGFAPIRLKEKPYWILKNSWGQSWGEQGYYKICRGYN  346

Query  181  ICGVDSMVSTVAAVNT  228
             CGVDS+VSTVAA++T
Sbjct  347  SCGVDSLVSTVAALHT  362



>ref|XP_007160702.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
 gb|ESW32696.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
Length=365

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC K LDHGVLLVGYG   YAPIR KEKPYWIIKNSWGE+WGE GYYKICRGRN
Sbjct  287  GVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGRN  346

Query  181  ICGVDSMVSTVAAVNTPTS  237
            +CGVDSMVSTV A++  T 
Sbjct  347  VCGVDSMVSTVGAIHASTQ  365



>emb|CDY34441.1| BnaC01g21920D [Brassica napus]
Length=368

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 73/79 (92%), Gaps = 1/79 (1%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR-  177
            GVSCPYICSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG +WGE GYYKICRGR 
Sbjct  289  GVSCPYICSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGSTWGEDGYYKICRGRH  348

Query  178  NICGVDSMVSTVAAVNTPT  234
            NICG+D+MVSTVAAV+T T
Sbjct  349  NICGMDTMVSTVAAVHTST  367



>ref|XP_006283963.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
 gb|EOA16861.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
Length=368

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRN
Sbjct  289  GVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRN  348

Query  181  ICGVDSMVSTVAAVNTPTS  237
            ICGVDS+VSTV+A  + T+
Sbjct  349  ICGVDSLVSTVSATVSTTA  367



>dbj|BAF03553.1| cysteine proteinase CP2 [Phaseolus vulgaris]
Length=365

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC K LDHGVLLVGYG   YAPIR KEKPYWIIKNSWGE+WGE GYYKICRGRN
Sbjct  287  GVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGRN  346

Query  181  ICGVDSMVSTVAAVNTPTS  237
            +CGVDSMVSTV A++  T 
Sbjct  347  VCGVDSMVSTVGAIHASTQ  365



>gb|AAD29084.1|AF082181_1 cysteine proteinase precursor [Solanum melongena]
Length=363

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCP IC KR DHGVLLVGYGSAG+APIRLKEKPYWIIKNSWGE+WGE GYYKICRG N
Sbjct  283  GVSCPLICFKRQDHGVLLVGYGSAGFAPIRLKEKPYWIIKNSWGENWGEHGYYKICRGHN  342

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVD+MVSTV A +T
Sbjct  343  ICGVDAMVSTVTATHT  358



>dbj|BAF46302.1| cysteine proteinase precursor [Ipomoea nil]
Length=369

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 72/77 (94%), Gaps = 1/77 (1%)
 Frame = +1

Query  1    GVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  177
            GVSCPYICSKR LDHGVLLVGYG+AGYAPIR K+KPYWI+KNSWGE+WGE+GYYKICRG 
Sbjct  290  GVSCPYICSKRNLDHGVLLVGYGAAGYAPIRFKDKPYWIVKNSWGENWGEEGYYKICRGN  349

Query  178  NICGVDSMVSTVAAVNT  228
            NICG+DSMVSTV A +T
Sbjct  350  NICGIDSMVSTVTAAST  366



>ref|XP_002868883.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45142.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRN
Sbjct  289  GVSCPYICTRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRN  348

Query  181  ICGVDSMVSTVAAVNTPTS  237
            ICGVDS+VSTV A  + T+
Sbjct  349  ICGVDSLVSTVTAAVSTTA  367



>ref|XP_003589348.1| Cysteine proteinase [Medicago truncatula]
 gb|AES59599.1| papain family cysteine protease [Medicago truncatula]
Length=364

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 72/77 (94%), Gaps = 1/77 (1%)
 Frame = +1

Query  1    GVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  177
            GVSCPYIC+K RLDHGVLL+G+G  GYAPIRLKEKPYWIIKNSWG++WGE+GYYKICRGR
Sbjct  288  GVSCPYICAKARLDHGVLLLGFGQGGYAPIRLKEKPYWIIKNSWGQNWGEEGYYKICRGR  347

Query  178  NICGVDSMVSTVAAVNT  228
            N+CGVDSMVSTVAA  +
Sbjct  348  NVCGVDSMVSTVAAAQS  364



>ref|XP_008221329.1| PREDICTED: cysteine proteinase 15A-like [Prunus mume]
Length=366

 Score =   143 bits (360),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC KR+DHGVLLVGYGS+G+APIR KEKPYWI+KNSWG+SWGE+GYYKICRG N
Sbjct  288  GVSCPYICGKRIDHGVLLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEEGYYKICRGHN  347

Query  181  ICGVDSMVSTVAAVNT  228
             CGVDS+VSTVA+++T
Sbjct  348  PCGVDSLVSTVASLHT  363



>emb|CDY09707.1| BnaC07g33540D [Brassica napus]
Length=366

 Score =   143 bits (360),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR-  177
            GVSCPY+CSK  DHGVLLVG+GSAGYAP+RL+EKPYWIIKNSWG  WGEKGYYKICRG  
Sbjct  287  GVSCPYVCSKNQDHGVLLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEKGYYKICRGTP  346

Query  178  NICGVDSMVSTVAAVNT  228
            NICGVD+MVSTVAAVNT
Sbjct  347  NICGVDTMVSTVAAVNT  363



>gb|ACX54787.2| cysteine protease [Arachis diogoi]
Length=360

 Score =   142 bits (359),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC K LDHGVLLVGYG+AGYAPIR K+KP+WIIKNSWGESWGE GYYKICRG+N
Sbjct  280  GVSCPYICGKNLDHGVLLVGYGAAGYAPIRFKDKPFWIIKNSWGESWGEDGYYKICRGKN  339

Query  181  ICGVDSMVSTVAAVNTPTSD  240
            +CGVDSMVS+V A    +S+
Sbjct  340  VCGVDSMVSSVVATTFTSSN  359



>ref|XP_002280808.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CBI19783.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   142 bits (359),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCP+ICS  L+HGVLLVGYGSAGY+PIR KEKPYW++KNSWG++WGE GYYKICRG N
Sbjct  288  GVSCPFICSTSLNHGVLLVGYGSAGYSPIRFKEKPYWLLKNSWGQNWGEHGYYKICRGHN  347

Query  181  ICGVDSMVSTVAAVNTPT  234
            ICGVDSMVSTVAA+ + T
Sbjct  348  ICGVDSMVSTVAAIQSAT  365



>emb|CDY41960.1| BnaA01g05320D [Brassica napus]
Length=367

 Score =   142 bits (359),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRN
Sbjct  288  GVSCPYICTRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRN  347

Query  181  ICGVDSMVSTVAAVNTPTS  237
            ICGVDS+VSTV A  + T+
Sbjct  348  ICGVDSLVSTVTAAVSTTA  366



>emb|CAA52403.1| putative thiol protease [Arabidopsis thaliana]
Length=313

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICS+RL+HGVLLVGYGSAG++  RLKEKPYWIIKNSWGESWGE G+YKIC+GRN
Sbjct  238  GVSCPYICSRRLNHGVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENGFYKICKGRN  297

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVDS+VSTVAA  +
Sbjct  298  ICGVDSLVSTVAATTS  313



>ref|XP_003550405.2| PREDICTED: cysteine proteinase 15A [Glycine max]
Length=392

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC K LDHGVLLVGYG   YAPIR K KPYWIIKNSWGESWGE GYYKICRGRN
Sbjct  314  GVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYYKICRGRN  373

Query  181  ICGVDSMVSTVAAV  222
            +CGVDSMVSTVAA+
Sbjct  374  VCGVDSMVSTVAAI  387



>dbj|BAA92495.1| cysteine protease [Vigna mungo]
Length=364

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC+KRLDHGV +VGYG +GYAPIR KEKPYWIIKNSWGESWGE GYYKICRG+N
Sbjct  286  GVSCPYICAKRLDHGVQIVGYGESGYAPIRFKEKPYWIIKNSWGESWGENGYYKICRGQN  345

Query  181  ICGVDSMVSTVAAVNT  228
             CGVDSMVSTV A++ 
Sbjct  346  ACGVDSMVSTVGAIHA  361



>ref|XP_010431862.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRN
Sbjct  288  GVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRN  347

Query  181  ICGVDSMVSTVAAV  222
            ICGVDS+VSTV+A 
Sbjct  348  ICGVDSLVSTVSAT  361



>ref|XP_007223351.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
 gb|EMJ24550.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
Length=367

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC KR+DHGVLLVGYGS+G+APIR KEKPYWI+KNSWG+SWGE+G+YKICRG N
Sbjct  289  GVSCPYICGKRIDHGVLLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEEGFYKICRGHN  348

Query  181  ICGVDSMVSTVAAVNT  228
             CGVDS+VSTVA+++T
Sbjct  349  SCGVDSLVSTVASLHT  364



>ref|XP_010446443.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRN
Sbjct  288  GVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRN  347

Query  181  ICGVDSMVSTVAAV  222
            ICGVDS+VSTV+A 
Sbjct  348  ICGVDSLVSTVSAT  361



>ref|XP_010440192.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=365

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 71/79 (90%), Gaps = 1/79 (1%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-R  177
            GVSCPY+CSK  DHGVLLVG+GSAGYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  
Sbjct  286  GVSCPYVCSKSQDHGVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGPH  345

Query  178  NICGVDSMVSTVAAVNTPT  234
            N+CG+DSMVSTVAAV+T T
Sbjct  346  NVCGMDSMVSTVAAVHTTT  364



>ref|XP_010437007.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=368

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRN
Sbjct  289  GVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRN  348

Query  181  ICGVDSMVSTVAAV  222
            ICGVDS+VSTV+A 
Sbjct  349  ICGVDSLVSTVSAT  362



>ref|XP_006665032.1| PREDICTED: cysteine proteinase 1-like [Oryza brachyantha]
Length=191

 Score =   137 bits (346),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 71/79 (90%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC K LDHGVLLVGYGS+G+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG N
Sbjct  110  GVSCPYICGKHLDHGVLLVGYGSSGFAPIRLKDKPYWIIKNSWGENWGEHGYYKICRGSN  169

Query  181  I---CGVDSMVSTVAAVNT  228
            +   CGVDSMVSTV A++T
Sbjct  170  VRDKCGVDSMVSTVTAIHT  188



>ref|XP_010449835.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 71/79 (90%), Gaps = 1/79 (1%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-R  177
            GVSCPY+CSK  DHGVLLVG+GSAGYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  
Sbjct  286  GVSCPYVCSKNQDHGVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGPH  345

Query  178  NICGVDSMVSTVAAVNTPT  234
            N+CG+DSMVSTVAAV+T T
Sbjct  346  NMCGMDSMVSTVAAVHTTT  364



>gb|ACK57563.1| cysteine protease-like protein [Arachis hypogaea]
Length=364

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCP+IC K LDHGVLLVGYG+ GYAPIR KEKPYWIIKNSWGE+WGE GYYKICRG N
Sbjct  286  GVSCPFICGKHLDHGVLLVGYGAGGYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGPN  345

Query  181  ICGVDSMVSTVAAVNT  228
            +CGVDSMVSTV A++T
Sbjct  346  MCGVDSMVSTVIAIHT  361



>sp|P25804.1|CYSP_PEA RecName: Full=Cysteine proteinase 15A; AltName: Full=Turgor-responsive 
protein 15A; Flags: Precursor [Pisum sativum]
 emb|CAA38242.1| unnamed protein product [Pisum sativum]
Length=363

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +1

Query  1    GVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  177
            GVSCPY+C+K RLDHGVLLVG+G   YAPIRLKEKPYWIIKNSWG++WGE+GYYKICRGR
Sbjct  285  GVSCPYVCAKSRLDHGVLLVGFGKGAYAPIRLKEKPYWIIKNSWGQNWGEQGYYKICRGR  344

Query  178  NICGVDSMVSTVAAVNT  228
            N+CGVDSMVSTVAA  +
Sbjct  345  NVCGVDSMVSTVAAAQS  361



>emb|CAA82995.1| cysteine proteinase [Vicia sativa]
Length=358

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +1

Query  1    GVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  177
            GVSCPY+C+K RLDHGVLLVG+G   YAPIRLKEKPYWIIKNSWG++WGE+GYYKICRGR
Sbjct  280  GVSCPYVCAKARLDHGVLLVGFGKGAYAPIRLKEKPYWIIKNSWGQNWGEQGYYKICRGR  339

Query  178  NICGVDSMVSTVAAVNT  228
            N+CGVDSMVSTVAA  +
Sbjct  340  NVCGVDSMVSTVAAAQS  356



>gb|ACM80348.1| cysteine proteinase [Solanum lycopersicum]
Length=368

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 73/78 (94%), Gaps = 1/78 (1%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSK+LDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKI RGRN
Sbjct  292  GVSCPYICSKQLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGESGYYKIRRGRN  350

Query  181  ICGVDSMVSTVAAVNTPT  234
            +CGVDSMVSTVAAV+T +
Sbjct  351  VCGVDSMVSTVAAVSTSS  368



>ref|XP_010434865.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 71/79 (90%), Gaps = 1/79 (1%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-R  177
            GVSCPY+CSK  DHGVLLVG+GSAGYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  
Sbjct  286  GVSCPYVCSKSQDHGVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGPH  345

Query  178  NICGVDSMVSTVAAVNTPT  234
            N+CG+DSMVSTVAAV+T T
Sbjct  346  NMCGMDSMVSTVAAVHTTT  364



>dbj|BAD43619.1| putative cysteine proteinase [Arabidopsis thaliana]
Length=361

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICS+RL+HGVLLVGYGSAG++  RLKEKPYWIIKNSWGESWGE G+YKIC+GRN
Sbjct  286  GVSCPYICSRRLNHGVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENGFYKICKGRN  345

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVDS+VSTVAA  +
Sbjct  346  ICGVDSLVSTVAATTS  361



>ref|XP_009150026.1| PREDICTED: cysteine proteinase RD19a [Brassica rapa]
Length=367

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC++RL+HGVLLVGYGSAGYAP R KE+PYWIIKNSWGE+WGE G+YKIC+GRN
Sbjct  288  GVSCPYICTRRLNHGVLLVGYGSAGYAPARFKERPYWIIKNSWGETWGENGFYKICKGRN  347

Query  181  ICGVDSMVSTVAAVNTPTS  237
            ICGVDS+VSTV A  + T+
Sbjct  348  ICGVDSLVSTVTAAVSTTA  366



>ref|NP_565512.1| Papain family cysteine protease [Arabidopsis thaliana]
 sp|P43295.2|A494_ARATH RecName: Full=Probable cysteine proteinase A494; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD23687.1| cysteine proteinase [Arabidopsis thaliana]
 gb|ABJ98563.1| At2g21430 [Arabidopsis thaliana]
 gb|AEC07177.1| Papain family cysteine protease [Arabidopsis thaliana]
Length=361

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICS+RL+HGVLLVGYGSAG++  RLKEKPYWIIKNSWGESWGE G+YKIC+GRN
Sbjct  286  GVSCPYICSRRLNHGVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENGFYKICKGRN  345

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVDS+VSTVAA  +
Sbjct  346  ICGVDSLVSTVAATTS  361



>gb|AAB67878.1| pre-pro-cysteine proteinase [Vicia faba]
Length=363

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +1

Query  1    GVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  177
            GVSCPY+C+K RLDHGVLLVG+G   YAPIRLKEKPYWI+KNSWG++WGE+GYYKICRGR
Sbjct  285  GVSCPYVCAKSRLDHGVLLVGFGKGAYAPIRLKEKPYWIVKNSWGQNWGEQGYYKICRGR  344

Query  178  NICGVDSMVSTVAAVNT  228
            N+CGVDSMVSTVAA  +
Sbjct  345  NVCGVDSMVSTVAAAQS  361



>gb|AAO11786.1| pre-pro cysteine proteinase [Vicia faba]
Length=363

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +1

Query  1    GVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  177
            GVSCPY+C+K RLDHGVLLVG+G   YAPIRLKEKPYWI+KNSWG++WGE+GYYKICRGR
Sbjct  285  GVSCPYVCAKSRLDHGVLLVGFGKGAYAPIRLKEKPYWIVKNSWGQNWGEQGYYKICRGR  344

Query  178  NICGVDSMVSTVAAVNT  228
            N+CGVDSMVSTVAA  +
Sbjct  345  NVCGVDSMVSTVAAAQS  361



>ref|XP_008775280.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=368

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC + LDHGVLLVGYGSAGYAPIR K+KPYWIIKNSWGE+WGE GYYKICRG N
Sbjct  293  GVSCPYICGRHLDHGVLLVGYGSAGYAPIRFKDKPYWIIKNSWGENWGEDGYYKICRGHN  352

Query  181  ICGVDSMVSTVAAV  222
            ICGV+SMVSTV A+
Sbjct  353  ICGVESMVSTVTAI  366



>ref|XP_003545051.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=367

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC K LDHGVL+VGYG   YAPIR K KPYWIIKNSWGESWGE GYYKICRGRN
Sbjct  289  GVSCPYICGKHLDHGVLIVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYYKICRGRN  348

Query  181  ICGVDSMVSTVAAV  222
            +CGVDSMVSTVAA+
Sbjct  349  VCGVDSMVSTVAAI  362



>ref|XP_011083631.1| PREDICTED: cysteine proteinase 15A-like [Sesamum indicum]
Length=371

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 70/78 (90%), Gaps = 1/78 (1%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC K LDHGVLLVGYG+AGYAPIRLKEKPYWIIKNSWGE+WGE GYYKICRG N
Sbjct  293  GVSCPYICGKHLDHGVLLVGYGAAGYAPIRLKEKPYWIIKNSWGENWGENGYYKICRGHN  352

Query  181  ICGVDSMVSTVAAVN-TP  231
            +CGV SMVSTV A + TP
Sbjct  353  VCGVASMVSTVTAAHVTP  370



>ref|XP_009136751.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
Length=368

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR-  177
            GVSCPY+CSK  DHGVLLVG+GSAGYAP+RL+EKPYWIIKNSWG  WGEKGYYKICRG  
Sbjct  289  GVSCPYVCSKNQDHGVLLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEKGYYKICRGTP  348

Query  178  NICGVDSMVSTVAAVNT  228
            NICGVD+MVSTVAAV+T
Sbjct  349  NICGVDTMVSTVAAVHT  365



>emb|CDX90537.1| BnaA03g42440D [Brassica napus]
Length=366

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR-  177
            GVSCPY+CSK  DHGVLLVG+GSAGYAP+RL+EKPYWIIKNSWG  WGEKGYYKICRG  
Sbjct  287  GVSCPYVCSKNQDHGVLLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEKGYYKICRGTP  346

Query  178  NICGVDSMVSTVAAVNT  228
            NICGVD+MVSTVAAV+T
Sbjct  347  NICGVDTMVSTVAAVHT  363



>ref|XP_006653265.1| PREDICTED: cysteine proteinase 1-like, partial [Oryza brachyantha]
Length=366

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 70/79 (89%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG--  174
            GVSCPYIC K LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYKICRG  
Sbjct  284  GVSCPYICGKHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGPH  343

Query  175  -RNICGVDSMVSTVAAVNT  228
             +N CGVDSMVSTV A++T
Sbjct  344  VQNKCGVDSMVSTVTAIHT  362



>ref|NP_001266121.1| uncharacterized protein LOC101501911 precursor [Cicer arietinum]
 emb|CAA08906.1| cysteine proteinase [Cicer arietinum]
Length=362

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 75/80 (94%), Gaps = 2/80 (3%)
 Frame = +1

Query  1    GVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  177
            GVSCPYIC+K RLDHGVLLVG+G+ G+APIRLKEKPYWIIKNSWG++WGE+GYYKICRGR
Sbjct  284  GVSCPYICAKSRLDHGVLLVGFGN-GFAPIRLKEKPYWIIKNSWGQNWGEEGYYKICRGR  342

Query  178  NICGVDSMVSTVAAVNTPTS  237
            NICGVDSMVSTVAAV+   +
Sbjct  343  NICGVDSMVSTVAAVHASNN  362



>gb|AJA74415.1| cysteine protease [Cicer arietinum]
Length=358

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 75/80 (94%), Gaps = 2/80 (3%)
 Frame = +1

Query  1    GVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  177
            GVSCPYIC+K RLDHGVLLVG+G+ G+APIRLKEKPYWIIKNSWG++WGE+GYYKICRGR
Sbjct  280  GVSCPYICAKSRLDHGVLLVGFGN-GFAPIRLKEKPYWIIKNSWGQNWGEEGYYKICRGR  338

Query  178  NICGVDSMVSTVAAVNTPTS  237
            NICGVDSMVSTVAAV+   +
Sbjct  339  NICGVDSMVSTVAAVHASNN  358



>ref|XP_009335626.1| PREDICTED: cysteine proteinase 15A [Pyrus x bretschneideri]
Length=366

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC KR+DHGVLLVGYGS+G+APIR KEKPYWI+KNSWG+SWGE+GYYKICRG N
Sbjct  288  GVSCPYICGKRIDHGVLLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEQGYYKICRGYN  347

Query  181  ICGVDSMVSTVAAVN  225
             CGVDS+VSTVAA++
Sbjct  348  SCGVDSLVSTVAALH  362



>gb|KJB58164.1| hypothetical protein B456_009G197400 [Gossypium raimondii]
Length=375

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC K LDHGVLLVGYGSAGYAP+R K KPYWIIKNSWGE+WGE GYYKICRG N
Sbjct  292  GVSCPYICGKHLDHGVLLVGYGSAGYAPVRFKNKPYWIIKNSWGENWGENGYYKICRGNN  351

Query  181  ICGVDSMVSTVAAVN  225
            +CGVDSMVS+V+A++
Sbjct  352  VCGVDSMVSSVSALH  366



>gb|KJB29611.1| hypothetical protein B456_005G110200 [Gossypium raimondii]
Length=370

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC + LDHGVLLVGYG+AGY+PIR K+KP+WIIKNSWG +WGE GYYKICRGRN
Sbjct  292  GVSCPYICFRTLDHGVLLVGYGAAGYSPIRFKDKPFWIIKNSWGANWGEDGYYKICRGRN  351

Query  181  ICGVDSMVSTVAAVNTPTS  237
            +CGVDSMVS+VAA++T + 
Sbjct  352  VCGVDSMVSSVAALHTKSQ  370



>ref|XP_008444769.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=373

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 71/79 (90%), Gaps = 1/79 (1%)
 Frame = +1

Query  1    GVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  177
            GVSCPYICSKR LDHGVLLVGYGSAG+APIR KEKPYWIIKNSWGE+WGE GYY IC+G+
Sbjct  295  GVSCPYICSKRNLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGENWGENGYYFICKGK  354

Query  178  NICGVDSMVSTVAAVNTPT  234
            N+CG +SMVS+VAA  TP 
Sbjct  355  NVCGSESMVSSVAAAATPN  373



>emb|CAB17075.1| cysteine proteinase precursor [Phaseolus vulgaris]
Length=365

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC K LDHGVLLVGYG   YAPIR KEKPYWIIKNSWGE+WG  GYYKICRGRN
Sbjct  287  GVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGGNGYYKICRGRN  346

Query  181  ICGVDSMVSTVAAVNTPTS  237
            +CGVDSMVSTV A++  T 
Sbjct  347  VCGVDSMVSTVGAIHASTQ  365



>ref|XP_010943608.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=371

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC + LDHGVLLVGYGSAGYAPIR K+KPYWIIKNSWG +WGE GYYKICRG+N
Sbjct  295  GVSCPYICGRHLDHGVLLVGYGSAGYAPIRFKDKPYWIIKNSWGGNWGEDGYYKICRGQN  354

Query  181  ICGVDSMVSTVAAVNT  228
            ICGV+SMVSTV AV T
Sbjct  355  ICGVESMVSTVTAVRT  370



>emb|CDP07452.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-R  177
            GVSCPYICSK  DHGVLLVGYG+AGYAPIRLK+KPYWIIKNSWGE+WGE GYYK CR  R
Sbjct  300  GVSCPYICSKSQDHGVLLVGYGAAGYAPIRLKDKPYWIIKNSWGENWGENGYYKFCRADR  359

Query  178  NICGVDSMVSTVAAVNT  228
            N+CGVDSMVS+VAAV+T
Sbjct  360  NLCGVDSMVSSVAAVHT  376



>gb|AAQ81938.1| cysteine proteinase precursor [Ipomoea batatas]
Length=371

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 72/77 (94%), Gaps = 1/77 (1%)
 Frame = +1

Query  1    GVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  177
            GVSCPYICSK+ LDHGVL+VGYG+AGYAPIR K+KPYWIIKNSWGE+WGE+GYYKICRG 
Sbjct  292  GVSCPYICSKKNLDHGVLIVGYGAAGYAPIRFKDKPYWIIKNSWGENWGEEGYYKICRGN  351

Query  178  NICGVDSMVSTVAAVNT  228
            NICGVDSMVS+V A +T
Sbjct  352  NICGVDSMVSSVTAAST  368



>ref|XP_002880378.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56637.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICS+RL+HGVLL+GYGS+GY+  RLKEKPYWIIKNSWGESWGE G+YKIC+GRN
Sbjct  285  GVSCPYICSRRLNHGVLLMGYGSSGYSQARLKEKPYWIIKNSWGESWGENGFYKICKGRN  344

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVDS+VSTVAA  +
Sbjct  345  ICGVDSLVSTVAAATS  360



>ref|XP_010672379.1| PREDICTED: cysteine proteinase RD19a-like [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score =   140 bits (353),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCP +C + LDHGV+LVGYGSAGYAPIR KEKPYWIIKNSWG +WG++GYYKICRG N
Sbjct  296  GVSCPLVCLRSLDHGVVLVGYGSAGYAPIRFKEKPYWIIKNSWGPNWGDQGYYKICRGHN  355

Query  181  ICGVDSMVSTVAAVN  225
            +CGVDSMVSTVAAVN
Sbjct  356  VCGVDSMVSTVAAVN  370



>emb|CDX99593.1| BnaC04g33500D [Brassica napus]
Length=343

 Score =   139 bits (351),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRL+HGVLLVGYGSAG++  R KEKPYWIIKNSWGE+WGE G+YK+C+GRN
Sbjct  269  GVSCPYICSKRLNHGVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENGFYKLCKGRN  328

Query  181  ICGVDSMVSTVAAV  222
            +CGVDSMVSTVAA 
Sbjct  329  VCGVDSMVSTVAAA  342



>gb|AEX97108.1| cysteine proteinase, partial [Malus domestica]
Length=128

 Score =   134 bits (336),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 69/75 (92%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    GVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  177
            GVSCPYICSKR LDHGVLLVGYGSAG+APIR KEKPYWIIKNSWG++WGE GYY IC+GR
Sbjct  14   GVSCPYICSKRNLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGQNWGENGYYLICKGR  73

Query  178  NICGVDSMVSTVAAV  222
            NICG +SMVS+VAA 
Sbjct  74   NICGSESMVSSVAAT  88



>gb|KHG15062.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=370

 Score =   140 bits (352),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC + LDHGVLLVGYG+AGY+PIR K+KP+WIIKNSWG +WGE GYY+ICRGRN
Sbjct  292  GVSCPYICFRTLDHGVLLVGYGAAGYSPIRFKDKPFWIIKNSWGANWGEDGYYRICRGRN  351

Query  181  ICGVDSMVSTVAAVNTPTS  237
            +CGVDSMVS+VAA++T + 
Sbjct  352  VCGVDSMVSSVAALHTKSQ  370



>ref|XP_009405542.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=366

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC K L+HGVLLVGYGSAGYAP R KEK YWIIKNSWGE+WGE GYYKICRGRN
Sbjct  291  GVSCPYICGKHLNHGVLLVGYGSAGYAPARFKEKSYWIIKNSWGENWGENGYYKICRGRN  350

Query  181  ICGVDSMVSTVAAV  222
            ICGVDSMVS+V A+
Sbjct  351  ICGVDSMVSSVTAI  364



>gb|AGS43121.1| cysteine protease 1, partial [Zea mays]
Length=90

 Score =   132 bits (332),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 71/79 (90%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG--  174
            GVSCPYIC + LDHGVLLVGYG++G+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG  
Sbjct  9    GVSCPYICGRHLDHGVLLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENGYYKICRGSN  68

Query  175  -RNICGVDSMVSTVAAVNT  228
             RN CGVDSMVSTV+AV+ 
Sbjct  69   VRNKCGVDSMVSTVSAVHA  87



>ref|XP_006283974.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
 gb|EOA16872.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
Length=365

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 71/79 (90%), Gaps = 1/79 (1%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-R  177
            GVSCPY+CSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  
Sbjct  286  GVSCPYVCSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGPH  345

Query  178  NICGVDSMVSTVAAVNTPT  234
            N+CG+D+MVSTVAAV+T T
Sbjct  346  NMCGMDTMVSTVAAVHTTT  364



>ref|XP_009140277.1| PREDICTED: probable cysteine proteinase A494 [Brassica rapa]
Length=362

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRL+HGVLLVGYGSAG++  R KEKPYWIIKNSWGE+WGE G+YK+C+GRN
Sbjct  288  GVSCPYICSKRLNHGVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENGFYKLCKGRN  347

Query  181  ICGVDSMVSTVAAV  222
            +CG+DSMVSTVAA 
Sbjct  348  VCGIDSMVSTVAAA  361



>emb|CDY15894.1| BnaA04g12170D [Brassica napus]
Length=362

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRL+HGVLLVGYGSAG++  R KEKPYWIIKNSWGE+WGE G+YK+C+GRN
Sbjct  288  GVSCPYICSKRLNHGVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENGFYKLCKGRN  347

Query  181  ICGVDSMVSTVAAV  222
            +CG+DSMVSTVAA 
Sbjct  348  VCGIDSMVSTVAAA  361



>ref|XP_006414378.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
 gb|ESQ55831.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
Length=367

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 70/80 (88%), Gaps = 1/80 (1%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-R  177
            GVSCPY+CSK  DHGVLLVG+GS+GY+PIRLKEKPYWIIKNSWG  WGE GYYKICRG  
Sbjct  288  GVSCPYVCSKSQDHGVLLVGFGSSGYSPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGSH  347

Query  178  NICGVDSMVSTVAAVNTPTS  237
            NICG+D+MVSTVAAV T T 
Sbjct  348  NICGMDTMVSTVAAVQTSTQ  367



>ref|XP_006404590.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
 gb|ESQ46043.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
Length=363

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICS+RL+HGVLLVGYGSAG+A  RLK+KPYWIIKNSWGE+WGE GYYK+CRGRN
Sbjct  289  GVSCPYICSRRLNHGVLLVGYGSAGFAQARLKKKPYWIIKNSWGETWGENGYYKLCRGRN  348

Query  181  ICGVDSMVSTVA  216
            ICGVDS+VSTVA
Sbjct  349  ICGVDSLVSTVA  360



>emb|CAD40319.2| OSJNBb0054B09.3 [Oryza sativa Japonica Group]
 emb|CAH66180.1| OSIGBa0130O15.4 [Oryza sativa Indica Group]
 emb|CAH66205.1| OSIGBa0148D14.11 [Oryza sativa Indica Group]
Length=381

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 71/79 (90%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG--  174
            GVSCP+IC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYKICRG  
Sbjct  298  GVSCPFICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKICRGPH  357

Query  175  -RNICGVDSMVSTVAAVNT  228
             +N CGVDSMVS+V A++T
Sbjct  358  DKNKCGVDSMVSSVTAIHT  376



>emb|CAA57675.1| cysteine proteinase [Zea mays]
Length=145

 Score =   133 bits (335),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 71/79 (90%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG--  174
            GVSCPYIC + LDHGVLLVGYG++G+AP+RLK+KPYWIIKNSWGE+WGE GYYKICRG  
Sbjct  64   GVSCPYICGRHLDHGVLLVGYGASGFAPMRLKDKPYWIIKNSWGENWGENGYYKICRGSN  123

Query  175  -RNICGVDSMVSTVAAVNT  228
             RN CGVDSMVSTV+AV+ 
Sbjct  124  VRNKCGVDSMVSTVSAVHA  142



>ref|XP_002452058.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
 gb|EES05034.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
Length=371

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 71/79 (90%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG--  174
            GVSCPYIC + LDHGVLLVGYG+AG+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG  
Sbjct  290  GVSCPYICGRTLDHGVLLVGYGAAGFAPIRLKDKPYWIIKNSWGENWGENGYYKICRGSN  349

Query  175  -RNICGVDSMVSTVAAVNT  228
             RN CGVDSMVSTV+AV T
Sbjct  350  VRNKCGVDSMVSTVSAVRT  368



>gb|EAY93546.1| hypothetical protein OsI_15336 [Oryza sativa Indica Group]
Length=348

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 71/79 (90%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG--  174
            GVSCP+IC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYKICRG  
Sbjct  265  GVSCPFICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKICRGPH  324

Query  175  -RNICGVDSMVSTVAAVNT  228
             +N CGVDSMVS+V A++T
Sbjct  325  DKNKCGVDSMVSSVTAIHT  343



>gb|EEE60725.1| hypothetical protein OsJ_14236 [Oryza sativa Japonica Group]
Length=364

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 71/79 (90%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG--  174
            GVSCP+IC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYKICRG  
Sbjct  281  GVSCPFICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKICRGPH  340

Query  175  -RNICGVDSMVSTVAAVNT  228
             +N CGVDSMVS+V A++T
Sbjct  341  DKNKCGVDSMVSSVTAIHT  359



>gb|EMT16425.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=379

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 70/79 (89%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG--  174
            GVSCPYIC + LDHGVLLVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYKICRG  
Sbjct  297  GVSCPYICGRHLDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKICRGPH  356

Query  175  -RNICGVDSMVSTVAAVNT  228
             +N CGVDSMVSTV A++T
Sbjct  357  VKNKCGVDSMVSTVTAIHT  375



>ref|XP_009611293.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana tomentosiformis]
 emb|CAB44983.1| putative preprocysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG N
Sbjct  283  GVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHN  342

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVD+MVSTV A +T
Sbjct  343  ICGVDAMVSTVTAAHT  358



>gb|AAK07731.1| CPR2-like cysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG N
Sbjct  283  GVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHN  342

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVD+MVSTV A +T
Sbjct  343  ICGVDAMVSTVTAAHT  358



>ref|XP_004238314.1| PREDICTED: cysteine proteinase 15A [Solanum lycopersicum]
Length=363

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCP IC KR DHGVLLVGYGS G+APIRLK KPYWIIKNSWG++WGE GYYKICRG N
Sbjct  283  GVSCPLICFKRQDHGVLLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEHGYYKICRGHN  342

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVD+MVSTV A +T
Sbjct  343  ICGVDAMVSTVTATHT  358



>emb|CAA78361.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG N
Sbjct  283  GVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHN  342

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVD+MVSTV A +T
Sbjct  343  ICGVDAMVSTVTAAHT  358



>emb|CAA78365.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=365

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG N
Sbjct  285  GVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHN  344

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVD+MVSTV A +T
Sbjct  345  ICGVDAMVSTVTAAHT  360



>ref|XP_003579573.2| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=399

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 71/83 (86%), Gaps = 3/83 (4%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG--  174
            GVSCP+IC + LDHGVLLVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYKICRG  
Sbjct  317  GVSCPFICGRHLDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKICRGAH  376

Query  175  -RNICGVDSMVSTVAAVNTPTSD  240
             +N CGVDSMVSTV A++T   +
Sbjct  377  VKNKCGVDSMVSTVTAIHTSNKE  399



>ref|XP_009776238.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana sylvestris]
Length=365

 Score =   138 bits (347),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG N
Sbjct  285  GVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHN  344

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVD+MVSTV A +T
Sbjct  345  ICGVDAMVSTVTAAHT  360



>ref|XP_004952477.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=374

 Score =   138 bits (348),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 71/79 (90%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG--  174
            GVSCPYIC + LDHGVLLVGYG+AG+APIRLKEKPYWIIKNSWGE+WGE GYYKICRG  
Sbjct  292  GVSCPYICGRHLDHGVLLVGYGAAGFAPIRLKEKPYWIIKNSWGENWGENGYYKICRGSN  351

Query  175  -RNICGVDSMVSTVAAVNT  228
             RN CGVDSMVSTV+A++ 
Sbjct  352  VRNKCGVDSMVSTVSAIHA  370



>ref|NP_001052440.1| Os04g0311400 [Oryza sativa Japonica Group]
 dbj|BAF14354.1| Os04g0311400, partial [Oryza sativa Japonica Group]
Length=384

 Score =   138 bits (348),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 71/79 (90%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG--  174
            GVSCP+IC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYKICRG  
Sbjct  301  GVSCPFICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKICRGPH  360

Query  175  -RNICGVDSMVSTVAAVNT  228
             +N CGVDSMVS+V A++T
Sbjct  361  DKNKCGVDSMVSSVTAIHT  379



>ref|XP_006341997.1| PREDICTED: cysteine proteinase 15A-like [Solanum tuberosum]
Length=376

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCP IC KR DHGVLLVGYGS G+APIRLK KPYWIIKNSWG++WGE GYYKICRG N
Sbjct  296  GVSCPLICLKRQDHGVLLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEHGYYKICRGHN  355

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVD+MVSTV A +T
Sbjct  356  ICGVDAMVSTVTATHT  371



>gb|KFK24413.1| hypothetical protein AALP_AAs58848U000200 [Arabis alpina]
Length=372

 Score =   137 bits (346),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 71/79 (90%), Gaps = 2/79 (3%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR-  177
            GVSCPY+CSK  DHGVLLVG+G +GYAPIRLKEKPYWIIKNSWG+ WGE GYYKICRGR 
Sbjct  293  GVSCPYVCSKSQDHGVLLVGFGESGYAPIRLKEKPYWIIKNSWGKMWGEHGYYKICRGRH  352

Query  178  NICGVDSMVSTVAAVN-TP  231
            NICG+D+MVSTVAAV  TP
Sbjct  353  NICGMDTMVSTVAAVQITP  371



>ref|XP_004152668.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004167370.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN62647.1| Cysteine protease [Cucumis sativus]
Length=371

 Score =   137 bits (346),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 71/75 (95%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    GVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  177
            G+SCPYICSKR LDHGVLLVGYG+AG+APIRLKEKPYWIIKNSWGE+WGE GYY IC+G+
Sbjct  295  GISCPYICSKRNLDHGVLLVGYGAAGFAPIRLKEKPYWIIKNSWGENWGENGYYFICKGK  354

Query  178  NICGVDSMVSTVAAV  222
            NICG +SMVS+VAA+
Sbjct  355  NICGSESMVSSVAAI  369



>gb|AAB16996.1| thiol protease isoform B, partial [Glycine max]
Length=319

 Score =   136 bits (343),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC K LDHGVLLVGYG   YAPIR K KPYWIIKNSWGESWGE GY +ICRGRN
Sbjct  241  GVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYDEICRGRN  300

Query  181  ICGVDSMVSTVAAV  222
            +CGVDSMVSTVAA+
Sbjct  301  VCGVDSMVSTVAAI  314



>gb|EMS53996.1| Cysteine proteinase 1 [Triticum urartu]
Length=405

 Score =   138 bits (347),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 70/79 (89%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG--  174
            GVSCPYIC + LDHGVLLVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYKICRG  
Sbjct  323  GVSCPYICGRHLDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKICRGPH  382

Query  175  -RNICGVDSMVSTVAAVNT  228
             +N CGVDSMVSTV A++T
Sbjct  383  VKNKCGVDSMVSTVTAIHT  401



>ref|NP_567489.1| papain family cysteine protease [Arabidopsis thaliana]
 emb|CAB10398.1| cysteine proteinase like protein [Arabidopsis thaliana]
 emb|CAB78661.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AAK62611.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM91059.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM96982.1| cysteine proteinase [Arabidopsis thaliana]
 gb|AAN31875.1| putative cysteine proteinase [Arabidopsis thaliana]
 dbj|BAE98514.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AEE83713.1| papain family cysteine protease [Arabidopsis thaliana]
Length=373

 Score =   137 bits (346),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 70/77 (91%), Gaps = 1/77 (1%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-R  177
            GVSCPY+CSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  
Sbjct  294  GVSCPYVCSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGAMWGEHGYYKICRGPH  353

Query  178  NICGVDSMVSTVAAVNT  228
            N+CG+D+MVSTVAAV+T
Sbjct  354  NMCGMDTMVSTVAAVHT  370



>ref|XP_002870174.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46433.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
Length=373

 Score =   137 bits (345),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 70/77 (91%), Gaps = 1/77 (1%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-R  177
            GVSCPY+CSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  
Sbjct  294  GVSCPYVCSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGAMWGEHGYYKICRGPH  353

Query  178  NICGVDSMVSTVAAVNT  228
            N+CG+D+MVSTVAAV+T
Sbjct  354  NMCGMDTMVSTVAAVHT  370



>emb|CAH59428.1| cysteine protease 2 [Plantago major]
Length=245

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 70/79 (89%), Gaps = 1/79 (1%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYIC K LDHGVL+VGYG+ GYAP+RLK KPYWIIKNSWGESWGE GYYKICRGRN
Sbjct  168  GVSCPYICGKSLDHGVLIVGYGT-GYAPVRLKNKPYWIIKNSWGESWGESGYYKICRGRN  226

Query  181  ICGVDSMVSTVAAVNTPTS  237
            +CGV+SMVS+V A +  T+
Sbjct  227  VCGVESMVSSVTAAHFTTT  245



>ref|XP_003607110.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89307.1| papain family cysteine protease [Medicago truncatula]
Length=331

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            G+SCPYIC++RLD GVLLVGYGS   A ++ KEKPYWI+KNSWGE+WGE GYYKICRGRN
Sbjct  253  GISCPYICTRRLDLGVLLVGYGSGAGADMKEKEKPYWIVKNSWGETWGENGYYKICRGRN  312

Query  181  ICGVDSMVSTVAAVNTPTS  237
            ICGVDSMVSTVAA +T T 
Sbjct  313  ICGVDSMVSTVAAAHTTTQ  331



>ref|XP_004975256.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=388

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 69/78 (88%), Gaps = 3/78 (4%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG--  174
            GVSCPYIC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYK+CRG  
Sbjct  306  GVSCPYICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGENGYYKLCRGPF  365

Query  175  -RNICGVDSMVSTVAAVN  225
             +N CGVDSMVSTV A++
Sbjct  366  VKNKCGVDSMVSTVTAIH  383



>gb|ACF86683.1| unknown [Zea mays]
 gb|AFW71402.1| cysteine protease1 [Zea mays]
Length=371

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 71/79 (90%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG--  174
            GVSCPYIC + LDHGVLLVGYG++G+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG  
Sbjct  290  GVSCPYICGRHLDHGVLLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENGYYKICRGSN  349

Query  175  -RNICGVDSMVSTVAAVNT  228
             RN CGVDSMVSTV+AV+ 
Sbjct  350  VRNKCGVDSMVSTVSAVHA  368



>ref|NP_001105685.1| cysteine proteinase 1 precursor [Zea mays]
 sp|Q10716.1|CYSP1_MAIZE RecName: Full=Cysteine proteinase 1; Flags: Precursor [Zea mays]
 dbj|BAA08244.1| cysteine proteinase [Zea mays]
Length=371

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 71/79 (90%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG--  174
            GVSCPYIC + LDHGVLLVGYG++G+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG  
Sbjct  290  GVSCPYICGRHLDHGVLLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENGYYKICRGSN  349

Query  175  -RNICGVDSMVSTVAAVNT  228
             RN CGVDSMVSTV+AV+ 
Sbjct  350  VRNKCGVDSMVSTVSAVHA  368



>emb|CAA78403.1| pre-pro-cysteine proteinase [Solanum lycopersicum]
Length=361

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCP IC KR DHGVLLVGYGS G+APIRLK KPYWIIKNSWG++WGE GYYKICRG +
Sbjct  281  GVSCPLICFKRQDHGVLLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEHGYYKICRGHH  340

Query  181  ICGVDSMVSTVAAVNT  228
            ICGVD+MVSTV A +T
Sbjct  341  ICGVDAMVSTVTATHT  356



>gb|KEH30505.1| papain family cysteine protease [Medicago truncatula]
Length=330

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            G+SCPYIC++RLD GVLLVGYGS   A ++ KEKPYWI+KNSWGE+WGE GYYKICRGRN
Sbjct  252  GISCPYICTRRLDLGVLLVGYGSGAGADMKEKEKPYWIVKNSWGETWGENGYYKICRGRN  311

Query  181  ICGVDSMVSTVAAVNTPTS  237
            ICGVDSMVSTVAA +T T 
Sbjct  312  ICGVDSMVSTVAAAHTNTQ  330



>ref|XP_003574963.1| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=377

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 70/79 (89%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG--  174
            GVSCPYIC + LDHGVLLVGYG++G+AP RLK KPYW+IKNSWGE+WGEKGYYKICRG  
Sbjct  295  GVSCPYICGRSLDHGVLLVGYGASGFAPSRLKNKPYWVIKNSWGENWGEKGYYKICRGSN  354

Query  175  -RNICGVDSMVSTVAAVNT  228
             RN CGVDSMVSTVAA +T
Sbjct  355  VRNKCGVDSMVSTVAAAHT  373



>gb|ABK24153.1| unknown [Picea sitchensis]
Length=394

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 70/81 (86%), Gaps = 1/81 (1%)
 Frame = +1

Query  1    GVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  177
            GVSCPY+C+K+ LDHGVLLVGYG+AGYAP RLK KP+WIIKNSWG  WGE GYYK+CRG 
Sbjct  313  GVSCPYVCNKQNLDHGVLLVGYGAAGYAPGRLKNKPFWIIKNSWGPDWGEDGYYKLCRGH  372

Query  178  NICGVDSMVSTVAAVNTPTSD  240
            N+CG+++MVSTVAA N  T D
Sbjct  373  NVCGINTMVSTVAAANIQTDD  393



>gb|EYU27644.1| hypothetical protein MIMGU_mgv1a008452mg [Erythranthe guttata]
Length=373

 Score =   135 bits (340),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 73/80 (91%), Gaps = 1/80 (1%)
 Frame = +1

Query  1    GVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  177
            GVSCPY+C KR LDHGVLLVGYG+AGY+ IRLK KPYWI+KNSWGESWGE+GYYKIC+G 
Sbjct  294  GVSCPYVCGKRNLDHGVLLVGYGAAGYSTIRLKNKPYWIVKNSWGESWGEEGYYKICKGH  353

Query  178  NICGVDSMVSTVAAVNTPTS  237
            N+CGV+SMVS+V A++T ++
Sbjct  354  NVCGVESMVSSVNAIHTTSA  373



>ref|NP_001046828.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAD19579.1| putative cysteine proteinase 1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF08742.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAG92750.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93804.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94031.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83204.1| hypothetical protein OsI_28465 [Oryza sativa Indica Group]
 gb|EEE56967.1| hypothetical protein OsJ_06681 [Oryza sativa Japonica Group]
Length=373

 Score =   135 bits (339),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 71/79 (90%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG--  174
            GVSCPYIC + LDHGVLLVGYG++G+APIRLK+K YWIIKNSWGE+WGE GYYKICRG  
Sbjct  292  GVSCPYICGRHLDHGVLLVGYGASGFAPIRLKDKAYWIIKNSWGENWGEHGYYKICRGSN  351

Query  175  -RNICGVDSMVSTVAAVNT  228
             RN CGVDSMVSTV+A++T
Sbjct  352  VRNKCGVDSMVSTVSAIHT  370



>ref|XP_002279862.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI19784.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCP++CS  LDHGVLLVGYGSAGY+PIR KEKPYWI+KNSW + WGE GYY+ICRG+N
Sbjct  289  GVSCPFLCSGELDHGVLLVGYGSAGYSPIRFKEKPYWILKNSWSKYWGEHGYYRICRGQN  348

Query  181  ICGVDSMVSTVAAVNTPTS  237
            +CGVDSMVS+V A    TS
Sbjct  349  MCGVDSMVSSVVAAIQTTS  367



>dbj|BAG16515.1| putative cysteine proteinase [Capsicum chinense]
Length=367

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 67/77 (87%), Gaps = 1/77 (1%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR-  177
            GVSCP +C K  DHGVLLVGYGSAG+APIRLK KPYWIIKNSWGE WGE GYYKICRG+ 
Sbjct  286  GVSCPLVCFKHQDHGVLLVGYGSAGFAPIRLKAKPYWIIKNSWGEHWGEHGYYKICRGQH  345

Query  178  NICGVDSMVSTVAAVNT  228
            NICGVD+MVSTV A +T
Sbjct  346  NICGVDAMVSTVTAAHT  362



>gb|EMS64962.1| Cysteine proteinase 1 [Triticum urartu]
Length=302

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 69/79 (87%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG--  174
            GVSCPYIC + LDHGVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYKICRG  
Sbjct  220  GVSCPYICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSN  279

Query  175  -RNICGVDSMVSTVAAVNT  228
             RN CGVDSMVSTV+A + 
Sbjct  280  VRNKCGVDSMVSTVSATHA  298



>tpe|CAD66657.1| TPA: putative cysteine proteinase precursor [Hordeum vulgare 
subsp. vulgare]
 dbj|BAJ94057.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 70/79 (89%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG--  174
            GVSCPYIC + LDHGVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYKICRG  
Sbjct  295  GVSCPYICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSN  354

Query  175  -RNICGVDSMVSTVAAVNT  228
             RN CGVDSMVSTV+A ++
Sbjct  355  VRNKCGVDSMVSTVSATHS  373



>gb|AES89347.2| papain family cysteine protease [Medicago truncatula]
Length=327

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 66/78 (85%), Gaps = 4/78 (5%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPY C++RLDHGVLLVGYGS  Y     KEKPYWI+K+SWGE+WGE GYYKICRGRN
Sbjct  253  GVSCPYTCTRRLDHGVLLVGYGSGAYT----KEKPYWIVKSSWGETWGENGYYKICRGRN  308

Query  181  ICGVDSMVSTVAAVNTPT  234
            ICGVDSMVSTVAA  T T
Sbjct  309  ICGVDSMVSTVAAAQTTT  326



>gb|ACN40679.1| unknown [Picea sitchensis]
Length=366

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 70/75 (93%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    GVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  177
            GVSCPY+CSKR LDHGVLLVGYG+A +APIR+K+KPYW+IKNSWG +WGE GYYK+CRG 
Sbjct  292  GVSCPYVCSKRNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENGYYKLCRGH  351

Query  178  NICGVDSMVSTVAAV  222
            N+CG+++MVSTVAA+
Sbjct  352  NVCGINNMVSTVAAI  366



>gb|ABK21238.1| unknown [Picea sitchensis]
 gb|ABR16087.1| unknown [Picea sitchensis]
 gb|ABR17330.1| unknown [Picea sitchensis]
 gb|ABR17545.1| unknown [Picea sitchensis]
 gb|ACN40765.1| unknown [Picea sitchensis]
Length=366

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 70/75 (93%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    GVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  177
            GVSCPY+CSKR LDHGVLLVGYG+A +APIR+K+KPYW+IKNSWG +WGE GYYK+CRG 
Sbjct  292  GVSCPYVCSKRNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENGYYKLCRGH  351

Query  178  NICGVDSMVSTVAAV  222
            N+CG+++MVSTVAA+
Sbjct  352  NVCGINNMVSTVAAI  366



>gb|EMT10192.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=369

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 69/79 (87%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG--  174
            GVSCPYIC + LDHGVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYKICRG  
Sbjct  287  GVSCPYICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSN  346

Query  175  -RNICGVDSMVSTVAAVNT  228
             RN CGVDSMVSTV+A + 
Sbjct  347  VRNKCGVDSMVSTVSATHA  365



>ref|XP_003607150.1| Cysteine proteinase [Medicago truncatula]
Length=326

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 66/78 (85%), Gaps = 4/78 (5%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPY C++RLDHGVLLVGYGS  Y     KEKPYWI+K+SWGE+WGE GYYKICRGRN
Sbjct  252  GVSCPYTCTRRLDHGVLLVGYGSGAYT----KEKPYWIVKSSWGETWGENGYYKICRGRN  307

Query  181  ICGVDSMVSTVAAVNTPT  234
            ICGVDSMVSTVAA  T T
Sbjct  308  ICGVDSMVSTVAAAQTTT  325



>gb|ABK24688.1| unknown [Picea sitchensis]
 gb|ACN39791.1| unknown [Picea sitchensis]
 gb|ACN40241.1| unknown [Picea sitchensis]
Length=366

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 70/75 (93%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    GVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  177
            GVSCPY+CSKR LDHGVLLVGYG+A +APIR+K+KPYW+IKNSWG +WGE GYYK+CRG 
Sbjct  292  GVSCPYVCSKRNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENGYYKLCRGH  351

Query  178  NICGVDSMVSTVAAV  222
            N+CG+++MVSTVAA+
Sbjct  352  NVCGINNMVSTVAAI  366



>gb|AAW21813.1| cysteine protease [Triticum aestivum]
Length=377

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 69/79 (87%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG--  174
            GVSCPYIC + LDHGVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYKICRG  
Sbjct  295  GVSCPYICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSN  354

Query  175  -RNICGVDSMVSTVAAVNT  228
             RN CGVDSMVSTV+A + 
Sbjct  355  VRNKCGVDSMVSTVSATHA  373



>gb|AAZ32411.1| cysteine proteinase glycinain type [Nicotiana benthamiana]
Length=355

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG N
Sbjct  285  GVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHN  344

Query  181  ICGVDSMVSTV  213
            ICGVD+MVSTV
Sbjct  345  ICGVDAMVSTV  355



>gb|EPS70818.1| cysteine proteinase, partial [Genlisea aurea]
Length=355

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 70/77 (91%), Gaps = 1/77 (1%)
 Frame = +1

Query  1    GVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  177
            GVSCP +C K  LDHGVL+VGYGS+GYAPIRLK KPYWI+KNSWG++WGEKGYYKICRG 
Sbjct  279  GVSCPLVCGKSNLDHGVLMVGYGSSGYAPIRLKNKPYWIVKNSWGKNWGEKGYYKICRGS  338

Query  178  NICGVDSMVSTVAAVNT  228
            NICGV+SMVSTV A+++
Sbjct  339  NICGVESMVSTVTAIHS  355



>dbj|BAD10859.1| cysteine protease [Aster tripolium]
Length=363

 Score =   132 bits (331),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = +1

Query  4    VSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            VSCPYICSK ++DHGVLLVGYGSAGYAP+R KEKPYWIIKNSWGE WGE GYYK+C G N
Sbjct  288  VSCPYICSKTKMDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGEDWGEDGYYKLCSGYN  347

Query  181  ICGVDSMVSTVAAVNT  228
             CG+D+MVS V + NT
Sbjct  348  ACGMDTMVSAVVSTNT  363



>gb|EPS65881.1| cysteine proteinase, partial [Genlisea aurea]
Length=335

 Score =   131 bits (330),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 69/74 (93%), Gaps = 1/74 (1%)
 Frame = +1

Query  1    GVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  177
            GVSCP IC K RLDHG+L+VGYG++GYAPIRLKEKPYWI+KNSWGE+WGE+GYYKIC+G 
Sbjct  262  GVSCPLICMKTRLDHGILIVGYGASGYAPIRLKEKPYWIVKNSWGENWGEQGYYKICKGH  321

Query  178  NICGVDSMVSTVAA  219
            N+CGV+S+VSTV A
Sbjct  322  NVCGVESLVSTVTA  335



>gb|AAB16997.1| thiol protease isoform A, partial [Glycine max]
Length=318

 Score =   130 bits (328),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK-GYYKICRGR  177
            GVSCPYIC K LDHGVLLVGYG   YAPIR K KPYWIIKNSWGESWGE  GY +ICRGR
Sbjct  239  GVSCPYICGKHLDHGVLLVGYGEGRYAPIRFKNKPYWIIKNSWGESWGENDGYDEICRGR  298

Query  178  NICGVDSMVSTVAAV  222
            N+CGVD+MVSTVAA+
Sbjct  299  NVCGVDAMVSTVAAI  313



>gb|ADY04293.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04297.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   126 bits (317),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGS+GY+P+RLKEKPYWIIKNSWG+ WGE+G+YKICRGRN
Sbjct  82   GVSCPYICSKRLDHGVLLVGYGSSGYSPVRLKEKPYWIIKNSWGDKWGEEGFYKICRGRN  141

Query  181  ICG  189
            ICG
Sbjct  142  ICG  144



>ref|XP_009786000.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana sylvestris]
Length=370

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 64/67 (96%), Gaps = 1/67 (1%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSK+LDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKICRGRN
Sbjct  293  GVSCPYICSKKLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGENGYYKICRGRN  351

Query  181  ICGVDSM  201
            +CGVDSM
Sbjct  352  VCGVDSM  358



>gb|ADY04361.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   126 bits (316),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICRGRN
Sbjct  82   GVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKICRGRN  141

Query  181  ICG  189
            ICG
Sbjct  142  ICG  144



>gb|ADY04342.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   125 bits (315),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICRGRN
Sbjct  82   GVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKICRGRN  141

Query  181  ICG  189
            ICG
Sbjct  142  ICG  144



>gb|ADY04336.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04343.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   125 bits (315),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICRGRN
Sbjct  82   GVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKICRGRN  141

Query  181  ICG  189
            ICG
Sbjct  142  ICG  144



>emb|CAQ00101.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=381

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 68/79 (86%), Gaps = 4/79 (5%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG--  174
            GVSCPYIC + LDH V LVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYKICRG  
Sbjct  300  GVSCPYICGRHLDH-VFLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKICRGPH  358

Query  175  -RNICGVDSMVSTVAAVNT  228
             +N CGVDSMVSTV A++T
Sbjct  359  VKNKCGVDSMVSTVTAIHT  377



>gb|ADY04262.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04263.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04264.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04265.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04266.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04267.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04269.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04270.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04271.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04272.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04273.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04274.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04275.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04276.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04277.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04278.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04279.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04280.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04281.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04282.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04283.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04284.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04285.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04286.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04287.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04288.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04289.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04290.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04291.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04292.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04294.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04296.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04298.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04299.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04300.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04301.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04302.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04303.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04304.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04305.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04306.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04307.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04308.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04309.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04310.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04311.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04312.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04313.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04314.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04315.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04316.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04317.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04318.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04319.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04320.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04321.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04322.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04323.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04324.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04325.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04326.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04327.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04328.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04329.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04330.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04331.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04332.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04333.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04334.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04335.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04337.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04338.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04339.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04340.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04341.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04344.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04345.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04346.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04347.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04348.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04349.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04350.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04351.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04352.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04353.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04354.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04355.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04356.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04357.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04360.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04362.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04363.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04364.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04365.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04366.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04367.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04369.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04370.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04371.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04372.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04373.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04374.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04377.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04378.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04379.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04380.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04381.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04382.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04383.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04384.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04385.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04386.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04387.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04388.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04389.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04391.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04392.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04393.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04394.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04395.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04396.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04397.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04398.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04399.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04400.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04401.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04402.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04403.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04404.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04405.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04406.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04407.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04408.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04409.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04410.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04411.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04412.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04413.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04415.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04416.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04417.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04418.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04419.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04420.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04421.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04422.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04423.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04424.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04425.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04426.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04427.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04428.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04429.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04430.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04431.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04432.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04433.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04434.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04435.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04436.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04437.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04438.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04439.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04440.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04441.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04442.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04443.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04444.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04445.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04446.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04447.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04448.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04449.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04450.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04451.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04452.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04453.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04454.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04455.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04456.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04458.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04459.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04460.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04461.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04462.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04463.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04464.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04465.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04466.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04467.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04468.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04469.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04470.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04471.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04472.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04473.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04474.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04475.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04476.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04478.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04481.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04483.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04484.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04485.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04486.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04487.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04488.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04489.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04491.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04493.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04501.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04502.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04503.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04504.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04505.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04506.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04507.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04508.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04509.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04510.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04511.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04512.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04513.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04514.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04515.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04516.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04517.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04518.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   125 bits (315),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICRGRN
Sbjct  82   GVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKICRGRN  141

Query  181  ICG  189
            ICG
Sbjct  142  ICG  144



>gb|ADY04457.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   125 bits (315),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICRGRN
Sbjct  82   GVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKICRGRN  141

Query  181  ICG  189
            ICG
Sbjct  142  ICG  144



>gb|ADY04414.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   125 bits (315),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICRGRN
Sbjct  82   GVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKICRGRN  141

Query  181  ICG  189
            ICG
Sbjct  142  ICG  144



>emb|CDX98179.1| BnaC07g09190D [Brassica napus]
Length=72

 Score =   123 bits (309),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +1

Query  28   KRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVS  207
            +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKICRGRN+CGVDS+VS
Sbjct  2    RRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEDGFYKICRGRNVCGVDSLVS  61

Query  208  TVAAVNTPTS  237
            TV A  +P +
Sbjct  62   TVTATVSPAA  71



>gb|ADY04359.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   125 bits (314),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICRGRN
Sbjct  82   GVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDRWGEEGFYKICRGRN  141

Query  181  ICG  189
            ICG
Sbjct  142  ICG  144



>gb|ADY04482.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   125 bits (314),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICRGRN
Sbjct  82   GVSCPYICSKRLDHGVLLVGYGSSGYSPVRVKEKPYWIIKNSWGDKWGEEGFYKICRGRN  141

Query  181  ICG  189
            ICG
Sbjct  142  ICG  144



>dbj|BAC57957.1| thiol protease [Aster tripolium]
Length=188

 Score =   126 bits (317),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = +1

Query  4    VSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            VSCPY+CSK+ LDHGVLLVGYGSAGYAP RLKEKPYWIIKNSWG  WGE GYYKIC G N
Sbjct  113  VSCPYVCSKKPLDHGVLLVGYGSAGYAPSRLKEKPYWIIKNSWGPDWGEDGYYKICSGHN  172

Query  181  ICGVDSMVSTVAAVNT  228
            +CG+D+MVS V + + 
Sbjct  173  LCGMDTMVSAVVSTSA  188



>gb|ADY04358.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   125 bits (313),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYG++GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICRGRN
Sbjct  82   GVSCPYICSKRLDHGVLLVGYGTSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKICRGRN  141

Query  181  ICG  189
            ICG
Sbjct  142  ICG  144



>gb|ADY04368.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04375.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04376.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04390.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04477.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04479.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   125 bits (313),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG  WGE+G+YKICRGRN
Sbjct  82   GVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGNKWGEEGFYKICRGRN  141

Query  181  ICG  189
            ICG
Sbjct  142  ICG  144



>gb|ADY04480.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   124 bits (312),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGS+GY+P+++KEKPYWIIKNSWG+ WGE+G+YKICRGRN
Sbjct  82   GVSCPYICSKRLDHGVLLVGYGSSGYSPVKMKEKPYWIIKNSWGDKWGEEGFYKICRGRN  141

Query  181  ICG  189
            ICG
Sbjct  142  ICG  144



>gb|ADY04268.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   124 bits (311),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKP+WIIKNSWG+ WGE+G+YKICRGRN
Sbjct  82   GVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPHWIIKNSWGDKWGEEGFYKICRGRN  141

Query  181  ICG  189
            ICG
Sbjct  142  ICG  144



>gb|ADY04295.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   124 bits (310),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  180
            GVSCPYICSKRLDHGVLLVGYGS+GY+P+ +KEKPYWIIKNSWG+ WGE+G+YKICRGRN
Sbjct  82   GVSCPYICSKRLDHGVLLVGYGSSGYSPVSMKEKPYWIIKNSWGDKWGEEGFYKICRGRN  141

Query  181  ICG  189
            ICG
Sbjct  142  ICG  144



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562275868875