BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP010F02 445 bp,:Filtered

Length=445
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAK27969.1|AF242373_1  cysteine protease                             166   1e-46   Ipomoea batatas [batate]
gb|AAF61440.1|AF138264_1  papain-like cysteine proteinase isoform I     166   1e-46   Ipomoea batatas [batate]
gb|AAF40414.1|AF216783_1  papain-like cysteine proteinase isoform I     166   1e-46   Ipomoea batatas [batate]
gb|AAF40415.1|AF216784_1  papain-like cysteine proteinase isoform II    166   1e-46   Ipomoea batatas [batate]
gb|AAF61441.1|AF138265_1  papain-like cysteine proteinase isoform II    166   2e-46   Ipomoea batatas [batate]
gb|AAF40416.1|AF216785_1  papain-like cysteine proteinase isoform...    166   2e-46   Ipomoea batatas [batate]
gb|KDP41743.1|  hypothetical protein JCGZ_26761                         161   1e-44   Jatropha curcas
ref|XP_002512963.1|  cysteine protease, putative                        161   1e-44   Ricinus communis
sp|P05993.1|PAPA5_CARPA  RecName: Full=Cysteine proteinase; AltNa...    152   2e-44   Carica papaya [mamon]
gb|KHG24064.1|  Cysteinease RD19a -like protein                         160   3e-44   Gossypium arboreum [tree cotton]
gb|AIB06024.1|  CP2                                                     159   5e-44   Hevea brasiliensis [jebe]
gb|AAX19661.1|  cysteine proteinase                                     159   6e-44   Populus tomentosa [Chinese white poplar]
gb|ABQ10201.1|  cysteine protease Cp3                                   159   7e-44   Actinidia deliciosa [Chinese gooseberry]
gb|KJB32561.1|  hypothetical protein B456_005G247000                    159   7e-44   Gossypium raimondii
ref|XP_011047717.1|  PREDICTED: cysteine proteinase RD19a               159   8e-44   Populus euphratica
gb|ABK96252.1|  unknown                                                 152   1e-43   Populus trichocarpa x Populus deltoides
emb|CDP20652.1|  unnamed protein product                                158   1e-43   Coffea canephora [robusta coffee]
gb|KJB79047.1|  hypothetical protein B456_013G033800                    158   1e-43   Gossypium raimondii
emb|CAE54306.1|  putative papain-like cysteine proteinase               158   1e-43   Gossypium hirsutum [American cotton]
gb|KHG15253.1|  Cysteinease RD19a -like protein                         158   2e-43   Gossypium arboreum [tree cotton]
ref|NP_001267989.1|  cysteine protease precursor                        158   2e-43   Vitis vinifera
ref|XP_002313770.1|  cysteine proteinase A494 precursor                 157   3e-43   Populus trichocarpa [western balsam poplar]
gb|ABK92536.1|  unknown                                                 157   3e-43   Populus trichocarpa [western balsam poplar]
ref|XP_007042077.1|  Papain family cysteine protease                    157   3e-43   Theobroma cacao [chocolate]
ref|XP_003606998.1|  Cysteine proteinase                                157   4e-43   Medicago truncatula
ref|XP_009351218.1|  PREDICTED: cysteine proteinase RD19a-like          155   4e-43   Pyrus x bretschneideri [bai li]
ref|XP_009373025.1|  PREDICTED: cysteine proteinase RD19a-like          157   4e-43   Pyrus x bretschneideri [bai li]
ref|XP_004290288.1|  PREDICTED: probable cysteine proteinase A494       156   6e-43   Fragaria vesca subsp. vesca
ref|XP_006487337.1|  PREDICTED: cysteine proteinase RD19a-like          156   7e-43   Citrus sinensis [apfelsine]
ref|XP_009373000.1|  PREDICTED: cysteine proteinase RD19a               156   7e-43   Pyrus x bretschneideri [bai li]
ref|XP_008382317.1|  PREDICTED: cysteine proteinase RD19a               156   7e-43   Malus domestica [apple tree]
gb|KDO49483.1|  hypothetical protein CISIN_1g017318mg                   156   7e-43   Citrus sinensis [apfelsine]
ref|XP_008236965.1|  PREDICTED: cysteine proteinase RD19a               156   7e-43   Prunus mume [ume]
gb|KHN39817.1|  Cysteine proteinase RD19a                               155   7e-43   Glycine soja [wild soybean]
ref|XP_007201310.1|  hypothetical protein PRUPE_ppa007454mg             156   8e-43   Prunus persica
ref|XP_010271520.1|  PREDICTED: cysteine proteinase RD19a-like          156   9e-43   Nelumbo nucifera [Indian lotus]
gb|ACI04578.1|  cysteine protease-like protein                          155   9e-43   Robinia pseudoacacia [black locust]
ref|XP_003539008.1|  PREDICTED: cysteine proteinase RD19a-like          155   1e-42   Glycine max [soybeans]
ref|XP_011028940.1|  PREDICTED: cysteine proteinase 15A-like            155   1e-42   Populus euphratica
ref|XP_006423403.1|  hypothetical protein CICLE_v10028670mg             155   1e-42   Citrus clementina
ref|XP_004507484.1|  PREDICTED: cysteine proteinase RD19a-like          155   1e-42   Cicer arietinum [garbanzo]
gb|AAL69389.1|AF462226_1  putative cysteine proteinase                  149   1e-42   Narcissus pseudonarcissus
ref|XP_010028631.1|  PREDICTED: cysteine proteinase RD19a-like          155   2e-42   Eucalyptus grandis [rose gum]
ref|XP_011088458.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    155   2e-42   Sesamum indicum [beniseed]
ref|XP_011037175.1|  PREDICTED: cysteine proteinase RD19a-like          155   2e-42   Populus euphratica
gb|ABK96580.1|  unknown                                                 155   2e-42   Populus trichocarpa x Populus deltoides
gb|AAR92156.1|  putative cysteine protease 3                            153   2e-42   Iris x hollandica [Dutch iris]
ref|XP_010066197.1|  PREDICTED: probable cysteine proteinase A494       155   2e-42   Eucalyptus grandis [rose gum]
ref|XP_002302004.2|  hypothetical protein POPTR_0002s03020g             154   3e-42   Populus trichocarpa [western balsam poplar]
gb|ABK94801.1|  unknown                                                 154   3e-42   Populus trichocarpa [western balsam poplar]
ref|XP_002305451.2|  cysteine proteinase A494 precursor                 154   3e-42   Populus trichocarpa [western balsam poplar]
ref|XP_007131787.1|  hypothetical protein PHAVU_011G041600g             154   4e-42   Phaseolus vulgaris [French bean]
ref|XP_009406357.1|  PREDICTED: cysteine proteinase 1-like              154   4e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011092831.1|  PREDICTED: cysteine proteinase RD19a-like          154   5e-42   Sesamum indicum [beniseed]
emb|CDQ51995.1|  Cysteine proteinase                                    148   7e-42   Fagus sylvatica
gb|ABK93575.1|  unknown                                                 147   9e-42   Populus trichocarpa [western balsam poplar]
gb|AJP16692.1|  cysteine protease                                       147   1e-41   Striga hermonthica [purple witchweed]
ref|XP_010061009.1|  PREDICTED: cysteine proteinase RD19a-like          153   1e-41   Eucalyptus grandis [rose gum]
gb|AAU81591.1|  cysteine proteinase                                     147   2e-41   Petunia x hybrida [garden petunia]
ref|XP_002510469.1|  cysteine protease, putative                        152   2e-41   Ricinus communis
dbj|BAD94010.1|  drought-inducible cysteine proteinase RD19A prec...    144   3e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009376976.1|  PREDICTED: cysteine proteinase RD19a-like          153   3e-41   Pyrus x bretschneideri [bai li]
ref|XP_004165230.1|  PREDICTED: cysteine proteinase RD19a-like          152   3e-41   
gb|KGN43159.1|  Papain-like cysteine proteinase isoform I               152   3e-41   Cucumis sativus [cucumbers]
ref|XP_004148554.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    152   3e-41   
ref|XP_003540987.1|  PREDICTED: cysteine proteinase RD19a-like          151   4e-41   Glycine max [soybeans]
ref|XP_009376977.1|  PREDICTED: cysteine proteinase RD19a-like          153   4e-41   Pyrus x bretschneideri [bai li]
ref|XP_010268619.1|  PREDICTED: cysteine proteinase RD19a-like          151   5e-41   Nelumbo nucifera [Indian lotus]
dbj|BAJ53178.1|  JHL18I08.12                                            151   5e-41   Jatropha curcas
ref|XP_002280798.2|  PREDICTED: cysteine proteinase 15A                 151   5e-41   Vitis vinifera
ref|XP_004150061.1|  PREDICTED: cysteine proteinase RD19a-like          151   6e-41   Cucumis sativus [cucumbers]
gb|AAU81589.1|  cysteine proteinase                                     148   7e-41   Petunia x hybrida [garden petunia]
ref|XP_003523684.1|  PREDICTED: cysteine proteinase 15A-like            150   9e-41   Glycine max [soybeans]
ref|NP_001241450.1|  uncharacterized protein LOC100778716 precursor     150   9e-41   Glycine max [soybeans]
gb|KHN45894.1|  Cysteine proteinase RD19a                               150   1e-40   Glycine soja [wild soybean]
gb|ABF46642.1|  papain-like cysteine proteinase                         150   1e-40   Pachysandra terminalis
gb|EYU37835.1|  hypothetical protein MIMGU_mgv1a008237mg                150   1e-40   Erythranthe guttata [common monkey flower]
ref|XP_002275759.1|  PREDICTED: cysteine proteinase RD19a               150   1e-40   Vitis vinifera
ref|XP_010910124.1|  PREDICTED: cysteine proteinase 1-like              150   2e-40   Elaeis guineensis
ref|XP_010530325.1|  PREDICTED: cysteine proteinase RD19a               150   2e-40   Tarenaya hassleriana [spider flower]
ref|XP_008775532.1|  PREDICTED: cysteine proteinase 1-like              150   2e-40   Phoenix dactylifera
ref|XP_010531457.1|  PREDICTED: probable cysteine proteinase A494       150   2e-40   Tarenaya hassleriana [spider flower]
dbj|BAC41322.1|  hypothetical protein                                   149   2e-40   Lotus japonicus
gb|AAL05851.1|AF411121_1  cysteine proteinase precursor                 149   2e-40   Sandersonia aurantiaca [Chinese-lantern lily]
ref|XP_008460996.1|  PREDICTED: cysteine proteinase RD19a-like          150   2e-40   Cucumis melo [Oriental melon]
ref|XP_009392632.1|  PREDICTED: cysteine proteinase 1-like              149   2e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN12668.1|  Cysteine proteinase 15A                                 144   2e-40   Glycine soja [wild soybean]
gb|EYU42593.1|  hypothetical protein MIMGU_mgv1a008336mg                150   3e-40   Erythranthe guttata [common monkey flower]
ref|XP_011045161.1|  PREDICTED: cysteine proteinase 15A-like            149   3e-40   Populus euphratica
gb|KHN25410.1|  Cysteine proteinase RD19a                               149   3e-40   Glycine soja [wild soybean]
emb|CAE45588.1|  papain-like cysteine proteinase-like protein 1         149   3e-40   Lotus japonicus
ref|XP_009602233.1|  PREDICTED: cysteine proteinase RD19a-like          149   3e-40   Nicotiana tomentosiformis
ref|XP_002306900.1|  hypothetical protein POPTR_0005s25540g             149   3e-40   Populus trichocarpa [western balsam poplar]
dbj|BAF98584.1|  CM0216.500.nc                                          149   4e-40   Lotus japonicus
ref|XP_007017672.1|  Papain family cysteine protease                    149   4e-40   Theobroma cacao [chocolate]
ref|XP_008448073.1|  PREDICTED: cysteine proteinase RD19a-like          149   4e-40   Cucumis melo [Oriental melon]
gb|KHN22211.1|  Cysteine proteinase 15A                                 149   5e-40   Glycine soja [wild soybean]
ref|XP_009109502.1|  PREDICTED: cysteine proteinase RD19a-like          149   5e-40   Brassica rapa
emb|CAE45589.1|  papain-like cysteine proteinase-like protein 2         148   6e-40   Lotus japonicus
gb|AGV54334.1|  cysteine proteinase RD19a-like protein                  148   6e-40   Phaseolus vulgaris [French bean]
ref|XP_006362019.1|  PREDICTED: cysteine proteinase RD19a-like          148   7e-40   Solanum tuberosum [potatoes]
gb|KJB07487.1|  hypothetical protein B456_001G026600                    149   7e-40   Gossypium raimondii
ref|XP_007136047.1|  hypothetical protein PHAVU_009G013600g             148   7e-40   Phaseolus vulgaris [French bean]
gb|AAB62937.1|  stress-induced cysteine proteinase                      143   7e-40   Lavatera thuringiaca
ref|XP_004291404.1|  PREDICTED: cysteine proteinase 15A-like            148   7e-40   Fragaria vesca subsp. vesca
ref|XP_004230928.1|  PREDICTED: cysteine proteinase RD19a               148   8e-40   Solanum lycopersicum
ref|XP_006473584.1|  PREDICTED: cysteine proteinase 15A-like            148   8e-40   Citrus sinensis [apfelsine]
ref|XP_010105270.1|  Cysteine proteinase 15A                            148   8e-40   Morus notabilis
dbj|BAF98585.1|  CM0216.510.nc                                          148   8e-40   Lotus japonicus
gb|AAM65162.1|  cysteine proteinase RD19A                               148   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568052.1|  cysteine proteinase RD19a                             148   1e-39   Arabidopsis thaliana [mouse-ear cress]
gb|KDO84720.1|  hypothetical protein CISIN_1g017548mg                   148   1e-39   Citrus sinensis [apfelsine]
ref|XP_006435090.1|  hypothetical protein CICLE_v10001559mg             147   1e-39   Citrus clementina
gb|AIB06025.1|  CP3                                                     147   1e-39   Hevea brasiliensis [jebe]
ref|XP_006828787.1|  hypothetical protein AMTR_s00001p00114210          147   2e-39   Amborella trichopoda
ref|XP_007160702.1|  hypothetical protein PHAVU_001G009900g             147   2e-39   Phaseolus vulgaris [French bean]
emb|CDY71205.1|  BnaCnng71840D                                          147   2e-39   Brassica napus [oilseed rape]
gb|AAL60581.1|AF454959_1  senescence-associated cysteine protease       147   2e-39   Brassica oleracea
ref|XP_006411706.1|  hypothetical protein EUTSA_v10025494mg             147   2e-39   Eutrema salsugineum
ref|XP_008387995.1|  PREDICTED: cysteine proteinase 15A                 147   2e-39   Malus domestica [apple tree]
gb|KFK30492.1|  hypothetical protein AALP_AA7G268600                    147   2e-39   Arabis alpina [alpine rockcress]
dbj|BAF03553.1|  cysteine proteinase CP2                                147   3e-39   Phaseolus vulgaris [French bean]
ref|XP_009146338.1|  PREDICTED: cysteine proteinase 15A-like            147   3e-39   Brassica rapa
emb|CDY34441.1|  BnaC01g21920D                                          146   4e-39   Brassica napus [oilseed rape]
emb|CAB53397.1|  cysteine protease                                      142   4e-39   Medicago sativa [alfalfa]
dbj|BAF46302.1|  cysteine proteinase precursor                          146   4e-39   Ipomoea nil [qian niu]
ref|XP_006283963.1|  hypothetical protein CARUB_v10005086mg             146   5e-39   Capsella rubella
ref|XP_002868883.1|  hypothetical protein ARALYDRAFT_490677             146   6e-39   Arabidopsis lyrata subsp. lyrata
gb|ACX54787.2|  cysteine protease                                       145   7e-39   Arachis diogoi
ref|XP_002280808.2|  PREDICTED: cysteine proteinase 15A                 145   8e-39   Vitis vinifera
ref|XP_003550405.2|  PREDICTED: cysteine proteinase 15A                 146   8e-39   
emb|CDY41960.1|  BnaA01g05320D                                          145   9e-39   Brassica napus [oilseed rape]
gb|ACK57563.1|  cysteine protease-like protein                          145   1e-38   Arachis hypogaea [goober]
dbj|BAA92495.1|  cysteine protease                                      145   1e-38   Vigna mungo [urad dal]
ref|XP_010446443.1|  PREDICTED: cysteine proteinase RD19a               145   1e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010431862.1|  PREDICTED: cysteine proteinase RD19a               145   1e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010437007.1|  PREDICTED: cysteine proteinase RD19a-like          145   1e-38   Camelina sativa [gold-of-pleasure]
ref|XP_006665032.1|  PREDICTED: cysteine proteinase 1-like              140   1e-38   
ref|XP_010440192.1|  PREDICTED: cysteine proteinase RD19a-like          145   1e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010449835.1|  PREDICTED: cysteine proteinase 15A-like            145   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_008775280.1|  PREDICTED: cysteine proteinase 1-like              144   2e-38   Phoenix dactylifera
ref|XP_003545051.1|  PREDICTED: cysteine proteinase 15A-like            144   2e-38   Glycine max [soybeans]
ref|XP_010434865.1|  PREDICTED: cysteine proteinase 15A-like            144   2e-38   Camelina sativa [gold-of-pleasure]
gb|AAD29084.1|AF082181_1  cysteine proteinase precursor                 144   2e-38   Solanum melongena [aubergine]
gb|ACM80348.1|  cysteine proteinase                                     144   2e-38   Solanum lycopersicum
emb|CAA52403.1|  putative thiol protease                                143   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011083631.1|  PREDICTED: cysteine proteinase 15A-like            144   2e-38   Sesamum indicum [beniseed]
ref|XP_009150026.1|  PREDICTED: cysteine proteinase RD19a               144   2e-38   Brassica rapa
dbj|BAD43619.1|  putative cysteine proteinase                           144   3e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003589348.1|  Cysteine proteinase                                144   3e-38   Medicago truncatula
ref|NP_565512.1|  Papain family cysteine protease                       144   3e-38   Arabidopsis thaliana [mouse-ear cress]
emb|CDY09707.1|  BnaC07g33540D                                          144   3e-38   Brassica napus [oilseed rape]
emb|CAB17075.1|  cysteine proteinase precursor                          144   4e-38   Phaseolus vulgaris [French bean]
ref|XP_006653265.1|  PREDICTED: cysteine proteinase 1-like              144   4e-38   
ref|XP_009335626.1|  PREDICTED: cysteine proteinase 15A                 144   4e-38   Pyrus x bretschneideri [bai li]
ref|XP_008221329.1|  PREDICTED: cysteine proteinase 15A-like            144   4e-38   Prunus mume [ume]
emb|CDP07452.1|  unnamed protein product                                144   4e-38   Coffea canephora [robusta coffee]
ref|XP_010943608.1|  PREDICTED: cysteine proteinase 1-like              144   4e-38   Elaeis guineensis
gb|KJB29611.1|  hypothetical protein B456_005G110200                    144   4e-38   Gossypium raimondii
gb|AAQ81938.1|  cysteine proteinase precursor                           143   5e-38   Ipomoea batatas [batate]
ref|XP_010672379.1|  PREDICTED: cysteine proteinase RD19a-like          143   5e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007223351.1|  hypothetical protein PRUPE_ppa007441mg             143   7e-38   Prunus persica
sp|P25804.1|CYSP_PEA  RecName: Full=Cysteine proteinase 15A; AltN...    143   8e-38   Pisum sativum [garden pea]
ref|XP_002880378.1|  hypothetical protein ARALYDRAFT_481008             142   1e-37   Arabidopsis lyrata subsp. lyrata
emb|CAA82995.1|  cysteine proteinase                                    142   1e-37   Vicia sativa [spring vetch]
emb|CDX99593.1|  BnaC04g33500D                                          142   1e-37   Brassica napus [oilseed rape]
gb|AAB67878.1|  pre-pro-cysteine proteinase                             142   1e-37   Vicia faba [broad bean]
gb|KHG15062.1|  Cysteinease RD19a -like protein                         142   1e-37   Gossypium arboreum [tree cotton]
gb|AAO11786.1|  pre-pro cysteine proteinase                             142   1e-37   Vicia faba [broad bean]
gb|AGS43121.1|  cysteine protease 1                                     135   1e-37   Zea mays [maize]
ref|XP_006283974.1|  hypothetical protein CARUB_v10005098mg             142   1e-37   Capsella rubella
emb|CAD40319.2|  OSJNBb0054B09.3                                        142   2e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009140277.1|  PREDICTED: probable cysteine proteinase A494       142   2e-37   Brassica rapa
ref|XP_009136751.1|  PREDICTED: cysteine proteinase RD19a-like          142   2e-37   Brassica rapa
emb|CDY15894.1|  BnaA04g12170D                                          142   2e-37   Brassica napus [oilseed rape]
emb|CAA57675.1|  cysteine proteinase                                    136   2e-37   Zea mays [maize]
ref|NP_001266121.1|  uncharacterized protein LOC101501911 precursor     142   2e-37   Cicer arietinum [garbanzo]
emb|CDX90537.1|  BnaA03g42440D                                          142   2e-37   Brassica napus [oilseed rape]
gb|EAY93546.1|  hypothetical protein OsI_15336                          141   2e-37   Oryza sativa Indica Group [Indian rice]
gb|AJA74415.1|  cysteine protease                                       142   2e-37   Cicer arietinum [garbanzo]
gb|KJB58164.1|  hypothetical protein B456_009G197400                    142   2e-37   Gossypium raimondii
ref|XP_006414378.1|  hypothetical protein EUTSA_v10025521mg             142   2e-37   Eutrema salsugineum
gb|EEE60725.1|  hypothetical protein OsJ_14236                          142   2e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006404590.1|  hypothetical protein EUTSA_v10000210mg             142   2e-37   Eutrema salsugineum
ref|XP_008444769.1|  PREDICTED: cysteine proteinase RD19a-like          142   2e-37   Cucumis melo [Oriental melon]
ref|XP_002452058.1|  hypothetical protein SORBIDRAFT_04g017830          142   2e-37   Sorghum bicolor [broomcorn]
gb|EMT16425.1|  Cysteine proteinase 1                                   142   2e-37   Aegilops tauschii
ref|XP_009611293.1|  PREDICTED: cysteine proteinase 15A-like            141   2e-37   Nicotiana tomentosiformis
gb|AAK07731.1|  CPR2-like cysteine proteinase                           141   3e-37   Nicotiana tabacum [American tobacco]
emb|CAA78365.1|  tobacco pre-pro-cysteine proteinase                    141   3e-37   Nicotiana tabacum [American tobacco]
emb|CAA78361.1|  tobacco pre-pro-cysteine proteinase                    141   3e-37   Nicotiana tabacum [American tobacco]
ref|XP_009776238.1|  PREDICTED: cysteine proteinase 15A-like            141   3e-37   Nicotiana sylvestris
ref|XP_004952477.1|  PREDICTED: cysteine proteinase 1-like              141   3e-37   Setaria italica
ref|XP_003579573.2|  PREDICTED: cysteine proteinase 1-like              142   4e-37   Brachypodium distachyon [annual false brome]
ref|NP_001052440.1|  Os04g0311400                                       141   4e-37   
gb|AEX97108.1|  cysteine proteinase                                     134   6e-37   Malus domestica [apple tree]
gb|AAB16996.1|  thiol protease isoform B                                139   6e-37   Glycine max [soybeans]
gb|KFK24413.1|  hypothetical protein AALP_AAs58848U000200               140   6e-37   Arabis alpina [alpine rockcress]
ref|XP_009405542.1|  PREDICTED: cysteine proteinase 1-like              140   7e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS53996.1|  Cysteine proteinase 1                                   141   7e-37   Triticum urartu
ref|NP_567489.1|  papain family cysteine protease                       140   9e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870174.1|  hypothetical protein ARALYDRAFT_915142             140   1e-36   Arabidopsis lyrata subsp. lyrata
ref|XP_004975256.1|  PREDICTED: cysteine proteinase 1-like              140   1e-36   Setaria italica
gb|ACF86683.1|  unknown                                                 140   1e-36   Zea mays [maize]
ref|NP_001105685.1|  cysteine proteinase 1 precursor                    139   1e-36   Zea mays [maize]
emb|CAH59428.1|  cysteine protease 2                                    137   1e-36   Plantago major [cart-track plant]
ref|XP_003607110.1|  Cysteine proteinase                                139   2e-36   Medicago truncatula
ref|XP_004238314.1|  PREDICTED: cysteine proteinase 15A                 139   2e-36   
gb|KEH30505.1|  papain family cysteine protease                         138   3e-36   Medicago truncatula
ref|XP_003574963.1|  PREDICTED: cysteine proteinase 1-like              139   3e-36   Brachypodium distachyon [annual false brome]
ref|XP_004152668.1|  PREDICTED: cysteine proteinase RD19a-like          139   3e-36   Cucumis sativus [cucumbers]
ref|XP_006341997.1|  PREDICTED: cysteine proteinase 15A-like            139   4e-36   Solanum tuberosum [potatoes]
gb|ABK24153.1|  unknown                                                 139   4e-36   Picea sitchensis
gb|EYU27644.1|  hypothetical protein MIMGU_mgv1a008452mg                138   5e-36   Erythranthe guttata [common monkey flower]
ref|NP_001046828.1|  Os02g0469600                                       138   7e-36   
emb|CAA78403.1|  pre-pro-cysteine proteinase                            137   9e-36   Solanum lycopersicum
dbj|BAG16515.1|  putative cysteine proteinase                           137   1e-35   Capsicum chinense [bonnet pepper]
gb|EMS64962.1|  Cysteine proteinase 1                                   135   1e-35   Triticum urartu
tpe|CAD66657.1|  TPA: putative cysteine proteinase precursor            137   2e-35   Hordeum vulgare subsp. vulgare [barley]
gb|ACN40679.1|  unknown                                                 137   2e-35   Picea sitchensis
gb|ABK24688.1|  unknown                                                 137   2e-35   Picea sitchensis
gb|ABK21238.1|  unknown                                                 137   2e-35   Picea sitchensis
gb|AAZ32411.1|  cysteine proteinase glycinain type                      136   2e-35   Nicotiana benthamiana
gb|EMT10192.1|  Cysteine proteinase 1                                   136   3e-35   Aegilops tauschii
gb|AAW21813.1|  cysteine protease                                       136   3e-35   Triticum aestivum [Canadian hard winter wheat]
gb|AES89347.2|  papain family cysteine protease                         135   4e-35   Medicago truncatula
ref|XP_003607150.1|  Cysteine proteinase                                135   4e-35   
ref|XP_002279862.1|  PREDICTED: cysteine proteinase RD19a               135   5e-35   Vitis vinifera
gb|AAB16997.1|  thiol protease isoform A                                134   8e-35   Glycine max [soybeans]
gb|ADY04293.1|  cysteine protease                                       129   9e-35   Clarkia xantiana subsp. xantiana
ref|XP_009786000.1|  PREDICTED: cysteine proteinase RD19a-like          134   1e-34   Nicotiana sylvestris
gb|ADY04361.1|  cysteine protease                                       129   1e-34   Clarkia xantiana subsp. xantiana
dbj|BAD10859.1|  cysteine protease                                      134   1e-34   Tripolium pannonicum [sea starwort]
gb|ADY04342.1|  cysteine protease                                       129   1e-34   Clarkia xantiana subsp. xantiana
gb|ADY04414.1|  cysteine protease                                       129   2e-34   Clarkia xantiana subsp. xantiana
gb|ADY04336.1|  cysteine protease                                       129   2e-34   Clarkia xantiana subsp. xantiana
gb|ADY04262.1|  cysteine protease                                       129   2e-34   Clarkia xantiana subsp. xantiana
gb|ADY04457.1|  cysteine protease                                       128   2e-34   Clarkia xantiana subsp. xantiana
emb|CAQ00101.1|  papain-like cysteine proteinase                        134   2e-34   Hordeum vulgare subsp. vulgare [barley]
gb|EPS70818.1|  cysteine proteinase                                     134   2e-34   Genlisea aurea
gb|ADY04359.1|  cysteine protease                                       128   2e-34   Clarkia xantiana subsp. xantiana
gb|ADY04482.1|  cysteine protease                                       128   3e-34   Clarkia xantiana subsp. xantiana
gb|ADY04358.1|  cysteine protease                                       128   3e-34   Clarkia xantiana subsp. xantiana
gb|ADY04368.1|  cysteine protease                                       127   3e-34   Clarkia xantiana subsp. xantiana
gb|ADY04480.1|  cysteine protease                                       127   4e-34   Clarkia xantiana subsp. xantiana
gb|EPS65881.1|  cysteine proteinase                                     132   4e-34   Genlisea aurea
gb|ADY04268.1|  cysteine protease                                       127   6e-34   Clarkia xantiana subsp. xantiana
dbj|BAC57957.1|  thiol protease                                         128   7e-34   Tripolium pannonicum [sea starwort]
gb|ADY04295.1|  cysteine protease                                       126   1e-33   Clarkia xantiana subsp. xantiana
emb|CDX98179.1|  BnaC07g09190D                                          124   1e-33   Brassica napus [oilseed rape]
gb|AAB53103.1|  cysteine protease                                       124   2e-33   Brassica napus [oilseed rape]
ref|XP_002960585.1|  hypothetical protein SELMODRAFT_266583             127   4e-32   Selaginella moellendorffii
ref|XP_002969223.1|  hypothetical protein SELMODRAFT_91274              127   6e-32   Selaginella moellendorffii
gb|ADY04490.1|  cysteine protease                                       117   6e-30   Clarkia xantiana subsp. xantiana
emb|CCA95098.1|  putative responsive to dehydration 19                  116   8e-30   Liriodendron tulipifera
ref|XP_008776953.1|  PREDICTED: cysteine proteinase-like                115   2e-29   Phoenix dactylifera
gb|KEH43476.1|  papain family cysteine protease                         120   2e-29   Medicago truncatula
ref|XP_010504326.1|  PREDICTED: cysteine proteinase 15A-like            120   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_006293095.1|  hypothetical protein CARUB_v10019394mg             120   2e-29   Capsella rubella
emb|CAB41090.1|  cysteine proteinase precursor-like protein             119   3e-29   Arabidopsis thaliana [mouse-ear cress]
gb|EMS59778.1|  Cysteine proteinase 15A                                 116   3e-29   Triticum urartu
ref|NP_567010.5|  Papain family cysteine protease                       119   4e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876278.1|  hypothetical protein ARALYDRAFT_485911             119   4e-29   Arabidopsis lyrata subsp. lyrata
ref|XP_010690815.1|  PREDICTED: cysteine proteinase RD19a               119   4e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008804021.1|  PREDICTED: cysteine proteinase RD19a-like          116   5e-29   Phoenix dactylifera
gb|KHN00877.1|  Cysteine proteinase 15A                                 119   5e-29   Glycine soja [wild soybean]
ref|XP_004496226.1|  PREDICTED: cysteine proteinase 15A-like            119   7e-29   Cicer arietinum [garbanzo]
ref|NP_001059639.1|  Os07g0480900                                       119   7e-29   
gb|KFK34737.1|  hypothetical protein AALP_AA5G186400                    119   7e-29   Arabis alpina [alpine rockcress]
ref|XP_002460693.1|  hypothetical protein SORBIDRAFT_02g033270          118   1e-28   Sorghum bicolor [broomcorn]
ref|XP_009404192.1|  PREDICTED: cysteine proteinase 15A                 117   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAB16316.1|  cysteine proteinase precursor                          117   2e-28   Vicia sativa [spring vetch]
gb|KHN37802.1|  Cysteine proteinase 1                                   117   3e-28   Glycine soja [wild soybean]
ref|XP_010534431.1|  PREDICTED: cysteine proteinase 15A                 117   3e-28   Tarenaya hassleriana [spider flower]
ref|XP_008802783.1|  PREDICTED: probable cysteine proteinase A494       117   5e-28   Phoenix dactylifera
gb|AAD46920.1|AF167986_1  putative cysteine proteinase GmPM33           116   5e-28   Glycine max [soybeans]
ref|NP_001236888.1|  cysteine proteinase precursor                      116   5e-28   Glycine max [soybeans]
ref|XP_004959670.1|  PREDICTED: cysteine proteinase 1-like              116   5e-28   Setaria italica
ref|XP_008354070.1|  PREDICTED: cysteine proteinase 15A-like            115   6e-28   Malus domestica [apple tree]
ref|XP_008362714.1|  PREDICTED: cysteine proteinase 15A                 115   8e-28   
gb|ABO93617.1|  papain-like cysteine proteinase                         111   9e-28   
tpg|DAA40800.1|  TPA: putative cysteine protease family protein         115   1e-27   
emb|CDX73424.1|  BnaC08g25790D                                          115   1e-27   
ref|XP_009116190.1|  PREDICTED: probable cysteine proteinase A494       115   1e-27   
emb|CDY56961.1|  BnaA09g55030D                                          115   1e-27   
emb|CAQ00102.1|  papain-like cysteine proteinase                        115   1e-27   
ref|XP_009117680.1|  PREDICTED: probable cysteine proteinase A494       115   2e-27   
ref|XP_003560213.1|  PREDICTED: cysteine proteinase 1                   115   2e-27   
ref|XP_001781954.1|  predicted protein                                  115   2e-27   
gb|EYU39642.1|  hypothetical protein MIMGU_mgv1a008552mg                114   4e-27   
emb|CDY13816.1|  BnaA09g43180D                                          112   4e-27   
ref|XP_007143764.1|  hypothetical protein PHAVU_007G099600g             114   5e-27   
ref|XP_010243268.1|  PREDICTED: cysteine proteinase 15A                 113   8e-27   
ref|XP_007218137.1|  hypothetical protein PRUPE_ppa007240mg             113   8e-27   
ref|XP_008233261.1|  PREDICTED: cysteine proteinase 15A                 113   8e-27   
ref|XP_006403513.1|  hypothetical protein EUTSA_v10010475mg             113   9e-27   
ref|XP_009789260.1|  PREDICTED: cysteine proteinase 15A                 113   1e-26   
ref|XP_009617441.1|  PREDICTED: cysteine proteinase 15A                 112   1e-26   
gb|AEQ54770.1|  cysteine proteinase CP1                                 112   1e-26   
gb|EEC82027.1|  hypothetical protein OsI_25996                          115   1e-26   
emb|CCA95082.1|  putative responsive to dehydration 19                  107   1e-26   
ref|XP_001761980.1|  predicted protein                                  112   1e-26   
gb|KJB73490.1|  hypothetical protein B456_011G235500                    112   2e-26   
gb|KHG08355.1|  Cysteinease 1                                           112   2e-26   
ref|XP_010918606.1|  PREDICTED: probable cysteine proteinase A494       112   2e-26   
ref|XP_004250044.1|  PREDICTED: cysteine proteinase 15A                 112   2e-26   
emb|CAB17077.1|  cysteine proteinase precursor                          111   5e-26   
emb|CBI31400.3|  unnamed protein product                                109   5e-26   
ref|XP_011094506.1|  PREDICTED: cysteine proteinase 15A                 110   5e-26   
emb|CDO99795.1|  unnamed protein product                                111   5e-26   
ref|XP_011024366.1|  PREDICTED: cysteine proteinase 15A                 110   6e-26   
ref|XP_006850211.1|  hypothetical protein AMTR_s00022p00251800          110   1e-25   
ref|XP_007510080.1|  unknown                                            110   1e-25   
ref|XP_008446834.1|  PREDICTED: cysteine proteinase 15A                 109   2e-25   
ref|XP_006361690.1|  PREDICTED: cysteine proteinase 15A-like            109   2e-25   
ref|XP_010034320.1|  PREDICTED: cysteine proteinase 1                   109   2e-25   
ref|XP_010688493.1|  PREDICTED: cysteine proteinase 15A                 109   2e-25   
gb|KDP30486.1|  hypothetical protein JCGZ_16165                         109   2e-25   
gb|ADE76932.1|  unknown                                                 109   2e-25   
ref|XP_004157559.1|  PREDICTED: cysteine proteinase 15A-like            108   3e-25   
ref|XP_006436511.1|  hypothetical protein CICLE_v10031865mg             108   3e-25   
ref|XP_004142497.1|  PREDICTED: cysteine proteinase 15A-like            108   3e-25   
ref|XP_002316398.1|  hypothetical protein POPTR_0010s23510g             108   3e-25   
ref|XP_002266821.1|  PREDICTED: cysteine proteinase 15A                 107   9e-25   
emb|CAN64491.1|  hypothetical protein VITISV_015725                     107   1e-24   
ref|XP_002533377.1|  cysteine protease, putative                        107   1e-24   
ref|XP_010103534.1|  putative cysteine proteinase A494                  107   1e-24   
ref|XP_007010012.1|  Papain family cysteine protease                    106   2e-24   
ref|XP_008647122.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin 7-...    104   5e-24   
ref|XP_006658557.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    104   9e-24   
emb|CEF99324.1|  Cysteine peptidase, cysteine active site               103   3e-23   
ref|XP_003081549.1|  Cysteine proteinase Cathepsin F (ISS)              102   3e-23   
ref|XP_001419933.1|  predicted protein                                  101   7e-23   
gb|EPS63354.1|  hypothetical protein M569_11429                         101   1e-22   
gb|AFW72358.1|  putative cysteine protease family protein               103   2e-22   
ref|XP_011469621.1|  PREDICTED: cysteine proteinase 15A-like          99.0    2e-22   
ref|XP_003057227.1|  predicted protein                                97.8    2e-21   
ref|XP_011169692.1|  PREDICTED: putative cysteine proteinase CG12163  97.8    2e-20   
ref|XP_011203808.1|  PREDICTED: putative cysteine proteinase CG12163  97.1    4e-20   
ref|XP_011184040.1|  PREDICTED: putative cysteine proteinase CG12163  97.1    4e-20   
ref|XP_004519757.1|  PREDICTED: putative cysteine proteinase CG12...  96.7    4e-20   
gb|EFN80374.1|  Putative cysteine proteinase CG12163                  97.1    5e-20   
ref|XP_011145705.1|  PREDICTED: uncharacterized protein LOC105186896  97.1    5e-20   
ref|XP_006608091.1|  PREDICTED: uncharacterized protein LOC102680728  95.9    1e-19   
ref|XP_003492760.1|  PREDICTED: hypothetical protein LOC100745708     95.5    2e-19   
ref|XP_004519758.1|  PREDICTED: putative cysteine proteinase CG12...  94.7    2e-19   
ref|XP_003696602.1|  PREDICTED: putative cysteine proteinase CG12...  95.1    2e-19   
ref|XP_011496222.1|  PREDICTED: uncharacterized protein LOC105360904  95.5    2e-19   
ref|XP_005184487.1|  PREDICTED: putative cysteine proteinase CG12...  94.4    3e-19   
ref|XP_005184486.1|  PREDICTED: putative cysteine proteinase CG12...  94.4    3e-19   
emb|CAN71324.1|  hypothetical protein VITISV_013970                   92.8    4e-19   
gb|KFB38327.1|  AGAP002879-PB-like protein                            94.7    4e-19   
ref|XP_001844355.1|  conserved hypothetical protein                   94.0    7e-19   
ref|XP_392381.3|  PREDICTED: putative cysteine proteinase CG12163...  93.6    7e-19   
ref|XP_006567715.1|  PREDICTED: putative cysteine proteinase CG12...  93.6    7e-19   
ref|XP_011493714.1|  AAEL017153-PA                                    93.6    8e-19   
ref|XP_002000409.1|  GI10216                                          92.4    1e-18   
ref|XP_001994049.1|  GH22731                                          92.4    1e-18   
ref|XP_001607324.1|  PREDICTED: uncharacterized protein LOC100123649  93.2    1e-18   
gb|EGI66903.1|  Putative cysteine proteinase                          92.4    1e-18   
ref|XP_002056575.1|  GJ11017                                          92.0    2e-18   
ref|XP_002017233.1|  GL22196                                          92.0    2e-18   
ref|XP_011052455.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  92.4    2e-18   
gb|EFN65613.1|  Putative cysteine proteinase CG12163                  92.4    2e-18   
ref|XP_002137768.1|  GA27408, isoform A                               92.0    2e-18   
gb|ACR08662.1|  cathepsin F                                           87.8    2e-18   
ref|XP_008550537.1|  PREDICTED: uncharacterized protein LOC103573287  92.4    2e-18   
dbj|BAI44279.1|  cysteine proteinase inhibitor precursor              92.8    2e-18   
ref|XP_003707276.1|  PREDICTED: uncharacterized protein LOC100880620  92.0    2e-18   
ref|NP_730901.1|  CG12163, isoform A                                  91.7    2e-18   
ref|XP_011260522.1|  PREDICTED: uncharacterized protein LOC105253881  92.4    2e-18   
ref|XP_002038380.1|  GM10654                                          91.3    2e-18   
ref|XP_002096026.1|  GE25302                                          91.3    2e-18   
emb|CAN80141.1|  hypothetical protein VITISV_038978                   89.7    2e-18   
gb|ETN61472.1|  hypothetical protein AND_006867                       92.4    3e-18   
gb|ABE72973.1|  cathepsin L                                           88.6    3e-18   
ref|XP_001978897.1|  GG11133                                          91.3    3e-18   
ref|XP_001955780.1|  GF16067                                          91.3    3e-18   
ref|XP_003736743.1|  GA27408, isoform B                               90.5    3e-18   
ref|XP_002988513.1|  hypothetical protein SELMODRAFT_128220           85.9    3e-18   
ref|NP_649521.1|  CG12163, isoform B                                  89.7    5e-18   
ref|XP_312034.5|  AGAP002879-PA                                       91.3    5e-18   
ref|XP_003436277.1|  AGAP002879-PB                                    91.3    5e-18   
ref|XP_002505924.1|  cysteine endopeptidase                           87.8    6e-18   
emb|CBY11269.1|  unnamed protein product                              88.2    7e-18   
gb|AJF94882.1|  C1 family cathepsin F10                               90.9    7e-18   
ref|XP_002073772.1|  GK14287                                          89.7    9e-18   
emb|CAN81617.1|  hypothetical protein VITISV_001998                   87.0    1e-17   
ref|XP_002979143.1|  hypothetical protein SELMODRAFT_110288           86.3    1e-17   
gb|EHJ64782.1|  cysteine proteinase inhibitor precursor               84.7    2e-17   
emb|CAN81619.1|  hypothetical protein VITISV_002000                   86.7    2e-17   
gb|AEW08440.1|  hypothetical protein 2_9845_02                        82.0    2e-17   
gb|AFQ01139.1|  cathepsin F-like protease                             88.6    2e-17   
ref|XP_008195656.1|  PREDICTED: uncharacterized protein LOC662417...  89.4    3e-17   
gb|EZA58965.1|  Putative cysteine proteinase                          88.6    3e-17   
emb|CBI23088.3|  unnamed protein product                              84.0    4e-17   
ref|XP_005184488.1|  PREDICTED: putative cysteine proteinase CG12...  87.4    4e-17   
ref|XP_008195657.1|  PREDICTED: uncharacterized protein LOC662417...  89.0    4e-17   
ref|XP_011331416.1|  PREDICTED: uncharacterized protein LOC105275911  88.6    5e-17   
gb|KHN72698.1|  Putative cysteine proteinase                          82.4    5e-17   
gb|ERG79645.1|  cysteine proteinase                                   81.3    7e-17   
emb|CBY31096.1|  unnamed protein product                              85.1    8e-17   
ref|XP_011309436.1|  PREDICTED: uncharacterized protein LOC105270293  86.7    2e-16   
gb|ABC48936.1|  cathepsin F like protease                             85.1    2e-16   
gb|KDR17524.1|  Putative cysteine proteinase                          85.9    4e-16   
gb|AFM37363.1|  cathepsin F1                                          84.3    5e-16   
gb|ENN81374.1|  hypothetical protein YQE_02191                        85.5    6e-16   
gb|EKC42097.1|  Cathepsin F                                           84.7    7e-16   
ref|XP_011434325.1|  PREDICTED: uncharacterized protein LOC105333...  84.7    7e-16   
ref|XP_011434326.1|  PREDICTED: uncharacterized protein LOC105333...  84.3    7e-16   
ref|XP_009047014.1|  hypothetical protein LOTGIDRAFT_172186           81.6    9e-16   
ref|XP_003389037.1|  PREDICTED: cathepsin L1-like                     81.6    9e-16   
ref|XP_003436276.1|  AGAP002879-PC                                    84.3    1e-15   
gb|AII16490.1|  cathepsin F                                           80.9    2e-15   
ref|XP_003115597.1|  CRE-TAG-196 protein                              82.8    2e-15   
ref|NP_505215.2|  Protein TAG-196                                     82.4    2e-15   
emb|CDX82031.1|  BnaC08g35700D                                        80.1    3e-15   
gb|ERL92611.1|  hypothetical protein D910_09924                       81.6    3e-15   
gb|EYC18288.1|  hypothetical protein Y032_0028g1777                   77.0    3e-15   
gb|KFM67613.1|  putative cysteine proteinase                          81.6    4e-15   
gb|KIH48456.1|  cysteine proteinase family protein                    75.5    5e-15   
ref|XP_009029595.1|  hypothetical protein HELRODRAFT_157956           79.3    6e-15   
ref|XP_002635317.1|  C. briggsae CBR-TAG-196 protein                  81.3    6e-15   
gb|EGT34543.1|  hypothetical protein CAEBREN_26318                    80.9    8e-15   
gb|EGT34572.1|  hypothetical protein CAEBREN_13324                    80.5    1e-14   
gb|ELT97360.1|  hypothetical protein CAPTEDRAFT_147978                78.6    1e-14   
ref|XP_002682087.1|  predicted protein                                79.0    1e-14   
gb|ABY75169.1|  cysteine protease                                     73.9    2e-14   
emb|CDJ92562.1|  Proteinase inhibitor I25 and Proteinase inhibito...  79.3    2e-14   
emb|CDJ88889.1|  Proteinase inhibitor I25 and Proteinase inhibito...  79.3    2e-14   
emb|CDJ26737.1|  cathepsin F-like cysteine peptidase protein          79.3    3e-14   
ref|XP_002427787.1|  Cathepsin F precursor, putative                  77.8    7e-14   
emb|CAC94443.1|  cysteine proteinase                                  74.3    7e-14   
dbj|GAA47436.1|  cathepsin L                                          75.5    9e-14   
ref|XP_009161938.1|  hypothetical protein T265_00017                  75.1    1e-13   
ref|NP_001156453.1|  cathepsin F isoform 1 precursor                  77.4    1e-13   
ref|XP_003148243.1|  hypothetical protein LOAG_12683                  74.3    2e-13   
gb|EFO15826.2|  hypothetical protein LOAG_12683                       74.3    2e-13   
ref|XP_002610214.1|  hypothetical protein BRAFLDRAFT_216923           75.1    2e-13   
gb|EFX71333.1|  hypothetical protein DAPPUDRAFT_189155                74.7    2e-13   
ref|XP_001029851.1|  Papain family cysteine protease containing p...  74.7    4e-13   
ref|XP_009035714.1|  hypothetical protein AURANDRAFT_53321            74.3    4e-13   
ref|XP_006121731.1|  PREDICTED: cathepsin W-like                      73.2    5e-13   
ref|XP_004351999.1|  cysteine protease                                74.3    5e-13   
ref|XP_003747496.1|  PREDICTED: cathepsin L-like                      73.9    6e-13   
ref|XP_003375070.1|  viral cathepsin                                  75.5    6e-13   
ref|XP_003284553.1|  hypothetical protein DICPUDRAFT_96752            74.3    7e-13   
dbj|BAN20819.1|  cysteine-type endopeptidase                          75.9    7e-13   
gb|AAT07059.1|  cathepsin F-like cysteine proteinase                  75.1    7e-13   
ref|XP_009064230.1|  hypothetical protein LOTGIDRAFT_204652           73.9    7e-13   
ref|XP_635374.1|  cysteine protease                                   74.3    7e-13   
gb|AAR27011.1|  cysteine protease                                     73.2    9e-13   
ref|XP_008472006.1|  PREDICTED: putative cysteine proteinase CG12163  71.6    1e-12   
ref|XP_007438969.1|  PREDICTED: cathepsin F-like                      72.0    1e-12   
ref|NP_001156454.1|  cathepsin F isoform 2 precursor                  75.1    1e-12   
gb|AAT09103.1|  digestive cysteine proteinase                         73.9    1e-12   
ref|XP_005305646.1|  PREDICTED: cathepsin W-like                      73.6    1e-12   
ref|XP_009034680.1|  hypothetical protein AURANDRAFT_22129            73.2    1e-12   
ref|XP_004364962.1|  cysteine proteinase 7                            73.6    1e-12   
ref|XP_006268168.1|  PREDICTED: cathepsin F-like                      73.9    2e-12   
ref|XP_002970484.1|  hypothetical protein SELMODRAFT_93661            73.2    2e-12   
ref|XP_002681317.1|  cysteine protease                                73.2    2e-12   
ref|XP_635417.1|  cysteine proteinase 1                               73.2    2e-12   
emb|CAA26255.1|  cysteine proteinase I precursor                      72.8    2e-12   
ref|XP_002978562.1|  hypothetical protein SELMODRAFT_109056           72.8    2e-12   
gb|ABK91811.1|  cathepsin F precursor                                 72.4    2e-12   
ref|XP_005101893.1|  PREDICTED: cathepsin F-like isoform X1           73.9    2e-12   
gb|ABC69431.1|  cysteine protease                                     72.4    2e-12   
gb|ABC69430.1|  cysteine protease                                     72.4    2e-12   
emb|CDP90584.1|  Protein BM-TAG-196                                   73.6    2e-12   
gb|ABC69429.1|  cysteine protease                                     72.4    2e-12   
emb|CAC94444.1|  cysteine proteinase                                  70.1    3e-12   
gb|ENN81994.1|  hypothetical protein YQE_01705                        72.8    3e-12   
ref|XP_002119872.3|  PREDICTED: cathepsin L-like                      73.6    3e-12   
gb|AEE62591.1|  unknown                                               72.8    3e-12   
gb|KGB33519.1|  Cathepsin L                                           72.0    3e-12   
ref|XP_006827472.1|  hypothetical protein AMTR_s00009p00129100        72.4    3e-12   
gb|AAB01769.1|  cysteine proteinase homolog                           72.0    4e-12   
ref|XP_003386471.1|  PREDICTED: cysteine proteinase 1-like            72.4    4e-12   
gb|ABI13158.1|  putative cysteine protease                            71.2    4e-12   
gb|AAF40479.1|  cystein protease                                      71.6    4e-12   
ref|XP_001894882.1|  cathepsin F-like cysteine proteinase             69.7    4e-12   
emb|CEF63690.1|  Cathepsin F                                          72.0    4e-12   
emb|CDQ07779.1|  Protein Bm12113, isoform a                           68.9    5e-12   
gb|AAF21461.1|U69120_1  cysteine proteinase PWCP1                     72.4    5e-12   
dbj|GAM23991.1|  hypothetical protein SAMD00019534_071660             71.6    5e-12   
dbj|GAM21447.1|  hypothetical protein SAMD00019534_046220             71.6    5e-12   
gb|AAP33049.1|  cysteine proteinase 1                                 71.2    6e-12   
ref|XP_005351748.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      72.4    6e-12   
ref|XP_008177856.1|  PREDICTED: cathepsin W-like                      68.2    6e-12   
ref|XP_006980634.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      72.4    6e-12   
ref|XP_006036937.1|  PREDICTED: cathepsin F-like                      71.6    8e-12   
ref|XP_011406938.1|  PREDICTED: silicatein-like                       69.3    8e-12   
gb|AAM44058.1|AF510740_1  cathepsin L1                                70.5    1e-11   
gb|EGW06365.1|  Cathepsin F                                           71.6    1e-11   
ref|XP_002117255.1|  hypothetical protein TRIADDRAFT_61245            71.2    1e-11   
emb|CDQ05036.1|  Protein Bm9835                                       69.3    1e-11   
gb|AAA87848.1|  cathepsin L                                           69.7    1e-11   
ref|XP_001898698.1|  fibroinase precursor                             69.3    1e-11   
gb|AAF21470.1|U85983_1  cysteine proteinase                           69.7    1e-11   



>gb|AAK27969.1|AF242373_1 cysteine protease [Ipomoea batatas]
Length=366

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/81 (94%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGR
Sbjct  286  GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGR  345

Query  208  NICGVDSMVSTVAAVNTPTSD  270
            N+CGVDSMVSTVAAV+T TSD
Sbjct  346  NVCGVDSMVSTVAAVSTTTSD  366



>gb|AAF61440.1|AF138264_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/81 (94%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGR
Sbjct  288  GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGR  347

Query  208  NICGVDSMVSTVAAVNTPTSD  270
            N+CGVDSMVSTVAAV+T TSD
Sbjct  348  NVCGVDSMVSTVAAVSTTTSD  368



>gb|AAF40414.1|AF216783_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/81 (94%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGR
Sbjct  288  GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGR  347

Query  208  NICGVDSMVSTVAAVNTPTSD  270
            N+CGVDSMVSTVAAV+T TSD
Sbjct  348  NVCGVDSMVSTVAAVSTTTSD  368



>gb|AAF40415.1|AF216784_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=368

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/81 (94%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGR
Sbjct  288  GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGR  347

Query  208  NICGVDSMVSTVAAVNTPTSD  270
            N+CGVDSMVSTVAAV+T TSD
Sbjct  348  NVCGVDSMVSTVAAVSTTTSD  368



>gb|AAF61441.1|AF138265_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=366

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/81 (94%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGR
Sbjct  286  GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGR  345

Query  208  NICGVDSMVSTVAAVNTPTSD  270
            N+CGVDSMVSTVAAV+T TSD
Sbjct  346  NVCGVDSMVSTVAAVSTTTSD  366



>gb|AAF40416.1|AF216785_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
 gb|AAF61442.1|AF138266_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
Length=366

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/81 (94%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGR
Sbjct  286  GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGR  345

Query  208  NICGVDSMVSTVAAVNTPTSD  270
            N+CGVDSMVSTVAAV+T TSD
Sbjct  346  NVCGVDSMVSTVAAVSTTTSD  366



>gb|KDP41743.1| hypothetical protein JCGZ_26761 [Jatropha curcas]
Length=370

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGE+WGE GYYKICRGR
Sbjct  291  GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGETWGESGYYKICRGR  350

Query  208  NICGVDSMVSTVAAVNTPT  264
            N+CGVDSMVSTVAAV T +
Sbjct  351  NVCGVDSMVSTVAAVQTSS  369



>ref|XP_002512963.1| cysteine protease, putative [Ricinus communis]
 gb|EEF49466.1| cysteine protease, putative [Ricinus communis]
Length=373

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/80 (91%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGE+WGE GYYKICRGR
Sbjct  294  GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGENWGESGYYKICRGR  353

Query  208  NICGVDSMVSTVAAVNTPTS  267
            NICGVDSMVSTVAAV T + 
Sbjct  354  NICGVDSMVSTVAAVQTASE  373



>sp|P05993.1|PAPA5_CARPA RecName: Full=Cysteine proteinase; AltName: Full=Clone PLBPC13, 
partial [Carica papaya]
 emb|CAA27609.1| pot. cysteine proteinase [Carica papaya]
Length=96

 Score =   152 bits (385),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICS+RL+HGVLLVGYGSAGYAPIRLKEKPYW+IKNSWGE+WGE GYYKICRGR
Sbjct  17   GGVSCPYICSRRLNHGVLLVGYGSAGYAPIRLKEKPYWVIKNSWGENWGENGYYKICRGR  76

Query  208  NICGVDSMVSTVAAVNTPTS  267
            NICGVDSMVSTVAAV+T + 
Sbjct  77   NICGVDSMVSTVAAVHTTSQ  96



>gb|KHG24064.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=374

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLK+KPYWIIKNSWGE+WGE GYYKICRGR
Sbjct  295  GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKDKPYWIIKNSWGETWGENGYYKICRGR  354

Query  208  NICGVDSMVSTVAAVNT  258
            N+CGVDS+VSTVAAVNT
Sbjct  355  NVCGVDSLVSTVAAVNT  371



>gb|AIB06024.1| CP2 [Hevea brasiliensis]
Length=372

 Score =   159 bits (403),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/81 (91%), Positives = 77/81 (95%), Gaps = 1/81 (1%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGSAGYAP+RLKEKPYWIIKNSWGE+WGE GYYKICRGR
Sbjct  292  GGVSCPYICSKRLDHGVLLVGYGSAGYAPVRLKEKPYWIIKNSWGENWGESGYYKICRGR  351

Query  208  NICGVDSMVSTVAA-VNTPTS  267
            NICGVDSMVSTVAA V TP+ 
Sbjct  352  NICGVDSMVSTVAAVVQTPSQ  372



>gb|AAX19661.1| cysteine proteinase [Populus tomentosa]
Length=374

 Score =   159 bits (402),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICS+RLDHGVLLVGYGSAGYAP+R+KEKPYWIIKNSWGESWGE G+YKICRGR
Sbjct  295  GGVSCPYICSRRLDHGVLLVGYGSAGYAPVRMKEKPYWIIKNSWGESWGENGFYKICRGR  354

Query  208  NICGVDSMVSTVAAVNT  258
            NICGVDSMVSTVAAV T
Sbjct  355  NICGVDSMVSTVAAVQT  371



>gb|ABQ10201.1| cysteine protease Cp3 [Actinidia deliciosa]
Length=365

 Score =   159 bits (401),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE G+YKIC+GR
Sbjct  286  GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGFYKICQGR  345

Query  208  NICGVDSMVSTVAAVNTPTS  267
            N+CGVDSMVSTVAAV+T ++
Sbjct  346  NVCGVDSMVSTVAAVHTTSN  365



>gb|KJB32561.1| hypothetical protein B456_005G247000 [Gossypium raimondii]
Length=374

 Score =   159 bits (402),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLK+KPYWIIKNSWGE+WGE G+YKICRGR
Sbjct  295  GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKDKPYWIIKNSWGETWGENGFYKICRGR  354

Query  208  NICGVDSMVSTVAAVNT  258
            N+CGVDS+VSTVAAVNT
Sbjct  355  NVCGVDSLVSTVAAVNT  371



>ref|XP_011047717.1| PREDICTED: cysteine proteinase RD19a [Populus euphratica]
Length=368

 Score =   159 bits (401),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICS+RLDHGVLLVGYGSAGYAP+R+KEKPYWIIKNSWGESWGE G+YKICRGR
Sbjct  289  GGVSCPYICSRRLDHGVLLVGYGSAGYAPVRMKEKPYWIIKNSWGESWGENGFYKICRGR  348

Query  208  NICGVDSMVSTVAAVNT  258
            NICGVDSMVSTVAAV T
Sbjct  349  NICGVDSMVSTVAAVQT  365



>gb|ABK96252.1| unknown [Populus trichocarpa x Populus deltoides]
Length=156

 Score =   152 bits (385),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICS+RLDHGVLLVGYGSAGY+P+R+KEKP+WIIKNSWGE WGE G+YKICRGR
Sbjct  78   GGVSCPYICSRRLDHGVLLVGYGSAGYSPVRMKEKPFWIIKNSWGEKWGENGFYKICRGR  137

Query  208  NICGVDSMVSTVAAVNTPT  264
            N+CGVDSMVSTVAAV T +
Sbjct  138  NVCGVDSMVSTVAAVQTSS  156



>emb|CDP20652.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/79 (91%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGS+GYAPIR+KEKPYWIIKNSWGE WGE GYYKICRG 
Sbjct  294  GGVSCPYICSKRLDHGVLLVGYGSSGYAPIRMKEKPYWIIKNSWGEHWGENGYYKICRGH  353

Query  208  NICGVDSMVSTVAAVNTPT  264
            NICGVDSMVSTVAAV+T T
Sbjct  354  NICGVDSMVSTVAAVHTST  372



>gb|KJB79047.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
Length=373

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGSAGYAP+R+K+KPYWIIKNSWGE+WGE G+Y+ICRGR
Sbjct  294  GGVSCPYICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGENGFYRICRGR  353

Query  208  NICGVDSMVSTVAAVNT  258
            NICGVDSMVSTVAAVNT
Sbjct  354  NICGVDSMVSTVAAVNT  370



>emb|CAE54306.1| putative papain-like cysteine proteinase [Gossypium hirsutum]
Length=373

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGSAGYAP+R+K+KPYWIIKNSWGE+WGE G+Y+ICRGR
Sbjct  294  GGVSCPYICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGENGFYRICRGR  353

Query  208  NICGVDSMVSTVAAVNT  258
            NICGVDSMVSTVAAVNT
Sbjct  354  NICGVDSMVSTVAAVNT  370



>gb|KHG15253.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=373

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGSAGYAP+R+K+KPYWIIKNSWGE+WGE G+Y+ICRGR
Sbjct  294  GGVSCPYICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGENGFYRICRGR  353

Query  208  NICGVDSMVSTVAAVNT  258
            NICGVDSMVSTVAAVNT
Sbjct  354  NICGVDSMVSTVAAVNT  370



>ref|NP_001267989.1| cysteine protease precursor [Vitis vinifera]
 gb|ABX79341.1| cysteine protease [Vitis vinifera]
Length=377

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+K+KPYWIIKNSWGE+WGE G+YKICRGR
Sbjct  298  GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKDKPYWIIKNSWGENWGENGFYKICRGR  357

Query  208  NICGVDSMVSTVAAVNTPTS  267
            N+CGVDSMVSTVAAV+T ++
Sbjct  358  NVCGVDSMVSTVAAVHTTSN  377



>ref|XP_002313770.1| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE87725.1| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICS+RLDHGVLLVGYGSA YAP+R+KEKPYWIIKNSWGESWGE G+YKICRGR
Sbjct  289  GGVSCPYICSRRLDHGVLLVGYGSAAYAPVRMKEKPYWIIKNSWGESWGENGFYKICRGR  348

Query  208  NICGVDSMVSTVAAVNT  258
            NICGVDSMVSTVAAV T
Sbjct  349  NICGVDSMVSTVAAVQT  365



>gb|ABK92536.1| unknown [Populus trichocarpa]
Length=368

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICS+RLDHGVLLVGYGSA YAP+R+KEKPYWIIKNSWGESWGE G+YKICRGR
Sbjct  289  GGVSCPYICSRRLDHGVLLVGYGSAAYAPVRMKEKPYWIIKNSWGESWGENGFYKICRGR  348

Query  208  NICGVDSMVSTVAAVNT  258
            NICGVDSMVSTVAAV T
Sbjct  349  NICGVDSMVSTVAAVQT  365



>ref|XP_007042077.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOX97908.1| Papain family cysteine protease [Theobroma cacao]
Length=395

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  31   GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  210
            GVSCPYICSKRLDHGVLLVGYGSAGYAP+R+K+KPYWIIKNSWGESWGE G+YKICRGRN
Sbjct  317  GVSCPYICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGESWGEDGFYKICRGRN  376

Query  211  ICGVDSMVSTVAAVNT  258
            ICGVDSMVSTVAAV+T
Sbjct  377  ICGVDSMVSTVAAVDT  392



>ref|XP_003606998.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89195.1| papain family cysteine protease [Medicago truncatula]
Length=362

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/79 (91%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGS  Y+PIRLKEKPYWIIKNSWGE+WGE GYYKICRGR
Sbjct  284  GGVSCPYICSKRLDHGVLLVGYGSGAYSPIRLKEKPYWIIKNSWGETWGENGYYKICRGR  343

Query  208  NICGVDSMVSTVAAVNTPT  264
            NICGVDSMVSTVAAV+T T
Sbjct  344  NICGVDSMVSTVAAVHTTT  362



>ref|XP_009351218.1| PREDICTED: cysteine proteinase RD19a-like, partial [Pyrus x bretschneideri]
Length=282

 Score =   155 bits (391),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YKICRGR
Sbjct  201  GGVSCPYICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKICRGR  260

Query  208  NICGVDSMVSTVAAVNTPTS  267
            NICGVDSMVSTVAA +  T+
Sbjct  261  NICGVDSMVSTVAAASVKTN  280



>ref|XP_009373025.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=371

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YKICRGR
Sbjct  290  GGVSCPYICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKICRGR  349

Query  208  NICGVDSMVSTVAAVNTPTS  267
            NICGVDSMVSTVAA +  T+
Sbjct  350  NICGVDSMVSTVAAASVKTN  369



>ref|XP_004290288.1| PREDICTED: probable cysteine proteinase A494 [Fragaria vesca 
subsp. vesca]
Length=372

 Score =   156 bits (395),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGSAGY+P+R+KEKPYWIIKNSWGE+WGEKG+YKICRGR
Sbjct  296  GGVSCPYICSKRLDHGVLLVGYGSAGYSPVRMKEKPYWIIKNSWGENWGEKGFYKICRGR  355

Query  208  NICGVDSMVSTVAAVN  255
            NICGVDSMVSTVAAV 
Sbjct  356  NICGVDSMVSTVAAVE  371



>ref|XP_006487337.1| PREDICTED: cysteine proteinase RD19a-like [Citrus sinensis]
Length=373

 Score =   156 bits (395),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 71/75 (95%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICS+RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE GYYKICRGR
Sbjct  298  GGVSCPYICSRRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGENGYYKICRGR  357

Query  208  NICGVDSMVSTVAAV  252
            N+CGVDSMVSTVAA 
Sbjct  358  NVCGVDSMVSTVAAA  372



>ref|XP_009373000.1| PREDICTED: cysteine proteinase RD19a [Pyrus x bretschneideri]
Length=371

 Score =   156 bits (395),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YKICRGR
Sbjct  290  GGVSCPYICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKICRGR  349

Query  208  NICGVDSMVSTVAAVNTPTS  267
            NICGVDSMVSTVAA +  T+
Sbjct  350  NICGVDSMVSTVAAASVKTN  369



>ref|XP_008382317.1| PREDICTED: cysteine proteinase RD19a [Malus domestica]
Length=371

 Score =   156 bits (395),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YKICRGR
Sbjct  290  GGVSCPYICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKICRGR  349

Query  208  NICGVDSMVSTVAAVNTPTS  267
            NICGVDSMVSTVAA +  T+
Sbjct  350  NICGVDSMVSTVAAASVKTN  369



>gb|KDO49483.1| hypothetical protein CISIN_1g017318mg [Citrus sinensis]
Length=373

 Score =   156 bits (395),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 71/75 (95%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICS+RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE GYYKICRGR
Sbjct  298  GGVSCPYICSRRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGENGYYKICRGR  357

Query  208  NICGVDSMVSTVAAV  252
            N+CGVDSMVSTVAA 
Sbjct  358  NVCGVDSMVSTVAAA  372



>ref|XP_008236965.1| PREDICTED: cysteine proteinase RD19a [Prunus mume]
Length=367

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYG+AGY+PIR+KEKPYWIIKNSWGE+WGEKG+YKIC+GR
Sbjct  286  GGVSCPYICSKRLDHGVLLVGYGAAGYSPIRMKEKPYWIIKNSWGENWGEKGFYKICKGR  345

Query  208  NICGVDSMVSTVAAVNTPTS  267
            NICGVDSMVSTVAA +  T+
Sbjct  346  NICGVDSMVSTVAAASVETN  365



>gb|KHN39817.1| Cysteine proteinase RD19a [Glycine soja]
Length=332

 Score =   155 bits (392),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICS+RLDHGVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYKICRGR
Sbjct  253  GGVSCPYICSRRLDHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKICRGR  312

Query  208  NICGVDSMVSTVAAVNTPTS  267
            NICGVDSMVSTVAAV+T T 
Sbjct  313  NICGVDSMVSTVAAVHTTTQ  332



>ref|XP_007201310.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
 gb|EMJ02509.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
Length=367

 Score =   156 bits (394),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYG+AGY+PIR+KEKPYWIIKNSWGE+WGEKG+YKIC+GR
Sbjct  286  GGVSCPYICSKRLDHGVLLVGYGAAGYSPIRMKEKPYWIIKNSWGENWGEKGFYKICKGR  345

Query  208  NICGVDSMVSTVAAVNTPTS  267
            NICGVDSMVSTVAA +  T+
Sbjct  346  NICGVDSMVSTVAAASVETN  365



>ref|XP_010271520.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=370

 Score =   156 bits (394),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 71/76 (93%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGS GYAPIRLK+KPYWIIKNSWGE WGE GYYKICRGR
Sbjct  291  GGVSCPYICSKRLDHGVLLVGYGSEGYAPIRLKDKPYWIIKNSWGEGWGENGYYKICRGR  350

Query  208  NICGVDSMVSTVAAVN  255
            N+CGVDSMVSTVAAVN
Sbjct  351  NVCGVDSMVSTVAAVN  366



>gb|ACI04578.1| cysteine protease-like protein [Robinia pseudoacacia]
Length=335

 Score =   155 bits (392),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC K LDHGVLLVGYG AGYAPIRLKEKPYWIIKNSWGESWGE GYYKICRGR
Sbjct  256  GGVSCPYICGKNLDHGVLLVGYGKAGYAPIRLKEKPYWIIKNSWGESWGENGYYKICRGR  315

Query  208  NICGVDSMVSTVAAVNT  258
            N+CGVDSMVSTVAAV+T
Sbjct  316  NVCGVDSMVSTVAAVHT  332



>ref|XP_003539008.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=363

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICS+RLDHGVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYKICRGR
Sbjct  284  GGVSCPYICSRRLDHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKICRGR  343

Query  208  NICGVDSMVSTVAAVNTPTS  267
            NICGVDSMVSTVAAV+T T 
Sbjct  344  NICGVDSMVSTVAAVHTTTQ  363



>ref|XP_011028940.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKR DHGVLLVGYGSAGYAPIR KEKP+WIIKNSWGE+WGE GYYKICRGR
Sbjct  288  GGVSCPYICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGENWGENGYYKICRGR  347

Query  208  NICGVDSMVSTVAAVNT  258
            NICGVDSMVSTVAA++T
Sbjct  348  NICGVDSMVSTVAAIHT  364



>ref|XP_006423403.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
 gb|ESR36643.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
Length=375

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/75 (93%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICS+RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE GYYKICRGR
Sbjct  298  GGVSCPYICSRRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGENGYYKICRGR  357

Query  208  NICGVDSMVSTVAAV  252
            N+CGVDSMVST+AA 
Sbjct  358  NVCGVDSMVSTIAAA  372



>ref|XP_004507484.1| PREDICTED: cysteine proteinase RD19a-like [Cicer arietinum]
Length=363

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICS+RLDHGVLLVGYGS  YAPIR+KEKPYWIIKNSWGE+WGE G+YKICRGR
Sbjct  284  GGVSCPYICSRRLDHGVLLVGYGSGAYAPIRMKEKPYWIIKNSWGENWGENGFYKICRGR  343

Query  208  NICGVDSMVSTVAAVNTPTS  267
            NICGVDSMVSTVAAV+T T 
Sbjct  344  NICGVDSMVSTVAAVHTTTQ  363



>gb|AAL69389.1|AF462226_1 putative cysteine proteinase [Narcissus pseudonarcissus]
Length=136

 Score =   149 bits (376),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC K LDHGVLLVGYGS+G+APIR KEKPYWIIKNSWGE+WGEKGYYKIC+GR
Sbjct  56   GGVSCPYICGKHLDHGVLLVGYGSSGWAPIRFKEKPYWIIKNSWGENWGEKGYYKICKGR  115

Query  208  NICGVDSMVSTVAAVNTPTSD  270
            N+CGVDSMVSTV A++T   D
Sbjct  116  NVCGVDSMVSTVTAIHTTPKD  136



>ref|XP_010028631.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW55393.1| hypothetical protein EUGRSUZ_I01305 [Eucalyptus grandis]
Length=370

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 76/82 (93%), Gaps = 2/82 (2%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGR
Sbjct  288  GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKDKPYWIIKNSWGETWGENGYYKICRGR  347

Query  208  NICGVDSMVSTVAAV--NTPTS  267
            NICGVDSMVSTVAA    TP S
Sbjct  348  NICGVDSMVSTVAAAVHTTPGS  369



>ref|XP_011088458.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Sesamum indicum]
Length=379

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCP ICSKRLDHGVLLVGYG AGYAPIR KEKPYWIIKNSWGE WGEKGYYKICRGR
Sbjct  301  GGVSCPLICSKRLDHGVLLVGYGEAGYAPIRRKEKPYWIIKNSWGEKWGEKGYYKICRGR  360

Query  208  NICGVDSMVSTVAAVNT  258
            NICGVDSMVSTVAAV+T
Sbjct  361  NICGVDSMVSTVAAVST  377



>ref|XP_011037175.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
 ref|XP_011037176.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
Length=368

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/77 (88%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICS+RLDHGVLLVGYGSAGY+PIR+K+KPYWIIKNSWGE WGE G+YKICRGR
Sbjct  289  GGVSCPYICSRRLDHGVLLVGYGSAGYSPIRMKDKPYWIIKNSWGEKWGENGFYKICRGR  348

Query  208  NICGVDSMVSTVAAVNT  258
            N+CGVDSMVSTVAAV T
Sbjct  349  NVCGVDSMVSTVAAVQT  365



>gb|ABK96580.1| unknown [Populus trichocarpa x Populus deltoides]
Length=367

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKR DHGVLLVGYGSAGYAPIR KEKP+WIIKNSWG++WGE GYYKICRGR
Sbjct  288  GGVSCPYICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGENGYYKICRGR  347

Query  208  NICGVDSMVSTVAAVNT  258
            NICGVDSMVSTVAA++T
Sbjct  348  NICGVDSMVSTVAAIHT  364



>gb|AAR92156.1| putative cysteine protease 3 [Iris x hollandica]
Length=292

 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC K LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGE+WGE GYYKICRGR
Sbjct  211  GGVSCPYICGKHLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGETWGENGYYKICRGR  270

Query  208  NICGVDSMVSTVAAVNT  258
            N+CGVDSMVSTV A++T
Sbjct  271  NVCGVDSMVSTVTAIHT  287



>ref|XP_010066197.1| PREDICTED: probable cysteine proteinase A494 [Eucalyptus grandis]
 gb|KCW64029.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
 gb|KCW64030.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
Length=376

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGSA Y+PIR+KEKPYWIIKNSWGE+WGE G+YKICRGR
Sbjct  297  GGVSCPYICSKRLDHGVLLVGYGSAAYSPIRMKEKPYWIIKNSWGENWGENGFYKICRGR  356

Query  208  NICGVDSMVSTVAAVNT  258
            NICGVDSMVSTVAA++T
Sbjct  357  NICGVDSMVSTVAAIHT  373



>ref|XP_002302004.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
 gb|ABK94746.1| unknown [Populus trichocarpa]
 gb|EEE81277.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
Length=367

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKR DHGVLLVGYGSAGYAPIR KEKP+WIIKNSWG++WGE GYYKICRGR
Sbjct  288  GGVSCPYICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGENGYYKICRGR  347

Query  208  NICGVDSMVSTVAAVNT  258
            NICGVDSMVSTVAA++T
Sbjct  348  NICGVDSMVSTVAAIHT  364



>gb|ABK94801.1| unknown [Populus trichocarpa]
Length=367

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKR DHGVLLVGYGSAGYAPIR KEKP+WIIKNSWG++WGE GYYKICRGR
Sbjct  288  GGVSCPYICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGENGYYKICRGR  347

Query  208  NICGVDSMVSTVAAVNT  258
            NICGVDSMVSTVAA++T
Sbjct  348  NICGVDSMVSTVAAIHT  364



>ref|XP_002305451.2| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE85962.2| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICS+RLDHGVLLVGYGSAGY+P+R+KEKP+WIIKNSWGE WGE G+YKICRGR
Sbjct  289  GGVSCPYICSRRLDHGVLLVGYGSAGYSPVRMKEKPFWIIKNSWGEKWGENGFYKICRGR  348

Query  208  NICGVDSMVSTVAAVNT  258
            N+CGVDSMVSTVAAV T
Sbjct  349  NVCGVDSMVSTVAAVQT  365



>ref|XP_007131787.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
 gb|ESW03781.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
Length=361

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 70/78 (90%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +1

Query  31   GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  210
            GVSCPYICS+RLDHGVLLVGYGS  YAPIR+KEKPYWIIKNSWGE+WGE GYYKICRGRN
Sbjct  283  GVSCPYICSRRLDHGVLLVGYGSGAYAPIRMKEKPYWIIKNSWGENWGENGYYKICRGRN  342

Query  211  ICGVDSMVSTVAAVNTPT  264
            ICGVDSMVSTVAAV+T T
Sbjct  343  ICGVDSMVSTVAAVHTTT  360



>ref|XP_009406357.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=372

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC + LDHGVLLVGYGSAGY+PIRLK+KP+WIIKNSWGE+WGEKGYYKICRGR
Sbjct  292  GGVSCPYICGRHLDHGVLLVGYGSAGYSPIRLKQKPFWIIKNSWGETWGEKGYYKICRGR  351

Query  208  NICGVDSMVSTVAAVNT  258
            N+CGVDSMVSTV A+NT
Sbjct  352  NVCGVDSMVSTVTAINT  368



>ref|XP_011092831.1| PREDICTED: cysteine proteinase RD19a-like [Sesamum indicum]
Length=378

 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCP+ICSKRLDHGVLLVGYG+A YAPIRLKEKPYWIIKNSWGE+WGE GYYKICRG 
Sbjct  300  GGVSCPFICSKRLDHGVLLVGYGAASYAPIRLKEKPYWIIKNSWGENWGENGYYKICRGH  359

Query  208  NICGVDSMVSTVAAVNT  258
            N+CGVDSMVSTVAAV+T
Sbjct  360  NVCGVDSMVSTVAAVST  376



>emb|CDQ51995.1| Cysteine proteinase, partial [Fagus sylvatica]
Length=165

 Score =   148 bits (373),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 66/75 (88%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +1

Query  31   GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  210
            GVSCPYIC + LDHGVLLVG+GSAGYAPIRLKEKP+WIIKNSWGE+WGE GYYKICRGRN
Sbjct  90   GVSCPYICGRHLDHGVLLVGFGSAGYAPIRLKEKPFWIIKNSWGENWGENGYYKICRGRN  149

Query  211  ICGVDSMVSTVAAVN  255
            +CGVDSMVSTVAA+N
Sbjct  150  VCGVDSMVSTVAAIN  164



>gb|ABK93575.1| unknown [Populus trichocarpa]
Length=157

 Score =   147 bits (372),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSK  DHGVLLVGYG+AGYAPIR KEKP+WIIKNSWGE+WGE GYYKICR R
Sbjct  78   GGVSCPYICSKHQDHGVLLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGENGYYKICRAR  137

Query  208  NICGVDSMVSTVAAVNT  258
            NICGVDSMVSTVAA++ 
Sbjct  138  NICGVDSMVSTVAAIHA  154



>gb|AJP16692.1| cysteine protease, partial [Striga hermonthica]
Length=148

 Score =   147 bits (371),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 66/73 (90%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  31   GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  210
            GVSCPYICSKRLDHGVLLVGYG +GYAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRN
Sbjct  76   GVSCPYICSKRLDHGVLLVGYGESGYAPIRMKDKPYWIIKNSWGENWGENGYYKICRGRN  135

Query  211  ICGVDSMVSTVAA  249
            +CGVDSMVSTVAA
Sbjct  136  VCGVDSMVSTVAA  148



>ref|XP_010061009.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW67908.1| hypothetical protein EUGRSUZ_F01612 [Eucalyptus grandis]
Length=369

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC K LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYKICRGR
Sbjct  290  GGVSCPYICGKHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGR  349

Query  208  NICGVDSMVSTVAAVNT  258
            +ICGVDSMVSTVAA++T
Sbjct  350  DICGVDSMVSTVAAIHT  366



>gb|AAU81591.1| cysteine proteinase, partial [Petunia x hybrida]
Length=190

 Score =   147 bits (372),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 74/79 (94%), Gaps = 1/79 (1%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKR DHGVLLVGYGS G+APIR+KEKPYWIIKNSWGE WGE GYYKICRGR
Sbjct  113  GGVSCPYICSKRQDHGVLLVGYGS-GFAPIRMKEKPYWIIKNSWGEKWGESGYYKICRGR  171

Query  208  NICGVDSMVSTVAAVNTPT  264
            N+CGVDSMVSTVAAV+T +
Sbjct  172  NVCGVDSMVSTVAAVSTSS  190



>ref|XP_002510469.1| cysteine protease, putative [Ricinus communis]
 gb|EEF52656.1| cysteine protease, putative [Ricinus communis]
Length=366

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKR DHGV+LVGYGSAGYAP+RLK+KP+WIIKNSWGE+WGE GYYKICRGR
Sbjct  287  GGVSCPYICSKRQDHGVVLVGYGSAGYAPVRLKDKPFWIIKNSWGENWGENGYYKICRGR  346

Query  208  NICGVDSMVSTVAAVNT  258
            N+CGVD+MVSTVAA++T
Sbjct  347  NVCGVDAMVSTVAAIHT  363



>dbj|BAD94010.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
Length=86

 Score =   144 bits (363),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC++RL+HGVLLVGYG+AGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GR
Sbjct  6    GGVSCPYICTRRLNHGVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGR  65

Query  208  NICGVDSMVSTVAAVNTPTSD  270
            NICGVDSMVSTVAA  + T+ 
Sbjct  66   NICGVDSMVSTVAATVSTTAH  86



>ref|XP_009376976.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=445

 Score =   153 bits (387),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 68/80 (85%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVS PYICS+RLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGESW E G+YKICRGR
Sbjct  364  GGVSYPYICSRRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGESWRESGFYKICRGR  423

Query  208  NICGVDSMVSTVAAVNTPTS  267
            NICGVDSMVSTVAA +  T+
Sbjct  424  NICGVDSMVSTVAAASVKTN  443



>ref|XP_004165230.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
Length=387

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCP+ICSKRLDHGVLLVGYGSAGYAPIR+++K YWIIKNSWGESWGE GYYKICRGR
Sbjct  298  GGVSCPFICSKRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGENGYYKICRGR  357

Query  208  NICGVDSMVSTVAAVN  255
            NICGVDS+VSTVAAV+
Sbjct  358  NICGVDSLVSTVAAVH  373



>gb|KGN43159.1| Papain-like cysteine proteinase isoform I [Cucumis sativus]
Length=387

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCP+ICSKRLDHGVLLVGYGSAGYAPIR+++K YWIIKNSWGESWGE GYYKICRGR
Sbjct  298  GGVSCPFICSKRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGENGYYKICRGR  357

Query  208  NICGVDSMVSTVAAVN  255
            NICGVDS+VSTVAAV+
Sbjct  358  NICGVDSLVSTVAAVH  373



>ref|XP_004148554.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Cucumis sativus]
Length=381

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCP+ICSKRLDHGVLLVGYGSAGYAPIR+++K YWIIKNSWGESWGE GYYKICRGR
Sbjct  292  GGVSCPFICSKRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGENGYYKICRGR  351

Query  208  NICGVDSMVSTVAAVN  255
            NICGVDS+VSTVAAV+
Sbjct  352  NICGVDSLVSTVAAVH  367



>ref|XP_003540987.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=365

 Score =   151 bits (382),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPY+CS+RL+HGVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYKICRGR
Sbjct  286  GGVSCPYVCSRRLNHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKICRGR  345

Query  208  NICGVDSMVSTVAAVNTPTS  267
            NICGVDSMVSTVA+V+T T 
Sbjct  346  NICGVDSMVSTVASVHTTTQ  365



>ref|XP_009376977.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=447

 Score =   153 bits (386),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 68/80 (85%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVS PYICS+RLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGESW E G+YKICRGR
Sbjct  366  GGVSYPYICSRRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGESWRESGFYKICRGR  425

Query  208  NICGVDSMVSTVAAVNTPTS  267
            NICGVDSMVSTVAA +  T+
Sbjct  426  NICGVDSMVSTVAAASVKTN  445



>ref|XP_010268619.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=369

 Score =   151 bits (382),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICS+RL+HGVLLVGYGS GY+PIR+K+KPYWIIKNSWGESWGE GYYKICRGR
Sbjct  290  GGVSCPYICSRRLNHGVLLVGYGSEGYSPIRMKDKPYWIIKNSWGESWGENGYYKICRGR  349

Query  208  NICGVDSMVSTVAAVNT  258
            ++CGVDSMVSTVAA++T
Sbjct  350  DVCGVDSMVSTVAAIHT  366



>dbj|BAJ53178.1| JHL18I08.12 [Jatropha curcas]
 gb|KDP38578.1| hypothetical protein JCGZ_04503 [Jatropha curcas]
Length=368

 Score =   151 bits (382),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKR DHGVLLVGYGSAGYAPIRLK+KP+WIIKNSWGESWGE GYY+ICRGR
Sbjct  288  GGVSCPYICSKRQDHGVLLVGYGSAGYAPIRLKDKPFWIIKNSWGESWGENGYYRICRGR  347

Query  208  NICGVDSMVSTVAAVN  255
            NICGVD+MVS+VAA++
Sbjct  348  NICGVDAMVSSVAAIH  363



>ref|XP_002280798.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CAN73591.1| hypothetical protein VITISV_022889 [Vitis vinifera]
 emb|CBI19785.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   151 bits (382),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  31   GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  210
            GVSCPYICS  LDHGVLLVGYGSAGY+PIR KEKPYWIIKNSWGESWGE+GYYKICRG N
Sbjct  293  GVSCPYICSSTLDHGVLLVGYGSAGYSPIRFKEKPYWIIKNSWGESWGEQGYYKICRGHN  352

Query  211  ICGVDSMVSTVAAVNT  258
            ICGVDSMVSTVAA++T
Sbjct  353  ICGVDSMVSTVAAIHT  368



>ref|XP_004150061.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004166953.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN61836.1| Cysteine protease [Cucumis sativus]
Length=377

 Score =   151 bits (382),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +1

Query  31   GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  210
            GVSCPYICSK LDHGVLLVGYGS GYAPIRLK+KPYWIIKNSWG +WGE GYYKICRGRN
Sbjct  299  GVSCPYICSKHLDHGVLLVGYGSDGYAPIRLKDKPYWIIKNSWGANWGENGYYKICRGRN  358

Query  211  ICGVDSMVSTVAAVNTPTS  267
            ICGVDSMVSTVAAV+T  +
Sbjct  359  ICGVDSMVSTVAAVHTAAN  377



>gb|AAU81589.1| cysteine proteinase [Petunia x hybrida]
Length=257

 Score =   148 bits (374),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 68/77 (88%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCP IC KR DHGVLLVGYGSAG+APIRLKEKPYWIIKNSWGESWGE+GYYKICRGR
Sbjct  176  GGVSCPLICFKRQDHGVLLVGYGSAGFAPIRLKEKPYWIIKNSWGESWGEQGYYKICRGR  235

Query  208  NICGVDSMVSTVAAVNT  258
            NICGVD+MVSTV A +T
Sbjct  236  NICGVDAMVSTVTAAHT  252



>ref|XP_003523684.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=366

 Score =   150 bits (380),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC K LDHGVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYYKICRGR
Sbjct  287  GGVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYKICRGR  346

Query  208  NICGVDSMVSTVAAVN  255
            N+CGVDSMVSTVAA++
Sbjct  347  NVCGVDSMVSTVAAIH  362



>ref|NP_001241450.1| uncharacterized protein LOC100778716 precursor [Glycine max]
 gb|ACU20049.1| unknown [Glycine max]
Length=366

 Score =   150 bits (380),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC K LDHGVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYYKICRGR
Sbjct  287  GGVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYKICRGR  346

Query  208  NICGVDSMVSTVAAVN  255
            N+CGVDSMVSTVAA++
Sbjct  347  NVCGVDSMVSTVAAIH  362



>gb|KHN45894.1| Cysteine proteinase RD19a [Glycine soja]
Length=366

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC K LDHGVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYYKICRGR
Sbjct  287  GGVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYKICRGR  346

Query  208  NICGVDSMVSTVAAVN  255
            N+CGVDSMVSTVAA++
Sbjct  347  NVCGVDSMVSTVAAIH  362



>gb|ABF46642.1| papain-like cysteine proteinase [Pachysandra terminalis]
Length=374

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/80 (90%), Positives = 74/80 (93%), Gaps = 2/80 (3%)
 Frame = +1

Query  28   GGVSCPYICSKRL-DHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG  204
            GGVSCPYICSKRL DHGVLLVGYGSAG+APIR KEKPYWIIKNSWGESWGEKGYYKICRG
Sbjct  294  GGVSCPYICSKRLLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGESWGEKGYYKICRG  353

Query  205  RNICGVDSMVSTVAAVNTPT  264
            RNICG+DSMVS VAA   PT
Sbjct  354  RNICGMDSMVSAVAAA-VPT  372



>gb|EYU37835.1| hypothetical protein MIMGU_mgv1a008237mg [Erythranthe guttata]
Length=380

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  31   GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  210
            GVSCPYIC+KRLDHGVLLVGYG  GY+PIR+KEKPYWIIKNSWG +WGE GYYKICRGRN
Sbjct  302  GVSCPYICTKRLDHGVLLVGYGETGYSPIRMKEKPYWIIKNSWGPNWGEDGYYKICRGRN  361

Query  211  ICGVDSMVSTVAAVNT  258
            ICGVDSMVSTVAAV+T
Sbjct  362  ICGVDSMVSTVAAVST  377



>ref|XP_002275759.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI17456.3| unnamed protein product [Vitis vinifera]
Length=367

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +1

Query  31   GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  210
            GVSCPYICS+ LDHGV+LVGYGSAGYAPIR KEKPYWIIKNSWGESWGE GYYKICRG N
Sbjct  289  GVSCPYICSRNLDHGVVLVGYGSAGYAPIRFKEKPYWIIKNSWGESWGEDGYYKICRGHN  348

Query  211  ICGVDSMVSTVAAVNTPTS  267
             CGVDSMVSTVAA+ T T 
Sbjct  349  ACGVDSMVSTVAAIQTTTQ  367



>ref|XP_010910124.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=374

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC K LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYKIC+GR
Sbjct  297  GGVSCPYICGKHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEDGYYKICKGR  356

Query  208  NICGVDSMVSTVAAVNT  258
            N+CGVDSMVSTV AV +
Sbjct  357  NVCGVDSMVSTVTAVRS  373



>ref|XP_010530325.1| PREDICTED: cysteine proteinase RD19a [Tarenaya hassleriana]
Length=370

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKR DHGVLLVGYGSAGY+PIRLKEKPYWIIKNSWG +WGE+GYYKIC GR
Sbjct  291  GGVSCPYICSKRQDHGVLLVGYGSAGYSPIRLKEKPYWIIKNSWGANWGEEGYYKICHGR  350

Query  208  NICGVDSMVSTVAAVNTPTS  267
            N+CG+D+MVS+VAAV+T T 
Sbjct  351  NLCGMDTMVSSVAAVHTSTQ  370



>ref|XP_008775532.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=371

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC + LDHGVLLVGYGSA YAPIR KEKPYWIIKNSWGE WGE GYYKICRGR
Sbjct  294  GGVSCPYICGRHLDHGVLLVGYGSAAYAPIRFKEKPYWIIKNSWGEKWGENGYYKICRGR  353

Query  208  NICGVDSMVSTVAAVNT  258
            N+CGVDSMVSTVAAV +
Sbjct  354  NVCGVDSMVSTVAAVRS  370



>ref|XP_010531457.1| PREDICTED: probable cysteine proteinase A494 [Tarenaya hassleriana]
Length=364

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICS+RL+HGVLLVGYGSAGYAP R+KEKP+WIIKNSWGE+WGEKG+YKICRGR
Sbjct  287  GGVSCPYICSRRLNHGVLLVGYGSAGYAPARMKEKPFWIIKNSWGENWGEKGFYKICRGR  346

Query  208  NICGVDSMVSTVAA  249
            NICGVDS+VSTVAA
Sbjct  347  NICGVDSLVSTVAA  360



>dbj|BAC41322.1| hypothetical protein [Lotus japonicus]
Length=358

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGR
Sbjct  281  GGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICRGR  340

Query  208  NICGVDSMVSTVAAVNT  258
            NICGVDSMVSTVAA++T
Sbjct  341  NICGVDSMVSTVAALHT  357



>gb|AAL05851.1|AF411121_1 cysteine proteinase precursor [Sandersonia aurantiaca]
Length=360

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC K LDHGVLLVGYGSAG+APIR KEKPYWIIKNSWGE+WGE GYYKICRGR
Sbjct  282  GGVSCPYICGKHLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGENWGENGYYKICRGR  341

Query  208  NICGVDSMVSTVAAVNT  258
            N+CGVDSMVS+V+A +T
Sbjct  342  NVCGVDSMVSSVSAFHT  358



>ref|XP_008460996.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=377

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +1

Query  31   GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  210
            GVSCPYICS+ LDHGVLLVGYGS GYAPIR+K+KPYWIIKNSWG +WGE GYYKICRGRN
Sbjct  299  GVSCPYICSRHLDHGVLLVGYGSEGYAPIRMKDKPYWIIKNSWGANWGENGYYKICRGRN  358

Query  211  ICGVDSMVSTVAAVNTPTS  267
            ICGVDSMVSTVAAV+T  +
Sbjct  359  ICGVDSMVSTVAAVHTAAN  377



>ref|XP_009392632.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=369

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC + LDHGVLLVGYGSAGY+PIRLK+KP+WIIKNSWGE+WGE GYYKICRGR
Sbjct  289  GGVSCPYICGRHLDHGVLLVGYGSAGYSPIRLKDKPFWIIKNSWGENWGEHGYYKICRGR  348

Query  208  NICGVDSMVSTVAAVNT  258
            NICGVDSMVS+V+A++T
Sbjct  349  NICGVDSMVSSVSAIHT  365



>gb|KHN12668.1| Cysteine proteinase 15A [Glycine soja]
Length=156

 Score =   144 bits (363),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC K LDHGVLLVGYG   YAPIR K KPYWIIKNSWGESWGE GYYKICRGR
Sbjct  77   GGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYYKICRGR  136

Query  208  NICGVDSMVSTVAAV  252
            N+CGVDSMVSTVAA+
Sbjct  137  NVCGVDSMVSTVAAI  151



>gb|EYU42593.1| hypothetical protein MIMGU_mgv1a008336mg [Erythranthe guttata]
Length=377

 Score =   150 bits (378),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCP+IC+KRLDHGVLLVGYG+  +APIR+KEKPYWIIKNSWG +WGEKGYYKIC+GR
Sbjct  300  GGVSCPFICAKRLDHGVLLVGYGAGAFAPIRMKEKPYWIIKNSWGPNWGEKGYYKICQGR  359

Query  208  NICGVDSMVSTVAAVNT  258
            N+CGVDSMVSTVAAV T
Sbjct  360  NLCGVDSMVSTVAAVTT  376



>ref|XP_011045161.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSK  DHGVLLVGYG+AGYAPIR KEKP+WIIKNSWGE+WGE GYYKICR R
Sbjct  288  GGVSCPYICSKHQDHGVLLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGENGYYKICRAR  347

Query  208  NICGVDSMVSTVAAVN  255
            NICGVDSMVSTVAA++
Sbjct  348  NICGVDSMVSTVAAIH  363



>gb|KHN25410.1| Cysteine proteinase RD19a [Glycine soja]
Length=365

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPY+CS+RL+HGVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYKICRGR
Sbjct  286  GGVSCPYVCSRRLNHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKICRGR  345

Query  208  NICGVDSMVSTVAAVNTPTS  267
            +ICGVDSMVSTVA+V+T T 
Sbjct  346  SICGVDSMVSTVASVHTTTQ  365



>emb|CAE45588.1| papain-like cysteine proteinase-like protein 1 [Lotus japonicus]
Length=359

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGR
Sbjct  282  GGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICRGR  341

Query  208  NICGVDSMVSTVAAVNT  258
            NICGVDSMVSTVAA++T
Sbjct  342  NICGVDSMVSTVAALHT  358



>ref|XP_009602233.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana tomentosiformis]
Length=369

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 75/79 (95%), Gaps = 1/79 (1%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKICRGR
Sbjct  291  GGVSCPYICSKRLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGENGYYKICRGR  349

Query  208  NICGVDSMVSTVAAVNTPT  264
            N+CGVDSMVSTVAAV+T +
Sbjct  350  NVCGVDSMVSTVAAVSTSS  368



>ref|XP_002306900.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
 gb|ABK92924.1| unknown [Populus trichocarpa]
 gb|EEE93896.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
Length=367

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSK  DHGVLLVGYG+AGYAPIR KEKP+WIIKNSWGE+WGE GYYKICR R
Sbjct  288  GGVSCPYICSKHQDHGVLLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGENGYYKICRAR  347

Query  208  NICGVDSMVSTVAAVN  255
            NICGVDSMVSTVAA++
Sbjct  348  NICGVDSMVSTVAAIH  363



>dbj|BAF98584.1| CM0216.500.nc [Lotus japonicus]
Length=360

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGR
Sbjct  281  GGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICRGR  340

Query  208  NICGVDSMVSTVAAVNT  258
            NICGVDSMVSTVAA++T
Sbjct  341  NICGVDSMVSTVAALHT  357



>ref|XP_007017672.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOY14897.1| Papain family cysteine protease [Theobroma cacao]
Length=401

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  31   GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  210
            GVSCPYIC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE+GYYKICRGRN
Sbjct  323  GVSCPYICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEEGYYKICRGRN  382

Query  211  ICGVDSMVSTVAAVNT  258
            +CGVDSMVS+VAA+ T
Sbjct  383  VCGVDSMVSSVAALQT  398



>ref|XP_008448073.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=385

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCP+ICS RLDHGVLLVGYGSAGYAPIR+++K YWIIKNSWGE+WGE GYYKICRGR
Sbjct  296  GGVSCPFICSNRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGENWGENGYYKICRGR  355

Query  208  NICGVDSMVSTVAAVN  255
            NICGVDS+VSTVAAV+
Sbjct  356  NICGVDSLVSTVAAVH  371



>gb|KHN22211.1| Cysteine proteinase 15A [Glycine soja]
Length=366

 Score =   149 bits (375),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC K LDHGVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYY ICRGR
Sbjct  287  GGVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYNICRGR  346

Query  208  NICGVDSMVSTVAAVN  255
            N+CGVDSMVSTVAA++
Sbjct  347  NVCGVDSMVSTVAAIH  362



>ref|XP_009109502.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
 emb|CDX90310.1| BnaA08g16740D [Brassica napus]
Length=369

 Score =   149 bits (375),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKICRGR
Sbjct  289  GGVSCPYICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICRGR  348

Query  208  NICGVDSMVSTVAAVNTPTS  267
            N+CGVDS+VSTV A  +PT+
Sbjct  349  NVCGVDSLVSTVTAAVSPTA  368



>emb|CAE45589.1| papain-like cysteine proteinase-like protein 2 [Lotus japonicus]
Length=361

 Score =   148 bits (374),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGR
Sbjct  282  GGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICRGR  341

Query  208  NICGVDSMVSTVAAVNT  258
            N+CGVDSMVSTVAA++T
Sbjct  342  NVCGVDSMVSTVAALHT  358



>gb|AGV54334.1| cysteine proteinase RD19a-like protein [Phaseolus vulgaris]
Length=366

 Score =   148 bits (374),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC K LDHGVLLVGYG+  YAPIR KEKP+WIIKNSWGESWGE GYYKICRG 
Sbjct  287  GGVSCPYICGKHLDHGVLLVGYGAGAYAPIRFKEKPFWIIKNSWGESWGENGYYKICRGH  346

Query  208  NICGVDSMVSTVAAVNT  258
            N+CGVDSMVSTVAA++T
Sbjct  347  NVCGVDSMVSTVAAIHT  363



>ref|XP_006362019.1| PREDICTED: cysteine proteinase RD19a-like [Solanum tuberosum]
Length=368

 Score =   148 bits (374),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 74/77 (96%), Gaps = 1/77 (1%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSK+LDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKICRGR
Sbjct  291  GGVSCPYICSKQLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGENGYYKICRGR  349

Query  208  NICGVDSMVSTVAAVNT  258
            N+CGVDSMVSTVAAV+T
Sbjct  350  NVCGVDSMVSTVAAVST  366



>gb|KJB07487.1| hypothetical protein B456_001G026600 [Gossypium raimondii]
Length=377

 Score =   149 bits (375),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCP+ICSK LDHGVLLVGYGSAGY+PI LK+KPYWIIKNSWGE+WGE GYYKICRG 
Sbjct  298  GGVSCPFICSKHLDHGVLLVGYGSAGYSPIHLKDKPYWIIKNSWGENWGENGYYKICRGS  357

Query  208  NICGVDSMVSTVAAVNT  258
            N+CGVDS+VSTV A+NT
Sbjct  358  NVCGVDSLVSTVVALNT  374



>ref|XP_007136047.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
 gb|ESW08041.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
Length=366

 Score =   148 bits (374),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC K LDHGVLLVGYG+  YAPIR KEKP+WIIKNSWGESWGE GYYKICRG 
Sbjct  287  GGVSCPYICGKHLDHGVLLVGYGAGAYAPIRFKEKPFWIIKNSWGESWGENGYYKICRGH  346

Query  208  NICGVDSMVSTVAAVNT  258
            N+CGVDSMVSTVAA++T
Sbjct  347  NVCGVDSMVSTVAAIHT  363



>gb|AAB62937.1| stress-induced cysteine proteinase [Lavatera thuringiaca]
Length=175

 Score =   143 bits (361),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC + LDHGVLLVGYG+AGYAP+R KEKP+WIIKNSWG +WGE GYYKICRGR
Sbjct  96   GGVSCPYICFRSLDHGVLLVGYGAAGYAPVRFKEKPFWIIKNSWGANWGEDGYYKICRGR  155

Query  208  NICGVDSMVSTVAAVNTPTS  267
            N+CGVDSMVS+VAA+ T + 
Sbjct  156  NVCGVDSMVSSVAALQTKSQ  175



>ref|XP_004291404.1| PREDICTED: cysteine proteinase 15A-like [Fragaria vesca subsp. 
vesca]
Length=365

 Score =   148 bits (374),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 74/78 (95%), Gaps = 1/78 (1%)
 Frame = +1

Query  28   GGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG  204
            GGVSCPYIC K  LDHGVLLVGYGS+GYAPIR KEKPYWIIKNSWG+SWGE+GYYKICRG
Sbjct  288  GGVSCPYICGKNHLDHGVLLVGYGSSGYAPIRFKEKPYWIIKNSWGQSWGEEGYYKICRG  347

Query  205  RNICGVDSMVSTVAAVNT  258
            RN+CGVDSMVSTVAA++T
Sbjct  348  RNVCGVDSMVSTVAAMHT  365



>ref|XP_004230928.1| PREDICTED: cysteine proteinase RD19a [Solanum lycopersicum]
Length=369

 Score =   148 bits (374),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 74/77 (96%), Gaps = 1/77 (1%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSK+LDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKICRGR
Sbjct  291  GGVSCPYICSKQLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGESGYYKICRGR  349

Query  208  NICGVDSMVSTVAAVNT  258
            N+CGVDSMVSTVAAV+T
Sbjct  350  NVCGVDSMVSTVAAVST  366



>ref|XP_006473584.1| PREDICTED: cysteine proteinase 15A-like [Citrus sinensis]
Length=369

 Score =   148 bits (374),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC K LDHGVL+VGYGS+G+APIR KEKPYWIIKNSWGE+WGE GYYKIC GR
Sbjct  290  GGVSCPYICGKYLDHGVLIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGENGYYKICMGR  349

Query  208  NICGVDSMVSTVAAVNTPTS  267
            N+CGVDSMVS+VAAV+T +S
Sbjct  350  NVCGVDSMVSSVAAVHTTSS  369



>ref|XP_010105270.1| Cysteine proteinase 15A [Morus notabilis]
 gb|EXC04205.1| Cysteine proteinase 15A [Morus notabilis]
Length=372

 Score =   148 bits (374),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 74/77 (96%), Gaps = 1/77 (1%)
 Frame = +1

Query  28   GGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG  204
            GGVSCPYICSK  LDHGVLLVGYG+AGYAPIR K+KPYWIIKNSWGE+WGE+GYYKICRG
Sbjct  287  GGVSCPYICSKHMLDHGVLLVGYGTAGYAPIRFKDKPYWIIKNSWGENWGEQGYYKICRG  346

Query  205  RNICGVDSMVSTVAAVN  255
            RN+CGVDSMVSTVAA++
Sbjct  347  RNVCGVDSMVSTVAALH  363



>dbj|BAF98585.1| CM0216.510.nc [Lotus japonicus]
Length=360

 Score =   148 bits (373),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGR
Sbjct  281  GGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICRGR  340

Query  208  NICGVDSMVSTVAAVNT  258
            N+CGVDSMVSTVAA++T
Sbjct  341  NVCGVDSMVSTVAALHT  357



>gb|AAM65162.1| cysteine proteinase RD19A [Arabidopsis thaliana]
Length=368

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC++RL+HGVLLVGYG+AGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GR
Sbjct  288  GGVSCPYICTRRLNHGVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGR  347

Query  208  NICGVDSMVSTVAAVNTPTS  267
            NICGVDSMVSTVAA  + T+
Sbjct  348  NICGVDSMVSTVAATVSTTA  367



>ref|NP_568052.1| cysteine proteinase RD19a [Arabidopsis thaliana]
 sp|P43296.1|RD19A_ARATH RecName: Full=Cysteine proteinase RD19a; Short=RD19; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA02373.1| thiol protease [Arabidopsis thaliana]
 emb|CAB38829.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 emb|CAB80572.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AAL85009.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 gb|AAM91778.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 dbj|BAE98545.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AEE87016.1| cysteine proteinase RD19a [Arabidopsis thaliana]
Length=368

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC++RL+HGVLLVGYG+AGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GR
Sbjct  288  GGVSCPYICTRRLNHGVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGR  347

Query  208  NICGVDSMVSTVAAVNTPTS  267
            NICGVDSMVSTVAA  + T+
Sbjct  348  NICGVDSMVSTVAATVSTTA  367



>gb|KDO84720.1| hypothetical protein CISIN_1g017548mg [Citrus sinensis]
Length=369

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC K LDHGVL+VGYGS+G+APIR KEKPYWIIKNSWGE+WGE GYYKIC GR
Sbjct  290  GGVSCPYICGKYLDHGVLIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGENGYYKICMGR  349

Query  208  NICGVDSMVSTVAAVNTPTS  267
            N+CGVDSMVS+VAA++T +S
Sbjct  350  NVCGVDSMVSSVAAIHTTSS  369



>ref|XP_006435090.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
 gb|ESR48330.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
Length=369

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC K LDHGVL+VGYGS+G+APIR KEKPYWIIKNSWGE+WGE GYYKIC GR
Sbjct  290  GGVSCPYICGKYLDHGVLIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGENGYYKICMGR  349

Query  208  NICGVDSMVSTVAAVNTPTS  267
            N+CGVDSMVS+VAA++T +S
Sbjct  350  NVCGVDSMVSSVAAIHTTSS  369



>gb|AIB06025.1| CP3 [Hevea brasiliensis]
Length=366

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSK  DHGVLLVGYG+AGYAPIR K+KP+WIIKNSWGE+WGE GYYKICRGR
Sbjct  287  GGVSCPYICSKSQDHGVLLVGYGAAGYAPIRFKDKPFWIIKNSWGENWGENGYYKICRGR  346

Query  208  NICGVDSMVSTVAAVNT  258
            NICG+D+MVS+VAA++T
Sbjct  347  NICGMDAMVSSVAAIHT  363



>ref|XP_006828787.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
 gb|ERM96203.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
Length=365

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 74/78 (95%), Gaps = 1/78 (1%)
 Frame = +1

Query  28   GGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG  204
            GGVSCPYICSKR LDHGVL+VGYGSAGYAPIRLK+K YWIIKNSWGE+WGEKGYYKICRG
Sbjct  288  GGVSCPYICSKRNLDHGVLIVGYGSAGYAPIRLKDKAYWIIKNSWGETWGEKGYYKICRG  347

Query  205  RNICGVDSMVSTVAAVNT  258
             NICGVDSMVSTVA++ +
Sbjct  348  HNICGVDSMVSTVASIQS  365



>ref|XP_007160702.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
 gb|ESW32696.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
Length=365

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC K LDHGVLLVGYG   YAPIR KEKPYWIIKNSWGE+WGE GYYKICRGR
Sbjct  286  GGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGR  345

Query  208  NICGVDSMVSTVAAVNTPTS  267
            N+CGVDSMVSTV A++  T 
Sbjct  346  NVCGVDSMVSTVGAIHASTQ  365



>emb|CDY71205.1| BnaCnng71840D [Brassica napus]
Length=368

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKICRGR
Sbjct  288  GGVSCPYICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEDGFYKICRGR  347

Query  208  NICGVDSMVSTVAAVNTPTS  267
            N+CGVDS+VSTV A  +P +
Sbjct  348  NVCGVDSLVSTVTATVSPAA  367



>gb|AAL60581.1|AF454959_1 senescence-associated cysteine protease [Brassica oleracea]
Length=368

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKICRGR
Sbjct  288  GGVSCPYICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEDGFYKICRGR  347

Query  208  NICGVDSMVSTVAAVNTPTS  267
            N+CGVDS+VSTV A  +P +
Sbjct  348  NVCGVDSLVSTVTATVSPAA  367



>ref|XP_006411706.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
 dbj|BAJ33785.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53159.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
Length=373

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGESWGE G+YKIC+GR
Sbjct  293  GGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGESWGENGFYKICKGR  352

Query  208  NICGVDSMVSTVAAVNTPTS  267
            NICGVDS+VSTV+A  + T+
Sbjct  353  NICGVDSLVSTVSATVSTTA  372



>ref|XP_008387995.1| PREDICTED: cysteine proteinase 15A [Malus domestica]
Length=365

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC KR+DHGVLLVGYGS+G+APIRLKEKPYWI+KNSWG+SWGE+GYYKICRG 
Sbjct  286  GGVSCPYICGKRIDHGVLLVGYGSSGFAPIRLKEKPYWILKNSWGQSWGEQGYYKICRGY  345

Query  208  NICGVDSMVSTVAAVNT  258
            N CGVDS+VSTVAA++T
Sbjct  346  NSCGVDSLVSTVAALHT  362



>gb|KFK30492.1| hypothetical protein AALP_AA7G268600 [Arabis alpina]
Length=367

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GR
Sbjct  287  GGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGR  346

Query  208  NICGVDSMVSTVAAVNTPTS  267
            NICGVDS+VSTVAA  + T+
Sbjct  347  NICGVDSLVSTVAATVSTTA  366



>dbj|BAF03553.1| cysteine proteinase CP2 [Phaseolus vulgaris]
Length=365

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC K LDHGVLLVGYG   YAPIR KEKPYWIIKNSWGE+WGE GYYKICRGR
Sbjct  286  GGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGR  345

Query  208  NICGVDSMVSTVAAVNTPTS  267
            N+CGVDSMVSTV A++  T 
Sbjct  346  NVCGVDSMVSTVGAIHASTQ  365



>ref|XP_009146338.1| PREDICTED: cysteine proteinase 15A-like [Brassica rapa]
 emb|CDY32227.1| BnaA01g17570D [Brassica napus]
Length=368

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 74/81 (91%), Gaps = 1/81 (1%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG +WGE GYYKICRGR
Sbjct  288  GGVSCPYICSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGSTWGEDGYYKICRGR  347

Query  208  -NICGVDSMVSTVAAVNTPTS  267
             NICG+D+MVSTVAAV+T T 
Sbjct  348  HNICGMDTMVSTVAAVHTSTQ  368



>emb|CDY34441.1| BnaC01g21920D [Brassica napus]
Length=368

 Score =   146 bits (369),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 74/80 (93%), Gaps = 1/80 (1%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG +WGE GYYKICRGR
Sbjct  288  GGVSCPYICSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGSTWGEDGYYKICRGR  347

Query  208  -NICGVDSMVSTVAAVNTPT  264
             NICG+D+MVSTVAAV+T T
Sbjct  348  HNICGMDTMVSTVAAVHTST  367



>emb|CAB53397.1| cysteine protease [Medicago sativa]
Length=209

 Score =   142 bits (359),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 73/77 (95%), Gaps = 1/77 (1%)
 Frame = +1

Query  31   GVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GVSCP+IC+K RLDHGVLLVG+GS GYAPIRLKEKPYWIIKNSWG++WGE+GYYKICRGR
Sbjct  133  GVSCPHICAKARLDHGVLLVGFGSGGYAPIRLKEKPYWIIKNSWGQNWGEEGYYKICRGR  192

Query  208  NICGVDSMVSTVAAVNT  258
            N+CGVDSMVSTVAA  +
Sbjct  193  NVCGVDSMVSTVAAAQS  209



>dbj|BAF46302.1| cysteine proteinase precursor [Ipomoea nil]
Length=369

 Score =   146 bits (369),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 73/78 (94%), Gaps = 1/78 (1%)
 Frame = +1

Query  28   GGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG  204
            GGVSCPYICSKR LDHGVLLVGYG+AGYAPIR K+KPYWI+KNSWGE+WGE+GYYKICRG
Sbjct  289  GGVSCPYICSKRNLDHGVLLVGYGAAGYAPIRFKDKPYWIVKNSWGENWGEEGYYKICRG  348

Query  205  RNICGVDSMVSTVAAVNT  258
             NICG+DSMVSTV A +T
Sbjct  349  NNICGIDSMVSTVTAAST  366



>ref|XP_006283963.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
 gb|EOA16861.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
Length=368

 Score =   146 bits (368),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GR
Sbjct  288  GGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGR  347

Query  208  NICGVDSMVSTVAAVNTPTS  267
            NICGVDS+VSTV+A  + T+
Sbjct  348  NICGVDSLVSTVSATVSTTA  367



>ref|XP_002868883.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45142.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score =   146 bits (368),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GR
Sbjct  288  GGVSCPYICTRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGR  347

Query  208  NICGVDSMVSTVAAVNTPTS  267
            NICGVDS+VSTV A  + T+
Sbjct  348  NICGVDSLVSTVTAAVSTTA  367



>gb|ACX54787.2| cysteine protease [Arachis diogoi]
Length=360

 Score =   145 bits (367),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC K LDHGVLLVGYG+AGYAPIR K+KP+WIIKNSWGESWGE GYYKICRG+
Sbjct  279  GGVSCPYICGKNLDHGVLLVGYGAAGYAPIRFKDKPFWIIKNSWGESWGEDGYYKICRGK  338

Query  208  NICGVDSMVSTVAAVNTPTSD  270
            N+CGVDSMVS+V A    +S+
Sbjct  339  NVCGVDSMVSSVVATTFTSSN  359



>ref|XP_002280808.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CBI19783.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   145 bits (367),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +1

Query  25   SGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG  204
            +GGVSCP+ICS  L+HGVLLVGYGSAGY+PIR KEKPYW++KNSWG++WGE GYYKICRG
Sbjct  286  AGGVSCPFICSTSLNHGVLLVGYGSAGYSPIRFKEKPYWLLKNSWGQNWGEHGYYKICRG  345

Query  205  RNICGVDSMVSTVAAVNTPT  264
             NICGVDSMVSTVAA+ + T
Sbjct  346  HNICGVDSMVSTVAAIQSAT  365



>ref|XP_003550405.2| PREDICTED: cysteine proteinase 15A [Glycine max]
Length=392

 Score =   146 bits (368),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC K LDHGVLLVGYG   YAPIR K KPYWIIKNSWGESWGE GYYKICRGR
Sbjct  313  GGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYYKICRGR  372

Query  208  NICGVDSMVSTVAAV  252
            N+CGVDSMVSTVAA+
Sbjct  373  NVCGVDSMVSTVAAI  387



>emb|CDY41960.1| BnaA01g05320D [Brassica napus]
Length=367

 Score =   145 bits (366),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GR
Sbjct  287  GGVSCPYICTRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGR  346

Query  208  NICGVDSMVSTVAAVNTPTS  267
            NICGVDS+VSTV A  + T+
Sbjct  347  NICGVDSLVSTVTAAVSTTA  366



>gb|ACK57563.1| cysteine protease-like protein [Arachis hypogaea]
Length=364

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCP+IC K LDHGVLLVGYG+ GYAPIR KEKPYWIIKNSWGE+WGE GYYKICRG 
Sbjct  285  GGVSCPFICGKHLDHGVLLVGYGAGGYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGP  344

Query  208  NICGVDSMVSTVAAVNT  258
            N+CGVDSMVSTV A++T
Sbjct  345  NMCGVDSMVSTVIAIHT  361



>dbj|BAA92495.1| cysteine protease [Vigna mungo]
Length=364

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC+KRLDHGV +VGYG +GYAPIR KEKPYWIIKNSWGESWGE GYYKICRG+
Sbjct  285  GGVSCPYICAKRLDHGVQIVGYGESGYAPIRFKEKPYWIIKNSWGESWGENGYYKICRGQ  344

Query  208  NICGVDSMVSTVAAVNT  258
            N CGVDSMVSTV A++ 
Sbjct  345  NACGVDSMVSTVGAIHA  361



>ref|XP_010446443.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GR
Sbjct  287  GGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGR  346

Query  208  NICGVDSMVSTVAAV  252
            NICGVDS+VSTV+A 
Sbjct  347  NICGVDSLVSTVSAT  361



>ref|XP_010431862.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GR
Sbjct  287  GGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGR  346

Query  208  NICGVDSMVSTVAAV  252
            NICGVDS+VSTV+A 
Sbjct  347  NICGVDSLVSTVSAT  361



>ref|XP_010437007.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=368

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GR
Sbjct  288  GGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGR  347

Query  208  NICGVDSMVSTVAAV  252
            NICGVDS+VSTV+A 
Sbjct  348  NICGVDSLVSTVSAT  362



>ref|XP_006665032.1| PREDICTED: cysteine proteinase 1-like [Oryza brachyantha]
Length=191

 Score =   140 bits (354),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 72/80 (90%), Gaps = 3/80 (4%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC K LDHGVLLVGYGS+G+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG 
Sbjct  109  GGVSCPYICGKHLDHGVLLVGYGSSGFAPIRLKDKPYWIIKNSWGENWGEHGYYKICRGS  168

Query  208  NI---CGVDSMVSTVAAVNT  258
            N+   CGVDSMVSTV A++T
Sbjct  169  NVRDKCGVDSMVSTVTAIHT  188



>ref|XP_010440192.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=365

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCPY+CSK  DHGVLLVG+GSAGYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG 
Sbjct  285  GGVSCPYVCSKSQDHGVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGP  344

Query  205  RNICGVDSMVSTVAAVNTPT  264
             N+CG+DSMVSTVAAV+T T
Sbjct  345  HNVCGMDSMVSTVAAVHTTT  364



>ref|XP_010449835.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCPY+CSK  DHGVLLVG+GSAGYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG 
Sbjct  285  GGVSCPYVCSKNQDHGVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGP  344

Query  205  RNICGVDSMVSTVAAVNTPT  264
             N+CG+DSMVSTVAAV+T T
Sbjct  345  HNMCGMDSMVSTVAAVHTTT  364



>ref|XP_008775280.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=368

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC + LDHGVLLVGYGSAGYAPIR K+KPYWIIKNSWGE+WGE GYYKICRG 
Sbjct  292  GGVSCPYICGRHLDHGVLLVGYGSAGYAPIRFKDKPYWIIKNSWGENWGEDGYYKICRGH  351

Query  208  NICGVDSMVSTVAAV  252
            NICGV+SMVSTV A+
Sbjct  352  NICGVESMVSTVTAI  366



>ref|XP_003545051.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=367

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC K LDHGVL+VGYG   YAPIR K KPYWIIKNSWGESWGE GYYKICRGR
Sbjct  288  GGVSCPYICGKHLDHGVLIVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYYKICRGR  347

Query  208  NICGVDSMVSTVAAV  252
            N+CGVDSMVSTVAA+
Sbjct  348  NVCGVDSMVSTVAAI  362



>ref|XP_010434865.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCPY+CSK  DHGVLLVG+GSAGYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG 
Sbjct  285  GGVSCPYVCSKSQDHGVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGP  344

Query  205  RNICGVDSMVSTVAAVNTPT  264
             N+CG+DSMVSTVAAV+T T
Sbjct  345  HNMCGMDSMVSTVAAVHTTT  364



>gb|AAD29084.1|AF082181_1 cysteine proteinase precursor [Solanum melongena]
Length=363

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  31   GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  210
            GVSCP IC KR DHGVLLVGYGSAG+APIRLKEKPYWIIKNSWGE+WGE GYYKICRG N
Sbjct  283  GVSCPLICFKRQDHGVLLVGYGSAGFAPIRLKEKPYWIIKNSWGENWGEHGYYKICRGHN  342

Query  211  ICGVDSMVSTVAAVNT  258
            ICGVD+MVSTV A +T
Sbjct  343  ICGVDAMVSTVTATHT  358



>gb|ACM80348.1| cysteine proteinase [Solanum lycopersicum]
Length=368

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 73/77 (95%), Gaps = 1/77 (1%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSK+LDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKI RGR
Sbjct  291  GGVSCPYICSKQLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGESGYYKIRRGR  349

Query  208  NICGVDSMVSTVAAVNT  258
            N+CGVDSMVSTVAAV+T
Sbjct  350  NVCGVDSMVSTVAAVST  366



>emb|CAA52403.1| putative thiol protease [Arabidopsis thaliana]
Length=313

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICS+RL+HGVLLVGYGSAG++  RLKEKPYWIIKNSWGESWGE G+YKIC+GR
Sbjct  237  GGVSCPYICSRRLNHGVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENGFYKICKGR  296

Query  208  NICGVDSMVSTVAAVNT  258
            NICGVDS+VSTVAA  +
Sbjct  297  NICGVDSLVSTVAATTS  313



>ref|XP_011083631.1| PREDICTED: cysteine proteinase 15A-like [Sesamum indicum]
Length=371

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 71/79 (90%), Gaps = 1/79 (1%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC K LDHGVLLVGYG+AGYAPIRLKEKPYWIIKNSWGE+WGE GYYKICRG 
Sbjct  292  GGVSCPYICGKHLDHGVLLVGYGAAGYAPIRLKEKPYWIIKNSWGENWGENGYYKICRGH  351

Query  208  NICGVDSMVSTVAAVN-TP  261
            N+CGV SMVSTV A + TP
Sbjct  352  NVCGVASMVSTVTAAHVTP  370



>ref|XP_009150026.1| PREDICTED: cysteine proteinase RD19a [Brassica rapa]
Length=367

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC++RL+HGVLLVGYGSAGYAP R KE+PYWIIKNSWGE+WGE G+YKIC+GR
Sbjct  287  GGVSCPYICTRRLNHGVLLVGYGSAGYAPARFKERPYWIIKNSWGETWGENGFYKICKGR  346

Query  208  NICGVDSMVSTVAAVNTPTS  267
            NICGVDS+VSTV A  + T+
Sbjct  347  NICGVDSLVSTVTAAVSTTA  366



>dbj|BAD43619.1| putative cysteine proteinase [Arabidopsis thaliana]
Length=361

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICS+RL+HGVLLVGYGSAG++  RLKEKPYWIIKNSWGESWGE G+YKIC+GR
Sbjct  285  GGVSCPYICSRRLNHGVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENGFYKICKGR  344

Query  208  NICGVDSMVSTVAAVNT  258
            NICGVDS+VSTVAA  +
Sbjct  345  NICGVDSLVSTVAATTS  361



>ref|XP_003589348.1| Cysteine proteinase [Medicago truncatula]
 gb|AES59599.1| papain family cysteine protease [Medicago truncatula]
Length=364

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 72/77 (94%), Gaps = 1/77 (1%)
 Frame = +1

Query  31   GVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GVSCPYIC+K RLDHGVLL+G+G  GYAPIRLKEKPYWIIKNSWG++WGE+GYYKICRGR
Sbjct  288  GVSCPYICAKARLDHGVLLLGFGQGGYAPIRLKEKPYWIIKNSWGQNWGEEGYYKICRGR  347

Query  208  NICGVDSMVSTVAAVNT  258
            N+CGVDSMVSTVAA  +
Sbjct  348  NVCGVDSMVSTVAAAQS  364



>ref|NP_565512.1| Papain family cysteine protease [Arabidopsis thaliana]
 sp|P43295.2|A494_ARATH RecName: Full=Probable cysteine proteinase A494; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD23687.1| cysteine proteinase [Arabidopsis thaliana]
 gb|ABJ98563.1| At2g21430 [Arabidopsis thaliana]
 gb|AEC07177.1| Papain family cysteine protease [Arabidopsis thaliana]
Length=361

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICS+RL+HGVLLVGYGSAG++  RLKEKPYWIIKNSWGESWGE G+YKIC+GR
Sbjct  285  GGVSCPYICSRRLNHGVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENGFYKICKGR  344

Query  208  NICGVDSMVSTVAAVNT  258
            NICGVDS+VSTVAA  +
Sbjct  345  NICGVDSLVSTVAATTS  361



>emb|CDY09707.1| BnaC07g33540D [Brassica napus]
Length=366

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 71/78 (91%), Gaps = 1/78 (1%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
             GVSCPY+CSK  DHGVLLVG+GSAGYAP+RL+EKPYWIIKNSWG  WGEKGYYKICRG 
Sbjct  286  AGVSCPYVCSKNQDHGVLLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEKGYYKICRGT  345

Query  208  -NICGVDSMVSTVAAVNT  258
             NICGVD+MVSTVAAVNT
Sbjct  346  PNICGVDTMVSTVAAVNT  363



>emb|CAB17075.1| cysteine proteinase precursor [Phaseolus vulgaris]
Length=365

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC K LDHGVLLVGYG   YAPIR KEKPYWIIKNSWGE+WG  GYYKICRGR
Sbjct  286  GGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGGNGYYKICRGR  345

Query  208  NICGVDSMVSTVAAVNTPTS  267
            N+CGVDSMVSTV A++  T 
Sbjct  346  NVCGVDSMVSTVGAIHASTQ  365



>ref|XP_006653265.1| PREDICTED: cysteine proteinase 1-like, partial [Oryza brachyantha]
Length=366

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 71/80 (89%), Gaps = 3/80 (4%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCPYIC K LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYKICRG 
Sbjct  283  GGVSCPYICGKHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGP  342

Query  205  --RNICGVDSMVSTVAAVNT  258
              +N CGVDSMVSTV A++T
Sbjct  343  HVQNKCGVDSMVSTVTAIHT  362



>ref|XP_009335626.1| PREDICTED: cysteine proteinase 15A [Pyrus x bretschneideri]
Length=366

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC KR+DHGVLLVGYGS+G+APIR KEKPYWI+KNSWG+SWGE+GYYKICRG 
Sbjct  287  GGVSCPYICGKRIDHGVLLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEQGYYKICRGY  346

Query  208  NICGVDSMVSTVAAVN  255
            N CGVDS+VSTVAA++
Sbjct  347  NSCGVDSLVSTVAALH  362



>ref|XP_008221329.1| PREDICTED: cysteine proteinase 15A-like [Prunus mume]
Length=366

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  31   GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  210
            GVSCPYIC KR+DHGVLLVGYGS+G+APIR KEKPYWI+KNSWG+SWGE+GYYKICRG N
Sbjct  288  GVSCPYICGKRIDHGVLLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEEGYYKICRGHN  347

Query  211  ICGVDSMVSTVAAVNT  258
             CGVDS+VSTVA+++T
Sbjct  348  PCGVDSLVSTVASLHT  363



>emb|CDP07452.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 72/78 (92%), Gaps = 1/78 (1%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCPYICSK  DHGVLLVGYG+AGYAPIRLK+KPYWIIKNSWGE+WGE GYYK CR  
Sbjct  299  GGVSCPYICSKSQDHGVLLVGYGAAGYAPIRLKDKPYWIIKNSWGENWGENGYYKFCRAD  358

Query  205  RNICGVDSMVSTVAAVNT  258
            RN+CGVDSMVS+VAAV+T
Sbjct  359  RNLCGVDSMVSSVAAVHT  376



>ref|XP_010943608.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=371

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC + LDHGVLLVGYGSAGYAPIR K+KPYWIIKNSWG +WGE GYYKICRG+
Sbjct  294  GGVSCPYICGRHLDHGVLLVGYGSAGYAPIRFKDKPYWIIKNSWGGNWGEDGYYKICRGQ  353

Query  208  NICGVDSMVSTVAAVNT  258
            NICGV+SMVSTV AV T
Sbjct  354  NICGVESMVSTVTAVRT  370



>gb|KJB29611.1| hypothetical protein B456_005G110200 [Gossypium raimondii]
Length=370

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC + LDHGVLLVGYG+AGY+PIR K+KP+WIIKNSWG +WGE GYYKICRGR
Sbjct  291  GGVSCPYICFRTLDHGVLLVGYGAAGYSPIRFKDKPFWIIKNSWGANWGEDGYYKICRGR  350

Query  208  NICGVDSMVSTVAAVNTPTS  267
            N+CGVDSMVS+VAA++T + 
Sbjct  351  NVCGVDSMVSSVAALHTKSQ  370



>gb|AAQ81938.1| cysteine proteinase precursor [Ipomoea batatas]
Length=371

 Score =   143 bits (361),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 73/78 (94%), Gaps = 1/78 (1%)
 Frame = +1

Query  28   GGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG  204
            GGVSCPYICSK+ LDHGVL+VGYG+AGYAPIR K+KPYWIIKNSWGE+WGE+GYYKICRG
Sbjct  291  GGVSCPYICSKKNLDHGVLIVGYGAAGYAPIRFKDKPYWIIKNSWGENWGEEGYYKICRG  350

Query  205  RNICGVDSMVSTVAAVNT  258
             NICGVDSMVS+V A +T
Sbjct  351  NNICGVDSMVSSVTAAST  368



>ref|XP_010672379.1| PREDICTED: cysteine proteinase RD19a-like [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score =   143 bits (361),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCP +C + LDHGV+LVGYGSAGYAPIR KEKPYWIIKNSWG +WG++GYYKICRG 
Sbjct  295  GGVSCPLVCLRSLDHGVVLVGYGSAGYAPIRFKEKPYWIIKNSWGPNWGDQGYYKICRGH  354

Query  208  NICGVDSMVSTVAAVN  255
            N+CGVDSMVSTVAAVN
Sbjct  355  NVCGVDSMVSTVAAVN  370



>ref|XP_007223351.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
 gb|EMJ24550.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
Length=367

 Score =   143 bits (360),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  31   GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  210
            GVSCPYIC KR+DHGVLLVGYGS+G+APIR KEKPYWI+KNSWG+SWGE+G+YKICRG N
Sbjct  289  GVSCPYICGKRIDHGVLLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEEGFYKICRGHN  348

Query  211  ICGVDSMVSTVAAVNT  258
             CGVDS+VSTVA+++T
Sbjct  349  SCGVDSLVSTVASLHT  364



>sp|P25804.1|CYSP_PEA RecName: Full=Cysteine proteinase 15A; AltName: Full=Turgor-responsive 
protein 15A; Flags: Precursor [Pisum sativum]
 emb|CAA38242.1| unnamed protein product [Pisum sativum]
Length=363

 Score =   143 bits (360),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +1

Query  31   GVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GVSCPY+C+K RLDHGVLLVG+G   YAPIRLKEKPYWIIKNSWG++WGE+GYYKICRGR
Sbjct  285  GVSCPYVCAKSRLDHGVLLVGFGKGAYAPIRLKEKPYWIIKNSWGQNWGEQGYYKICRGR  344

Query  208  NICGVDSMVSTVAAVNT  258
            N+CGVDSMVSTVAA  +
Sbjct  345  NVCGVDSMVSTVAAAQS  361



>ref|XP_002880378.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56637.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICS+RL+HGVLL+GYGS+GY+  RLKEKPYWIIKNSWGESWGE G+YKIC+GR
Sbjct  284  GGVSCPYICSRRLNHGVLLMGYGSSGYSQARLKEKPYWIIKNSWGESWGENGFYKICKGR  343

Query  208  NICGVDSMVSTVAAVNT  258
            NICGVDS+VSTVAA  +
Sbjct  344  NICGVDSLVSTVAAATS  360



>emb|CAA82995.1| cysteine proteinase [Vicia sativa]
Length=358

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +1

Query  31   GVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GVSCPY+C+K RLDHGVLLVG+G   YAPIRLKEKPYWIIKNSWG++WGE+GYYKICRGR
Sbjct  280  GVSCPYVCAKARLDHGVLLVGFGKGAYAPIRLKEKPYWIIKNSWGQNWGEQGYYKICRGR  339

Query  208  NICGVDSMVSTVAAVNT  258
            N+CGVDSMVSTVAA  +
Sbjct  340  NVCGVDSMVSTVAAAQS  356



>emb|CDX99593.1| BnaC04g33500D [Brassica napus]
Length=343

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRL+HGVLLVGYGSAG++  R KEKPYWIIKNSWGE+WGE G+YK+C+GR
Sbjct  268  GGVSCPYICSKRLNHGVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENGFYKLCKGR  327

Query  208  NICGVDSMVSTVAAV  252
            N+CGVDSMVSTVAA 
Sbjct  328  NVCGVDSMVSTVAAA  342



>gb|AAB67878.1| pre-pro-cysteine proteinase [Vicia faba]
Length=363

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +1

Query  31   GVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GVSCPY+C+K RLDHGVLLVG+G   YAPIRLKEKPYWI+KNSWG++WGE+GYYKICRGR
Sbjct  285  GVSCPYVCAKSRLDHGVLLVGFGKGAYAPIRLKEKPYWIVKNSWGQNWGEQGYYKICRGR  344

Query  208  NICGVDSMVSTVAAVNT  258
            N+CGVDSMVSTVAA  +
Sbjct  345  NVCGVDSMVSTVAAAQS  361



>gb|KHG15062.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=370

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC + LDHGVLLVGYG+AGY+PIR K+KP+WIIKNSWG +WGE GYY+ICRGR
Sbjct  291  GGVSCPYICFRTLDHGVLLVGYGAAGYSPIRFKDKPFWIIKNSWGANWGEDGYYRICRGR  350

Query  208  NICGVDSMVSTVAAVNTPTS  267
            N+CGVDSMVS+VAA++T + 
Sbjct  351  NVCGVDSMVSSVAALHTKSQ  370



>gb|AAO11786.1| pre-pro cysteine proteinase [Vicia faba]
Length=363

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +1

Query  31   GVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GVSCPY+C+K RLDHGVLLVG+G   YAPIRLKEKPYWI+KNSWG++WGE+GYYKICRGR
Sbjct  285  GVSCPYVCAKSRLDHGVLLVGFGKGAYAPIRLKEKPYWIVKNSWGQNWGEQGYYKICRGR  344

Query  208  NICGVDSMVSTVAAVNT  258
            N+CGVDSMVSTVAA  +
Sbjct  345  NVCGVDSMVSTVAAAQS  361



>gb|AGS43121.1| cysteine protease 1, partial [Zea mays]
Length=90

 Score =   135 bits (339),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 3/80 (4%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCPYIC + LDHGVLLVGYG++G+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG 
Sbjct  8    GGVSCPYICGRHLDHGVLLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENGYYKICRGS  67

Query  205  --RNICGVDSMVSTVAAVNT  258
              RN CGVDSMVSTV+AV+ 
Sbjct  68   NVRNKCGVDSMVSTVSAVHA  87



>ref|XP_006283974.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
 gb|EOA16872.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
Length=365

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCPY+CSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG 
Sbjct  285  GGVSCPYVCSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGP  344

Query  205  RNICGVDSMVSTVAAVNTPT  264
             N+CG+D+MVSTVAAV+T T
Sbjct  345  HNMCGMDTMVSTVAAVHTTT  364



>emb|CAD40319.2| OSJNBb0054B09.3 [Oryza sativa Japonica Group]
 emb|CAH66180.1| OSIGBa0130O15.4 [Oryza sativa Indica Group]
 emb|CAH66205.1| OSIGBa0148D14.11 [Oryza sativa Indica Group]
Length=381

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 72/80 (90%), Gaps = 3/80 (4%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCP+IC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYKICRG 
Sbjct  297  GGVSCPFICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKICRGP  356

Query  205  --RNICGVDSMVSTVAAVNT  258
              +N CGVDSMVS+V A++T
Sbjct  357  HDKNKCGVDSMVSSVTAIHT  376



>ref|XP_009140277.1| PREDICTED: probable cysteine proteinase A494 [Brassica rapa]
Length=362

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRL+HGVLLVGYGSAG++  R KEKPYWIIKNSWGE+WGE G+YK+C+GR
Sbjct  287  GGVSCPYICSKRLNHGVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENGFYKLCKGR  346

Query  208  NICGVDSMVSTVAAV  252
            N+CG+DSMVSTVAA 
Sbjct  347  NVCGIDSMVSTVAAA  361



>ref|XP_009136751.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
Length=368

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 71/78 (91%), Gaps = 1/78 (1%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
             GVSCPY+CSK  DHGVLLVG+GSAGYAP+RL+EKPYWIIKNSWG  WGEKGYYKICRG 
Sbjct  288  AGVSCPYVCSKNQDHGVLLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEKGYYKICRGT  347

Query  208  -NICGVDSMVSTVAAVNT  258
             NICGVD+MVSTVAAV+T
Sbjct  348  PNICGVDTMVSTVAAVHT  365



>emb|CDY15894.1| BnaA04g12170D [Brassica napus]
Length=362

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRL+HGVLLVGYGSAG++  R KEKPYWIIKNSWGE+WGE G+YK+C+GR
Sbjct  287  GGVSCPYICSKRLNHGVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENGFYKLCKGR  346

Query  208  NICGVDSMVSTVAAV  252
            N+CG+DSMVSTVAA 
Sbjct  347  NVCGIDSMVSTVAAA  361



>emb|CAA57675.1| cysteine proteinase [Zea mays]
Length=145

 Score =   136 bits (343),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 72/80 (90%), Gaps = 3/80 (4%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCPYIC + LDHGVLLVGYG++G+AP+RLK+KPYWIIKNSWGE+WGE GYYKICRG 
Sbjct  63   GGVSCPYICGRHLDHGVLLVGYGASGFAPMRLKDKPYWIIKNSWGENWGENGYYKICRGS  122

Query  205  --RNICGVDSMVSTVAAVNT  258
              RN CGVDSMVSTV+AV+ 
Sbjct  123  NVRNKCGVDSMVSTVSAVHA  142



>ref|NP_001266121.1| uncharacterized protein LOC101501911 precursor [Cicer arietinum]
 emb|CAA08906.1| cysteine proteinase [Cicer arietinum]
Length=362

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 74/76 (97%), Gaps = 2/76 (3%)
 Frame = +1

Query  31   GVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GVSCPYIC+K RLDHGVLLVG+G+ G+APIRLKEKPYWIIKNSWG++WGE+GYYKICRGR
Sbjct  284  GVSCPYICAKSRLDHGVLLVGFGN-GFAPIRLKEKPYWIIKNSWGQNWGEEGYYKICRGR  342

Query  208  NICGVDSMVSTVAAVN  255
            NICGVDSMVSTVAAV+
Sbjct  343  NICGVDSMVSTVAAVH  358



>emb|CDX90537.1| BnaA03g42440D [Brassica napus]
Length=366

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 71/78 (91%), Gaps = 1/78 (1%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
             GVSCPY+CSK  DHGVLLVG+GSAGYAP+RL+EKPYWIIKNSWG  WGEKGYYKICRG 
Sbjct  286  AGVSCPYVCSKNQDHGVLLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEKGYYKICRGT  345

Query  208  -NICGVDSMVSTVAAVNT  258
             NICGVD+MVSTVAAV+T
Sbjct  346  PNICGVDTMVSTVAAVHT  363



>gb|EAY93546.1| hypothetical protein OsI_15336 [Oryza sativa Indica Group]
Length=348

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 72/80 (90%), Gaps = 3/80 (4%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCP+IC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYKICRG 
Sbjct  264  GGVSCPFICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKICRGP  323

Query  205  --RNICGVDSMVSTVAAVNT  258
              +N CGVDSMVS+V A++T
Sbjct  324  HDKNKCGVDSMVSSVTAIHT  343



>gb|AJA74415.1| cysteine protease [Cicer arietinum]
Length=358

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 74/76 (97%), Gaps = 2/76 (3%)
 Frame = +1

Query  31   GVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GVSCPYIC+K RLDHGVLLVG+G+ G+APIRLKEKPYWIIKNSWG++WGE+GYYKICRGR
Sbjct  280  GVSCPYICAKSRLDHGVLLVGFGN-GFAPIRLKEKPYWIIKNSWGQNWGEEGYYKICRGR  338

Query  208  NICGVDSMVSTVAAVN  255
            NICGVDSMVSTVAAV+
Sbjct  339  NICGVDSMVSTVAAVH  354



>gb|KJB58164.1| hypothetical protein B456_009G197400 [Gossypium raimondii]
Length=375

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +1

Query  31   GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  210
            GVSCPYIC K LDHGVLLVGYGSAGYAP+R K KPYWIIKNSWGE+WGE GYYKICRG N
Sbjct  292  GVSCPYICGKHLDHGVLLVGYGSAGYAPVRFKNKPYWIIKNSWGENWGENGYYKICRGNN  351

Query  211  ICGVDSMVSTVAAVN  255
            +CGVDSMVS+V+A++
Sbjct  352  VCGVDSMVSSVSALH  366



>ref|XP_006414378.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
 gb|ESQ55831.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
Length=367

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 71/81 (88%), Gaps = 1/81 (1%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCPY+CSK  DHGVLLVG+GS+GY+PIRLKEKPYWIIKNSWG  WGE GYYKICRG 
Sbjct  287  GGVSCPYVCSKSQDHGVLLVGFGSSGYSPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGS  346

Query  205  RNICGVDSMVSTVAAVNTPTS  267
             NICG+D+MVSTVAAV T T 
Sbjct  347  HNICGMDTMVSTVAAVQTSTQ  367



>gb|EEE60725.1| hypothetical protein OsJ_14236 [Oryza sativa Japonica Group]
Length=364

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 72/80 (90%), Gaps = 3/80 (4%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCP+IC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYKICRG 
Sbjct  280  GGVSCPFICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKICRGP  339

Query  205  --RNICGVDSMVSTVAAVNT  258
              +N CGVDSMVS+V A++T
Sbjct  340  HDKNKCGVDSMVSSVTAIHT  359



>ref|XP_006404590.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
 gb|ESQ46043.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
Length=363

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICS+RL+HGVLLVGYGSAG+A  RLK+KPYWIIKNSWGE+WGE GYYK+CRGR
Sbjct  288  GGVSCPYICSRRLNHGVLLVGYGSAGFAQARLKKKPYWIIKNSWGETWGENGYYKLCRGR  347

Query  208  NICGVDSMVSTVA  246
            NICGVDS+VSTVA
Sbjct  348  NICGVDSLVSTVA  360



>ref|XP_008444769.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=373

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 71/79 (90%), Gaps = 1/79 (1%)
 Frame = +1

Query  31   GVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GVSCPYICSKR LDHGVLLVGYGSAG+APIR KEKPYWIIKNSWGE+WGE GYY IC+G+
Sbjct  295  GVSCPYICSKRNLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGENWGENGYYFICKGK  354

Query  208  NICGVDSMVSTVAAVNTPT  264
            N+CG +SMVS+VAA  TP 
Sbjct  355  NVCGSESMVSSVAAAATPN  373



>ref|XP_002452058.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
 gb|EES05034.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
Length=371

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 72/80 (90%), Gaps = 3/80 (4%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCPYIC + LDHGVLLVGYG+AG+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG 
Sbjct  289  GGVSCPYICGRTLDHGVLLVGYGAAGFAPIRLKDKPYWIIKNSWGENWGENGYYKICRGS  348

Query  205  --RNICGVDSMVSTVAAVNT  258
              RN CGVDSMVSTV+AV T
Sbjct  349  NVRNKCGVDSMVSTVSAVRT  368



>gb|EMT16425.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=379

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 3/80 (4%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCPYIC + LDHGVLLVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYKICRG 
Sbjct  296  GGVSCPYICGRHLDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKICRGP  355

Query  205  --RNICGVDSMVSTVAAVNT  258
              +N CGVDSMVSTV A++T
Sbjct  356  HVKNKCGVDSMVSTVTAIHT  375



>ref|XP_009611293.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana tomentosiformis]
 emb|CAB44983.1| putative preprocysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG 
Sbjct  282  GGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGH  341

Query  208  NICGVDSMVSTVAAVNT  258
            NICGVD+MVSTV A +T
Sbjct  342  NICGVDAMVSTVTAAHT  358



>gb|AAK07731.1| CPR2-like cysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG 
Sbjct  282  GGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGH  341

Query  208  NICGVDSMVSTVAAVNT  258
            NICGVD+MVSTV A +T
Sbjct  342  NICGVDAMVSTVTAAHT  358



>emb|CAA78365.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=365

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG 
Sbjct  284  GGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGH  343

Query  208  NICGVDSMVSTVAAVNT  258
            NICGVD+MVSTV A +T
Sbjct  344  NICGVDAMVSTVTAAHT  360



>emb|CAA78361.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG 
Sbjct  282  GGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGH  341

Query  208  NICGVDSMVSTVAAVNT  258
            NICGVD+MVSTV A +T
Sbjct  342  NICGVDAMVSTVTAAHT  358



>ref|XP_009776238.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana sylvestris]
Length=365

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG 
Sbjct  284  GGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGH  343

Query  208  NICGVDSMVSTVAAVNT  258
            NICGVD+MVSTV A +T
Sbjct  344  NICGVDAMVSTVTAAHT  360



>ref|XP_004952477.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=374

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 72/80 (90%), Gaps = 3/80 (4%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCPYIC + LDHGVLLVGYG+AG+APIRLKEKPYWIIKNSWGE+WGE GYYKICRG 
Sbjct  291  GGVSCPYICGRHLDHGVLLVGYGAAGFAPIRLKEKPYWIIKNSWGENWGENGYYKICRGS  350

Query  205  --RNICGVDSMVSTVAAVNT  258
              RN CGVDSMVSTV+A++ 
Sbjct  351  NVRNKCGVDSMVSTVSAIHA  370



>ref|XP_003579573.2| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=399

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 72/84 (86%), Gaps = 3/84 (4%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCP+IC + LDHGVLLVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYKICRG 
Sbjct  316  GGVSCPFICGRHLDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKICRGA  375

Query  205  --RNICGVDSMVSTVAAVNTPTSD  270
              +N CGVDSMVSTV A++T   +
Sbjct  376  HVKNKCGVDSMVSTVTAIHTSNKE  399



>ref|NP_001052440.1| Os04g0311400 [Oryza sativa Japonica Group]
 dbj|BAF14354.1| Os04g0311400, partial [Oryza sativa Japonica Group]
Length=384

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 72/80 (90%), Gaps = 3/80 (4%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCP+IC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYKICRG 
Sbjct  300  GGVSCPFICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKICRGP  359

Query  205  --RNICGVDSMVSTVAAVNT  258
              +N CGVDSMVS+V A++T
Sbjct  360  HDKNKCGVDSMVSSVTAIHT  379



>gb|AEX97108.1| cysteine proteinase, partial [Malus domestica]
Length=128

 Score =   134 bits (338),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 69/74 (93%), Gaps = 1/74 (1%)
 Frame = +1

Query  31   GVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GVSCPYICSKR LDHGVLLVGYGSAG+APIR KEKPYWIIKNSWG++WGE GYY IC+GR
Sbjct  14   GVSCPYICSKRNLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGQNWGENGYYLICKGR  73

Query  208  NICGVDSMVSTVAA  249
            NICG +SMVS+VAA
Sbjct  74   NICGSESMVSSVAA  87



>gb|AAB16996.1| thiol protease isoform B, partial [Glycine max]
Length=319

 Score =   139 bits (351),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC K LDHGVLLVGYG   YAPIR K KPYWIIKNSWGESWGE GY +ICRGR
Sbjct  240  GGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYDEICRGR  299

Query  208  NICGVDSMVSTVAAV  252
            N+CGVDSMVSTVAA+
Sbjct  300  NVCGVDSMVSTVAAI  314



>gb|KFK24413.1| hypothetical protein AALP_AAs58848U000200 [Arabis alpina]
Length=372

 Score =   140 bits (354),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 72/80 (90%), Gaps = 2/80 (3%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPY+CSK  DHGVLLVG+G +GYAPIRLKEKPYWIIKNSWG+ WGE GYYKICRGR
Sbjct  292  GGVSCPYVCSKSQDHGVLLVGFGESGYAPIRLKEKPYWIIKNSWGKMWGEHGYYKICRGR  351

Query  208  -NICGVDSMVSTVAAVN-TP  261
             NICG+D+MVSTVAAV  TP
Sbjct  352  HNICGMDTMVSTVAAVQITP  371



>ref|XP_009405542.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=366

 Score =   140 bits (353),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +1

Query  31   GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  210
            GVSCPYIC K L+HGVLLVGYGSAGYAP R KEK YWIIKNSWGE+WGE GYYKICRGRN
Sbjct  291  GVSCPYICGKHLNHGVLLVGYGSAGYAPARFKEKSYWIIKNSWGENWGENGYYKICRGRN  350

Query  211  ICGVDSMVSTVAAV  252
            ICGVDSMVS+V A+
Sbjct  351  ICGVDSMVSSVTAI  364



>gb|EMS53996.1| Cysteine proteinase 1 [Triticum urartu]
Length=405

 Score =   141 bits (355),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 3/80 (4%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCPYIC + LDHGVLLVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYKICRG 
Sbjct  322  GGVSCPYICGRHLDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKICRGP  381

Query  205  --RNICGVDSMVSTVAAVNT  258
              +N CGVDSMVSTV A++T
Sbjct  382  HVKNKCGVDSMVSTVTAIHT  401



>ref|NP_567489.1| papain family cysteine protease [Arabidopsis thaliana]
 emb|CAB10398.1| cysteine proteinase like protein [Arabidopsis thaliana]
 emb|CAB78661.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AAK62611.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM91059.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM96982.1| cysteine proteinase [Arabidopsis thaliana]
 gb|AAN31875.1| putative cysteine proteinase [Arabidopsis thaliana]
 dbj|BAE98514.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AEE83713.1| papain family cysteine protease [Arabidopsis thaliana]
Length=373

 Score =   140 bits (353),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 71/78 (91%), Gaps = 1/78 (1%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCPY+CSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG 
Sbjct  293  GGVSCPYVCSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGAMWGEHGYYKICRGP  352

Query  205  RNICGVDSMVSTVAAVNT  258
             N+CG+D+MVSTVAAV+T
Sbjct  353  HNMCGMDTMVSTVAAVHT  370



>ref|XP_002870174.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46433.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
Length=373

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 71/78 (91%), Gaps = 1/78 (1%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCPY+CSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG 
Sbjct  293  GGVSCPYVCSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGAMWGEHGYYKICRGP  352

Query  205  RNICGVDSMVSTVAAVNT  258
             N+CG+D+MVSTVAAV+T
Sbjct  353  HNMCGMDTMVSTVAAVHT  370



>ref|XP_004975256.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=388

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 70/79 (89%), Gaps = 3/79 (4%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCPYIC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYK+CRG 
Sbjct  305  GGVSCPYICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGENGYYKLCRGP  364

Query  205  --RNICGVDSMVSTVAAVN  255
              +N CGVDSMVSTV A++
Sbjct  365  FVKNKCGVDSMVSTVTAIH  383



>gb|ACF86683.1| unknown [Zea mays]
 gb|AFW71402.1| cysteine protease1 [Zea mays]
Length=371

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 3/80 (4%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCPYIC + LDHGVLLVGYG++G+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG 
Sbjct  289  GGVSCPYICGRHLDHGVLLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENGYYKICRGS  348

Query  205  --RNICGVDSMVSTVAAVNT  258
              RN CGVDSMVSTV+AV+ 
Sbjct  349  NVRNKCGVDSMVSTVSAVHA  368



>ref|NP_001105685.1| cysteine proteinase 1 precursor [Zea mays]
 sp|Q10716.1|CYSP1_MAIZE RecName: Full=Cysteine proteinase 1; Flags: Precursor [Zea mays]
 dbj|BAA08244.1| cysteine proteinase [Zea mays]
Length=371

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 3/80 (4%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCPYIC + LDHGVLLVGYG++G+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG 
Sbjct  289  GGVSCPYICGRHLDHGVLLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENGYYKICRGS  348

Query  205  --RNICGVDSMVSTVAAVNT  258
              RN CGVDSMVSTV+AV+ 
Sbjct  349  NVRNKCGVDSMVSTVSAVHA  368



>emb|CAH59428.1| cysteine protease 2 [Plantago major]
Length=245

 Score =   137 bits (344),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYIC K LDHGVL+VGYG+ GYAP+RLK KPYWIIKNSWGESWGE GYYKICRGR
Sbjct  167  GGVSCPYICGKSLDHGVLIVGYGT-GYAPVRLKNKPYWIIKNSWGESWGESGYYKICRGR  225

Query  208  NICGVDSMVSTVAAVNTPTS  267
            N+CGV+SMVS+V A +  T+
Sbjct  226  NVCGVESMVSSVTAAHFTTT  245



>ref|XP_003607110.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89307.1| papain family cysteine protease [Medicago truncatula]
Length=331

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GG+SCPYIC++RLD GVLLVGYGS   A ++ KEKPYWI+KNSWGE+WGE GYYKICRGR
Sbjct  252  GGISCPYICTRRLDLGVLLVGYGSGAGADMKEKEKPYWIVKNSWGETWGENGYYKICRGR  311

Query  208  NICGVDSMVSTVAAVNTPTS  267
            NICGVDSMVSTVAA +T T 
Sbjct  312  NICGVDSMVSTVAAAHTTTQ  331



>ref|XP_004238314.1| PREDICTED: cysteine proteinase 15A [Solanum lycopersicum]
Length=363

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +1

Query  31   GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  210
            GVSCP IC KR DHGVLLVGYGS G+APIRLK KPYWIIKNSWG++WGE GYYKICRG N
Sbjct  283  GVSCPLICFKRQDHGVLLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEHGYYKICRGHN  342

Query  211  ICGVDSMVSTVAAVNT  258
            ICGVD+MVSTV A +T
Sbjct  343  ICGVDAMVSTVTATHT  358



>gb|KEH30505.1| papain family cysteine protease [Medicago truncatula]
Length=330

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GG+SCPYIC++RLD GVLLVGYGS   A ++ KEKPYWI+KNSWGE+WGE GYYKICRGR
Sbjct  251  GGISCPYICTRRLDLGVLLVGYGSGAGADMKEKEKPYWIVKNSWGETWGENGYYKICRGR  310

Query  208  NICGVDSMVSTVAAVNTPTS  267
            NICGVDSMVSTVAA +T T 
Sbjct  311  NICGVDSMVSTVAAAHTNTQ  330



>ref|XP_003574963.1| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=377

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 71/80 (89%), Gaps = 3/80 (4%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCPYIC + LDHGVLLVGYG++G+AP RLK KPYW+IKNSWGE+WGEKGYYKICRG 
Sbjct  294  GGVSCPYICGRSLDHGVLLVGYGASGFAPSRLKNKPYWVIKNSWGENWGEKGYYKICRGS  353

Query  205  --RNICGVDSMVSTVAAVNT  258
              RN CGVDSMVSTVAA +T
Sbjct  354  NVRNKCGVDSMVSTVAAAHT  373



>ref|XP_004152668.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004167370.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN62647.1| Cysteine protease [Cucumis sativus]
Length=371

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 71/75 (95%), Gaps = 1/75 (1%)
 Frame = +1

Query  31   GVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            G+SCPYICSKR LDHGVLLVGYG+AG+APIRLKEKPYWIIKNSWGE+WGE GYY IC+G+
Sbjct  295  GISCPYICSKRNLDHGVLLVGYGAAGFAPIRLKEKPYWIIKNSWGENWGENGYYFICKGK  354

Query  208  NICGVDSMVSTVAAV  252
            NICG +SMVS+VAA+
Sbjct  355  NICGSESMVSSVAAI  369



>ref|XP_006341997.1| PREDICTED: cysteine proteinase 15A-like [Solanum tuberosum]
Length=376

 Score =   139 bits (349),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +1

Query  31   GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  210
            GVSCP IC KR DHGVLLVGYGS G+APIRLK KPYWIIKNSWG++WGE GYYKICRG N
Sbjct  296  GVSCPLICLKRQDHGVLLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEHGYYKICRGHN  355

Query  211  ICGVDSMVSTVAAVNT  258
            ICGVD+MVSTV A +T
Sbjct  356  ICGVDAMVSTVTATHT  371



>gb|ABK24153.1| unknown [Picea sitchensis]
Length=394

 Score =   139 bits (349),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = +1

Query  28   GGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG  204
            GGVSCPY+C+K+ LDHGVLLVGYG+AGYAP RLK KP+WIIKNSWG  WGE GYYK+CRG
Sbjct  312  GGVSCPYVCNKQNLDHGVLLVGYGAAGYAPGRLKNKPFWIIKNSWGPDWGEDGYYKLCRG  371

Query  205  RNICGVDSMVSTVAAVNTPTSD  270
             N+CG+++MVSTVAA N  T D
Sbjct  372  HNVCGINTMVSTVAAANIQTDD  393



>gb|EYU27644.1| hypothetical protein MIMGU_mgv1a008452mg [Erythranthe guttata]
Length=373

 Score =   138 bits (348),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 74/81 (91%), Gaps = 1/81 (1%)
 Frame = +1

Query  28   GGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG  204
            GGVSCPY+C KR LDHGVLLVGYG+AGY+ IRLK KPYWI+KNSWGESWGE+GYYKIC+G
Sbjct  293  GGVSCPYVCGKRNLDHGVLLVGYGAAGYSTIRLKNKPYWIVKNSWGESWGEEGYYKICKG  352

Query  205  RNICGVDSMVSTVAAVNTPTS  267
             N+CGV+SMVS+V A++T ++
Sbjct  353  HNVCGVESMVSSVNAIHTTSA  373



>ref|NP_001046828.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAD19579.1| putative cysteine proteinase 1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF08742.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAG92750.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93804.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94031.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83204.1| hypothetical protein OsI_28465 [Oryza sativa Indica Group]
 gb|EEE56967.1| hypothetical protein OsJ_06681 [Oryza sativa Japonica Group]
Length=373

 Score =   138 bits (347),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 72/80 (90%), Gaps = 3/80 (4%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCPYIC + LDHGVLLVGYG++G+APIRLK+K YWIIKNSWGE+WGE GYYKICRG 
Sbjct  291  GGVSCPYICGRHLDHGVLLVGYGASGFAPIRLKDKAYWIIKNSWGENWGEHGYYKICRGS  350

Query  205  --RNICGVDSMVSTVAAVNT  258
              RN CGVDSMVSTV+A++T
Sbjct  351  NVRNKCGVDSMVSTVSAIHT  370



>emb|CAA78403.1| pre-pro-cysteine proteinase [Solanum lycopersicum]
Length=361

 Score =   137 bits (345),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +1

Query  31   GVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRN  210
            GVSCP IC KR DHGVLLVGYGS G+APIRLK KPYWIIKNSWG++WGE GYYKICRG +
Sbjct  281  GVSCPLICFKRQDHGVLLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEHGYYKICRGHH  340

Query  211  ICGVDSMVSTVAAVNT  258
            ICGVD+MVSTV A +T
Sbjct  341  ICGVDAMVSTVTATHT  356



>dbj|BAG16515.1| putative cysteine proteinase [Capsicum chinense]
Length=367

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 68/78 (87%), Gaps = 1/78 (1%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCP +C K  DHGVLLVGYGSAG+APIRLK KPYWIIKNSWGE WGE GYYKICRG+
Sbjct  285  GGVSCPLVCFKHQDHGVLLVGYGSAGFAPIRLKAKPYWIIKNSWGEHWGEHGYYKICRGQ  344

Query  208  -NICGVDSMVSTVAAVNT  258
             NICGVD+MVSTV A +T
Sbjct  345  HNICGVDAMVSTVTAAHT  362



>gb|EMS64962.1| Cysteine proteinase 1 [Triticum urartu]
Length=302

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 70/80 (88%), Gaps = 3/80 (4%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCPYIC + LDHGVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYKICRG 
Sbjct  219  GGVSCPYICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGS  278

Query  205  --RNICGVDSMVSTVAAVNT  258
              RN CGVDSMVSTV+A + 
Sbjct  279  NVRNKCGVDSMVSTVSATHA  298



>tpe|CAD66657.1| TPA: putative cysteine proteinase precursor [Hordeum vulgare 
subsp. vulgare]
 dbj|BAJ94057.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 3/80 (4%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCPYIC + LDHGVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYKICRG 
Sbjct  294  GGVSCPYICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGS  353

Query  205  --RNICGVDSMVSTVAAVNT  258
              RN CGVDSMVSTV+A ++
Sbjct  354  NVRNKCGVDSMVSTVSATHS  373



>gb|ACN40679.1| unknown [Picea sitchensis]
Length=366

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 71/76 (93%), Gaps = 1/76 (1%)
 Frame = +1

Query  28   GGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG  204
            GGVSCPY+CSKR LDHGVLLVGYG+A +APIR+K+KPYW+IKNSWG +WGE GYYK+CRG
Sbjct  291  GGVSCPYVCSKRNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENGYYKLCRG  350

Query  205  RNICGVDSMVSTVAAV  252
             N+CG+++MVSTVAA+
Sbjct  351  HNVCGINNMVSTVAAI  366



>gb|ABK24688.1| unknown [Picea sitchensis]
 gb|ACN39791.1| unknown [Picea sitchensis]
 gb|ACN40241.1| unknown [Picea sitchensis]
Length=366

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 71/76 (93%), Gaps = 1/76 (1%)
 Frame = +1

Query  28   GGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG  204
            GGVSCPY+CSKR LDHGVLLVGYG+A +APIR+K+KPYW+IKNSWG +WGE GYYK+CRG
Sbjct  291  GGVSCPYVCSKRNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENGYYKLCRG  350

Query  205  RNICGVDSMVSTVAAV  252
             N+CG+++MVSTVAA+
Sbjct  351  HNVCGINNMVSTVAAI  366



>gb|ABK21238.1| unknown [Picea sitchensis]
 gb|ABR16087.1| unknown [Picea sitchensis]
 gb|ABR17330.1| unknown [Picea sitchensis]
 gb|ABR17545.1| unknown [Picea sitchensis]
 gb|ACN40765.1| unknown [Picea sitchensis]
Length=366

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 71/76 (93%), Gaps = 1/76 (1%)
 Frame = +1

Query  28   GGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG  204
            GGVSCPY+CSKR LDHGVLLVGYG+A +APIR+K+KPYW+IKNSWG +WGE GYYK+CRG
Sbjct  291  GGVSCPYVCSKRNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENGYYKLCRG  350

Query  205  RNICGVDSMVSTVAAV  252
             N+CG+++MVSTVAA+
Sbjct  351  HNVCGINNMVSTVAAI  366



>gb|AAZ32411.1| cysteine proteinase glycinain type [Nicotiana benthamiana]
Length=355

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG 
Sbjct  284  GGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGH  343

Query  208  NICGVDSMVSTV  243
            NICGVD+MVSTV
Sbjct  344  NICGVDAMVSTV  355



>gb|EMT10192.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=369

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 70/80 (88%), Gaps = 3/80 (4%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCPYIC + LDHGVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYKICRG 
Sbjct  286  GGVSCPYICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGS  345

Query  205  --RNICGVDSMVSTVAAVNT  258
              RN CGVDSMVSTV+A + 
Sbjct  346  NVRNKCGVDSMVSTVSATHA  365



>gb|AAW21813.1| cysteine protease [Triticum aestivum]
Length=377

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 70/80 (88%), Gaps = 3/80 (4%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCPYIC + LDHGVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYKICRG 
Sbjct  294  GGVSCPYICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGS  353

Query  205  --RNICGVDSMVSTVAAVNT  258
              RN CGVDSMVSTV+A + 
Sbjct  354  NVRNKCGVDSMVSTVSATHA  373



>gb|AES89347.2| papain family cysteine protease [Medicago truncatula]
Length=327

 Score =   135 bits (339),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 67/79 (85%), Gaps = 4/79 (5%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPY C++RLDHGVLLVGYGS  Y     KEKPYWI+K+SWGE+WGE GYYKICRGR
Sbjct  252  GGVSCPYTCTRRLDHGVLLVGYGSGAYT----KEKPYWIVKSSWGETWGENGYYKICRGR  307

Query  208  NICGVDSMVSTVAAVNTPT  264
            NICGVDSMVSTVAA  T T
Sbjct  308  NICGVDSMVSTVAAAQTTT  326



>ref|XP_003607150.1| Cysteine proteinase [Medicago truncatula]
Length=326

 Score =   135 bits (339),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 67/79 (85%), Gaps = 4/79 (5%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPY C++RLDHGVLLVGYGS  Y     KEKPYWI+K+SWGE+WGE GYYKICRGR
Sbjct  251  GGVSCPYTCTRRLDHGVLLVGYGSGAYT----KEKPYWIVKSSWGETWGENGYYKICRGR  306

Query  208  NICGVDSMVSTVAAVNTPT  264
            NICGVDSMVSTVAA  T T
Sbjct  307  NICGVDSMVSTVAAAQTTT  325



>ref|XP_002279862.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI19784.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +1

Query  25   SGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG  204
            + GVSCP++CS  LDHGVLLVGYGSAGY+PIR KEKPYWI+KNSW + WGE GYY+ICRG
Sbjct  287  TAGVSCPFLCSGELDHGVLLVGYGSAGYSPIRFKEKPYWILKNSWSKYWGEHGYYRICRG  346

Query  205  RNICGVDSMVSTVAAVNTPTS  267
            +N+CGVDSMVS+V A    TS
Sbjct  347  QNMCGVDSMVSSVVAAIQTTS  367



>gb|AAB16997.1| thiol protease isoform A, partial [Glycine max]
Length=318

 Score =   134 bits (337),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK-GYYKICRG  204
            GGVSCPYIC K LDHGVLLVGYG   YAPIR K KPYWIIKNSWGESWGE  GY +ICRG
Sbjct  238  GGVSCPYICGKHLDHGVLLVGYGEGRYAPIRFKNKPYWIIKNSWGESWGENDGYDEICRG  297

Query  205  RNICGVDSMVSTVAAV  252
            RN+CGVD+MVSTVAA+
Sbjct  298  RNVCGVDAMVSTVAAI  313



>gb|ADY04293.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04297.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   129 bits (324),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGS+GY+P+RLKEKPYWIIKNSWG+ WGE+G+YKICRGR
Sbjct  81   GGVSCPYICSKRLDHGVLLVGYGSSGYSPVRLKEKPYWIIKNSWGDKWGEEGFYKICRGR  140

Query  208  NICG  219
            NICG
Sbjct  141  NICG  144



>ref|XP_009786000.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana sylvestris]
Length=370

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 65/68 (96%), Gaps = 1/68 (1%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSK+LDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKICRGR
Sbjct  292  GGVSCPYICSKKLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGENGYYKICRGR  350

Query  208  NICGVDSM  231
            N+CGVDSM
Sbjct  351  NVCGVDSM  358



>gb|ADY04361.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   129 bits (324),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICRGR
Sbjct  81   GGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKICRGR  140

Query  208  NICG  219
            NICG
Sbjct  141  NICG  144



>dbj|BAD10859.1| cysteine protease [Aster tripolium]
Length=363

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 67/78 (86%), Gaps = 1/78 (1%)
 Frame = +1

Query  28   GGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG  204
            G VSCPYICSK ++DHGVLLVGYGSAGYAP+R KEKPYWIIKNSWGE WGE GYYK+C G
Sbjct  286  GQVSCPYICSKTKMDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGEDWGEDGYYKLCSG  345

Query  205  RNICGVDSMVSTVAAVNT  258
             N CG+D+MVS V + NT
Sbjct  346  YNACGMDTMVSAVVSTNT  363



>gb|ADY04342.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   129 bits (323),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICRGR
Sbjct  81   GGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKICRGR  140

Query  208  NICG  219
            NICG
Sbjct  141  NICG  144



>gb|ADY04414.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   129 bits (323),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICRGR
Sbjct  81   GGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKICRGR  140

Query  208  NICG  219
            NICG
Sbjct  141  NICG  144



>gb|ADY04336.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04343.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   129 bits (323),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICRGR
Sbjct  81   GGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKICRGR  140

Query  208  NICG  219
            NICG
Sbjct  141  NICG  144



>gb|ADY04262.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04263.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04264.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04265.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04266.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04267.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04269.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04270.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04271.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04272.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04273.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04274.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04275.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04276.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04277.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04278.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04279.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04280.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04281.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04282.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04283.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04284.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04285.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04286.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04287.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04288.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04289.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04290.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04291.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04292.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04294.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04296.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04298.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04299.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04300.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04301.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04302.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04303.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04304.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04305.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04306.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04307.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04308.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04309.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04310.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04311.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04312.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04313.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04314.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04315.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04316.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04317.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04318.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04319.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04320.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04321.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04322.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04323.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04324.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04325.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04326.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04327.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04328.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04329.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04330.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04331.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04332.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04333.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04334.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04335.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04337.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04338.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04339.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04340.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04341.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04344.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04345.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04346.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04347.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04348.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04349.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04350.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04351.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04352.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04353.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04354.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04355.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04356.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04357.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04360.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04362.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04363.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04364.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04365.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04366.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04367.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04369.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04370.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04371.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04372.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04373.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04374.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04377.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04378.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04379.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04380.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04381.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04382.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04383.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04384.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04385.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04386.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04387.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04388.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04389.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04391.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04392.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04393.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04394.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04395.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04396.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04397.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04398.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04399.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04400.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04401.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04402.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04403.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04404.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04405.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04406.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04407.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04408.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04409.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04410.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04411.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04412.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04413.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04415.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04416.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04417.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04418.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04419.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04420.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04421.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04422.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04423.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04424.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04425.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04426.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04427.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04428.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04429.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04430.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04431.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04432.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04433.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04434.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04435.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04436.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04437.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04438.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04439.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04440.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04441.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04442.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04443.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04444.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04445.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04446.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04447.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04448.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04449.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04450.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04451.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04452.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04453.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04454.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04455.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04456.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04458.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04459.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04460.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04461.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04462.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04463.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04464.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04465.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04466.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04467.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04468.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04469.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04470.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04471.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04472.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04473.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04474.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04475.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04476.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04478.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04481.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04483.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04484.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04485.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04486.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04487.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04488.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04489.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04491.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04493.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04501.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04502.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04503.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04504.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04505.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04506.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04507.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04508.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04509.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04510.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04511.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04512.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04513.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04514.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04515.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04516.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04517.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04518.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   129 bits (323),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICRGR
Sbjct  81   GGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKICRGR  140

Query  208  NICG  219
            NICG
Sbjct  141  NICG  144



>gb|ADY04457.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   128 bits (322),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICRGR
Sbjct  81   GGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKICRGR  140

Query  208  NICG  219
            NICG
Sbjct  141  NICG  144



>emb|CAQ00101.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=381

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 69/80 (86%), Gaps = 4/80 (5%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-  204
            GGVSCPYIC + LDH V LVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYKICRG 
Sbjct  299  GGVSCPYICGRHLDH-VFLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKICRGP  357

Query  205  --RNICGVDSMVSTVAAVNT  258
              +N CGVDSMVSTV A++T
Sbjct  358  HVKNKCGVDSMVSTVTAIHT  377



>gb|EPS70818.1| cysteine proteinase, partial [Genlisea aurea]
Length=355

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 70/77 (91%), Gaps = 1/77 (1%)
 Frame = +1

Query  31   GVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GVSCP +C K  LDHGVL+VGYGS+GYAPIRLK KPYWI+KNSWG++WGEKGYYKICRG 
Sbjct  279  GVSCPLVCGKSNLDHGVLMVGYGSSGYAPIRLKNKPYWIVKNSWGKNWGEKGYYKICRGS  338

Query  208  NICGVDSMVSTVAAVNT  258
            NICGV+SMVSTV A+++
Sbjct  339  NICGVESMVSTVTAIHS  355



>gb|ADY04359.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   128 bits (322),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICRGR
Sbjct  81   GGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDRWGEEGFYKICRGR  140

Query  208  NICG  219
            NICG
Sbjct  141  NICG  144



>gb|ADY04482.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   128 bits (321),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICRGR
Sbjct  81   GGVSCPYICSKRLDHGVLLVGYGSSGYSPVRVKEKPYWIIKNSWGDKWGEEGFYKICRGR  140

Query  208  NICG  219
            NICG
Sbjct  141  NICG  144



>gb|ADY04358.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   128 bits (321),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYG++GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICRGR
Sbjct  81   GGVSCPYICSKRLDHGVLLVGYGTSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKICRGR  140

Query  208  NICG  219
            NICG
Sbjct  141  NICG  144



>gb|ADY04368.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04375.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04376.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04390.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04477.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04479.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   127 bits (320),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG  WGE+G+YKICRGR
Sbjct  81   GGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGNKWGEEGFYKICRGR  140

Query  208  NICG  219
            NICG
Sbjct  141  NICG  144



>gb|ADY04480.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   127 bits (320),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGS+GY+P+++KEKPYWIIKNSWG+ WGE+G+YKICRGR
Sbjct  81   GGVSCPYICSKRLDHGVLLVGYGSSGYSPVKMKEKPYWIIKNSWGDKWGEEGFYKICRGR  140

Query  208  NICG  219
            NICG
Sbjct  141  NICG  144



>gb|EPS65881.1| cysteine proteinase, partial [Genlisea aurea]
Length=335

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 69/74 (93%), Gaps = 1/74 (1%)
 Frame = +1

Query  31   GVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GVSCP IC K RLDHG+L+VGYG++GYAPIRLKEKPYWI+KNSWGE+WGE+GYYKIC+G 
Sbjct  262  GVSCPLICMKTRLDHGILIVGYGASGYAPIRLKEKPYWIVKNSWGENWGEQGYYKICKGH  321

Query  208  NICGVDSMVSTVAA  249
            N+CGV+S+VSTV A
Sbjct  322  NVCGVESLVSTVTA  335



>gb|ADY04268.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   127 bits (319),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKP+WIIKNSWG+ WGE+G+YKICRGR
Sbjct  81   GGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPHWIIKNSWGDKWGEEGFYKICRGR  140

Query  208  NICG  219
            NICG
Sbjct  141  NICG  144



>dbj|BAC57957.1| thiol protease [Aster tripolium]
Length=188

 Score =   128 bits (322),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 66/78 (85%), Gaps = 1/78 (1%)
 Frame = +1

Query  28   GGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG  204
            G VSCPY+CSK+ LDHGVLLVGYGSAGYAP RLKEKPYWIIKNSWG  WGE GYYKIC G
Sbjct  111  GKVSCPYVCSKKPLDHGVLLVGYGSAGYAPSRLKEKPYWIIKNSWGPDWGEDGYYKICSG  170

Query  205  RNICGVDSMVSTVAAVNT  258
             N+CG+D+MVS V + + 
Sbjct  171  HNLCGMDTMVSAVVSTSA  188



>gb|ADY04295.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   126 bits (317),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +1

Query  28   GGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR  207
            GGVSCPYICSKRLDHGVLLVGYGS+GY+P+ +KEKPYWIIKNSWG+ WGE+G+YKICRGR
Sbjct  81   GGVSCPYICSKRLDHGVLLVGYGSSGYSPVSMKEKPYWIIKNSWGDKWGEEGFYKICRGR  140

Query  208  NICG  219
            NICG
Sbjct  141  NICG  144



>emb|CDX98179.1| BnaC07g09190D [Brassica napus]
Length=72

 Score =   124 bits (311),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +1

Query  58   KRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVS  237
            +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKICRGRN+CGVDS+VS
Sbjct  2    RRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEDGFYKICRGRNVCGVDSLVS  61

Query  238  TVAAVNTPTS  267
            TV A  +P +
Sbjct  62   TVTATVSPAA  71



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557830460880