BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP010E11 659 bp,

Length=613
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010318487.1|  PREDICTED: uncharacterized protein LOC101258446    196   2e-55   Solanum lycopersicum
ref|XP_006342945.1|  PREDICTED: uncharacterized protein LOC102604...    193   4e-54   Solanum tuberosum [potatoes]
ref|XP_009602392.1|  PREDICTED: uncharacterized protein LOC104097...    192   6e-54   Nicotiana tomentosiformis
ref|XP_009602394.1|  PREDICTED: uncharacterized protein LOC104097...    192   6e-54   Nicotiana tomentosiformis
ref|XP_009782035.1|  PREDICTED: uncharacterized protein LOC104230838    192   7e-54   Nicotiana sylvestris
ref|XP_002521340.1|  conserved hypothetical protein                     166   2e-44   
gb|KDP40712.1|  hypothetical protein JCGZ_24711                         164   1e-43   Jatropha curcas
ref|XP_011035704.1|  PREDICTED: uncharacterized protein LOC105133...    162   4e-43   Populus euphratica
ref|XP_010654460.1|  PREDICTED: uncharacterized protein LOC100263...    162   5e-43   Vitis vinifera
ref|XP_010654462.1|  PREDICTED: uncharacterized protein LOC100263...    162   5e-43   Vitis vinifera
ref|XP_010654463.1|  PREDICTED: uncharacterized protein LOC100263...    162   5e-43   Vitis vinifera
ref|XP_002274215.1|  PREDICTED: uncharacterized protein LOC100263...    162   5e-43   Vitis vinifera
ref|XP_007024601.1|  TRF-like 3, putative isoform 2                     162   6e-43   Theobroma cacao [chocolate]
ref|XP_010654464.1|  PREDICTED: uncharacterized protein LOC100263...    162   6e-43   Vitis vinifera
ref|XP_011035703.1|  PREDICTED: uncharacterized protein LOC105133...    162   6e-43   Populus euphratica
ref|XP_010654465.1|  PREDICTED: uncharacterized protein LOC100263...    162   6e-43   Vitis vinifera
ref|XP_007024600.1|  TRF-like 3, putative isoform 1                     162   8e-43   Theobroma cacao [chocolate]
emb|CAN77858.1|  hypothetical protein VITISV_005454                     162   2e-42   Vitis vinifera
ref|XP_011040067.1|  PREDICTED: uncharacterized protein LOC105136...    160   2e-42   Populus euphratica
ref|XP_011040065.1|  PREDICTED: uncharacterized protein LOC105136...    160   2e-42   Populus euphratica
ref|XP_002298100.2|  myb family transcription factor family protein     160   2e-42   Populus trichocarpa [western balsam poplar]
ref|XP_011040066.1|  PREDICTED: uncharacterized protein LOC105136...    160   3e-42   Populus euphratica
ref|XP_011040062.1|  PREDICTED: uncharacterized protein LOC105136...    160   3e-42   Populus euphratica
ref|XP_011040064.1|  PREDICTED: uncharacterized protein LOC105136...    160   3e-42   Populus euphratica
ref|XP_011040060.1|  PREDICTED: uncharacterized protein LOC105136...    160   3e-42   Populus euphratica
ref|XP_002303250.2|  myb family transcription factor family protein     157   3e-41   Populus trichocarpa [western balsam poplar]
gb|KJB70112.1|  hypothetical protein B456_011G058300                    154   3e-40   Gossypium raimondii
gb|KJB70111.1|  hypothetical protein B456_011G058300                    154   3e-40   Gossypium raimondii
gb|KJB70109.1|  hypothetical protein B456_011G058300                    154   3e-40   Gossypium raimondii
gb|KHG30544.1|  Telomere repeat-binding 6 -like protein                 154   6e-40   Gossypium arboreum [tree cotton]
emb|CDP21217.1|  unnamed protein product                                150   7e-39   Coffea canephora [robusta coffee]
ref|XP_011079795.1|  PREDICTED: uncharacterized protein LOC105163...    148   6e-38   Sesamum indicum [beniseed]
ref|XP_011079786.1|  PREDICTED: uncharacterized protein LOC105163...    148   6e-38   Sesamum indicum [beniseed]
gb|EYU45881.1|  hypothetical protein MIMGU_mgv1a005063mg                147   9e-38   Erythranthe guttata [common monkey flower]
ref|XP_010261951.1|  PREDICTED: uncharacterized protein LOC104600...    144   6e-37   Nelumbo nucifera [Indian lotus]
ref|XP_008351044.1|  PREDICTED: uncharacterized protein LOC103414...    145   7e-37   Malus domestica [apple tree]
ref|XP_008351047.1|  PREDICTED: uncharacterized protein LOC103414...    145   7e-37   Malus domestica [apple tree]
ref|XP_008351036.1|  PREDICTED: uncharacterized protein LOC103414...    145   1e-36   Malus domestica [apple tree]
ref|XP_010261948.1|  PREDICTED: uncharacterized protein LOC104600...    144   1e-36   Nelumbo nucifera [Indian lotus]
ref|XP_009339885.1|  PREDICTED: uncharacterized protein LOC103932...    140   4e-35   Pyrus x bretschneideri [bai li]
ref|XP_006426636.1|  hypothetical protein CICLE_v10025094mg             139   5e-35   Citrus clementina
ref|XP_009339877.1|  PREDICTED: uncharacterized protein LOC103932...    140   5e-35   Pyrus x bretschneideri [bai li]
ref|XP_009339863.1|  PREDICTED: uncharacterized protein LOC103932...    140   6e-35   Pyrus x bretschneideri [bai li]
ref|XP_006426634.1|  hypothetical protein CICLE_v10025094mg             139   8e-35   Citrus clementina
gb|KDO65067.1|  hypothetical protein CISIN_1g006062mg                   138   1e-34   Citrus sinensis [Valencia orange]
ref|XP_006426635.1|  hypothetical protein CICLE_v10025094mg             139   1e-34   Citrus clementina
gb|KDO65066.1|  hypothetical protein CISIN_1g006062mg                   137   2e-34   Citrus sinensis [Valencia orange]
gb|KDO65071.1|  hypothetical protein CISIN_1g006062mg                   138   2e-34   Citrus sinensis [Valencia orange]
gb|KDO65065.1|  hypothetical protein CISIN_1g006062mg                   137   2e-34   Citrus sinensis [Valencia orange]
gb|KDO65070.1|  hypothetical protein CISIN_1g006062mg                   138   2e-34   Citrus sinensis [Valencia orange]
ref|XP_008786594.1|  PREDICTED: uncharacterized protein LOC103704...    137   2e-34   Phoenix dactylifera
ref|XP_008786595.1|  PREDICTED: uncharacterized protein LOC103704...    137   2e-34   Phoenix dactylifera
ref|XP_008786593.1|  PREDICTED: uncharacterized protein LOC103704...    137   2e-34   Phoenix dactylifera
ref|XP_008786591.1|  PREDICTED: uncharacterized protein LOC103704...    137   2e-34   Phoenix dactylifera
gb|KDO65068.1|  hypothetical protein CISIN_1g006062mg                   137   3e-34   Citrus sinensis [Valencia orange]
gb|KDO65064.1|  hypothetical protein CISIN_1g006062mg                   137   3e-34   Citrus sinensis [Valencia orange]
ref|XP_008786590.1|  PREDICTED: uncharacterized protein LOC103704...    137   3e-34   
gb|KDO65063.1|  hypothetical protein CISIN_1g006062mg                   137   4e-34   Citrus sinensis [Valencia orange]
ref|XP_008786589.1|  PREDICTED: uncharacterized protein LOC103704...    137   4e-34   Phoenix dactylifera
ref|XP_006465936.1|  PREDICTED: uncharacterized protein LOC102630...    137   4e-34   Citrus sinensis [Valencia orange]
ref|XP_008786587.1|  PREDICTED: uncharacterized protein LOC103704...    137   5e-34   
ref|XP_008786588.1|  PREDICTED: uncharacterized protein LOC103704...    137   5e-34   
ref|XP_008786586.1|  PREDICTED: uncharacterized protein LOC103704...    137   5e-34   Phoenix dactylifera
gb|KDO65062.1|  hypothetical protein CISIN_1g006062mg                   137   5e-34   Citrus sinensis [Valencia orange]
ref|XP_006465933.1|  PREDICTED: uncharacterized protein LOC102630...    137   6e-34   Citrus sinensis [Valencia orange]
ref|XP_008786585.1|  PREDICTED: uncharacterized protein LOC103704...    137   6e-34   Phoenix dactylifera
ref|XP_008786584.1|  PREDICTED: uncharacterized protein LOC103704...    137   6e-34   
ref|XP_008786580.1|  PREDICTED: uncharacterized protein LOC103704...    137   7e-34   
ref|XP_008786581.1|  PREDICTED: uncharacterized protein LOC103704...    137   7e-34   Phoenix dactylifera
ref|XP_007135460.1|  hypothetical protein PHAVU_010G131400g             136   1e-33   Phaseolus vulgaris [French bean]
ref|XP_007135461.1|  hypothetical protein PHAVU_010G131400g             136   1e-33   Phaseolus vulgaris [French bean]
ref|XP_008784290.1|  PREDICTED: uncharacterized protein LOC103703...    135   2e-33   
ref|XP_008784289.1|  PREDICTED: uncharacterized protein LOC103703...    135   2e-33   
ref|XP_008784288.1|  PREDICTED: uncharacterized protein LOC103703...    135   2e-33   
ref|XP_008784287.1|  PREDICTED: uncharacterized protein LOC103703...    135   3e-33   Phoenix dactylifera
gb|KCW53548.1|  hypothetical protein EUGRSUZ_J02823                     134   3e-33   Eucalyptus grandis [rose gum]
ref|XP_008784286.1|  PREDICTED: uncharacterized protein LOC103703...    134   4e-33   Phoenix dactylifera
ref|XP_008784285.1|  PREDICTED: uncharacterized protein LOC103703...    134   5e-33   Phoenix dactylifera
ref|XP_008784279.1|  PREDICTED: uncharacterized protein LOC103703...    135   5e-33   Phoenix dactylifera
ref|XP_008784283.1|  PREDICTED: uncharacterized protein LOC103703...    135   5e-33   Phoenix dactylifera
ref|XP_008784284.1|  PREDICTED: uncharacterized protein LOC103703...    134   5e-33   Phoenix dactylifera
ref|XP_010033746.1|  PREDICTED: uncharacterized protein LOC104422...    133   7e-33   Eucalyptus grandis [rose gum]
ref|XP_009372358.1|  PREDICTED: uncharacterized protein LOC103961...    135   8e-33   Pyrus x bretschneideri [bai li]
ref|XP_010932444.1|  PREDICTED: uncharacterized protein LOC105053...    134   8e-33   Elaeis guineensis
ref|XP_004510445.1|  PREDICTED: uncharacterized protein LOC101500...    134   9e-33   Cicer arietinum [garbanzo]
ref|XP_010033745.1|  PREDICTED: uncharacterized protein LOC104422...    133   9e-33   Eucalyptus grandis [rose gum]
ref|XP_004510447.1|  PREDICTED: uncharacterized protein LOC101500...    134   9e-33   Cicer arietinum [garbanzo]
ref|XP_004510444.1|  PREDICTED: uncharacterized protein LOC101500...    134   1e-32   Cicer arietinum [garbanzo]
ref|XP_004510446.1|  PREDICTED: uncharacterized protein LOC101500...    134   1e-32   Cicer arietinum [garbanzo]
ref|XP_004510442.1|  PREDICTED: uncharacterized protein LOC101500...    134   1e-32   Cicer arietinum [garbanzo]
ref|XP_004510443.1|  PREDICTED: uncharacterized protein LOC101500...    134   1e-32   Cicer arietinum [garbanzo]
ref|XP_010932437.1|  PREDICTED: uncharacterized protein LOC105053...    134   1e-32   Elaeis guineensis
ref|XP_010932445.1|  PREDICTED: uncharacterized protein LOC105053...    133   1e-32   Elaeis guineensis
ref|XP_010932441.1|  PREDICTED: uncharacterized protein LOC105053...    134   1e-32   Elaeis guineensis
ref|XP_010932443.1|  PREDICTED: uncharacterized protein LOC105053...    134   1e-32   Elaeis guineensis
ref|XP_006849623.1|  hypothetical protein AMTR_s00024p00216510          133   2e-32   Amborella trichopoda
ref|XP_007217148.1|  hypothetical protein PRUPE_ppa003052mg             132   2e-32   Prunus persica
ref|XP_011467419.1|  PREDICTED: telomere repeat-binding protein 2...    132   3e-32   Fragaria vesca subsp. vesca
ref|XP_011467420.1|  PREDICTED: telomere repeat-binding protein 2...    132   3e-32   Fragaria vesca subsp. vesca
ref|XP_008228212.1|  PREDICTED: uncharacterized protein LOC103327648    132   4e-32   
ref|XP_011467416.1|  PREDICTED: uncharacterized protein LOC101295...    132   4e-32   Fragaria vesca subsp. vesca
ref|XP_010917157.1|  PREDICTED: uncharacterized protein LOC105041...    132   4e-32   Elaeis guineensis
ref|XP_011467418.1|  PREDICTED: uncharacterized protein LOC101295...    132   4e-32   Fragaria vesca subsp. vesca
ref|XP_008391379.1|  PREDICTED: uncharacterized protein LOC103453...    131   5e-32   
ref|XP_010917156.1|  PREDICTED: uncharacterized protein LOC105041...    132   5e-32   Elaeis guineensis
ref|XP_010917155.1|  PREDICTED: uncharacterized protein LOC105041...    132   5e-32   Elaeis guineensis
ref|XP_010105512.1|  Telomere repeat-binding protein 6                  132   6e-32   Morus notabilis
ref|XP_008391378.1|  PREDICTED: uncharacterized protein LOC103453...    131   6e-32   Malus domestica [apple tree]
ref|XP_010917153.1|  PREDICTED: uncharacterized protein LOC105041...    132   7e-32   Elaeis guineensis
ref|XP_010917150.1|  PREDICTED: uncharacterized protein LOC105041...    132   7e-32   Elaeis guineensis
ref|XP_010917152.1|  PREDICTED: uncharacterized protein LOC105041...    132   7e-32   Elaeis guineensis
ref|XP_010917151.1|  PREDICTED: uncharacterized protein LOC105041...    132   7e-32   Elaeis guineensis
ref|XP_003627252.1|  Myb family transcription factor                    131   7e-32   
gb|AET01728.2|  myb transcription factor                                131   7e-32   Medicago truncatula
ref|XP_008391374.1|  PREDICTED: uncharacterized protein LOC103453...    132   8e-32   Malus domestica [apple tree]
ref|XP_010917154.1|  PREDICTED: uncharacterized protein LOC105041...    132   8e-32   Elaeis guineensis
ref|XP_010531870.1|  PREDICTED: uncharacterized protein LOC104808...    129   2e-31   Tarenaya hassleriana [spider flower]
gb|AET01727.2|  myb transcription factor                                130   2e-31   Medicago truncatula
ref|XP_002887444.1|  hypothetical protein ARALYDRAFT_476400             130   2e-31   Arabidopsis lyrata subsp. lyrata
gb|KEH18465.1|  myb transcription factor                                130   2e-31   Medicago truncatula
ref|XP_003627253.1|  Myb family transcription factor                    130   2e-31   
ref|XP_003627251.1|  Myb family transcription factor                    130   2e-31   
gb|AET01729.2|  myb transcription factor                                130   2e-31   Medicago truncatula
gb|KEH18466.1|  myb transcription factor                                130   2e-31   Medicago truncatula
ref|XP_006598821.1|  PREDICTED: uncharacterized protein LOC100782...    130   2e-31   Glycine max [soybeans]
ref|XP_006598820.1|  PREDICTED: uncharacterized protein LOC100782...    130   2e-31   Glycine max [soybeans]
ref|XP_006598822.1|  PREDICTED: uncharacterized protein LOC100782...    130   2e-31   Glycine max [soybeans]
ref|XP_003547658.1|  PREDICTED: uncharacterized protein LOC100782...    130   2e-31   Glycine max [soybeans]
ref|XP_010531869.1|  PREDICTED: uncharacterized protein LOC104808...    129   3e-31   Tarenaya hassleriana [spider flower]
ref|XP_010531868.1|  PREDICTED: uncharacterized protein LOC104808...    129   4e-31   Tarenaya hassleriana [spider flower]
ref|XP_009372362.1|  PREDICTED: uncharacterized protein LOC103961...    128   8e-31   Pyrus x bretschneideri [bai li]
gb|AAM61098.1|  unknown                                                 128   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009372361.1|  PREDICTED: uncharacterized protein LOC103961...    128   1e-30   Pyrus x bretschneideri [bai li]
ref|XP_009372363.1|  PREDICTED: uncharacterized protein LOC103961...    128   2e-30   Pyrus x bretschneideri [bai li]
ref|XP_009372360.1|  PREDICTED: uncharacterized protein LOC103961...    128   2e-30   Pyrus x bretschneideri [bai li]
ref|XP_009372359.1|  PREDICTED: uncharacterized protein LOC103961...    128   2e-30   Pyrus x bretschneideri [bai li]
ref|NP_565045.1|  myb family transcription factor TRFL6                 127   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009372352.1|  PREDICTED: uncharacterized protein LOC103961...    128   2e-30   Pyrus x bretschneideri [bai li]
ref|XP_009372357.1|  PREDICTED: uncharacterized protein LOC103961...    128   2e-30   Pyrus x bretschneideri [bai li]
ref|XP_009372356.1|  PREDICTED: uncharacterized protein LOC103961...    128   2e-30   Pyrus x bretschneideri [bai li]
ref|NP_974133.1|  myb family transcription factor TRFL6                 127   2e-30   Arabidopsis thaliana [mouse-ear cress]
gb|AAG51859.1|AC010926_22  hypothetical protein; 60264-57191            127   3e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010471292.1|  PREDICTED: uncharacterized protein LOC104751...    127   3e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010471295.1|  PREDICTED: uncharacterized protein LOC104751...    127   3e-30   Camelina sativa [gold-of-pleasure]
ref|NP_001240101.1|  uncharacterized protein LOC100775511               127   4e-30   Glycine max [soybeans]
ref|XP_010416024.1|  PREDICTED: uncharacterized protein LOC104701...    125   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_008462322.1|  PREDICTED: uncharacterized protein LOC103500...    124   1e-29   
ref|XP_004141697.1|  PREDICTED: uncharacterized protein LOC101203003    125   1e-29   
ref|XP_010416023.1|  PREDICTED: uncharacterized protein LOC104701...    125   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010416020.1|  PREDICTED: uncharacterized protein LOC104701...    125   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_008462320.1|  PREDICTED: uncharacterized protein LOC103500...    124   2e-29   
ref|XP_010428154.1|  PREDICTED: uncharacterized protein LOC104712871    125   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_008462318.1|  PREDICTED: uncharacterized protein LOC103500...    124   2e-29   
ref|XP_006300624.1|  hypothetical protein CARUB_v10019876mg             125   2e-29   Capsella rubella
gb|KGN45496.1|  hypothetical protein Csa_7G450550                       124   6e-29   Cucumis sativus [cucumbers]
ref|XP_006390637.1|  hypothetical protein EUTSA_v10018282mg             123   8e-29   Eutrema salsugineum
ref|XP_010685325.1|  PREDICTED: uncharacterized protein LOC104899...    122   1e-28   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010685324.1|  PREDICTED: uncharacterized protein LOC104899...    122   2e-28   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|AEV91171.1|  MYB-related protein                                     121   3e-28   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009403376.1|  PREDICTED: uncharacterized protein LOC103986...    120   5e-28   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT24643.1|  hypothetical protein F775_05862                         122   6e-28   Aegilops tauschii
ref|XP_004954094.1|  PREDICTED: uncharacterized protein LOC101768...    119   1e-27   Setaria italica
ref|XP_009403371.1|  PREDICTED: uncharacterized protein LOC103986...    119   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDM85538.1|  unnamed protein product                                119   2e-27   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009403374.1|  PREDICTED: uncharacterized protein LOC103986...    119   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004954093.1|  PREDICTED: uncharacterized protein LOC101768...    119   2e-27   Setaria italica
ref|XP_009104846.1|  PREDICTED: uncharacterized protein LOC103830...    118   2e-27   Brassica rapa
ref|XP_009104845.1|  PREDICTED: uncharacterized protein LOC103830...    118   3e-27   Brassica rapa
ref|XP_009105586.1|  PREDICTED: uncharacterized protein LOC103831454    118   3e-27   Brassica rapa
emb|CDX68258.1|  BnaA07g22980D                                          118   3e-27   Brassica napus [oilseed rape]
gb|AGT15966.1|  MYB-related protein                                     117   7e-27   Saccharum hybrid cultivar R570
gb|AGT16747.1|  MYB-related protein                                     117   9e-27   Saccharum hybrid cultivar R570
gb|AGT16617.1|  MYB-related protein                                     117   1e-26   Saccharum hybrid cultivar R570
gb|AGT16702.1|  MYB-related protein                                     117   1e-26   Saccharum hybrid cultivar R570
gb|AGT16112.1|  MYB-related protein                                     117   1e-26   Saccharum hybrid cultivar R570
gb|AGT16716.1|  MYB-related protein                                     117   1e-26   Saccharum hybrid cultivar R570
gb|AGT16673.1|  MYB-related protein                                     117   1e-26   Saccharum hybrid cultivar R570
emb|CDX72932.1|  BnaC06g33800D                                          116   2e-26   Brassica napus [oilseed rape]
ref|XP_009402132.1|  PREDICTED: uncharacterized protein LOC103985999    115   4e-26   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGT16984.1|  MYB-related protein                                     115   6e-26   Saccharum hybrid cultivar R570
gb|EMS60332.1|  Telomere repeat-binding protein 4                       115   6e-26   Triticum urartu
emb|CDY11162.1|  BnaC06g24140D                                          114   7e-26   Brassica napus [oilseed rape]
ref|XP_003570524.1|  PREDICTED: uncharacterized protein LOC100846611    113   2e-25   Brachypodium distachyon [annual false brome]
gb|KHN29760.1|  hypothetical protein glysoja_035446                     110   2e-25   Glycine soja [wild soybean]
emb|CDX96424.1|  BnaA07g30350D                                          113   2e-25   Brassica napus [oilseed rape]
ref|XP_009105926.1|  PREDICTED: uncharacterized protein LOC103831...    113   3e-25   Brassica rapa
ref|XP_009105925.1|  PREDICTED: uncharacterized protein LOC103831...    112   3e-25   Brassica rapa
ref|XP_009105924.1|  PREDICTED: uncharacterized protein LOC103831...    112   3e-25   Brassica rapa
ref|XP_006647993.1|  PREDICTED: uncharacterized protein LOC102707...    112   5e-25   Oryza brachyantha
gb|AAF97307.1|AC007843_10  Hypothetical protein                         111   1e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AAF79464.1|AC022492_8  F1L3.16                                       111   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564025.2|  protein TRF-like 3                                    111   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185023.1|  protein TRF-like 3                                 111   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003554936.1|  PREDICTED: uncharacterized protein LOC100777434    106   6e-24   Glycine max [soybeans]
ref|XP_008644056.1|  PREDICTED: uncharacterized protein LOC100383...    108   2e-23   Zea mays [maize]
gb|AFA45125.1|  MYB-related protein                                     108   2e-23   Zea mays [maize]
ref|XP_008644055.1|  PREDICTED: uncharacterized protein LOC100383...    108   2e-23   Zea mays [maize]
ref|NP_001169431.1|  uncharacterized protein LOC100383302               107   2e-23   Zea mays [maize]
ref|XP_008644054.1|  PREDICTED: uncharacterized protein LOC100383...    107   2e-23   Zea mays [maize]
ref|XP_008644058.1|  PREDICTED: uncharacterized protein LOC100383...    107   2e-23   Zea mays [maize]
ref|NP_001048286.1|  Os02g0776700                                       107   2e-23   
gb|EEC74099.1|  hypothetical protein OsI_09146                          107   2e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_002890227.1|  hypothetical protein ARALYDRAFT_471953             107   4e-23   Arabidopsis lyrata subsp. lyrata
ref|XP_006416700.1|  hypothetical protein EUTSA_v10007199mg             105   2e-22   Eutrema salsugineum
dbj|BAM74414.1|  carboxyl-terminal Myb1 short polypeptide               104   3e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010476899.1|  PREDICTED: uncharacterized protein LOC104756...  98.2    5e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010476898.1|  PREDICTED: uncharacterized protein LOC104756...  98.2    6e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010498099.1|  PREDICTED: uncharacterized protein LOC104775857  95.1    6e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010459342.1|  PREDICTED: uncharacterized protein LOC104740442  92.0    7e-18   Camelina sativa [gold-of-pleasure]
ref|XP_006304808.1|  hypothetical protein CARUB_v10012426mg           90.5    2e-17   Capsella rubella
emb|CDY48303.1|  BnaC05g13570D                                        82.8    9e-15   Brassica napus [oilseed rape]
emb|CDY26243.1|  BnaA06g11740D                                        82.4    1e-14   Brassica napus [oilseed rape]
ref|XP_009149196.1|  PREDICTED: uncharacterized protein LOC103872532  82.4    1e-14   Brassica rapa
ref|XP_010253930.1|  PREDICTED: uncharacterized protein LOC104595064  81.3    2e-14   Nelumbo nucifera [Indian lotus]
dbj|BAD16962.1|  MYB transcription factor-like                        80.1    3e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006827445.1|  hypothetical protein AMTR_s00009p00103030        80.9    4e-14   Amborella trichopoda
ref|XP_010262885.1|  PREDICTED: uncharacterized protein LOC104601289  79.7    1e-13   Nelumbo nucifera [Indian lotus]
dbj|BAM74415.1|  carboxyl-terminal Myb1 short polypeptide             77.0    4e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010918708.1|  PREDICTED: uncharacterized protein LOC105043012  73.9    7e-12   Elaeis guineensis
ref|XP_008800050.1|  PREDICTED: uncharacterized protein LOC103714...  73.2    1e-11   Phoenix dactylifera
ref|XP_008800048.1|  PREDICTED: uncharacterized protein LOC103714...  73.2    1e-11   Phoenix dactylifera
ref|XP_001760535.1|  predicted protein                                65.1    6e-09   Physcomitrella patens
ref|XP_001773667.1|  predicted protein                                65.1    7e-09   Physcomitrella patens
emb|CAN66760.1|  hypothetical protein VITISV_006318                   63.9    1e-08   Vitis vinifera
emb|CBI16344.3|  unnamed protein product                              63.9    2e-08   Vitis vinifera
ref|XP_010651207.1|  PREDICTED: uncharacterized protein LOC100853...  63.5    2e-08   Vitis vinifera
ref|XP_010651206.1|  PREDICTED: uncharacterized protein LOC100853...  63.5    2e-08   Vitis vinifera
ref|XP_010651205.1|  PREDICTED: uncharacterized protein LOC100853...  63.5    2e-08   Vitis vinifera
ref|XP_010031963.1|  PREDICTED: uncharacterized protein LOC104421...  63.2    2e-08   Eucalyptus grandis [rose gum]
gb|KCW51363.1|  hypothetical protein EUGRSUZ_J009051                  63.2    2e-08   Eucalyptus grandis [rose gum]
ref|XP_010031962.1|  PREDICTED: uncharacterized protein LOC104421...  63.2    2e-08   Eucalyptus grandis [rose gum]
ref|XP_010031965.1|  PREDICTED: uncharacterized protein LOC104421...  63.2    2e-08   Eucalyptus grandis [rose gum]
ref|XP_010031964.1|  PREDICTED: uncharacterized protein LOC104421...  63.2    2e-08   Eucalyptus grandis [rose gum]
ref|XP_002529433.1|  conserved hypothetical protein                   52.8    7e-05   



>ref|XP_010318487.1| PREDICTED: uncharacterized protein LOC101258446 [Solanum lycopersicum]
Length=555

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 147/200 (74%), Gaps = 2/200 (1%)
 Frame = -2

Query  609  DAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKR  430
            DA +E+    S AG+SWKPDFSKL+G+ICL++L VKEL ETFKATFGR+TSVKDKQWLKR
Sbjct  93   DAPNEDTPSTSAAGSSWKPDFSKLEGKICLDDLPVKELQETFKATFGRETSVKDKQWLKR  152

Query  429  RISMGLSNSCDFSCTSFVIEDSRVVKKVKENIASVNGS-ISKDPIVALPNINS-GSSSGH  256
            RI+MGL+NSCDFSCT+F+I D+ VVKK +E I     S IS D    + N+NS GS S H
Sbjct  153  RITMGLTNSCDFSCTTFIIRDNVVVKKGEEQICHREKSRISADSEDGVANLNSRGSFSDH  212

Query  255  DDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesressg  76
            D+K+   A+++  ++ +S LE C V++  N EQ  AKR RKPTKRYIEELSE+ESRE+S 
Sbjct  213  DNKINDAADLSGADVSSSALESCNVTKDLNAEQITAKRARKPTKRYIEELSEIESRETSE  272

Query  75   ksmssEKICGYKSTHPSNHV  16
            K  S EKI  Y+   P  H+
Sbjct  273  KLASPEKIPRYQFACPETHI  292



>ref|XP_006342945.1| PREDICTED: uncharacterized protein LOC102604816 isoform X1 [Solanum 
tuberosum]
 ref|XP_006342946.1| PREDICTED: uncharacterized protein LOC102604816 isoform X2 [Solanum 
tuberosum]
Length=606

 Score =   193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 145/200 (73%), Gaps = 2/200 (1%)
 Frame = -2

Query  609  DAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKR  430
            DA +E+    S AG+SWKPDFSKL+G+ICL++L VKEL ETFKATFGR+TSVKDKQWLKR
Sbjct  144  DAPNEDTPSTSAAGSSWKPDFSKLEGKICLDDLPVKELQETFKATFGRETSVKDKQWLKR  203

Query  429  RISMGLSNSCDFSCTSFVIEDSRVVKKVKENIA-SVNGSISKDPIVALPNINS-GSSSGH  256
            RI+MGL+NSCDFSCT+F+I D+ VVKK +E I   V   IS D    + N NS GS S H
Sbjct  204  RITMGLTNSCDFSCTTFIIRDNVVVKKGEEQICHRVKSRISADSEDGVANSNSRGSLSDH  263

Query  255  DDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesressg  76
            D+++   A+++  ++ +S  E C V++  N EQ  AKR RKPTKRYIEELSE+ESRE+S 
Sbjct  264  DNRINDDADLSGADVSSSAFESCNVTKDLNTEQITAKRARKPTKRYIEELSEIESRETSE  323

Query  75   ksmssEKICGYKSTHPSNHV  16
            K  S +KI  Y+   P  H+
Sbjct  324  KLASPDKISRYQFACPETHL  343



>ref|XP_009602392.1| PREDICTED: uncharacterized protein LOC104097528 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009602393.1| PREDICTED: uncharacterized protein LOC104097528 isoform X1 [Nicotiana 
tomentosiformis]
Length=627

 Score =   192 bits (489),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 126/167 (75%), Gaps = 3/167 (2%)
 Frame = -2

Query  609  DAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKR  430
            DA +E+   ++ A +SWKPDFSKL+G+ICL+NLTVKEL ETFKATFGR+TSVKDKQWLKR
Sbjct  160  DALNEDTP-STSASSSWKPDFSKLEGKICLDNLTVKELQETFKATFGRETSVKDKQWLKR  218

Query  429  RISMGLSNSCDFSCTSFVIEDSRVVKKVKENIA-SVNGSISKDPIVALPNINSGSSSG-H  256
            RI+MGL+NSCDFSCT+F+I D+ VV+K +E I+  V   IS DP V + N +SG S G  
Sbjct  219  RITMGLTNSCDFSCTTFIIRDNLVVRKGEEQISHPVKVRISADPEVGVANSDSGGSLGDR  278

Query  255  DDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            D++V   AN +  ++P+S  E C V++    EQ  AKRVRKPTKRYI
Sbjct  279  DNRVNDDANFSGTDVPSSAFESCNVTKDLYAEQGTAKRVRKPTKRYI  325



>ref|XP_009602394.1| PREDICTED: uncharacterized protein LOC104097528 isoform X2 [Nicotiana 
tomentosiformis]
Length=623

 Score =   192 bits (489),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 126/167 (75%), Gaps = 3/167 (2%)
 Frame = -2

Query  609  DAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKR  430
            DA +E+   ++ A +SWKPDFSKL+G+ICL+NLTVKEL ETFKATFGR+TSVKDKQWLKR
Sbjct  156  DALNEDTP-STSASSSWKPDFSKLEGKICLDNLTVKELQETFKATFGRETSVKDKQWLKR  214

Query  429  RISMGLSNSCDFSCTSFVIEDSRVVKKVKENIA-SVNGSISKDPIVALPNINSGSSSG-H  256
            RI+MGL+NSCDFSCT+F+I D+ VV+K +E I+  V   IS DP V + N +SG S G  
Sbjct  215  RITMGLTNSCDFSCTTFIIRDNLVVRKGEEQISHPVKVRISADPEVGVANSDSGGSLGDR  274

Query  255  DDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            D++V   AN +  ++P+S  E C V++    EQ  AKRVRKPTKRYI
Sbjct  275  DNRVNDDANFSGTDVPSSAFESCNVTKDLYAEQGTAKRVRKPTKRYI  321



>ref|XP_009782035.1| PREDICTED: uncharacterized protein LOC104230838 [Nicotiana sylvestris]
Length=624

 Score =   192 bits (489),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 126/167 (75%), Gaps = 3/167 (2%)
 Frame = -2

Query  609  DAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKR  430
            DA +E+   ++ A +SWKPDFSKL+G+ICL+NLTVKEL ETFKATFGR+TSVKDKQWLKR
Sbjct  156  DALNEDTP-STSASSSWKPDFSKLEGKICLDNLTVKELQETFKATFGRETSVKDKQWLKR  214

Query  429  RISMGLSNSCDFSCTSFVIEDSRVVKKVKENIA-SVNGSISKDPIVALPNINSGSSSG-H  256
            RI+MGL+NSCDFSCT+F+I D+ VV+K +E I+  V   IS DP V + +  SG S G H
Sbjct  215  RITMGLTNSCDFSCTTFIIRDNLVVRKGEEQISHPVKVRISADPEVGVAHSYSGGSLGDH  274

Query  255  DDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            D++V   AN +  ++P+S  E C V++    EQ  AKRVRKPTKRYI
Sbjct  275  DNRVNDDANFSGTDVPSSAFESCNVTKDLYAEQGTAKRVRKPTKRYI  321



>ref|XP_002521340.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41008.1| conserved hypothetical protein [Ricinus communis]
Length=623

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 114/170 (67%), Gaps = 15/170 (9%)
 Frame = -2

Query  603  FSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRI  424
             +E   L S    +  PDFSKLKGEICL+NL++KELHETFKATFGRDT+VKDKQWLKRRI
Sbjct  172  LTEAGSLISATATTSIPDFSKLKGEICLDNLSIKELHETFKATFGRDTTVKDKQWLKRRI  231

Query  423  SMGLSNSCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPN-------INSGSS  265
            +MGL+NSCD S T+F+I+D+++VKK KE   +VN + + DP +   +       IN GS 
Sbjct  232  TMGLTNSCDVSATTFIIKDNKLVKKGKEGFDNVNSAFANDPALGTMDANEEGSPINYGSQ  291

Query  264  SGHDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
                  V    +++ G   NS       SE HN+EQ AAKRVRKPT+RYI
Sbjct  292  LEDHQVVSLKRSLSIGE--NSG------SEDHNIEQRAAKRVRKPTRRYI  333



>gb|KDP40712.1| hypothetical protein JCGZ_24711 [Jatropha curcas]
Length=608

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 113/152 (74%), Gaps = 6/152 (4%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPDFSKLKGEICL+NL++KELHETF+ATFGR+T+VKDKQWLKRRI+MGL+NSCD S T
Sbjct  166  SSKPDFSKLKGEICLDNLSIKELHETFRATFGRETTVKDKQWLKRRITMGLTNSCDVSAT  225

Query  384  SFVIEDSRVVKKVKENIASVN-GSISKDPIVA-LPNINSGSSSGHDDKVESPANITEGNI  211
            +F+I+D+++VKK KE   SVN  + + DP+   + N   G+   HD ++E    I++   
Sbjct  226  TFIIKDNKLVKKGKEE-GSVNVDAFANDPVTGTINNSQEGTPITHDSQLEDQV-ISDKR-  282

Query  210  PNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
             N ++     SE HN EQ AAKRVRKPT+RYI
Sbjct  283  -NHSIGDNSGSEDHNTEQRAAKRVRKPTRRYI  313



>ref|XP_011035704.1| PREDICTED: uncharacterized protein LOC105133411 isoform X2 [Populus 
euphratica]
Length=616

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 109/150 (73%), Gaps = 6/150 (4%)
 Frame = -2

Query  558  KPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSF  379
            KPDFS+LKGEICL+NL++KELHETFKATFGR+T+VKDKQWLKRRISMGL+NSCD S TSF
Sbjct  175  KPDFSRLKGEICLDNLSIKELHETFKATFGRETTVKDKQWLKRRISMGLTNSCDVSTTSF  234

Query  378  VIEDSRVVKKV-KENIASVNGSISKDPIVALPNINS-GSSSGHDDKVESPANITEGNIPN  205
            +I+D++ VKK  +E    + GS +KDP    P +N  G  + H  +++    + E  + N
Sbjct  235  IIKDNKFVKKGNEEGCNGMYGSFAKDP----PIVNQKGLPACHVGQLDYHKVVPERRLEN  290

Query  204  STLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
              L+    S+ H  EQ AAKRVRKPTKRYI
Sbjct  291  HNLDDNSGSDDHQKEQRAAKRVRKPTKRYI  320



>ref|XP_010654460.1| PREDICTED: uncharacterized protein LOC100263481 isoform X1 [Vitis 
vinifera]
 ref|XP_010654461.1| PREDICTED: uncharacterized protein LOC100263481 isoform X1 [Vitis 
vinifera]
Length=687

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = -2

Query  582  ASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS  403
            AS    S KPDF+KLKGEICL+NL+++ELHETFKATFGR+TSVKDKQWLKRRI+MGL+NS
Sbjct  235  ASAVCTSLKPDFTKLKGEICLDNLSIRELHETFKATFGRETSVKDKQWLKRRIAMGLTNS  294

Query  402  CDFSCTSFVIEDSRVVKKVKENIA-SVNGSISKDPIVALPNIN-SGSSSGHDDKVESPAN  229
            CD S T+F+ +D++ +KKVKE    SV+G++ +D +V   N N   S +  +++ E+   
Sbjct  295  CDVSTTTFIFKDNKSMKKVKEECCKSVDGTLIEDTVVGAKNDNCRDSPTSRNNRGEAHQI  354

Query  228  ITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            ++   + NS++E    S+  + EQ A KR+RKPTKRYI
Sbjct  355  LSGKRLRNSSVEYDCGSDDLHTEQIAGKRIRKPTKRYI  392



>ref|XP_010654462.1| PREDICTED: uncharacterized protein LOC100263481 isoform X2 [Vitis 
vinifera]
 emb|CBI35889.3| unnamed protein product [Vitis vinifera]
Length=686

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = -2

Query  582  ASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS  403
            AS    S KPDF+KLKGEICL+NL+++ELHETFKATFGR+TSVKDKQWLKRRI+MGL+NS
Sbjct  234  ASAVCTSLKPDFTKLKGEICLDNLSIRELHETFKATFGRETSVKDKQWLKRRIAMGLTNS  293

Query  402  CDFSCTSFVIEDSRVVKKVKENIA-SVNGSISKDPIVALPNIN-SGSSSGHDDKVESPAN  229
            CD S T+F+ +D++ +KKVKE    SV+G++ +D +V   N N   S +  +++ E+   
Sbjct  294  CDVSTTTFIFKDNKSMKKVKEECCKSVDGTLIEDTVVGAKNDNCRDSPTSRNNRGEAHQI  353

Query  228  ITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            ++   + NS++E    S+  + EQ A KR+RKPTKRYI
Sbjct  354  LSGKRLRNSSVEYDCGSDDLHTEQIAGKRIRKPTKRYI  391



>ref|XP_010654463.1| PREDICTED: uncharacterized protein LOC100263481 isoform X4 [Vitis 
vinifera]
Length=631

 Score =   162 bits (410),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = -2

Query  582  ASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS  403
            AS    S KPDF+KLKGEICL+NL+++ELHETFKATFGR+TSVKDKQWLKRRI+MGL+NS
Sbjct  179  ASAVCTSLKPDFTKLKGEICLDNLSIRELHETFKATFGRETSVKDKQWLKRRIAMGLTNS  238

Query  402  CDFSCTSFVIEDSRVVKKVKENIA-SVNGSISKDPIVALPNIN-SGSSSGHDDKVESPAN  229
            CD S T+F+ +D++ +KKVKE    SV+G++ +D +V   N N   S +  +++ E+   
Sbjct  239  CDVSTTTFIFKDNKSMKKVKEECCKSVDGTLIEDTVVGAKNDNCRDSPTSRNNRGEAHQI  298

Query  228  ITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            ++   + NS++E    S+  + EQ A KR+RKPTKRYI
Sbjct  299  LSGKRLRNSSVEYDCGSDDLHTEQIAGKRIRKPTKRYI  336



>ref|XP_002274215.1| PREDICTED: uncharacterized protein LOC100263481 isoform X3 [Vitis 
vinifera]
Length=667

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = -2

Query  582  ASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS  403
            AS    S KPDF+KLKGEICL+NL+++ELHETFKATFGR+TSVKDKQWLKRRI+MGL+NS
Sbjct  215  ASAVCTSLKPDFTKLKGEICLDNLSIRELHETFKATFGRETSVKDKQWLKRRIAMGLTNS  274

Query  402  CDFSCTSFVIEDSRVVKKVKENIA-SVNGSISKDPIVALPNIN-SGSSSGHDDKVESPAN  229
            CD S T+F+ +D++ +KKVKE    SV+G++ +D +V   N N   S +  +++ E+   
Sbjct  275  CDVSTTTFIFKDNKSMKKVKEECCKSVDGTLIEDTVVGAKNDNCRDSPTSRNNRGEAHQI  334

Query  228  ITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            ++   + NS++E    S+  + EQ A KR+RKPTKRYI
Sbjct  335  LSGKRLRNSSVEYDCGSDDLHTEQIAGKRIRKPTKRYI  372



>ref|XP_007024601.1| TRF-like 3, putative isoform 2 [Theobroma cacao]
 gb|EOY27223.1| TRF-like 3, putative isoform 2 [Theobroma cacao]
Length=603

 Score =   162 bits (410),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 114/156 (73%), Gaps = 12/156 (8%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPDFSKLKGEICL+NL++KELHE FKATFGRDT+VKDKQWLKRRI+MGL+NSCD S T
Sbjct  164  SSKPDFSKLKGEICLDNLSIKELHEVFKATFGRDTTVKDKQWLKRRIAMGLTNSCDVSTT  223

Query  384  SFVIEDSRVVKKVKEN-IASVNGSISKD-PIVALPN----INSGSSSGHDDKVESPANIT  223
            +FVI+D+++VKKVKE+   +V+G+ S+D P+V + N    +NS SS   + +  S   + 
Sbjct  224  TFVIKDNKLVKKVKEDSCNNVDGATSEDHPVVGVENHEDLLNSLSSQIDEHQTTSGMRLG  283

Query  222  EGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
              +  N+       SE    EQ AAKRVRKPT+RYI
Sbjct  284  SNSHENT------YSEDLAAEQRAAKRVRKPTRRYI  313



>ref|XP_010654464.1| PREDICTED: uncharacterized protein LOC100263481 isoform X5 [Vitis 
vinifera]
Length=630

 Score =   162 bits (410),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = -2

Query  582  ASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS  403
            AS    S KPDF+KLKGEICL+NL+++ELHETFKATFGR+TSVKDKQWLKRRI+MGL+NS
Sbjct  178  ASAVCTSLKPDFTKLKGEICLDNLSIRELHETFKATFGRETSVKDKQWLKRRIAMGLTNS  237

Query  402  CDFSCTSFVIEDSRVVKKVKENIA-SVNGSISKDPIVALPNIN-SGSSSGHDDKVESPAN  229
            CD S T+F+ +D++ +KKVKE    SV+G++ +D +V   N N   S +  +++ E+   
Sbjct  238  CDVSTTTFIFKDNKSMKKVKEECCKSVDGTLIEDTVVGAKNDNCRDSPTSRNNRGEAHQI  297

Query  228  ITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            ++   + NS++E    S+  + EQ A KR+RKPTKRYI
Sbjct  298  LSGKRLRNSSVEYDCGSDDLHTEQIAGKRIRKPTKRYI  335



>ref|XP_011035703.1| PREDICTED: uncharacterized protein LOC105133411 isoform X1 [Populus 
euphratica]
Length=672

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 109/150 (73%), Gaps = 6/150 (4%)
 Frame = -2

Query  558  KPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSF  379
            KPDFS+LKGEICL+NL++KELHETFKATFGR+T+VKDKQWLKRRISMGL+NSCD S TSF
Sbjct  231  KPDFSRLKGEICLDNLSIKELHETFKATFGRETTVKDKQWLKRRISMGLTNSCDVSTTSF  290

Query  378  VIEDSRVVKKV-KENIASVNGSISKDPIVALPNINS-GSSSGHDDKVESPANITEGNIPN  205
            +I+D++ VKK  +E    + GS +KDP    P +N  G  + H  +++    + E  + N
Sbjct  291  IIKDNKFVKKGNEEGCNGMYGSFAKDP----PIVNQKGLPACHVGQLDYHKVVPERRLEN  346

Query  204  STLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
              L+    S+ H  EQ AAKRVRKPTKRYI
Sbjct  347  HNLDDNSGSDDHQKEQRAAKRVRKPTKRYI  376



>ref|XP_010654465.1| PREDICTED: uncharacterized protein LOC100263481 isoform X6 [Vitis 
vinifera]
Length=611

 Score =   162 bits (410),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = -2

Query  582  ASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS  403
            AS    S KPDF+KLKGEICL+NL+++ELHETFKATFGR+TSVKDKQWLKRRI+MGL+NS
Sbjct  159  ASAVCTSLKPDFTKLKGEICLDNLSIRELHETFKATFGRETSVKDKQWLKRRIAMGLTNS  218

Query  402  CDFSCTSFVIEDSRVVKKVKENIA-SVNGSISKDPIVALPNIN-SGSSSGHDDKVESPAN  229
            CD S T+F+ +D++ +KKVKE    SV+G++ +D +V   N N   S +  +++ E+   
Sbjct  219  CDVSTTTFIFKDNKSMKKVKEECCKSVDGTLIEDTVVGAKNDNCRDSPTSRNNRGEAHQI  278

Query  228  ITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            ++   + NS++E    S+  + EQ A KR+RKPTKRYI
Sbjct  279  LSGKRLRNSSVEYDCGSDDLHTEQIAGKRIRKPTKRYI  316



>ref|XP_007024600.1| TRF-like 3, putative isoform 1 [Theobroma cacao]
 gb|EOY27222.1| TRF-like 3, putative isoform 1 [Theobroma cacao]
Length=659

 Score =   162 bits (409),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 114/156 (73%), Gaps = 12/156 (8%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPDFSKLKGEICL+NL++KELHE FKATFGRDT+VKDKQWLKRRI+MGL+NSCD S T
Sbjct  220  SSKPDFSKLKGEICLDNLSIKELHEVFKATFGRDTTVKDKQWLKRRIAMGLTNSCDVSTT  279

Query  384  SFVIEDSRVVKKVKEN-IASVNGSISKD-PIVALPN----INSGSSSGHDDKVESPANIT  223
            +FVI+D+++VKKVKE+   +V+G+ S+D P+V + N    +NS SS   + +  S   + 
Sbjct  280  TFVIKDNKLVKKVKEDSCNNVDGATSEDHPVVGVENHEDLLNSLSSQIDEHQTTSGMRLG  339

Query  222  EGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
              +  N+       SE    EQ AAKRVRKPT+RYI
Sbjct  340  SNSHENT------YSEDLAAEQRAAKRVRKPTRRYI  369



>emb|CAN77858.1| hypothetical protein VITISV_005454 [Vitis vinifera]
Length=867

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 117/158 (74%), Gaps = 2/158 (1%)
 Frame = -2

Query  582  ASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS  403
            AS    S KPDF+KLKGEICL+NL+++ELHETFKATFGR+TSVKDKQWLKRRI+MGL+NS
Sbjct  407  ASAVCTSLKPDFTKLKGEICLDNLSIRELHETFKATFGRETSVKDKQWLKRRIAMGLTNS  466

Query  402  CDFSCTSFVIEDSRVVKKVKENIA-SVNGSISKDPIVALPNIN-SGSSSGHDDKVESPAN  229
            CD S T+F+++D++ +KKVKE    SV+G++ +D +V   N N   S +  +++ E+   
Sbjct  467  CDVSTTTFILKDNKSMKKVKEECCKSVDGTLIEDTVVGAKNDNCRDSPTSRNNRGEAHQI  526

Query  228  ITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            ++   + NS++E    S+  + EQ A KR+RKPTKRYI
Sbjct  527  LSGKRLRNSSVEYDCGSDDLHTEQIAGKRIRKPTKRYI  564



>ref|XP_011040067.1| PREDICTED: uncharacterized protein LOC105136426 isoform X6 [Populus 
euphratica]
Length=593

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 112/150 (75%), Gaps = 6/150 (4%)
 Frame = -2

Query  558  KPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSF  379
            KPDFSKLKGEICL+NL++KELHETFKATFGR+T+VKDKQWLKRRISMGL+NSCD S TSF
Sbjct  107  KPDFSKLKGEICLDNLSIKELHETFKATFGRETTVKDKQWLKRRISMGLTNSCDVSVTSF  166

Query  378  VIEDSRVVKKVKENIAS-VNGSISKD-PIVALPNINSGSSSGHDDKVESPANITEGNIPN  205
            +I+D+++VKK  E I++ ++GS ++D PI    ++ +   S    +++    + E  + N
Sbjct  167  IIKDNKLVKKGNEEISNCMDGSYAEDLPIGNQKDLPTSLVS----QLDYHQVVPEKRLEN  222

Query  204  STLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
              L+    S+ H  EQ AAKRVRKPTKRYI
Sbjct  223  PNLDENSGSDDHQTEQRAAKRVRKPTKRYI  252



>ref|XP_011040065.1| PREDICTED: uncharacterized protein LOC105136426 isoform X4 [Populus 
euphratica]
Length=609

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 110/150 (73%), Gaps = 6/150 (4%)
 Frame = -2

Query  558  KPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSF  379
            KPDFSKLKGEICL+NL++KELHETFKATFGR+T+VKDKQWLKRRISMGL+NSCD S TSF
Sbjct  169  KPDFSKLKGEICLDNLSIKELHETFKATFGRETTVKDKQWLKRRISMGLTNSCDVSVTSF  228

Query  378  VIEDSRVVKKVKENIAS-VNGSISKD-PIVALPNINSGSSSGHDDKVESPANITEGNIPN  205
            +I+D+++VKK  E I++ ++GS ++D PI    ++ +   S  D     P    E  + N
Sbjct  229  IIKDNKLVKKGNEEISNCMDGSYAEDLPIGNQKDLPTSLVSQLDYHQVVP----EKRLEN  284

Query  204  STLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
              L+    S+ H  EQ AAKRVRKPTKRYI
Sbjct  285  PNLDENSGSDDHQTEQRAAKRVRKPTKRYI  314



>ref|XP_002298100.2| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEE82905.2| myb family transcription factor family protein [Populus trichocarpa]
Length=661

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 111/158 (70%), Gaps = 6/158 (4%)
 Frame = -2

Query  582  ASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS  403
             S +  + KPDFS+LKGEICL+NL++KELHETFKATFGR+T+VKDKQWLKRRISMGL+NS
Sbjct  212  GSPSSITTKPDFSRLKGEICLDNLSIKELHETFKATFGRETTVKDKQWLKRRISMGLTNS  271

Query  402  CDFSCTSFVIEDSRVVKKV-KENIASVNGSISKDPIVALPNINS-GSSSGHDDKVESPAN  229
            CD S TSF+I+ ++ VKK  +E    + GS +KDP    P +N  G  + H  +++    
Sbjct  272  CDVSTTSFIIKGNKFVKKGNEEGCNGIYGSFAKDP----PIVNQKGLPTCHVGQLDYHKV  327

Query  228  ITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            + E  + N  L+    S+ H  EQ AAKRVRKPTKRYI
Sbjct  328  VPERRLENHNLDDNSGSDDHQKEQRAAKRVRKPTKRYI  365



>ref|XP_011040066.1| PREDICTED: uncharacterized protein LOC105136426 isoform X5 [Populus 
euphratica]
Length=609

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 110/150 (73%), Gaps = 6/150 (4%)
 Frame = -2

Query  558  KPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSF  379
            KPDFSKLKGEICL+NL++KELHETFKATFGR+T+VKDKQWLKRRISMGL+NSCD S TSF
Sbjct  169  KPDFSKLKGEICLDNLSIKELHETFKATFGRETTVKDKQWLKRRISMGLTNSCDVSVTSF  228

Query  378  VIEDSRVVKKVKENIAS-VNGSISKD-PIVALPNINSGSSSGHDDKVESPANITEGNIPN  205
            +I+D+++VKK  E I++ ++GS ++D PI    ++ +   S  D     P    E  + N
Sbjct  229  IIKDNKLVKKGNEEISNCMDGSYAEDLPIGNQKDLPTSLVSQLDYHQVVP----EKRLEN  284

Query  204  STLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
              L+    S+ H  EQ AAKRVRKPTKRYI
Sbjct  285  PNLDENSGSDDHQTEQRAAKRVRKPTKRYI  314



>ref|XP_011040062.1| PREDICTED: uncharacterized protein LOC105136426 isoform X2 [Populus 
euphratica]
 ref|XP_011040063.1| PREDICTED: uncharacterized protein LOC105136426 isoform X2 [Populus 
euphratica]
Length=651

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 112/150 (75%), Gaps = 6/150 (4%)
 Frame = -2

Query  558  KPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSF  379
            KPDFSKLKGEICL+NL++KELHETFKATFGR+T+VKDKQWLKRRISMGL+NSCD S TSF
Sbjct  165  KPDFSKLKGEICLDNLSIKELHETFKATFGRETTVKDKQWLKRRISMGLTNSCDVSVTSF  224

Query  378  VIEDSRVVKKVKENIAS-VNGSISKD-PIVALPNINSGSSSGHDDKVESPANITEGNIPN  205
            +I+D+++VKK  E I++ ++GS ++D PI    ++ +   S    +++    + E  + N
Sbjct  225  IIKDNKLVKKGNEEISNCMDGSYAEDLPIGNQKDLPTSLVS----QLDYHQVVPEKRLEN  280

Query  204  STLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
              L+    S+ H  EQ AAKRVRKPTKRYI
Sbjct  281  PNLDENSGSDDHQTEQRAAKRVRKPTKRYI  310



>ref|XP_011040064.1| PREDICTED: uncharacterized protein LOC105136426 isoform X3 [Populus 
euphratica]
Length=646

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 112/150 (75%), Gaps = 6/150 (4%)
 Frame = -2

Query  558  KPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSF  379
            KPDFSKLKGEICL+NL++KELHETFKATFGR+T+VKDKQWLKRRISMGL+NSCD S TSF
Sbjct  160  KPDFSKLKGEICLDNLSIKELHETFKATFGRETTVKDKQWLKRRISMGLTNSCDVSVTSF  219

Query  378  VIEDSRVVKKVKENIAS-VNGSISKD-PIVALPNINSGSSSGHDDKVESPANITEGNIPN  205
            +I+D+++VKK  E I++ ++GS ++D PI    ++ +   S    +++    + E  + N
Sbjct  220  IIKDNKLVKKGNEEISNCMDGSYAEDLPIGNQKDLPTSLVS----QLDYHQVVPEKRLEN  275

Query  204  STLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
              L+    S+ H  EQ AAKRVRKPTKRYI
Sbjct  276  PNLDENSGSDDHQTEQRAAKRVRKPTKRYI  305



>ref|XP_011040060.1| PREDICTED: uncharacterized protein LOC105136426 isoform X1 [Populus 
euphratica]
 ref|XP_011040061.1| PREDICTED: uncharacterized protein LOC105136426 isoform X1 [Populus 
euphratica]
Length=655

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 110/150 (73%), Gaps = 6/150 (4%)
 Frame = -2

Query  558  KPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSF  379
            KPDFSKLKGEICL+NL++KELHETFKATFGR+T+VKDKQWLKRRISMGL+NSCD S TSF
Sbjct  169  KPDFSKLKGEICLDNLSIKELHETFKATFGRETTVKDKQWLKRRISMGLTNSCDVSVTSF  228

Query  378  VIEDSRVVKKVKENIAS-VNGSISKD-PIVALPNINSGSSSGHDDKVESPANITEGNIPN  205
            +I+D+++VKK  E I++ ++GS ++D PI    ++ +   S  D     P    E  + N
Sbjct  229  IIKDNKLVKKGNEEISNCMDGSYAEDLPIGNQKDLPTSLVSQLDYHQVVP----EKRLEN  284

Query  204  STLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
              L+    S+ H  EQ AAKRVRKPTKRYI
Sbjct  285  PNLDENSGSDDHQTEQRAAKRVRKPTKRYI  314



>ref|XP_002303250.2| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEE78229.2| myb family transcription factor family protein [Populus trichocarpa]
Length=704

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 106/153 (69%), Gaps = 12/153 (8%)
 Frame = -2

Query  558  KPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSF  379
            KPDFSKLKGEICL+NL++KELHETFKATFGR+T+VKDKQWLKRRISMGL+NSCD S TSF
Sbjct  221  KPDFSKLKGEICLDNLSIKELHETFKATFGRETTVKDKQWLKRRISMGLTNSCDVSVTSF  280

Query  378  VIEDSRVVKKVKENIAS-VNGSISKDPIVA----LPNINSGSSSGHDDKVESPANITEGN  214
            +I+D+++VKK    I++ ++GS ++DP +     LP         H         + E  
Sbjct  281  IIKDNKLVKKGNGEISNCMDGSYAEDPPIGNQKDLPTSLVSQLDYHQ-------VVPEKR  333

Query  213  IPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            + N  L+    S+ H  EQ AAKR RKPTKRYI
Sbjct  334  LENPNLDDNSGSDDHQTEQRAAKRARKPTKRYI  366



>gb|KJB70112.1| hypothetical protein B456_011G058300 [Gossypium raimondii]
Length=564

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 104/151 (69%), Gaps = 1/151 (1%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPDFSKLKGEICL+NL++KELHE FKATFGRDT+VKDK WLKRRI+MGL+NSCD S T
Sbjct  123  SSKPDFSKLKGEICLDNLSIKELHEVFKATFGRDTTVKDKLWLKRRIAMGLTNSCDVSAT  182

Query  384  SFVIEDSRVVKKVKEN-IASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIP  208
            +FVI+D+++VKK  E+   +VN    K+ +      N    +    +++     +E  + 
Sbjct  183  TFVIKDNKLVKKDNEDGFNNVNLGAGKEHLAVAVEYNEDLLNNLSSQIDEHQTTSEVRLG  242

Query  207  NSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            N+ +E    SE    +Q AAKRVRKPTKRYI
Sbjct  243  NNVVENNFASEDLAADQRAAKRVRKPTKRYI  273



>gb|KJB70111.1| hypothetical protein B456_011G058300 [Gossypium raimondii]
Length=548

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 104/151 (69%), Gaps = 1/151 (1%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPDFSKLKGEICL+NL++KELHE FKATFGRDT+VKDK WLKRRI+MGL+NSCD S T
Sbjct  107  SSKPDFSKLKGEICLDNLSIKELHEVFKATFGRDTTVKDKLWLKRRIAMGLTNSCDVSAT  166

Query  384  SFVIEDSRVVKKVKEN-IASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIP  208
            +FVI+D+++VKK  E+   +VN    K+ +      N    +    +++     +E  + 
Sbjct  167  TFVIKDNKLVKKDNEDGFNNVNLGAGKEHLAVAVEYNEDLLNNLSSQIDEHQTTSEVRLG  226

Query  207  NSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            N+ +E    SE    +Q AAKRVRKPTKRYI
Sbjct  227  NNVVENNFASEDLAADQRAAKRVRKPTKRYI  257



>gb|KJB70109.1| hypothetical protein B456_011G058300 [Gossypium raimondii]
 gb|KJB70110.1| hypothetical protein B456_011G058300 [Gossypium raimondii]
 gb|KJB70113.1| hypothetical protein B456_011G058300 [Gossypium raimondii]
Length=606

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 104/151 (69%), Gaps = 1/151 (1%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPDFSKLKGEICL+NL++KELHE FKATFGRDT+VKDK WLKRRI+MGL+NSCD S T
Sbjct  165  SSKPDFSKLKGEICLDNLSIKELHEVFKATFGRDTTVKDKLWLKRRIAMGLTNSCDVSAT  224

Query  384  SFVIEDSRVVKKVKEN-IASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIP  208
            +FVI+D+++VKK  E+   +VN    K+ +      N    +    +++     +E  + 
Sbjct  225  TFVIKDNKLVKKDNEDGFNNVNLGAGKEHLAVAVEYNEDLLNNLSSQIDEHQTTSEVRLG  284

Query  207  NSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            N+ +E    SE    +Q AAKRVRKPTKRYI
Sbjct  285  NNVVENNFASEDLAADQRAAKRVRKPTKRYI  315



>gb|KHG30544.1| Telomere repeat-binding 6 -like protein [Gossypium arboreum]
Length=624

 Score =   154 bits (388),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 104/151 (69%), Gaps = 1/151 (1%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPDFSKLKGEICL+NL++KELHE FKATFGRDT+VKDK WLKRRI+MGL+NSCD S T
Sbjct  165  SSKPDFSKLKGEICLDNLSIKELHEVFKATFGRDTTVKDKLWLKRRIAMGLTNSCDVSTT  224

Query  384  SFVIEDSRVVKKVKEN-IASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIP  208
            +FVI+D+++VKK  E+   +VN    K+ +      N    +    +++     +E  + 
Sbjct  225  TFVIKDNKLVKKDNEDGFNNVNLGAGKEHLAVAVEYNEDLLNNLSSQIDEHQTTSEVRLG  284

Query  207  NSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            N+ +E    SE    +Q AAKRVRKPTKRYI
Sbjct  285  NNVVENNFASEDLAADQRAAKRVRKPTKRYI  315



>emb|CDP21217.1| unnamed protein product [Coffea canephora]
Length=569

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 109/149 (73%), Gaps = 2/149 (1%)
 Frame = -2

Query  558  KPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSF  379
            KPDFSKLKGEICL+NLTVKEL ETF+ATFGR+T VKDK+WLKRRISMGL+NSCDFS T+F
Sbjct  175  KPDFSKLKGEICLDNLTVKELQETFRATFGRETFVKDKRWLKRRISMGLTNSCDFSTTAF  234

Query  378  VIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGS-SSGHDDKVESPANITEGNIPNS  202
            +I+D+ V+KK K+     + ++ KD +V + +  +GS ++G +   +S  N  +    + 
Sbjct  235  MIKDNEVLKKDKKENRKKS-AVYKDLVVGVASETAGSPTNGLNRLADSNPNFDDRKTESL  293

Query  201  TLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
             LE   V E  ++EQ  AKRVRKPTKRYI
Sbjct  294  LLEHDSVREDPSLEQRTAKRVRKPTKRYI  322



>ref|XP_011079795.1| PREDICTED: uncharacterized protein LOC105163216 isoform X2 [Sesamum 
indicum]
Length=555

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 116/173 (67%), Gaps = 10/173 (6%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASW----KPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDK  445
            S  FSE  L  SK  +S+    KPDFS L GEI L+NL+VK+L ETFKATFGR+TSVKDK
Sbjct  137  SKTFSE--LDRSKTNSSFDTGMKPDFSLLNGEIHLDNLSVKDLQETFKATFGRETSVKDK  194

Query  444  QWLKRRISMGLSNSCDFSCTSFVIEDSRVVKKVK-ENIASVNGSISKDPIV--ALPNINS  274
            QWLKRRI MGL+NSCDFS TSFVI D+RV +K K E   SV+ S+  D +V  A+ N  S
Sbjct  195  QWLKRRIIMGLTNSCDFSTTSFVIIDNRVGRKQKTETCESVDCSVLFDCVVTSAMENHES  254

Query  273  GSSSGHDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
             S+S HD K E  +   E N+ +ST +     +    E+  AKR+RKPTKRYI
Sbjct  255  PSTS-HDKKSEIHSIANETNMESSTFQDKSGGKDAETEERPAKRIRKPTKRYI  306



>ref|XP_011079786.1| PREDICTED: uncharacterized protein LOC105163216 isoform X1 [Sesamum 
indicum]
Length=602

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 116/173 (67%), Gaps = 10/173 (6%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASW----KPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDK  445
            S  FSE  L  SK  +S+    KPDFS L GEI L+NL+VK+L ETFKATFGR+TSVKDK
Sbjct  137  SKTFSE--LDRSKTNSSFDTGMKPDFSLLNGEIHLDNLSVKDLQETFKATFGRETSVKDK  194

Query  444  QWLKRRISMGLSNSCDFSCTSFVIEDSRVVKKVK-ENIASVNGSISKDPIV--ALPNINS  274
            QWLKRRI MGL+NSCDFS TSFVI D+RV +K K E   SV+ S+  D +V  A+ N  S
Sbjct  195  QWLKRRIIMGLTNSCDFSTTSFVIIDNRVGRKQKTETCESVDCSVLFDCVVTSAMENHES  254

Query  273  GSSSGHDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
             S+S HD K E  +   E N+ +ST +     +    E+  AKR+RKPTKRYI
Sbjct  255  PSTS-HDKKSEIHSIANETNMESSTFQDKSGGKDAETEERPAKRIRKPTKRYI  306



>gb|EYU45881.1| hypothetical protein MIMGU_mgv1a005063mg [Erythranthe guttata]
Length=498

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 107/168 (64%), Gaps = 2/168 (1%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            S    EN    S  G    PDFS L GE+ L++L VKEL +TFKATFGR+TSVKDKQWLK
Sbjct  144  SGGLYENKTSKSAIGTGLNPDFSLLNGEVHLDSLGVKELQDTFKATFGRETSVKDKQWLK  203

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVVKKVKENIA-SVNGSISKDPIVALPNINSGS-SSG  259
            RRI MGL+NSCDFS TSFVI D+RVVKK KE    S++ S+  D +V     + GS  + 
Sbjct  204  RRIIMGLTNSCDFSTTSFVIIDNRVVKKGKEEACKSMDSSVLVDCVVTSLRESHGSPPTC  263

Query  258  HDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            HD++ E+ + +      +ST +    SE  N  Q   KRVRKPTKRYI
Sbjct  264  HDNQNENHSIVDGMKAQSSTFQDNYESEDANTNQRPTKRVRKPTKRYI  311



>ref|XP_010261951.1| PREDICTED: uncharacterized protein LOC104600603 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010261952.1| PREDICTED: uncharacterized protein LOC104600603 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010261953.1| PREDICTED: uncharacterized protein LOC104600603 isoform X2 [Nelumbo 
nucifera]
Length=496

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 109/168 (65%), Gaps = 3/168 (2%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            +D    N   AS    S KPDFS LK EICL+NL++KELHETFKATFGR+TSVKDK WLK
Sbjct  80   TDGLLNNGSSASAHSTSSKPDFSILKEEICLDNLSIKELHETFKATFGRETSVKDKLWLK  139

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVV--KKVKENIASVNGSISKDPIVALPNINSGSSSG  259
            RRI+MGL+NSCD S T+F+I    +V  K  +EN  SV+ +++KD +V   N      S 
Sbjct  140  RRIAMGLTNSCDVSTTTFIIRGKTLVRNKVTEENSKSVDTTLTKDQVVVNDNCKD-LPSN  198

Query  258  HDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
              +++E    ++      S +E    SE  +ME+ AAKRVRKPT+RYI
Sbjct  199  PTNQMEDQGVLSGKIFGKSDVESGYKSEDIHMEERAAKRVRKPTRRYI  246



>ref|XP_008351044.1| PREDICTED: uncharacterized protein LOC103414429 isoform X2 [Malus 
domestica]
Length=622

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPD + LKGEICL+NL+++ELHE F+ATFGR+T+VKDK WLKRRI+MGL+NSCD S T
Sbjct  158  SSKPDLNTLKGEICLDNLSIRELHELFRATFGRETTVKDKLWLKRRITMGLTNSCDVSTT  217

Query  384  SFVIEDSRVVKKVKEN-IASVNGSISKDPIVALPNINSGSS-SGHDDKVESPANITEGNI  211
            +F I D+ +VKK K++ I + +G +++       N    +S + H  +VE+P  ++   +
Sbjct  218  TFTIVDNNLVKKGKDDSIQNADGMLTEGSDGEAKNHGYETSPTSHSSQVENPHTVSGKRL  277

Query  210  PNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
             NS++E    SE  + +Q AAKRVRKPTKRYI
Sbjct  278  GNSSVELDCGSEDLHTDQRAAKRVRKPTKRYI  309



>ref|XP_008351047.1| PREDICTED: uncharacterized protein LOC103414429 isoform X3 [Malus 
domestica]
Length=609

 Score =   145 bits (365),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPD + LKGEICL+NL+++ELHE F+ATFGR+T+VKDK WLKRRI+MGL+NSCD S T
Sbjct  145  SSKPDLNTLKGEICLDNLSIRELHELFRATFGRETTVKDKLWLKRRITMGLTNSCDVSTT  204

Query  384  SFVIEDSRVVKKVKEN-IASVNGSISKDPIVALPNINSGSS-SGHDDKVESPANITEGNI  211
            +F I D+ +VKK K++ I + +G +++       N    +S + H  +VE+P  ++   +
Sbjct  205  TFTIVDNNLVKKGKDDSIQNADGMLTEGSDGEAKNHGYETSPTSHSSQVENPHTVSGKRL  264

Query  210  PNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
             NS++E    SE  + +Q AAKRVRKPTKRYI
Sbjct  265  GNSSVELDCGSEDLHTDQRAAKRVRKPTKRYI  296



>ref|XP_008351036.1| PREDICTED: uncharacterized protein LOC103414429 isoform X1 [Malus 
domestica]
Length=677

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPD + LKGEICL+NL+++ELHE F+ATFGR+T+VKDK WLKRRI+MGL+NSCD S T
Sbjct  213  SSKPDLNTLKGEICLDNLSIRELHELFRATFGRETTVKDKLWLKRRITMGLTNSCDVSTT  272

Query  384  SFVIEDSRVVKKVKEN-IASVNGSISKDPIVALPNINSGSS-SGHDDKVESPANITEGNI  211
            +F I D+ +VKK K++ I + +G +++       N    +S + H  +VE+P  ++   +
Sbjct  273  TFTIVDNNLVKKGKDDSIQNADGMLTEGSDGEAKNHGYETSPTSHSSQVENPHTVSGKRL  332

Query  210  PNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
             NS++E    SE  + +Q AAKRVRKPTKRYI
Sbjct  333  GNSSVELDCGSEDLHTDQRAAKRVRKPTKRYI  364



>ref|XP_010261948.1| PREDICTED: uncharacterized protein LOC104600603 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010261949.1| PREDICTED: uncharacterized protein LOC104600603 isoform X1 [Nelumbo 
nucifera]
Length=615

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 109/168 (65%), Gaps = 3/168 (2%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            +D    N   AS    S KPDFS LK EICL+NL++KELHETFKATFGR+TSVKDK WLK
Sbjct  199  TDGLLNNGSSASAHSTSSKPDFSILKEEICLDNLSIKELHETFKATFGRETSVKDKLWLK  258

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVV--KKVKENIASVNGSISKDPIVALPNINSGSSSG  259
            RRI+MGL+NSCD S T+F+I    +V  K  +EN  SV+ +++KD +V   N      S 
Sbjct  259  RRIAMGLTNSCDVSTTTFIIRGKTLVRNKVTEENSKSVDTTLTKDQVVVNDNCKD-LPSN  317

Query  258  HDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
              +++E    ++      S +E    SE  +ME+ AAKRVRKPT+RYI
Sbjct  318  PTNQMEDQGVLSGKIFGKSDVESGYKSEDIHMEERAAKRVRKPTRRYI  365



>ref|XP_009339885.1| PREDICTED: uncharacterized protein LOC103932042 isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009339892.1| PREDICTED: uncharacterized protein LOC103932042 isoform X3 [Pyrus 
x bretschneideri]
Length=615

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPD + LKGEICL+NL+++ELHE F+ATFGR+T+VKDK WLKRRI+MGL+NSCD S T
Sbjct  151  SSKPDVNTLKGEICLDNLSIRELHELFRATFGRETTVKDKLWLKRRITMGLTNSCDVSTT  210

Query  384  SFVIEDSRVVKKVKEN-IASVNGSISKDPIVALPNINSGSS-SGHDDKVESPANITEGNI  211
            +F I D+++VKK K++ I + +G +++       N    +S + H  ++E+   ++   +
Sbjct  211  TFTIIDNKLVKKGKDDSIQNADGMLAEGSDGEAKNHGYETSPTSHSSQMENHHTVSGKRL  270

Query  210  PNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
             NS++E    SE  + +Q AAKRVRKPTKRYI
Sbjct  271  GNSSVELDCGSEDLHTDQRAAKRVRKPTKRYI  302



>ref|XP_006426636.1| hypothetical protein CICLE_v10025094mg [Citrus clementina]
 gb|ESR39876.1| hypothetical protein CICLE_v10025094mg [Citrus clementina]
Length=604

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 105/168 (63%), Gaps = 5/168 (3%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            S+   E     S    S KPDFS+L GEICL+NL++KELHETFKATFGR+T+VKDKQWLK
Sbjct  146  SNGLVEGQRSTSAVCTSSKPDFSRLMGEICLDNLSIKELHETFKATFGRETTVKDKQWLK  205

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSG--SSSG  259
            RRI+MGL+NSCD S +SF+I+D+++V K  E   S N    +D  V  P   SG  SS  
Sbjct  206  RRIAMGLTNSCDVSTSSFIIKDNKLVSKGGE--GSCNKEAIEDQAVK-PVDGSGKESSLN  262

Query  258  HDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
               K+E    ++     N + +     E    EQ  AKR+RKPT+RYI
Sbjct  263  PGSKMEDQQIVSSERQRNCSKDYSCADEDPLKEQRNAKRIRKPTRRYI  310



>ref|XP_009339877.1| PREDICTED: uncharacterized protein LOC103932042 isoform X2 [Pyrus 
x bretschneideri]
Length=628

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPD + LKGEICL+NL+++ELHE F+ATFGR+T+VKDK WLKRRI+MGL+NSCD S T
Sbjct  164  SSKPDVNTLKGEICLDNLSIRELHELFRATFGRETTVKDKLWLKRRITMGLTNSCDVSTT  223

Query  384  SFVIEDSRVVKKVKEN-IASVNGSISKDPIVALPNINSGSS-SGHDDKVESPANITEGNI  211
            +F I D+++VKK K++ I + +G +++       N    +S + H  ++E+   ++   +
Sbjct  224  TFTIIDNKLVKKGKDDSIQNADGMLAEGSDGEAKNHGYETSPTSHSSQMENHHTVSGKRL  283

Query  210  PNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
             NS++E    SE  + +Q AAKRVRKPTKRYI
Sbjct  284  GNSSVELDCGSEDLHTDQRAAKRVRKPTKRYI  315



>ref|XP_009339863.1| PREDICTED: uncharacterized protein LOC103932042 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009339871.1| PREDICTED: uncharacterized protein LOC103932042 isoform X1 [Pyrus 
x bretschneideri]
Length=682

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPD + LKGEICL+NL+++ELHE F+ATFGR+T+VKDK WLKRRI+MGL+NSCD S T
Sbjct  218  SSKPDVNTLKGEICLDNLSIRELHELFRATFGRETTVKDKLWLKRRITMGLTNSCDVSTT  277

Query  384  SFVIEDSRVVKKVKEN-IASVNGSISKDPIVALPNINSGSS-SGHDDKVESPANITEGNI  211
            +F I D+++VKK K++ I + +G +++       N    +S + H  ++E+   ++   +
Sbjct  278  TFTIIDNKLVKKGKDDSIQNADGMLAEGSDGEAKNHGYETSPTSHSSQMENHHTVSGKRL  337

Query  210  PNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
             NS++E    SE  + +Q AAKRVRKPTKRYI
Sbjct  338  GNSSVELDCGSEDLHTDQRAAKRVRKPTKRYI  369



>ref|XP_006426634.1| hypothetical protein CICLE_v10025094mg [Citrus clementina]
 gb|ESR39874.1| hypothetical protein CICLE_v10025094mg [Citrus clementina]
Length=643

 Score =   139 bits (351),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 105/168 (63%), Gaps = 5/168 (3%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            S+   E     S    S KPDFS+L GEICL+NL++KELHETFKATFGR+T+VKDKQWLK
Sbjct  204  SNGLVEGQRSTSAVCTSSKPDFSRLMGEICLDNLSIKELHETFKATFGRETTVKDKQWLK  263

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSG--SSSG  259
            RRI+MGL+NSCD S +SF+I+D+++V K  E   S N    +D  V  P   SG  SS  
Sbjct  264  RRIAMGLTNSCDVSTSSFIIKDNKLVSKGGE--GSCNKEAIEDQAVK-PVDGSGKESSLN  320

Query  258  HDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
               K+E    ++     N + +     E    EQ  AKR+RKPT+RYI
Sbjct  321  PGSKMEDQQIVSSERQRNCSKDYSCADEDPLKEQRNAKRIRKPTRRYI  368



>gb|KDO65067.1| hypothetical protein CISIN_1g006062mg [Citrus sinensis]
Length=468

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 105/168 (63%), Gaps = 5/168 (3%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            S+   E     S    S KP+FS+L GEICL+NL++KELHETFKATFGR+T+VKDKQWLK
Sbjct  204  SNGLVEGQRSTSAVYTSSKPEFSRLMGEICLDNLSIKELHETFKATFGRETTVKDKQWLK  263

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSG--SSSG  259
            RRI+MGL+NSCD S +SF+I+D+++V K  E   S N    +D  V  P   SG  SS  
Sbjct  264  RRIAMGLTNSCDVSTSSFIIKDNKLVSKGGE--GSCNKEAIEDQAVK-PVDGSGKESSLN  320

Query  258  HDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
               K+E    ++   +   + +     E    EQ  AKR+RKPT+RYI
Sbjct  321  PGSKMEDQQIVSSERLRTCSKDYSCADEDPLKEQRNAKRIRKPTRRYI  368



>ref|XP_006426635.1| hypothetical protein CICLE_v10025094mg [Citrus clementina]
 gb|ESR39875.1| hypothetical protein CICLE_v10025094mg [Citrus clementina]
Length=662

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 105/168 (63%), Gaps = 5/168 (3%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            S+   E     S    S KPDFS+L GEICL+NL++KELHETFKATFGR+T+VKDKQWLK
Sbjct  204  SNGLVEGQRSTSAVCTSSKPDFSRLMGEICLDNLSIKELHETFKATFGRETTVKDKQWLK  263

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSG--SSSG  259
            RRI+MGL+NSCD S +SF+I+D+++V K  E   S N    +D  V  P   SG  SS  
Sbjct  264  RRIAMGLTNSCDVSTSSFIIKDNKLVSKGGE--GSCNKEAIEDQAVK-PVDGSGKESSLN  320

Query  258  HDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
               K+E    ++     N + +     E    EQ  AKR+RKPT+RYI
Sbjct  321  PGSKMEDQQIVSSERQRNCSKDYSCADEDPLKEQRNAKRIRKPTRRYI  368



>gb|KDO65066.1| hypothetical protein CISIN_1g006062mg [Citrus sinensis]
Length=499

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 105/168 (63%), Gaps = 5/168 (3%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            S+   E     S    S KP+FS+L GEICL+NL++KELHETFKATFGR+T+VKDKQWLK
Sbjct  204  SNGLVEGQRSTSAVYTSSKPEFSRLMGEICLDNLSIKELHETFKATFGRETTVKDKQWLK  263

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSG--SSSG  259
            RRI+MGL+NSCD S +SF+I+D+++V K  E   S N    +D  V  P   SG  SS  
Sbjct  264  RRIAMGLTNSCDVSTSSFIIKDNKLVSKGGE--GSCNKEAIEDQAVK-PVDGSGKESSLN  320

Query  258  HDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
               K+E    ++   +   + +     E    EQ  AKR+RKPT+RYI
Sbjct  321  PGSKMEDQQIVSSERLRTCSKDYSCADEDPLKEQRNAKRIRKPTRRYI  368



>gb|KDO65071.1| hypothetical protein CISIN_1g006062mg [Citrus sinensis]
 gb|KDO65072.1| hypothetical protein CISIN_1g006062mg [Citrus sinensis]
 gb|KDO65073.1| hypothetical protein CISIN_1g006062mg [Citrus sinensis]
Length=518

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 105/168 (63%), Gaps = 5/168 (3%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            S+   E     S    S KP+FS+L GEICL+NL++KELHETFKATFGR+T+VKDKQWLK
Sbjct  79   SNGLVEGQRSTSAVYTSSKPEFSRLMGEICLDNLSIKELHETFKATFGRETTVKDKQWLK  138

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSG--SSSG  259
            RRI+MGL+NSCD S +SF+I+D+++V K  E   S N    +D  V  P   SG  SS  
Sbjct  139  RRIAMGLTNSCDVSTSSFIIKDNKLVSKGGE--GSCNKEAIEDQAVK-PVDGSGKESSLN  195

Query  258  HDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
               K+E    ++   +   + +     E    EQ  AKR+RKPT+RYI
Sbjct  196  PGSKMEDQQIVSSERLRTCSKDYSCADEDPLKEQRNAKRIRKPTRRYI  243



>gb|KDO65065.1| hypothetical protein CISIN_1g006062mg [Citrus sinensis]
Length=523

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 105/168 (63%), Gaps = 5/168 (3%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            S+   E     S    S KP+FS+L GEICL+NL++KELHETFKATFGR+T+VKDKQWLK
Sbjct  204  SNGLVEGQRSTSAVYTSSKPEFSRLMGEICLDNLSIKELHETFKATFGRETTVKDKQWLK  263

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSG--SSSG  259
            RRI+MGL+NSCD S +SF+I+D+++V K  E   S N    +D  V  P   SG  SS  
Sbjct  264  RRIAMGLTNSCDVSTSSFIIKDNKLVSKGGE--GSCNKEAIEDQAVK-PVDGSGKESSLN  320

Query  258  HDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
               K+E    ++   +   + +     E    EQ  AKR+RKPT+RYI
Sbjct  321  PGSKMEDQQIVSSERLRTCSKDYSCADEDPLKEQRNAKRIRKPTRRYI  368



>gb|KDO65070.1| hypothetical protein CISIN_1g006062mg [Citrus sinensis]
Length=554

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 105/168 (63%), Gaps = 5/168 (3%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            S+   E     S    S KP+FS+L GEICL+NL++KELHETFKATFGR+T+VKDKQWLK
Sbjct  115  SNGLVEGQRSTSAVYTSSKPEFSRLMGEICLDNLSIKELHETFKATFGRETTVKDKQWLK  174

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSG--SSSG  259
            RRI+MGL+NSCD S +SF+I+D+++V K  E   S N    +D  V  P   SG  SS  
Sbjct  175  RRIAMGLTNSCDVSTSSFIIKDNKLVSKGGE--GSCNKEAIEDQAVK-PVDGSGKESSLN  231

Query  258  HDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
               K+E    ++   +   + +     E    EQ  AKR+RKPT+RYI
Sbjct  232  PGSKMEDQQIVSSERLRTCSKDYSCADEDPLKEQRNAKRIRKPTRRYI  279



>ref|XP_008786594.1| PREDICTED: uncharacterized protein LOC103704887 isoform X12 [Phoenix 
dactylifera]
Length=553

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 103/154 (67%), Gaps = 7/154 (5%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKG+ICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   ++FV
Sbjct  100  PDFSILKGDICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTSNFV  159

Query  375  IEDSRVV-KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEG-NIPNS  202
            ++D+++V K+VKE  + +  S +++  +    +   ++S   D   SP N TE   + + 
Sbjct  160  MKDNKIVLKEVKEEPSKLQKSKTEESTLPTDQVTDPTNSNFQDLPTSPTNQTEDQQVASK  219

Query  201  TLEGCIV-----SEGHNMEQTAAKRVRKPTKRYI  115
             L   +      +E   MEQ AAKRVRKPT+RYI
Sbjct  220  RLRKPLSEYDEKNENLQMEQFAAKRVRKPTRRYI  253



>ref|XP_008786595.1| PREDICTED: uncharacterized protein LOC103704887 isoform X13 [Phoenix 
dactylifera]
 ref|XP_008786596.1| PREDICTED: uncharacterized protein LOC103704887 isoform X13 [Phoenix 
dactylifera]
Length=551

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 103/154 (67%), Gaps = 7/154 (5%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKG+ICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   ++FV
Sbjct  98   PDFSILKGDICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTSNFV  157

Query  375  IEDSRVV-KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEG-NIPNS  202
            ++D+++V K+VKE  + +  S +++  +    +   ++S   D   SP N TE   + + 
Sbjct  158  MKDNKIVLKEVKEEPSKLQKSKTEESTLPTDQVTDPTNSNFQDLPTSPTNQTEDQQVASK  217

Query  201  TLEGCIV-----SEGHNMEQTAAKRVRKPTKRYI  115
             L   +      +E   MEQ AAKRVRKPT+RYI
Sbjct  218  RLRKPLSEYDEKNENLQMEQFAAKRVRKPTRRYI  251



>ref|XP_008786593.1| PREDICTED: uncharacterized protein LOC103704887 isoform X11 [Phoenix 
dactylifera]
Length=564

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 103/154 (67%), Gaps = 7/154 (5%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKG+ICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   ++FV
Sbjct  111  PDFSILKGDICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTSNFV  170

Query  375  IEDSRVV-KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEG-NIPNS  202
            ++D+++V K+VKE  + +  S +++  +    +   ++S   D   SP N TE   + + 
Sbjct  171  MKDNKIVLKEVKEEPSKLQKSKTEESTLPTDQVTDPTNSNFQDLPTSPTNQTEDQQVASK  230

Query  201  TLEGCIV-----SEGHNMEQTAAKRVRKPTKRYI  115
             L   +      +E   MEQ AAKRVRKPT+RYI
Sbjct  231  RLRKPLSEYDEKNENLQMEQFAAKRVRKPTRRYI  264



>ref|XP_008786591.1| PREDICTED: uncharacterized protein LOC103704887 isoform X10 [Phoenix 
dactylifera]
 ref|XP_008786592.1| PREDICTED: uncharacterized protein LOC103704887 isoform X10 [Phoenix 
dactylifera]
Length=579

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 103/154 (67%), Gaps = 7/154 (5%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKG+ICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   ++FV
Sbjct  126  PDFSILKGDICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTSNFV  185

Query  375  IEDSRVV-KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEG-NIPNS  202
            ++D+++V K+VKE  + +  S +++  +    +   ++S   D   SP N TE   + + 
Sbjct  186  MKDNKIVLKEVKEEPSKLQKSKTEESTLPTDQVTDPTNSNFQDLPTSPTNQTEDQQVASK  245

Query  201  TLEGCIV-----SEGHNMEQTAAKRVRKPTKRYI  115
             L   +      +E   MEQ AAKRVRKPT+RYI
Sbjct  246  RLRKPLSEYDEKNENLQMEQFAAKRVRKPTRRYI  279



>gb|KDO65068.1| hypothetical protein CISIN_1g006062mg [Citrus sinensis]
 gb|KDO65069.1| hypothetical protein CISIN_1g006062mg [Citrus sinensis]
Length=585

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 105/168 (63%), Gaps = 5/168 (3%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            S+   E     S    S KP+FS+L GEICL+NL++KELHETFKATFGR+T+VKDKQWLK
Sbjct  146  SNGLVEGQRSTSAVYTSSKPEFSRLMGEICLDNLSIKELHETFKATFGRETTVKDKQWLK  205

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSG--SSSG  259
            RRI+MGL+NSCD S +SF+I+D+++V K  E   S N    +D  V  P   SG  SS  
Sbjct  206  RRIAMGLTNSCDVSTSSFIIKDNKLVSKGGE--GSCNKEAIEDQAVK-PVDGSGKESSLN  262

Query  258  HDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
               K+E    ++   +   + +     E    EQ  AKR+RKPT+RYI
Sbjct  263  PGSKMEDQQIVSSERLRTCSKDYSCADEDPLKEQRNAKRIRKPTRRYI  310



>gb|KDO65064.1| hypothetical protein CISIN_1g006062mg [Citrus sinensis]
Length=586

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 105/168 (63%), Gaps = 5/168 (3%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            S+   E     S    S KP+FS+L GEICL+NL++KELHETFKATFGR+T+VKDKQWLK
Sbjct  204  SNGLVEGQRSTSAVYTSSKPEFSRLMGEICLDNLSIKELHETFKATFGRETTVKDKQWLK  263

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSG--SSSG  259
            RRI+MGL+NSCD S +SF+I+D+++V K  E   S N    +D  V  P   SG  SS  
Sbjct  264  RRIAMGLTNSCDVSTSSFIIKDNKLVSKGGE--GSCNKEAIEDQAVK-PVDGSGKESSLN  320

Query  258  HDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
               K+E    ++   +   + +     E    EQ  AKR+RKPT+RYI
Sbjct  321  PGSKMEDQQIVSSERLRTCSKDYSCADEDPLKEQRNAKRIRKPTRRYI  368



>ref|XP_008786590.1| PREDICTED: uncharacterized protein LOC103704887 isoform X9 [Phoenix 
dactylifera]
Length=615

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 103/154 (67%), Gaps = 7/154 (5%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKG+ICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   ++FV
Sbjct  162  PDFSILKGDICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTSNFV  221

Query  375  IEDSRVV-KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEG-NIPNS  202
            ++D+++V K+VKE  + +  S +++  +    +   ++S   D   SP N TE   + + 
Sbjct  222  MKDNKIVLKEVKEEPSKLQKSKTEESTLPTDQVTDPTNSNFQDLPTSPTNQTEDQQVASK  281

Query  201  TLEGCIV-----SEGHNMEQTAAKRVRKPTKRYI  115
             L   +      +E   MEQ AAKRVRKPT+RYI
Sbjct  282  RLRKPLSEYDEKNENLQMEQFAAKRVRKPTRRYI  315



>gb|KDO65063.1| hypothetical protein CISIN_1g006062mg [Citrus sinensis]
Length=643

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 105/168 (63%), Gaps = 5/168 (3%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            S+   E     S    S KP+FS+L GEICL+NL++KELHETFKATFGR+T+VKDKQWLK
Sbjct  204  SNGLVEGQRSTSAVYTSSKPEFSRLMGEICLDNLSIKELHETFKATFGRETTVKDKQWLK  263

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSG--SSSG  259
            RRI+MGL+NSCD S +SF+I+D+++V K  E   S N    +D  V  P   SG  SS  
Sbjct  264  RRIAMGLTNSCDVSTSSFIIKDNKLVSKGGE--GSCNKEAIEDQAVK-PVDGSGKESSLN  320

Query  258  HDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
               K+E    ++   +   + +     E    EQ  AKR+RKPT+RYI
Sbjct  321  PGSKMEDQQIVSSERLRTCSKDYSCADEDPLKEQRNAKRIRKPTRRYI  368



>ref|XP_008786589.1| PREDICTED: uncharacterized protein LOC103704887 isoform X8 [Phoenix 
dactylifera]
Length=631

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 103/154 (67%), Gaps = 7/154 (5%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKG+ICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   ++FV
Sbjct  178  PDFSILKGDICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTSNFV  237

Query  375  IEDSRVV-KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEG-NIPNS  202
            ++D+++V K+VKE  + +  S +++  +    +   ++S   D   SP N TE   + + 
Sbjct  238  MKDNKIVLKEVKEEPSKLQKSKTEESTLPTDQVTDPTNSNFQDLPTSPTNQTEDQQVASK  297

Query  201  TLEGCIV-----SEGHNMEQTAAKRVRKPTKRYI  115
             L   +      +E   MEQ AAKRVRKPT+RYI
Sbjct  298  RLRKPLSEYDEKNENLQMEQFAAKRVRKPTRRYI  331



>ref|XP_006465936.1| PREDICTED: uncharacterized protein LOC102630482 isoform X4 [Citrus 
sinensis]
Length=643

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 105/168 (63%), Gaps = 5/168 (3%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            S+   E     S    S KP+FS+L GEICL+NL++KELHETFKATFGR+T+VKDKQWLK
Sbjct  204  SNGLVEGQQSTSAVYTSSKPEFSRLMGEICLDNLSIKELHETFKATFGRETTVKDKQWLK  263

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSG--SSSG  259
            RRI+MGL+NSCD S +SF+I+D+++V K  E   S N    +D  V  P   SG  SS  
Sbjct  264  RRIAMGLTNSCDVSTSSFIIKDNKLVSKGGE--GSCNKEAIEDQAVK-PVDGSGKESSLN  320

Query  258  HDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
               K+E    ++   +   + +     E    EQ  AKR+RKPT+RYI
Sbjct  321  PGSKMEDQQIVSSERLRTCSKDYSCADEDPLKEQRNAKRIRKPTRRYI  368



>ref|XP_008786587.1| PREDICTED: uncharacterized protein LOC103704887 isoform X6 [Phoenix 
dactylifera]
Length=650

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 103/154 (67%), Gaps = 7/154 (5%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKG+ICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   ++FV
Sbjct  241  PDFSILKGDICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTSNFV  300

Query  375  IEDSRVV-KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEG-NIPNS  202
            ++D+++V K+VKE  + +  S +++  +    +   ++S   D   SP N TE   + + 
Sbjct  301  MKDNKIVLKEVKEEPSKLQKSKTEESTLPTDQVTDPTNSNFQDLPTSPTNQTEDQQVASK  360

Query  201  TLEGCIV-----SEGHNMEQTAAKRVRKPTKRYI  115
             L   +      +E   MEQ AAKRVRKPT+RYI
Sbjct  361  RLRKPLSEYDEKNENLQMEQFAAKRVRKPTRRYI  394



>ref|XP_008786588.1| PREDICTED: uncharacterized protein LOC103704887 isoform X7 [Phoenix 
dactylifera]
Length=643

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 103/154 (67%), Gaps = 7/154 (5%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKG+ICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   ++FV
Sbjct  241  PDFSILKGDICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTSNFV  300

Query  375  IEDSRVV-KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEG-NIPNS  202
            ++D+++V K+VKE  + +  S +++  +    +   ++S   D   SP N TE   + + 
Sbjct  301  MKDNKIVLKEVKEEPSKLQKSKTEESTLPTDQVTDPTNSNFQDLPTSPTNQTEDQQVASK  360

Query  201  TLEGCIV-----SEGHNMEQTAAKRVRKPTKRYI  115
             L   +      +E   MEQ AAKRVRKPT+RYI
Sbjct  361  RLRKPLSEYDEKNENLQMEQFAAKRVRKPTRRYI  394



>ref|XP_008786586.1| PREDICTED: uncharacterized protein LOC103704887 isoform X5 [Phoenix 
dactylifera]
Length=661

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 103/154 (67%), Gaps = 7/154 (5%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKG+ICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   ++FV
Sbjct  208  PDFSILKGDICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTSNFV  267

Query  375  IEDSRVV-KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEG-NIPNS  202
            ++D+++V K+VKE  + +  S +++  +    +   ++S   D   SP N TE   + + 
Sbjct  268  MKDNKIVLKEVKEEPSKLQKSKTEESTLPTDQVTDPTNSNFQDLPTSPTNQTEDQQVASK  327

Query  201  TLEGCIV-----SEGHNMEQTAAKRVRKPTKRYI  115
             L   +      +E   MEQ AAKRVRKPT+RYI
Sbjct  328  RLRKPLSEYDEKNENLQMEQFAAKRVRKPTRRYI  361



>gb|KDO65062.1| hypothetical protein CISIN_1g006062mg [Citrus sinensis]
Length=662

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 105/168 (63%), Gaps = 5/168 (3%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            S+   E     S    S KP+FS+L GEICL+NL++KELHETFKATFGR+T+VKDKQWLK
Sbjct  204  SNGLVEGQRSTSAVYTSSKPEFSRLMGEICLDNLSIKELHETFKATFGRETTVKDKQWLK  263

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSG--SSSG  259
            RRI+MGL+NSCD S +SF+I+D+++V K  E   S N    +D  V  P   SG  SS  
Sbjct  264  RRIAMGLTNSCDVSTSSFIIKDNKLVSKGGE--GSCNKEAIEDQAVK-PVDGSGKESSLN  320

Query  258  HDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
               K+E    ++   +   + +     E    EQ  AKR+RKPT+RYI
Sbjct  321  PGSKMEDQQIVSSERLRTCSKDYSCADEDPLKEQRNAKRIRKPTRRYI  368



>ref|XP_006465933.1| PREDICTED: uncharacterized protein LOC102630482 isoform X1 [Citrus 
sinensis]
 ref|XP_006465934.1| PREDICTED: uncharacterized protein LOC102630482 isoform X2 [Citrus 
sinensis]
 ref|XP_006465935.1| PREDICTED: uncharacterized protein LOC102630482 isoform X3 [Citrus 
sinensis]
Length=662

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 105/168 (63%), Gaps = 5/168 (3%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            S+   E     S    S KP+FS+L GEICL+NL++KELHETFKATFGR+T+VKDKQWLK
Sbjct  204  SNGLVEGQQSTSAVYTSSKPEFSRLMGEICLDNLSIKELHETFKATFGRETTVKDKQWLK  263

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSG--SSSG  259
            RRI+MGL+NSCD S +SF+I+D+++V K  E   S N    +D  V  P   SG  SS  
Sbjct  264  RRIAMGLTNSCDVSTSSFIIKDNKLVSKGGE--GSCNKEAIEDQAVK-PVDGSGKESSLN  320

Query  258  HDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
               K+E    ++   +   + +     E    EQ  AKR+RKPT+RYI
Sbjct  321  PGSKMEDQQIVSSERLRTCSKDYSCADEDPLKEQRNAKRIRKPTRRYI  368



>ref|XP_008786585.1| PREDICTED: uncharacterized protein LOC103704887 isoform X4 [Phoenix 
dactylifera]
Length=682

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 103/154 (67%), Gaps = 7/154 (5%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKG+ICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   ++FV
Sbjct  229  PDFSILKGDICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTSNFV  288

Query  375  IEDSRVV-KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEG-NIPNS  202
            ++D+++V K+VKE  + +  S +++  +    +   ++S   D   SP N TE   + + 
Sbjct  289  MKDNKIVLKEVKEEPSKLQKSKTEESTLPTDQVTDPTNSNFQDLPTSPTNQTEDQQVASK  348

Query  201  TLEGCIV-----SEGHNMEQTAAKRVRKPTKRYI  115
             L   +      +E   MEQ AAKRVRKPT+RYI
Sbjct  349  RLRKPLSEYDEKNENLQMEQFAAKRVRKPTRRYI  382



>ref|XP_008786584.1| PREDICTED: uncharacterized protein LOC103704887 isoform X3 [Phoenix 
dactylifera]
Length=687

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 103/154 (67%), Gaps = 7/154 (5%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKG+ICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   ++FV
Sbjct  241  PDFSILKGDICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTSNFV  300

Query  375  IEDSRVV-KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEG-NIPNS  202
            ++D+++V K+VKE  + +  S +++  +    +   ++S   D   SP N TE   + + 
Sbjct  301  MKDNKIVLKEVKEEPSKLQKSKTEESTLPTDQVTDPTNSNFQDLPTSPTNQTEDQQVASK  360

Query  201  TLEGCIV-----SEGHNMEQTAAKRVRKPTKRYI  115
             L   +      +E   MEQ AAKRVRKPT+RYI
Sbjct  361  RLRKPLSEYDEKNENLQMEQFAAKRVRKPTRRYI  394



>ref|XP_008786580.1| PREDICTED: uncharacterized protein LOC103704887 isoform X1 [Phoenix 
dactylifera]
Length=694

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 103/154 (67%), Gaps = 7/154 (5%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKG+ICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   ++FV
Sbjct  241  PDFSILKGDICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTSNFV  300

Query  375  IEDSRVV-KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEG-NIPNS  202
            ++D+++V K+VKE  + +  S +++  +    +   ++S   D   SP N TE   + + 
Sbjct  301  MKDNKIVLKEVKEEPSKLQKSKTEESTLPTDQVTDPTNSNFQDLPTSPTNQTEDQQVASK  360

Query  201  TLEGCIV-----SEGHNMEQTAAKRVRKPTKRYI  115
             L   +      +E   MEQ AAKRVRKPT+RYI
Sbjct  361  RLRKPLSEYDEKNENLQMEQFAAKRVRKPTRRYI  394



>ref|XP_008786581.1| PREDICTED: uncharacterized protein LOC103704887 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008786582.1| PREDICTED: uncharacterized protein LOC103704887 isoform X2 [Phoenix 
dactylifera]
Length=689

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 103/154 (67%), Gaps = 7/154 (5%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKG+ICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   ++FV
Sbjct  236  PDFSILKGDICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTSNFV  295

Query  375  IEDSRVV-KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEG-NIPNS  202
            ++D+++V K+VKE  + +  S +++  +    +   ++S   D   SP N TE   + + 
Sbjct  296  MKDNKIVLKEVKEEPSKLQKSKTEESTLPTDQVTDPTNSNFQDLPTSPTNQTEDQQVASK  355

Query  201  TLEGCIV-----SEGHNMEQTAAKRVRKPTKRYI  115
             L   +      +E   MEQ AAKRVRKPT+RYI
Sbjct  356  RLRKPLSEYDEKNENLQMEQFAAKRVRKPTRRYI  389



>ref|XP_007135460.1| hypothetical protein PHAVU_010G131400g [Phaseolus vulgaris]
 gb|ESW07454.1| hypothetical protein PHAVU_010G131400g [Phaseolus vulgaris]
Length=658

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 112/174 (64%), Gaps = 12/174 (7%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            S+   E+   AS   ++ KPD S   GEICL+ L+++ELHE FK TFGR+T+VKDKQWLK
Sbjct  195  SEGVIESGSSASAIHSNLKPDLSMSDGEICLDKLSIRELHELFKVTFGRETTVKDKQWLK  254

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVVKK-VKENIASVNGS--ISKDPIVALPNINSGSSS  262
            RRI+M L+NSCD S T+F+I+D+++V+K V+E+  ++N S  IS + +    +IN   SS
Sbjct  255  RRIAMSLTNSCDVSATNFIIKDNQIVRKFVEESSGNMNISSLISSENMTEEEDINLKDSS  314

Query  261  -----GHDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
                 G DD       I+E  + N   E  +  E +  EQ AAKR+R+PTKRYI
Sbjct  315  AVNACGIDDN----QVISEIRLRNQNTEYGLEDENNETEQRAAKRIRRPTKRYI  364



>ref|XP_007135461.1| hypothetical protein PHAVU_010G131400g [Phaseolus vulgaris]
 gb|ESW07455.1| hypothetical protein PHAVU_010G131400g [Phaseolus vulgaris]
Length=654

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 112/174 (64%), Gaps = 12/174 (7%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            S+   E+   AS   ++ KPD S   GEICL+ L+++ELHE FK TFGR+T+VKDKQWLK
Sbjct  191  SEGVIESGSSASAIHSNLKPDLSMSDGEICLDKLSIRELHELFKVTFGRETTVKDKQWLK  250

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVVKK-VKENIASVNGS--ISKDPIVALPNINSGSSS  262
            RRI+M L+NSCD S T+F+I+D+++V+K V+E+  ++N S  IS + +    +IN   SS
Sbjct  251  RRIAMSLTNSCDVSATNFIIKDNQIVRKFVEESSGNMNISSLISSENMTEEEDINLKDSS  310

Query  261  -----GHDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
                 G DD       I+E  + N   E  +  E +  EQ AAKR+R+PTKRYI
Sbjct  311  AVNACGIDDN----QVISEIRLRNQNTEYGLEDENNETEQRAAKRIRRPTKRYI  360



>ref|XP_008784290.1| PREDICTED: uncharacterized protein LOC103703273 isoform X9 [Phoenix 
dactylifera]
 ref|XP_008784291.1| PREDICTED: uncharacterized protein LOC103703273 isoform X9 [Phoenix 
dactylifera]
Length=543

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 102/158 (65%), Gaps = 9/158 (6%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPDFS LKGEICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   T
Sbjct  94   SSKPDFSILKGEICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTT  153

Query  384  SFVIEDSRVV-KKVKENIASVN------GSISKDPIV-ALPNINSGSSSGHDDKVESPAN  229
            SFVI+D++VV K++KE  + +       GS+S D +  A  N +    S   D+ E    
Sbjct  154  SFVIKDNKVVHKEMKEEPSRLQKSQTEAGSMSTDQVTDATINNSQTLPSSPTDRTED-LQ  212

Query  228  ITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            ++   +     E    +E   MEQ A KRVRKPT+RYI
Sbjct  213  VSGKRLRKPFCEYDEKNENLQMEQFAGKRVRKPTRRYI  250



>ref|XP_008784289.1| PREDICTED: uncharacterized protein LOC103703273 isoform X8 [Phoenix 
dactylifera]
Length=576

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 102/158 (65%), Gaps = 9/158 (6%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPDFS LKGEICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   T
Sbjct  127  SSKPDFSILKGEICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTT  186

Query  384  SFVIEDSRVV-KKVKENIASVN------GSISKDPIV-ALPNINSGSSSGHDDKVESPAN  229
            SFVI+D++VV K++KE  + +       GS+S D +  A  N +    S   D+ E    
Sbjct  187  SFVIKDNKVVHKEMKEEPSRLQKSQTEAGSMSTDQVTDATINNSQTLPSSPTDRTED-LQ  245

Query  228  ITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            ++   +     E    +E   MEQ A KRVRKPT+RYI
Sbjct  246  VSGKRLRKPFCEYDEKNENLQMEQFAGKRVRKPTRRYI  283



>ref|XP_008784288.1| PREDICTED: uncharacterized protein LOC103703273 isoform X7 [Phoenix 
dactylifera]
Length=581

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 102/158 (65%), Gaps = 9/158 (6%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPDFS LKGEICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   T
Sbjct  132  SSKPDFSILKGEICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTT  191

Query  384  SFVIEDSRVV-KKVKENIASVN------GSISKDPIV-ALPNINSGSSSGHDDKVESPAN  229
            SFVI+D++VV K++KE  + +       GS+S D +  A  N +    S   D+ E    
Sbjct  192  SFVIKDNKVVHKEMKEEPSRLQKSQTEAGSMSTDQVTDATINNSQTLPSSPTDRTED-LQ  250

Query  228  ITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            ++   +     E    +E   MEQ A KRVRKPT+RYI
Sbjct  251  VSGKRLRKPFCEYDEKNENLQMEQFAGKRVRKPTRRYI  288



>ref|XP_008784287.1| PREDICTED: uncharacterized protein LOC103703273 isoform X6 [Phoenix 
dactylifera]
Length=596

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 102/158 (65%), Gaps = 9/158 (6%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPDFS LKGEICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   T
Sbjct  147  SSKPDFSILKGEICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTT  206

Query  384  SFVIEDSRVV-KKVKENIASVN------GSISKDPIV-ALPNINSGSSSGHDDKVESPAN  229
            SFVI+D++VV K++KE  + +       GS+S D +  A  N +    S   D+ E    
Sbjct  207  SFVIKDNKVVHKEMKEEPSRLQKSQTEAGSMSTDQVTDATINNSQTLPSSPTDRTED-LQ  265

Query  228  ITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            ++   +     E    +E   MEQ A KRVRKPT+RYI
Sbjct  266  VSGKRLRKPFCEYDEKNENLQMEQFAGKRVRKPTRRYI  303



>gb|KCW53548.1| hypothetical protein EUGRSUZ_J02823 [Eucalyptus grandis]
Length=440

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/184 (47%), Positives = 125/184 (68%), Gaps = 2/184 (1%)
 Frame = -2

Query  582  ASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS  403
            +S A  S  PDFSKLKGEICL+NL+++ELH+TF+ATFGR T+ KDK WLKRRI+MGL+NS
Sbjct  155  SSCAATSLLPDFSKLKGEICLDNLSIRELHDTFRATFGRVTTAKDKTWLKRRIAMGLTNS  214

Query  402  CDFSCTSFVIEDSRVVK-KVKENIASVNGSISKDP-IVALPNINSGSSSGHDDKVESPAN  229
            CD   TSFVI++++++K   +EN  +VN ++  D  +VA+ + ++ S +    ++E    
Sbjct  215  CDVPSTSFVIKENQILKLGEEENSNNVNCAVETDQDVVAINDQHTDSDNSQKKQLEDCQI  274

Query  228  ITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesressgksmssEKIC  49
            I+   + N         E  + EQ + KR+RKPT+RYIEE+SEVE  E +G+S+   K C
Sbjct  275  ISGKRLRNYGPIEDSQPEVLSREQKSVKRLRKPTRRYIEEVSEVEHHEPTGRSVIPAKSC  334

Query  48   GYKS  37
            G+ S
Sbjct  335  GWDS  338



>ref|XP_008784286.1| PREDICTED: uncharacterized protein LOC103703273 isoform X5 [Phoenix 
dactylifera]
Length=613

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 102/158 (65%), Gaps = 9/158 (6%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPDFS LKGEICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   T
Sbjct  208  SSKPDFSILKGEICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTT  267

Query  384  SFVIEDSRVV-KKVKENIASVN------GSISKDPIV-ALPNINSGSSSGHDDKVESPAN  229
            SFVI+D++VV K++KE  + +       GS+S D +  A  N +    S   D+ E    
Sbjct  268  SFVIKDNKVVHKEMKEEPSRLQKSQTEAGSMSTDQVTDATINNSQTLPSSPTDRTED-LQ  326

Query  228  ITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            ++   +     E    +E   MEQ A KRVRKPT+RYI
Sbjct  327  VSGKRLRKPFCEYDEKNENLQMEQFAGKRVRKPTRRYI  364



>ref|XP_008784285.1| PREDICTED: uncharacterized protein LOC103703273 isoform X4 [Phoenix 
dactylifera]
Length=639

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 102/158 (65%), Gaps = 9/158 (6%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPDFS LKGEICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   T
Sbjct  190  SSKPDFSILKGEICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTT  249

Query  384  SFVIEDSRVV-KKVKENIASVN------GSISKDPIV-ALPNINSGSSSGHDDKVESPAN  229
            SFVI+D++VV K++KE  + +       GS+S D +  A  N +    S   D+ E    
Sbjct  250  SFVIKDNKVVHKEMKEEPSRLQKSQTEAGSMSTDQVTDATINNSQTLPSSPTDRTED-LQ  308

Query  228  ITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            ++   +     E    +E   MEQ A KRVRKPT+RYI
Sbjct  309  VSGKRLRKPFCEYDEKNENLQMEQFAGKRVRKPTRRYI  346



>ref|XP_008784279.1| PREDICTED: uncharacterized protein LOC103703273 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008784280.1| PREDICTED: uncharacterized protein LOC103703273 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008784282.1| PREDICTED: uncharacterized protein LOC103703273 isoform X1 [Phoenix 
dactylifera]
Length=657

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 102/158 (65%), Gaps = 9/158 (6%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPDFS LKGEICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   T
Sbjct  208  SSKPDFSILKGEICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTT  267

Query  384  SFVIEDSRVV-KKVKENIASVN------GSISKDPIV-ALPNINSGSSSGHDDKVESPAN  229
            SFVI+D++VV K++KE  + +       GS+S D +  A  N +    S   D+ E    
Sbjct  268  SFVIKDNKVVHKEMKEEPSRLQKSQTEAGSMSTDQVTDATINNSQTLPSSPTDRTED-LQ  326

Query  228  ITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            ++   +     E    +E   MEQ A KRVRKPT+RYI
Sbjct  327  VSGKRLRKPFCEYDEKNENLQMEQFAGKRVRKPTRRYI  364



>ref|XP_008784283.1| PREDICTED: uncharacterized protein LOC103703273 isoform X2 [Phoenix 
dactylifera]
Length=650

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 102/158 (65%), Gaps = 9/158 (6%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPDFS LKGEICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   T
Sbjct  201  SSKPDFSILKGEICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTT  260

Query  384  SFVIEDSRVV-KKVKENIASVN------GSISKDPIV-ALPNINSGSSSGHDDKVESPAN  229
            SFVI+D++VV K++KE  + +       GS+S D +  A  N +    S   D+ E    
Sbjct  261  SFVIKDNKVVHKEMKEEPSRLQKSQTEAGSMSTDQVTDATINNSQTLPSSPTDRTED-LQ  319

Query  228  ITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            ++   +     E    +E   MEQ A KRVRKPT+RYI
Sbjct  320  VSGKRLRKPFCEYDEKNENLQMEQFAGKRVRKPTRRYI  357



>ref|XP_008784284.1| PREDICTED: uncharacterized protein LOC103703273 isoform X3 [Phoenix 
dactylifera]
Length=646

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 102/158 (65%), Gaps = 9/158 (6%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPDFS LKGEICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   T
Sbjct  197  SSKPDFSILKGEICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTT  256

Query  384  SFVIEDSRVV-KKVKENIASVN------GSISKDPIV-ALPNINSGSSSGHDDKVESPAN  229
            SFVI+D++VV K++KE  + +       GS+S D +  A  N +    S   D+ E    
Sbjct  257  SFVIKDNKVVHKEMKEEPSRLQKSQTEAGSMSTDQVTDATINNSQTLPSSPTDRTED-LQ  315

Query  228  ITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            ++   +     E    +E   MEQ A KRVRKPT+RYI
Sbjct  316  VSGKRLRKPFCEYDEKNENLQMEQFAGKRVRKPTRRYI  353



>ref|XP_010033746.1| PREDICTED: uncharacterized protein LOC104422992 isoform X2 [Eucalyptus 
grandis]
 gb|KCW53547.1| hypothetical protein EUGRSUZ_J02823 [Eucalyptus grandis]
Length=556

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 123/181 (68%), Gaps = 2/181 (1%)
 Frame = -2

Query  573  AGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDF  394
            A  S  PDFSKLKGEICL+NL+++ELH+TF+ATFGR T+ KDK WLKRRI+MGL+NSCD 
Sbjct  158  AATSLLPDFSKLKGEICLDNLSIRELHDTFRATFGRVTTAKDKTWLKRRIAMGLTNSCDV  217

Query  393  SCTSFVIEDSRVVK-KVKENIASVNGSISKDP-IVALPNINSGSSSGHDDKVESPANITE  220
              TSFVI++++++K   +EN  +VN ++  D  +VA+ + ++ S +    ++E    I+ 
Sbjct  218  PSTSFVIKENQILKLGEEENSNNVNCAVETDQDVVAINDQHTDSDNSQKKQLEDCQIISG  277

Query  219  GNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesressgksmssEKICGYK  40
              + N         E  + EQ + KR+RKPT+RYIEE+SEVE  E +G+S+   K CG+ 
Sbjct  278  KRLRNYGPIEDSQPEVLSREQKSVKRLRKPTRRYIEEVSEVEHHEPTGRSVIPAKSCGWD  337

Query  39   S  37
            S
Sbjct  338  S  338



>ref|XP_009372358.1| PREDICTED: uncharacterized protein LOC103961527 isoform X4 [Pyrus 
x bretschneideri]
Length=710

 Score =   135 bits (339),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 121/179 (68%), Gaps = 2/179 (1%)
 Frame = -2

Query  558  KPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSF  379
            KPD + LKGEICL+NL+++ELHE F+ATFGR+T+VKDK WLKRRI+M L+NSCD S T+F
Sbjct  222  KPDVNTLKGEICLDNLSIRELHELFRATFGRETTVKDKLWLKRRITMALTNSCDVSTTTF  281

Query  378  VIEDSRVVKKVKEN-IASVNGSISKDPIVALPNINSGSS-SGHDDKVESPANITEGNIPN  205
             I D+++V K K++ I + +G +++       N+   +S + H  K+E+   ++     N
Sbjct  282  TIVDNKLVNKGKDDSIQNADGMLTEGSDGEAKNLGYETSPTSHSSKMENHVTVSGKRFVN  341

Query  204  STLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesressgksmssEKICGYKSTHP  28
             + E    SE  + +Q AAKR+RKPTKRYIEELSEVES++ S K  S  K  G + T P
Sbjct  342  ISAELDCGSEDLHTDQRAAKRIRKPTKRYIEELSEVESKDCSPKVTSPVKSAGQRQTSP  400



>ref|XP_010932444.1| PREDICTED: uncharacterized protein LOC105053107 isoform X4 [Elaeis 
guineensis]
Length=623

 Score =   134 bits (336),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 101/158 (64%), Gaps = 9/158 (6%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPDFS LK EICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   T
Sbjct  174  SSKPDFSILKREICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRIAMGLTNSCDVPTT  233

Query  384  SFVIEDS-RVVKKVKENIASVN------GSISKDPIVALPNINSGS-SSGHDDKVESPAN  229
            S+VI+D+ RV K++KE  + +       GS+S DP+  L   NS +  S   D+ E    
Sbjct  234  SYVIKDNKRVHKEMKEEPSRLQKSQTEAGSLSMDPVNDLTINNSQNLPSSPTDQTED-QQ  292

Query  228  ITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            +    +     E    +E   MEQ A KRVRKPT+RYI
Sbjct  293  VYSKRLRKPLCEDDEKNENLQMEQFAGKRVRKPTRRYI  330



>ref|XP_004510445.1| PREDICTED: uncharacterized protein LOC101500283 isoform X4 [Cicer 
arietinum]
Length=640

 Score =   134 bits (336),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 126/199 (63%), Gaps = 8/199 (4%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            S+   E+   AS   ++ K +FS  +GEICL+ L++KELHE FK TFGR+T+VKDKQWLK
Sbjct  194  SEGVIESGSSASDVYSTSKHNFSMPEGEICLDKLSIKELHELFKVTFGRETTVKDKQWLK  253

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHD  253
            RRI+M L+NSCD S T+F ++D+++ +K +E  +   G+ S   ++++ N+        D
Sbjct  254  RRIAMSLTNSCDVSATTFTVKDNKITRKCEEECS---GNASAAAVISVKNMAGEGCGIED  310

Query  252  DKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesressgk  73
            ++V S     E  + N  +E  +  E    E+ AAKR+RKPTKRYIEELSE ESRE   +
Sbjct  311  NQVAS-----ETRLKNLNVENELRDEDQQREERAAKRIRKPTKRYIEELSENESREHIPR  365

Query  72   smssEKICGYKSTHPSNHV  16
            S SS K  G+    P+ +V
Sbjct  366  SSSSNKNIGHGHVSPTAYV  384



>ref|XP_010033745.1| PREDICTED: uncharacterized protein LOC104422992 isoform X1 [Eucalyptus 
grandis]
 gb|KCW53546.1| hypothetical protein EUGRSUZ_J02823 [Eucalyptus grandis]
Length=586

 Score =   133 bits (335),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 123/181 (68%), Gaps = 2/181 (1%)
 Frame = -2

Query  573  AGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDF  394
            A  S  PDFSKLKGEICL+NL+++ELH+TF+ATFGR T+ KDK WLKRRI+MGL+NSCD 
Sbjct  158  AATSLLPDFSKLKGEICLDNLSIRELHDTFRATFGRVTTAKDKTWLKRRIAMGLTNSCDV  217

Query  393  SCTSFVIEDSRVVK-KVKENIASVNGSISKDP-IVALPNINSGSSSGHDDKVESPANITE  220
              TSFVI++++++K   +EN  +VN ++  D  +VA+ + ++ S +    ++E    I+ 
Sbjct  218  PSTSFVIKENQILKLGEEENSNNVNCAVETDQDVVAINDQHTDSDNSQKKQLEDCQIISG  277

Query  219  GNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesressgksmssEKICGYK  40
              + N         E  + EQ + KR+RKPT+RYIEE+SEVE  E +G+S+   K CG+ 
Sbjct  278  KRLRNYGPIEDSQPEVLSREQKSVKRLRKPTRRYIEEVSEVEHHEPTGRSVIPAKSCGWD  337

Query  39   S  37
            S
Sbjct  338  S  338



>ref|XP_004510447.1| PREDICTED: uncharacterized protein LOC101500283 isoform X6 [Cicer 
arietinum]
Length=636

 Score =   134 bits (336),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 126/199 (63%), Gaps = 8/199 (4%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            S+   E+   AS   ++ K +FS  +GEICL+ L++KELHE FK TFGR+T+VKDKQWLK
Sbjct  190  SEGVIESGSSASDVYSTSKHNFSMPEGEICLDKLSIKELHELFKVTFGRETTVKDKQWLK  249

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHD  253
            RRI+M L+NSCD S T+F ++D+++ +K +E  +   G+ S   ++++ N+        D
Sbjct  250  RRIAMSLTNSCDVSATTFTVKDNKITRKCEEECS---GNASAAAVISVKNMAGEGCGIED  306

Query  252  DKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesressgk  73
            ++V S     E  + N  +E  +  E    E+ AAKR+RKPTKRYIEELSE ESRE   +
Sbjct  307  NQVAS-----ETRLKNLNVENELRDEDQQREERAAKRIRKPTKRYIEELSENESREHIPR  361

Query  72   smssEKICGYKSTHPSNHV  16
            S SS K  G+    P+ +V
Sbjct  362  SSSSNKNIGHGHVSPTAYV  380



>ref|XP_004510444.1| PREDICTED: uncharacterized protein LOC101500283 isoform X3 [Cicer 
arietinum]
Length=643

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 126/199 (63%), Gaps = 8/199 (4%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            S+   E+   AS   ++ K +FS  +GEICL+ L++KELHE FK TFGR+T+VKDKQWLK
Sbjct  197  SEGVIESGSSASDVYSTSKHNFSMPEGEICLDKLSIKELHELFKVTFGRETTVKDKQWLK  256

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHD  253
            RRI+M L+NSCD S T+F ++D+++ +K +E  +   G+ S   ++++ N+        D
Sbjct  257  RRIAMSLTNSCDVSATTFTVKDNKITRKCEEECS---GNASAAAVISVKNMAGEGCGIED  313

Query  252  DKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesressgk  73
            ++V S     E  + N  +E  +  E    E+ AAKR+RKPTKRYIEELSE ESRE   +
Sbjct  314  NQVAS-----ETRLKNLNVENELRDEDQQREERAAKRIRKPTKRYIEELSENESREHIPR  368

Query  72   smssEKICGYKSTHPSNHV  16
            S SS K  G+    P+ +V
Sbjct  369  SSSSNKNIGHGHVSPTAYV  387



>ref|XP_004510446.1| PREDICTED: uncharacterized protein LOC101500283 isoform X5 [Cicer 
arietinum]
Length=639

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 126/199 (63%), Gaps = 8/199 (4%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            S+   E+   AS   ++ K +FS  +GEICL+ L++KELHE FK TFGR+T+VKDKQWLK
Sbjct  193  SEGVIESGSSASDVYSTSKHNFSMPEGEICLDKLSIKELHELFKVTFGRETTVKDKQWLK  252

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHD  253
            RRI+M L+NSCD S T+F ++D+++ +K +E  +   G+ S   ++++ N+        D
Sbjct  253  RRIAMSLTNSCDVSATTFTVKDNKITRKCEEECS---GNASAAAVISVKNMAGEGCGIED  309

Query  252  DKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesressgk  73
            ++V S     E  + N  +E  +  E    E+ AAKR+RKPTKRYIEELSE ESRE   +
Sbjct  310  NQVAS-----ETRLKNLNVENELRDEDQQREERAAKRIRKPTKRYIEELSENESREHIPR  364

Query  72   smssEKICGYKSTHPSNHV  16
            S SS K  G+    P+ +V
Sbjct  365  SSSSNKNIGHGHVSPTAYV  383



>ref|XP_004510442.1| PREDICTED: uncharacterized protein LOC101500283 isoform X1 [Cicer 
arietinum]
Length=648

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 126/199 (63%), Gaps = 8/199 (4%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            S+   E+   AS   ++ K +FS  +GEICL+ L++KELHE FK TFGR+T+VKDKQWLK
Sbjct  202  SEGVIESGSSASDVYSTSKHNFSMPEGEICLDKLSIKELHELFKVTFGRETTVKDKQWLK  261

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHD  253
            RRI+M L+NSCD S T+F ++D+++ +K +E  +   G+ S   ++++ N+        D
Sbjct  262  RRIAMSLTNSCDVSATTFTVKDNKITRKCEEECS---GNASAAAVISVKNMAGEGCGIED  318

Query  252  DKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesressgk  73
            ++V S     E  + N  +E  +  E    E+ AAKR+RKPTKRYIEELSE ESRE   +
Sbjct  319  NQVAS-----ETRLKNLNVENELRDEDQQREERAAKRIRKPTKRYIEELSENESREHIPR  373

Query  72   smssEKICGYKSTHPSNHV  16
            S SS K  G+    P+ +V
Sbjct  374  SSSSNKNIGHGHVSPTAYV  392



>ref|XP_004510443.1| PREDICTED: uncharacterized protein LOC101500283 isoform X2 [Cicer 
arietinum]
Length=644

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 126/199 (63%), Gaps = 8/199 (4%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            S+   E+   AS   ++ K +FS  +GEICL+ L++KELHE FK TFGR+T+VKDKQWLK
Sbjct  198  SEGVIESGSSASDVYSTSKHNFSMPEGEICLDKLSIKELHELFKVTFGRETTVKDKQWLK  257

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHD  253
            RRI+M L+NSCD S T+F ++D+++ +K +E  +   G+ S   ++++ N+        D
Sbjct  258  RRIAMSLTNSCDVSATTFTVKDNKITRKCEEECS---GNASAAAVISVKNMAGEGCGIED  314

Query  252  DKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesressgk  73
            ++V S     E  + N  +E  +  E    E+ AAKR+RKPTKRYIEELSE ESRE   +
Sbjct  315  NQVAS-----ETRLKNLNVENELRDEDQQREERAAKRIRKPTKRYIEELSENESREHIPR  369

Query  72   smssEKICGYKSTHPSNHV  16
            S SS K  G+    P+ +V
Sbjct  370  SSSSNKNIGHGHVSPTAYV  388



>ref|XP_010932437.1| PREDICTED: uncharacterized protein LOC105053107 isoform X1 [Elaeis 
guineensis]
 ref|XP_010932438.1| PREDICTED: uncharacterized protein LOC105053107 isoform X1 [Elaeis 
guineensis]
 ref|XP_010932439.1| PREDICTED: uncharacterized protein LOC105053107 isoform X1 [Elaeis 
guineensis]
 ref|XP_010932440.1| PREDICTED: uncharacterized protein LOC105053107 isoform X1 [Elaeis 
guineensis]
Length=657

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 101/158 (64%), Gaps = 9/158 (6%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPDFS LK EICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   T
Sbjct  208  SSKPDFSILKREICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRIAMGLTNSCDVPTT  267

Query  384  SFVIEDS-RVVKKVKENIASVN------GSISKDPIVALPNINSGS-SSGHDDKVESPAN  229
            S+VI+D+ RV K++KE  + +       GS+S DP+  L   NS +  S   D+ E    
Sbjct  268  SYVIKDNKRVHKEMKEEPSRLQKSQTEAGSLSMDPVNDLTINNSQNLPSSPTDQTED-QQ  326

Query  228  ITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            +    +     E    +E   MEQ A KRVRKPT+RYI
Sbjct  327  VYSKRLRKPLCEDDEKNENLQMEQFAGKRVRKPTRRYI  364



>ref|XP_010932445.1| PREDICTED: uncharacterized protein LOC105053107 isoform X5 [Elaeis 
guineensis]
Length=613

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 101/158 (64%), Gaps = 9/158 (6%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPDFS LK EICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   T
Sbjct  208  SSKPDFSILKREICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRIAMGLTNSCDVPTT  267

Query  384  SFVIEDS-RVVKKVKENIASVN------GSISKDPIVALPNINSGS-SSGHDDKVESPAN  229
            S+VI+D+ RV K++KE  + +       GS+S DP+  L   NS +  S   D+ E    
Sbjct  268  SYVIKDNKRVHKEMKEEPSRLQKSQTEAGSLSMDPVNDLTINNSQNLPSSPTDQTED-QQ  326

Query  228  ITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            +    +     E    +E   MEQ A KRVRKPT+RYI
Sbjct  327  VYSKRLRKPLCEDDEKNENLQMEQFAGKRVRKPTRRYI  364



>ref|XP_010932441.1| PREDICTED: uncharacterized protein LOC105053107 isoform X2 [Elaeis 
guineensis]
Length=650

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 101/158 (64%), Gaps = 9/158 (6%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPDFS LK EICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   T
Sbjct  201  SSKPDFSILKREICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRIAMGLTNSCDVPTT  260

Query  384  SFVIEDS-RVVKKVKENIASVN------GSISKDPIVALPNINSGS-SSGHDDKVESPAN  229
            S+VI+D+ RV K++KE  + +       GS+S DP+  L   NS +  S   D+ E    
Sbjct  261  SYVIKDNKRVHKEMKEEPSRLQKSQTEAGSLSMDPVNDLTINNSQNLPSSPTDQTED-QQ  319

Query  228  ITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            +    +     E    +E   MEQ A KRVRKPT+RYI
Sbjct  320  VYSKRLRKPLCEDDEKNENLQMEQFAGKRVRKPTRRYI  357



>ref|XP_010932443.1| PREDICTED: uncharacterized protein LOC105053107 isoform X3 [Elaeis 
guineensis]
Length=646

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 101/158 (64%), Gaps = 9/158 (6%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPDFS LK EICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   T
Sbjct  197  SSKPDFSILKREICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRIAMGLTNSCDVPTT  256

Query  384  SFVIEDS-RVVKKVKENIASVN------GSISKDPIVALPNINSGS-SSGHDDKVESPAN  229
            S+VI+D+ RV K++KE  + +       GS+S DP+  L   NS +  S   D+ E    
Sbjct  257  SYVIKDNKRVHKEMKEEPSRLQKSQTEAGSLSMDPVNDLTINNSQNLPSSPTDQTED-QQ  315

Query  228  ITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            +    +     E    +E   MEQ A KRVRKPT+RYI
Sbjct  316  VYSKRLRKPLCEDDEKNENLQMEQFAGKRVRKPTRRYI  353



>ref|XP_006849623.1| hypothetical protein AMTR_s00024p00216510 [Amborella trichopoda]
 gb|ERN11204.1| hypothetical protein AMTR_s00024p00216510 [Amborella trichopoda]
Length=650

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 97/149 (65%), Gaps = 12/149 (8%)
 Frame = -2

Query  558  KPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSF  379
            KPDFS +KGEICL+NL+++ELHETFKATFGR+TSVKDK WLKRRI+MGL+NSC+ S TSF
Sbjct  220  KPDFSTVKGEICLDNLSIRELHETFKATFGRETSVKDKLWLKRRIAMGLTNSCNVSTTSF  279

Query  378  VIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEG-NIPNS  202
            +IE+  +  K   ++ ++ G       +       G   GH  +     N   G  +   
Sbjct  280  IIENKSL--KKTNDVEAMEGVTPSGRTIE----GWGLGVGHMGR-----NFVSGKRLRKP  328

Query  201  TLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
             LE  + ++ H  EQTA+KR+RKPTKRYI
Sbjct  329  KLEYEVKNDDHGPEQTASKRIRKPTKRYI  357



>ref|XP_007217148.1| hypothetical protein PRUPE_ppa003052mg [Prunus persica]
 gb|EMJ18347.1| hypothetical protein PRUPE_ppa003052mg [Prunus persica]
Length=608

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 101/152 (66%), Gaps = 2/152 (1%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPDF  LKGEICL+NL+++ELH  F+ATFGR+T+VKDK WLKRRI+MGL+NSCD S T
Sbjct  163  SSKPDFYTLKGEICLDNLSIRELHGLFRATFGRETTVKDKLWLKRRIAMGLTNSCDVSTT  222

Query  384  SFVIEDSRVVKKVKEN-IASVNGSISKDPIVALPNINSGSS-SGHDDKVESPANITEGNI  211
            +F I D+++V K  +N   + +G +++       N+   +S + H  ++E+   +    +
Sbjct  223  TFTIIDNKLVNKGTDNSFQNADGMLTEGSDGEAKNLGYETSPTSHSSQMENHQIVLGKRL  282

Query  210  PNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
             N ++E    S+   ME   AKRVRKPTKRYI
Sbjct  283  GNLSVELDCGSDDLQMEHRGAKRVRKPTKRYI  314



>ref|XP_011467419.1| PREDICTED: telomere repeat-binding protein 2 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=565

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 99/172 (58%), Gaps = 29/172 (17%)
 Frame = -2

Query  585  LASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSN  406
            LAS    S K DF +   EICL+NL+++ELH+ F+ATFGR+TSVKDK WLKRRI+MGL+N
Sbjct  114  LASAVCTSSKLDFYESNSEICLDNLSIRELHDLFRATFGRETSVKDKLWLKRRITMGLTN  173

Query  405  SCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVE-----  241
            SCD S T+F I ++++VKK +EN              +L N N     G D   +     
Sbjct  174  SCDVSTTTFTIRNNKLVKKGEEN--------------SLRNANDMHIQGSDGGAKNLEYE  219

Query  240  -SPA---------NITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
             SPA          +       S  E   VSE H M+Q AAKRVRKPTKRYI
Sbjct  220  NSPASHSCPLENHQVVSAKRSGSLSEEEYVSEDHMMDQRAAKRVRKPTKRYI  271



>ref|XP_011467420.1| PREDICTED: telomere repeat-binding protein 2 isoform X4 [Fragaria 
vesca subsp. vesca]
Length=564

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 99/172 (58%), Gaps = 29/172 (17%)
 Frame = -2

Query  585  LASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSN  406
            LAS    S K DF +   EICL+NL+++ELH+ F+ATFGR+TSVKDK WLKRRI+MGL+N
Sbjct  113  LASAVCTSSKLDFYESNSEICLDNLSIRELHDLFRATFGRETSVKDKLWLKRRITMGLTN  172

Query  405  SCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVE-----  241
            SCD S T+F I ++++VKK +EN              +L N N     G D   +     
Sbjct  173  SCDVSTTTFTIRNNKLVKKGEEN--------------SLRNANDMHIQGSDGGAKNLEYE  218

Query  240  -SPA---------NITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
             SPA          +       S  E   VSE H M+Q AAKRVRKPTKRYI
Sbjct  219  NSPASHSCPLENHQVVSAKRSGSLSEEEYVSEDHMMDQRAAKRVRKPTKRYI  270



>ref|XP_008228212.1| PREDICTED: uncharacterized protein LOC103327648 [Prunus mume]
Length=663

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 101/152 (66%), Gaps = 2/152 (1%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S KPDF  LKGEICL+NL+++ELH  F+ATFGR+T+VKDK WLKRRI+MGL+NSCD S T
Sbjct  219  SSKPDFYTLKGEICLDNLSIRELHGLFRATFGRETTVKDKLWLKRRIAMGLTNSCDVSTT  278

Query  384  SFVIEDSRVVKKVKEN-IASVNGSISKDPIVALPNINSGSS-SGHDDKVESPANITEGNI  211
            +F I D+++V K  +N   + +G +++       N+   +S + H  ++E+   +    +
Sbjct  279  TFTIIDNKLVNKGTDNSFQNADGMLTEGSDGEAKNLGYETSPTSHSSQMENHQIVLGKRL  338

Query  210  PNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
             N ++E    S+   ME   AKRVRKPTKRYI
Sbjct  339  GNLSVELDCGSDDLQMEHRGAKRVRKPTKRYI  370



>ref|XP_011467416.1| PREDICTED: uncharacterized protein LOC101295435 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=607

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 99/172 (58%), Gaps = 29/172 (17%)
 Frame = -2

Query  585  LASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSN  406
            LAS    S K DF +   EICL+NL+++ELH+ F+ATFGR+TSVKDK WLKRRI+MGL+N
Sbjct  156  LASAVCTSSKLDFYESNSEICLDNLSIRELHDLFRATFGRETSVKDKLWLKRRITMGLTN  215

Query  405  SCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVE-----  241
            SCD S T+F I ++++VKK +EN              +L N N     G D   +     
Sbjct  216  SCDVSTTTFTIRNNKLVKKGEEN--------------SLRNANDMHIQGSDGGAKNLEYE  261

Query  240  -SPA---------NITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
             SPA          +       S  E   VSE H M+Q AAKRVRKPTKRYI
Sbjct  262  NSPASHSCPLENHQVVSAKRSGSLSEEEYVSEDHMMDQRAAKRVRKPTKRYI  313



>ref|XP_010917157.1| PREDICTED: uncharacterized protein LOC105041815 isoform X8 [Elaeis 
guineensis]
Length=615

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 100/166 (60%), Gaps = 31/166 (19%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKGEICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   TSFV
Sbjct  167  PDFSILKGEICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTTSFV  226

Query  375  IEDSRVV-KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIPNS-  202
            I+D ++V K+VKE  + +    SK    +LP+          D+V  P +    N+P S 
Sbjct  227  IKDHKIVLKEVKEEPSKLQK--SKTEAGSLPS----------DQVTDPTDGNFHNLPTSL  274

Query  201  --TLEGCIVS---------------EGHNMEQTAAKRVRKPTKRYI  115
                E   VS               E   MEQ A+KRVRKPT+RYI
Sbjct  275  TNQTEDQQVSGKRLGKPLSEYDEKNEDLQMEQFASKRVRKPTRRYI  320



>ref|XP_011467418.1| PREDICTED: uncharacterized protein LOC101295435 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=606

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 99/172 (58%), Gaps = 29/172 (17%)
 Frame = -2

Query  585  LASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSN  406
            LAS    S K DF +   EICL+NL+++ELH+ F+ATFGR+TSVKDK WLKRRI+MGL+N
Sbjct  155  LASAVCTSSKLDFYESNSEICLDNLSIRELHDLFRATFGRETSVKDKLWLKRRITMGLTN  214

Query  405  SCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVE-----  241
            SCD S T+F I ++++VKK +EN              +L N N     G D   +     
Sbjct  215  SCDVSTTTFTIRNNKLVKKGEEN--------------SLRNANDMHIQGSDGGAKNLEYE  260

Query  240  -SPA---------NITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
             SPA          +       S  E   VSE H M+Q AAKRVRKPTKRYI
Sbjct  261  NSPASHSCPLENHQVVSAKRSGSLSEEEYVSEDHMMDQRAAKRVRKPTKRYI  312



>ref|XP_008391379.1| PREDICTED: uncharacterized protein LOC103453600 isoform X3 [Malus 
domestica]
Length=615

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 130/196 (66%), Gaps = 3/196 (2%)
 Frame = -2

Query  609  DAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKR  430
            D   E+   AS    S KPD + LKGEICL+NL+++ELHE F+ATFGR+++VKDK WLKR
Sbjct  136  DGPIESGSSASVICTSPKPDVNTLKGEICLDNLSIRELHELFRATFGRESTVKDKLWLKR  195

Query  429  RISMGLSNSCDFSCTSFVIEDSRVVKKVKEN-IASVNGSISKDPIVALPNINSGSS-SGH  256
            RI+MGL+NSCD S T+F I D+++V K K++ I + +G +++       N+   +S + H
Sbjct  196  RITMGLTNSCDVS-TTFTIVDNKLVNKGKDDSIQNADGMLTEGSDGEAKNLGYETSPTSH  254

Query  255  DDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesressg  76
              ++E+   ++   + N + E    SE  + +Q AAKRVRKPTKRYIEELSEVES++ S 
Sbjct  255  SSQMENHVTVSGKRLVNISAELDCGSEDLHTDQRAAKRVRKPTKRYIEELSEVESKDCSP  314

Query  75   ksmssEKICGYKSTHP  28
            K +S  K  G + T P
Sbjct  315  KVISPVKSAGQRQTSP  330



>ref|XP_010917156.1| PREDICTED: uncharacterized protein LOC105041815 isoform X7 [Elaeis 
guineensis]
Length=626

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 100/166 (60%), Gaps = 31/166 (19%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKGEICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   TSFV
Sbjct  178  PDFSILKGEICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTTSFV  237

Query  375  IEDSRVV-KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIPNS-  202
            I+D ++V K+VKE  + +    SK    +LP+          D+V  P +    N+P S 
Sbjct  238  IKDHKIVLKEVKEEPSKLQK--SKTEAGSLPS----------DQVTDPTDGNFHNLPTSL  285

Query  201  --TLEGCIVS---------------EGHNMEQTAAKRVRKPTKRYI  115
                E   VS               E   MEQ A+KRVRKPT+RYI
Sbjct  286  TNQTEDQQVSGKRLGKPLSEYDEKNEDLQMEQFASKRVRKPTRRYI  331



>ref|XP_010917155.1| PREDICTED: uncharacterized protein LOC105041815 isoform X6 [Elaeis 
guineensis]
Length=645

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 100/166 (60%), Gaps = 31/166 (19%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKGEICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   TSFV
Sbjct  241  PDFSILKGEICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTTSFV  300

Query  375  IEDSRVV-KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIPNS-  202
            I+D ++V K+VKE  + +    SK    +LP+          D+V  P +    N+P S 
Sbjct  301  IKDHKIVLKEVKEEPSKLQK--SKTEAGSLPS----------DQVTDPTDGNFHNLPTSL  348

Query  201  --TLEGCIVS---------------EGHNMEQTAAKRVRKPTKRYI  115
                E   VS               E   MEQ A+KRVRKPT+RYI
Sbjct  349  TNQTEDQQVSGKRLGKPLSEYDEKNEDLQMEQFASKRVRKPTRRYI  394



>ref|XP_010105512.1| Telomere repeat-binding protein 6 [Morus notabilis]
 gb|EXC04963.1| Telomere repeat-binding protein 6 [Morus notabilis]
Length=737

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 100/149 (67%), Gaps = 1/149 (1%)
 Frame = -2

Query  558  KPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSF  379
            KPDFSKL+ EICL+NL+++ELHE F+ATFGR+T+VKDK WLKRRI+MGL+NSCD + T+F
Sbjct  296  KPDFSKLEEEICLDNLSIRELHEFFRATFGRETTVKDKLWLKRRIAMGLTNSCDVATTTF  355

Query  378  VIEDSRVVKKV-KENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIPNS  202
             I+D+++V K  +EN  + N + ++D  V    ++  +S  +         I  G   + 
Sbjct  356  TIKDNKLVNKGNEENCKNTNAAFTEDSRVEAVLVSPKNSPTNHSTQREDHKIALGERFHD  415

Query  201  TLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
              E    S+  + E+ AAKRVRKPT+RYI
Sbjct  416  NAELDCGSDDLHTEERAAKRVRKPTRRYI  444



>ref|XP_008391378.1| PREDICTED: uncharacterized protein LOC103453600 isoform X2 [Malus 
domestica]
 ref|XP_008351355.1| PREDICTED: uncharacterized protein LOC103414763 isoform X2 [Malus 
domestica]
Length=628

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 130/196 (66%), Gaps = 3/196 (2%)
 Frame = -2

Query  609  DAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKR  430
            D   E+   AS    S KPD + LKGEICL+NL+++ELHE F+ATFGR+++VKDK WLKR
Sbjct  149  DGPIESGSSASVICTSPKPDVNTLKGEICLDNLSIRELHELFRATFGRESTVKDKLWLKR  208

Query  429  RISMGLSNSCDFSCTSFVIEDSRVVKKVKEN-IASVNGSISKDPIVALPNINSGSS-SGH  256
            RI+MGL+NSCD S T+F I D+++V K K++ I + +G +++       N+   +S + H
Sbjct  209  RITMGLTNSCDVS-TTFTIVDNKLVNKGKDDSIQNADGMLTEGSDGEAKNLGYETSPTSH  267

Query  255  DDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesressg  76
              ++E+   ++   + N + E    SE  + +Q AAKRVRKPTKRYIEELSEVES++ S 
Sbjct  268  SSQMENHVTVSGKRLVNISAELDCGSEDLHTDQRAAKRVRKPTKRYIEELSEVESKDCSP  327

Query  75   ksmssEKICGYKSTHP  28
            K +S  K  G + T P
Sbjct  328  KVISPVKSAGQRQTSP  343



>ref|XP_010917153.1| PREDICTED: uncharacterized protein LOC105041815 isoform X4 [Elaeis 
guineensis]
Length=682

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 100/166 (60%), Gaps = 31/166 (19%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKGEICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   TSFV
Sbjct  234  PDFSILKGEICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTTSFV  293

Query  375  IEDSRVV-KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIPNS-  202
            I+D ++V K+VKE  + +    SK    +LP+          D+V  P +    N+P S 
Sbjct  294  IKDHKIVLKEVKEEPSKLQK--SKTEAGSLPS----------DQVTDPTDGNFHNLPTSL  341

Query  201  --TLEGCIVS---------------EGHNMEQTAAKRVRKPTKRYI  115
                E   VS               E   MEQ A+KRVRKPT+RYI
Sbjct  342  TNQTEDQQVSGKRLGKPLSEYDEKNEDLQMEQFASKRVRKPTRRYI  387



>ref|XP_010917150.1| PREDICTED: uncharacterized protein LOC105041815 isoform X1 [Elaeis 
guineensis]
Length=689

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 100/166 (60%), Gaps = 31/166 (19%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKGEICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   TSFV
Sbjct  241  PDFSILKGEICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTTSFV  300

Query  375  IEDSRVV-KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIPNS-  202
            I+D ++V K+VKE  + +    SK    +LP+          D+V  P +    N+P S 
Sbjct  301  IKDHKIVLKEVKEEPSKLQK--SKTEAGSLPS----------DQVTDPTDGNFHNLPTSL  348

Query  201  --TLEGCIVS---------------EGHNMEQTAAKRVRKPTKRYI  115
                E   VS               E   MEQ A+KRVRKPT+RYI
Sbjct  349  TNQTEDQQVSGKRLGKPLSEYDEKNEDLQMEQFASKRVRKPTRRYI  394



>ref|XP_010917152.1| PREDICTED: uncharacterized protein LOC105041815 isoform X3 [Elaeis 
guineensis]
Length=682

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 100/166 (60%), Gaps = 31/166 (19%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKGEICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   TSFV
Sbjct  234  PDFSILKGEICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTTSFV  293

Query  375  IEDSRVV-KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIPNS-  202
            I+D ++V K+VKE  + +    SK    +LP+          D+V  P +    N+P S 
Sbjct  294  IKDHKIVLKEVKEEPSKLQK--SKTEAGSLPS----------DQVTDPTDGNFHNLPTSL  341

Query  201  --TLEGCIVS---------------EGHNMEQTAAKRVRKPTKRYI  115
                E   VS               E   MEQ A+KRVRKPT+RYI
Sbjct  342  TNQTEDQQVSGKRLGKPLSEYDEKNEDLQMEQFASKRVRKPTRRYI  387



>ref|XP_010917151.1| PREDICTED: uncharacterized protein LOC105041815 isoform X2 [Elaeis 
guineensis]
Length=687

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 100/166 (60%), Gaps = 31/166 (19%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKGEICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   TSFV
Sbjct  241  PDFSILKGEICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTTSFV  300

Query  375  IEDSRVV-KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIPNS-  202
            I+D ++V K+VKE  + +    SK    +LP+          D+V  P +    N+P S 
Sbjct  301  IKDHKIVLKEVKEEPSKLQK--SKTEAGSLPS----------DQVTDPTDGNFHNLPTSL  348

Query  201  --TLEGCIVS---------------EGHNMEQTAAKRVRKPTKRYI  115
                E   VS               E   MEQ A+KRVRKPT+RYI
Sbjct  349  TNQTEDQQVSGKRLGKPLSEYDEKNEDLQMEQFASKRVRKPTRRYI  394



>ref|XP_003627252.1| Myb family transcription factor [Medicago truncatula]
Length=599

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 124/196 (63%), Gaps = 10/196 (5%)
 Frame = -2

Query  582  ASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS  403
            AS   ++ K DFS   GEICL+ L++KELHE FK TFGR+T+VKDKQWL+RRI+M L+NS
Sbjct  205  ASAVNSALKHDFSMTDGEICLDKLSIKELHELFKVTFGRETTVKDKQWLRRRIAMSLTNS  264

Query  402  CDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDD-------KV  244
            CD S T+F ++D+++ +K +E  +    +++   ++++ N+       ++D       +V
Sbjct  265  CDVSATTFTVKDNKITRKCEEECSR---NVNAAAVISVENMAVQRDIKYNDSNAVGGCEV  321

Query  243  ESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesressgksms  64
            ++    +E  + N  +E  +  E    EQ AAKR+RKPTKRYIEELSE ESRE   +S S
Sbjct  322  DNNQVASETRLENLNIEHELEDEDQLREQRAAKRMRKPTKRYIEELSENESREQIPRSSS  381

Query  63   sEKICGYKSTHPSNHV  16
            S K  G+    P+++ 
Sbjct  382  SNKSTGHMQASPTSYA  397



>gb|AET01728.2| myb transcription factor [Medicago truncatula]
Length=599

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 124/196 (63%), Gaps = 10/196 (5%)
 Frame = -2

Query  582  ASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS  403
            AS   ++ K DFS   GEICL+ L++KELHE FK TFGR+T+VKDKQWL+RRI+M L+NS
Sbjct  205  ASAVNSALKHDFSMTDGEICLDKLSIKELHELFKVTFGRETTVKDKQWLRRRIAMSLTNS  264

Query  402  CDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDD-------KV  244
            CD S T+F ++D+++ +K +E  +    +++   ++++ N+       ++D       +V
Sbjct  265  CDVSATTFTVKDNKITRKCEEECSR---NVNAAAVISVENMAVQRDIKYNDSNAVGGCEV  321

Query  243  ESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesressgksms  64
            ++    +E  + N  +E  +  E    EQ AAKR+RKPTKRYIEELSE ESRE   +S S
Sbjct  322  DNNQVASETRLENLNIEHELEDEDQLREQRAAKRMRKPTKRYIEELSENESREQIPRSSS  381

Query  63   sEKICGYKSTHPSNHV  16
            S K  G+    P+++ 
Sbjct  382  SNKSTGHMQASPTSYA  397



>ref|XP_008391374.1| PREDICTED: uncharacterized protein LOC103453600 isoform X1 [Malus 
domestica]
 ref|XP_008391375.1| PREDICTED: uncharacterized protein LOC103453600 isoform X1 [Malus 
domestica]
 ref|XP_008391376.1| PREDICTED: uncharacterized protein LOC103453600 isoform X1 [Malus 
domestica]
 ref|XP_008351352.1| PREDICTED: uncharacterized protein LOC103414763 isoform X1 [Malus 
domestica]
 ref|XP_008351353.1| PREDICTED: uncharacterized protein LOC103414763 isoform X1 [Malus 
domestica]
 ref|XP_008351354.1| PREDICTED: uncharacterized protein LOC103414763 isoform X1 [Malus 
domestica]
Length=684

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 127/187 (68%), Gaps = 3/187 (2%)
 Frame = -2

Query  582  ASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS  403
            AS    S KPD + LKGEICL+NL+++ELHE F+ATFGR+++VKDK WLKRRI+MGL+NS
Sbjct  214  ASVICTSPKPDVNTLKGEICLDNLSIRELHELFRATFGRESTVKDKLWLKRRITMGLTNS  273

Query  402  CDFSCTSFVIEDSRVVKKVKEN-IASVNGSISKDPIVALPNINSGSS-SGHDDKVESPAN  229
            CD S T+F I D+++V K K++ I + +G +++       N+   +S + H  ++E+   
Sbjct  274  CDVS-TTFTIVDNKLVNKGKDDSIQNADGMLTEGSDGEAKNLGYETSPTSHSSQMENHVT  332

Query  228  ITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesressgksmssEKIC  49
            ++   + N + E    SE  + +Q AAKRVRKPTKRYIEELSEVES++ S K +S  K  
Sbjct  333  VSGKRLVNISAELDCGSEDLHTDQRAAKRVRKPTKRYIEELSEVESKDCSPKVISPVKSA  392

Query  48   GYKSTHP  28
            G + T P
Sbjct  393  GQRQTSP  399



>ref|XP_010917154.1| PREDICTED: uncharacterized protein LOC105041815 isoform X5 [Elaeis 
guineensis]
Length=678

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 100/166 (60%), Gaps = 31/166 (19%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKGEICL+NL+++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSCD   TSFV
Sbjct  230  PDFSILKGEICLDNLSIRELQEAFRATFGRQTSVKDKLWLKRRITMGLTNSCDVPTTSFV  289

Query  375  IEDSRVV-KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIPNS-  202
            I+D ++V K+VKE  + +    SK    +LP+          D+V  P +    N+P S 
Sbjct  290  IKDHKIVLKEVKEEPSKLQK--SKTEAGSLPS----------DQVTDPTDGNFHNLPTSL  337

Query  201  --TLEGCIVS---------------EGHNMEQTAAKRVRKPTKRYI  115
                E   VS               E   MEQ A+KRVRKPT+RYI
Sbjct  338  TNQTEDQQVSGKRLGKPLSEYDEKNEDLQMEQFASKRVRKPTRRYI  383



>ref|XP_010531870.1| PREDICTED: uncharacterized protein LOC104808052 isoform X3 [Tarenaya 
hassleriana]
Length=543

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 102/154 (66%), Gaps = 4/154 (3%)
 Frame = -2

Query  567  ASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSC  388
            ++ KPDFS ++G+ICL+NL++K LHETF+ATFGR+T+VKDK WLKRRI+MGL NSC  S 
Sbjct  116  SAQKPDFSTVRGDICLDNLSIKALHETFRATFGRETTVKDKLWLKRRIAMGLLNSCYVST  175

Query  387  TSFVIEDSRVVKKVKENIASVNGSISKDPI--VALPNINSGSSSGHDDKVESPANIT-EG  217
            T   I+D++++   KEN   +N   SKD +  + + + N  ++SG  D+++  A+ + + 
Sbjct  176  TCLTIKDNKLIGGQKENFNCLNDDFSKDVVDEIRVDDSNKEAASGPSDQIDGFASASGDS  235

Query  216  NIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            ++ N     C   E    E  A KR RKPT+RYI
Sbjct  236  SMDNFGNHEC-GGEDFASEHRAEKRQRKPTRRYI  268



>gb|AET01727.2| myb transcription factor [Medicago truncatula]
Length=662

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 124/196 (63%), Gaps = 10/196 (5%)
 Frame = -2

Query  582  ASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS  403
            AS   ++ K DFS   GEICL+ L++KELHE FK TFGR+T+VKDKQWL+RRI+M L+NS
Sbjct  205  ASAVNSALKHDFSMTDGEICLDKLSIKELHELFKVTFGRETTVKDKQWLRRRIAMSLTNS  264

Query  402  CDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDD-------KV  244
            CD S T+F ++D+++ +K +E  +    +++   ++++ N+       ++D       +V
Sbjct  265  CDVSATTFTVKDNKITRKCEEECSR---NVNAAAVISVENMAVQRDIKYNDSNAVGGCEV  321

Query  243  ESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesressgksms  64
            ++    +E  + N  +E  +  E    EQ AAKR+RKPTKRYIEELSE ESRE   +S S
Sbjct  322  DNNQVASETRLENLNIEHELEDEDQLREQRAAKRMRKPTKRYIEELSENESREQIPRSSS  381

Query  63   sEKICGYKSTHPSNHV  16
            S K  G+    P+++ 
Sbjct  382  SNKSTGHMQASPTSYA  397



>ref|XP_002887444.1| hypothetical protein ARALYDRAFT_476400 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63703.1| hypothetical protein ARALYDRAFT_476400 [Arabidopsis lyrata subsp. 
lyrata]
Length=627

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 97/153 (63%), Gaps = 10/153 (7%)
 Frame = -2

Query  573  AGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDF  394
            +GA+ KPDFS+++GEICL+NL +K L ETF+ATFGR+T+VKDK WLKRRI+MGL NSCD 
Sbjct  225  SGAAQKPDFSRVRGEICLDNLPIKALQETFRATFGRETTVKDKTWLKRRIAMGLINSCDV  284

Query  393  SCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGN  214
              T+  ++D  +V   +E    V  +ISKD          G         ++P++    N
Sbjct  285  PATNLRVKDKMLVGN-QEKTNDVTNAISKD---------MGDDVRATKMKDAPSSTDHVN  334

Query  213  IPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
              ++  +    SE ++ EQ AAKRVRKPT+RYI
Sbjct  335  GHSNGGDHYYASEDYSSEQRAAKRVRKPTRRYI  367



>gb|KEH18465.1| myb transcription factor [Medicago truncatula]
Length=667

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 124/196 (63%), Gaps = 10/196 (5%)
 Frame = -2

Query  582  ASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS  403
            AS   ++ K DFS   GEICL+ L++KELHE FK TFGR+T+VKDKQWL+RRI+M L+NS
Sbjct  210  ASAVNSALKHDFSMTDGEICLDKLSIKELHELFKVTFGRETTVKDKQWLRRRIAMSLTNS  269

Query  402  CDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDD-------KV  244
            CD S T+F ++D+++ +K +E  +    +++   ++++ N+       ++D       +V
Sbjct  270  CDVSATTFTVKDNKITRKCEEECSR---NVNAAAVISVENMAVQRDIKYNDSNAVGGCEV  326

Query  243  ESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesressgksms  64
            ++    +E  + N  +E  +  E    EQ AAKR+RKPTKRYIEELSE ESRE   +S S
Sbjct  327  DNNQVASETRLENLNIEHELEDEDQLREQRAAKRMRKPTKRYIEELSENESREQIPRSSS  386

Query  63   sEKICGYKSTHPSNHV  16
            S K  G+    P+++ 
Sbjct  387  SNKSTGHMQASPTSYA  402



>ref|XP_003627253.1| Myb family transcription factor [Medicago truncatula]
Length=663

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 124/196 (63%), Gaps = 10/196 (5%)
 Frame = -2

Query  582  ASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS  403
            AS   ++ K DFS   GEICL+ L++KELHE FK TFGR+T+VKDKQWL+RRI+M L+NS
Sbjct  206  ASAVNSALKHDFSMTDGEICLDKLSIKELHELFKVTFGRETTVKDKQWLRRRIAMSLTNS  265

Query  402  CDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDD-------KV  244
            CD S T+F ++D+++ +K +E  +    +++   ++++ N+       ++D       +V
Sbjct  266  CDVSATTFTVKDNKITRKCEEECSR---NVNAAAVISVENMAVQRDIKYNDSNAVGGCEV  322

Query  243  ESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesressgksms  64
            ++    +E  + N  +E  +  E    EQ AAKR+RKPTKRYIEELSE ESRE   +S S
Sbjct  323  DNNQVASETRLENLNIEHELEDEDQLREQRAAKRMRKPTKRYIEELSENESREQIPRSSS  382

Query  63   sEKICGYKSTHPSNHV  16
            S K  G+    P+++ 
Sbjct  383  SNKSTGHMQASPTSYA  398



>ref|XP_003627251.1| Myb family transcription factor [Medicago truncatula]
Length=662

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 124/196 (63%), Gaps = 10/196 (5%)
 Frame = -2

Query  582  ASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS  403
            AS   ++ K DFS   GEICL+ L++KELHE FK TFGR+T+VKDKQWL+RRI+M L+NS
Sbjct  205  ASAVNSALKHDFSMTDGEICLDKLSIKELHELFKVTFGRETTVKDKQWLRRRIAMSLTNS  264

Query  402  CDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDD-------KV  244
            CD S T+F ++D+++ +K +E  +    +++   ++++ N+       ++D       +V
Sbjct  265  CDVSATTFTVKDNKITRKCEEECSR---NVNAAAVISVENMAVQRDIKYNDSNAVGGCEV  321

Query  243  ESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesressgksms  64
            ++    +E  + N  +E  +  E    EQ AAKR+RKPTKRYIEELSE ESRE   +S S
Sbjct  322  DNNQVASETRLENLNIEHELEDEDQLREQRAAKRMRKPTKRYIEELSENESREQIPRSSS  381

Query  63   sEKICGYKSTHPSNHV  16
            S K  G+    P+++ 
Sbjct  382  SNKSTGHMQASPTSYA  397



>gb|AET01729.2| myb transcription factor [Medicago truncatula]
Length=663

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 124/196 (63%), Gaps = 10/196 (5%)
 Frame = -2

Query  582  ASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS  403
            AS   ++ K DFS   GEICL+ L++KELHE FK TFGR+T+VKDKQWL+RRI+M L+NS
Sbjct  206  ASAVNSALKHDFSMTDGEICLDKLSIKELHELFKVTFGRETTVKDKQWLRRRIAMSLTNS  265

Query  402  CDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDD-------KV  244
            CD S T+F ++D+++ +K +E  +    +++   ++++ N+       ++D       +V
Sbjct  266  CDVSATTFTVKDNKITRKCEEECSR---NVNAAAVISVENMAVQRDIKYNDSNAVGGCEV  322

Query  243  ESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesressgksms  64
            ++    +E  + N  +E  +  E    EQ AAKR+RKPTKRYIEELSE ESRE   +S S
Sbjct  323  DNNQVASETRLENLNIEHELEDEDQLREQRAAKRMRKPTKRYIEELSENESREQIPRSSS  382

Query  63   sEKICGYKSTHPSNHV  16
            S K  G+    P+++ 
Sbjct  383  SNKSTGHMQASPTSYA  398



>gb|KEH18466.1| myb transcription factor [Medicago truncatula]
Length=658

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 124/196 (63%), Gaps = 10/196 (5%)
 Frame = -2

Query  582  ASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS  403
            AS   ++ K DFS   GEICL+ L++KELHE FK TFGR+T+VKDKQWL+RRI+M L+NS
Sbjct  201  ASAVNSALKHDFSMTDGEICLDKLSIKELHELFKVTFGRETTVKDKQWLRRRIAMSLTNS  260

Query  402  CDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDD-------KV  244
            CD S T+F ++D+++ +K +E  +    +++   ++++ N+       ++D       +V
Sbjct  261  CDVSATTFTVKDNKITRKCEEECSR---NVNAAAVISVENMAVQRDIKYNDSNAVGGCEV  317

Query  243  ESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesressgksms  64
            ++    +E  + N  +E  +  E    EQ AAKR+RKPTKRYIEELSE ESRE   +S S
Sbjct  318  DNNQVASETRLENLNIEHELEDEDQLREQRAAKRMRKPTKRYIEELSENESREQIPRSSS  377

Query  63   sEKICGYKSTHPSNHV  16
            S K  G+    P+++ 
Sbjct  378  SNKSTGHMQASPTSYA  393



>ref|XP_006598821.1| PREDICTED: uncharacterized protein LOC100782501 isoform X3 [Glycine 
max]
Length=647

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 125/200 (63%), Gaps = 4/200 (2%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            S+   E+   AS   ++ K D S   GEICL+ L+++ELHE FK TFGR+T+VKDKQWLK
Sbjct  192  SEGVIESGSSASAVYSNLKSDISMSDGEICLDKLSIRELHELFKVTFGRETTVKDKQWLK  251

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHD  253
            RRI+M L+NSCD S T+F+I+D+++V+K +E+ +   G+++   +++  N+     +  D
Sbjct  252  RRIAMSLTNSCDVSATTFIIKDNKIVRKFEEDSS---GNMNAGSLISSENMTEEDVNFKD  308

Query  252  DKVESPANITEGNIPNSTL-EGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesressg  76
                    I +  + + T  E  +  E +   Q AAKR+R+PTKRYIEELSE ESRE + 
Sbjct  309  SSAVDACGIDDNQVVSETRSENGLEYENYQTGQRAAKRIRRPTKRYIEELSENESREHNP  368

Query  75   ksmssEKICGYKSTHPSNHV  16
            +   S K  G+    P+++V
Sbjct  369  RLSISNKTVGFGHVSPTSNV  388



>ref|XP_006598820.1| PREDICTED: uncharacterized protein LOC100782501 isoform X2 [Glycine 
max]
 gb|KHN39641.1| Telomere repeat-binding protein 6 [Glycine soja]
Length=650

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 125/200 (63%), Gaps = 4/200 (2%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            S+   E+   AS   ++ K D S   GEICL+ L+++ELHE FK TFGR+T+VKDKQWLK
Sbjct  195  SEGVIESGSSASAVYSNLKSDISMSDGEICLDKLSIRELHELFKVTFGRETTVKDKQWLK  254

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHD  253
            RRI+M L+NSCD S T+F+I+D+++V+K +E+ +   G+++   +++  N+     +  D
Sbjct  255  RRIAMSLTNSCDVSATTFIIKDNKIVRKFEEDSS---GNMNAGSLISSENMTEEDVNFKD  311

Query  252  DKVESPANITEGNIPNSTL-EGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesressg  76
                    I +  + + T  E  +  E +   Q AAKR+R+PTKRYIEELSE ESRE + 
Sbjct  312  SSAVDACGIDDNQVVSETRSENGLEYENYQTGQRAAKRIRRPTKRYIEELSENESREHNP  371

Query  75   ksmssEKICGYKSTHPSNHV  16
            +   S K  G+    P+++V
Sbjct  372  RLSISNKTVGFGHVSPTSNV  391



>ref|XP_006598822.1| PREDICTED: uncharacterized protein LOC100782501 isoform X4 [Glycine 
max]
Length=643

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 125/200 (63%), Gaps = 4/200 (2%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            S+   E+   AS   ++ K D S   GEICL+ L+++ELHE FK TFGR+T+VKDKQWLK
Sbjct  188  SEGVIESGSSASAVYSNLKSDISMSDGEICLDKLSIRELHELFKVTFGRETTVKDKQWLK  247

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHD  253
            RRI+M L+NSCD S T+F+I+D+++V+K +E+ +   G+++   +++  N+     +  D
Sbjct  248  RRIAMSLTNSCDVSATTFIIKDNKIVRKFEEDSS---GNMNAGSLISSENMTEEDVNFKD  304

Query  252  DKVESPANITEGNIPNSTL-EGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesressg  76
                    I +  + + T  E  +  E +   Q AAKR+R+PTKRYIEELSE ESRE + 
Sbjct  305  SSAVDACGIDDNQVVSETRSENGLEYENYQTGQRAAKRIRRPTKRYIEELSENESREHNP  364

Query  75   ksmssEKICGYKSTHPSNHV  16
            +   S K  G+    P+++V
Sbjct  365  RLSISNKTVGFGHVSPTSNV  384



>ref|XP_003547658.1| PREDICTED: uncharacterized protein LOC100782501 isoform X1 [Glycine 
max]
Length=646

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 125/200 (63%), Gaps = 4/200 (2%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            S+   E+   AS   ++ K D S   GEICL+ L+++ELHE FK TFGR+T+VKDKQWLK
Sbjct  191  SEGVIESGSSASAVYSNLKSDISMSDGEICLDKLSIRELHELFKVTFGRETTVKDKQWLK  250

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHD  253
            RRI+M L+NSCD S T+F+I+D+++V+K +E+ +   G+++   +++  N+     +  D
Sbjct  251  RRIAMSLTNSCDVSATTFIIKDNKIVRKFEEDSS---GNMNAGSLISSENMTEEDVNFKD  307

Query  252  DKVESPANITEGNIPNSTL-EGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesressg  76
                    I +  + + T  E  +  E +   Q AAKR+R+PTKRYIEELSE ESRE + 
Sbjct  308  SSAVDACGIDDNQVVSETRSENGLEYENYQTGQRAAKRIRRPTKRYIEELSENESREHNP  367

Query  75   ksmssEKICGYKSTHPSNHV  16
            +   S K  G+    P+++V
Sbjct  368  RLSISNKTVGFGHVSPTSNV  387



>ref|XP_010531869.1| PREDICTED: uncharacterized protein LOC104808052 isoform X2 [Tarenaya 
hassleriana]
Length=595

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 102/154 (66%), Gaps = 4/154 (3%)
 Frame = -2

Query  567  ASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSC  388
            ++ KPDFS ++G+ICL+NL++K LHETF+ATFGR+T+VKDK WLKRRI+MGL NSC  S 
Sbjct  168  SAQKPDFSTVRGDICLDNLSIKALHETFRATFGRETTVKDKLWLKRRIAMGLLNSCYVST  227

Query  387  TSFVIEDSRVVKKVKENIASVNGSISKDPI--VALPNINSGSSSGHDDKVESPANIT-EG  217
            T   I+D++++   KEN   +N   SKD +  + + + N  ++SG  D+++  A+ + + 
Sbjct  228  TCLTIKDNKLIGGQKENFNCLNDDFSKDVVDEIRVDDSNKEAASGPSDQIDGFASASGDS  287

Query  216  NIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            ++ N     C   E    E  A KR RKPT+RYI
Sbjct  288  SMDNFGNHEC-GGEDFASEHRAEKRQRKPTRRYI  320



>ref|XP_010531868.1| PREDICTED: uncharacterized protein LOC104808052 isoform X1 [Tarenaya 
hassleriana]
Length=638

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 102/154 (66%), Gaps = 4/154 (3%)
 Frame = -2

Query  567  ASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSC  388
            ++ KPDFS ++G+ICL+NL++K LHETF+ATFGR+T+VKDK WLKRRI+MGL NSC  S 
Sbjct  211  SAQKPDFSTVRGDICLDNLSIKALHETFRATFGRETTVKDKLWLKRRIAMGLLNSCYVST  270

Query  387  TSFVIEDSRVVKKVKENIASVNGSISKDPI--VALPNINSGSSSGHDDKVESPANIT-EG  217
            T   I+D++++   KEN   +N   SKD +  + + + N  ++SG  D+++  A+ + + 
Sbjct  271  TCLTIKDNKLIGGQKENFNCLNDDFSKDVVDEIRVDDSNKEAASGPSDQIDGFASASGDS  330

Query  216  NIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            ++ N     C   E    E  A KR RKPT+RYI
Sbjct  331  SMDNFGNHEC-GGEDFASEHRAEKRQRKPTRRYI  363



>ref|XP_009372362.1| PREDICTED: uncharacterized protein LOC103961527 isoform X8 [Pyrus 
x bretschneideri]
Length=598

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 121/197 (61%), Gaps = 20/197 (10%)
 Frame = -2

Query  558  KPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSF  379
            KPD + LKGEICL+NL+++ELHE F+ATFGR+T+VKDK WLKRRI+M L+NSCD S T+F
Sbjct  92   KPDVNTLKGEICLDNLSIRELHELFRATFGRETTVKDKLWLKRRITMALTNSCDVSTTTF  151

Query  378  VIEDSRVVKKVKEN-------------------IASVNGSISKDPIVALPNINSGSS-SG  259
             I D+++V K K++                   I + +G +++       N+   +S + 
Sbjct  152  TIVDNKLVNKGKDDSIQNADGMHKLVNKGKDDSIQNADGMLTEGSDGEAKNLGYETSPTS  211

Query  258  HDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesress  79
            H  K+E+   ++     N + E    SE  + +Q AAKR+RKPTKRYIEELSEVES++ S
Sbjct  212  HSSKMENHVTVSGKRFVNISAELDCGSEDLHTDQRAAKRIRKPTKRYIEELSEVESKDCS  271

Query  78   gksmssEKICGYKSTHP  28
             K  S  K  G + T P
Sbjct  272  PKVTSPVKSAGQRQTSP  288



>gb|AAM61098.1| unknown [Arabidopsis thaliana]
Length=624

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 99/156 (63%), Gaps = 16/156 (10%)
 Frame = -2

Query  573  AGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDF  394
            + A+ KPDFS+++GEICL+NL +K L ETF+ATFGRDT+VKDK WLKRRI+MGL NSCD 
Sbjct  219  SAAAQKPDFSRVRGEICLDNLPIKALQETFRATFGRDTTVKDKTWLKRRIAMGLINSCDV  278

Query  393  SCTSFVIEDSRVVKKVKENIASVNGSISK---DPIVALPNINSGSSSGHDDKVESPANIT  223
              T+  ++D ++V   +E    V  +I K   D + A    ++ SS+ H   V   +N  
Sbjct  279  PTTNLRVKDDKLVGN-QEKSNDVTNAIRKEMGDDVRATKMKDAPSSTDH---VNGHSN--  332

Query  222  EGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
             GN           SE ++ EQ AAKRVRKPT+RYI
Sbjct  333  GGN-------HYYASEDYSSEQRAAKRVRKPTRRYI  361



>ref|XP_009372361.1| PREDICTED: uncharacterized protein LOC103961527 isoform X7 [Pyrus 
x bretschneideri]
Length=654

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 121/197 (61%), Gaps = 20/197 (10%)
 Frame = -2

Query  558  KPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSF  379
            KPD + LKGEICL+NL+++ELHE F+ATFGR+T+VKDK WLKRRI+M L+NSCD S T+F
Sbjct  148  KPDVNTLKGEICLDNLSIRELHELFRATFGRETTVKDKLWLKRRITMALTNSCDVSTTTF  207

Query  378  VIEDSRVVKKVKEN-------------------IASVNGSISKDPIVALPNINSGSS-SG  259
             I D+++V K K++                   I + +G +++       N+   +S + 
Sbjct  208  TIVDNKLVNKGKDDSIQNADGMHKLVNKGKDDSIQNADGMLTEGSDGEAKNLGYETSPTS  267

Query  258  HDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesress  79
            H  K+E+   ++     N + E    SE  + +Q AAKR+RKPTKRYIEELSEVES++ S
Sbjct  268  HSSKMENHVTVSGKRFVNISAELDCGSEDLHTDQRAAKRIRKPTKRYIEELSEVESKDCS  327

Query  78   gksmssEKICGYKSTHP  28
             K  S  K  G + T P
Sbjct  328  PKVTSPVKSAGQRQTSP  344



>ref|XP_009372363.1| PREDICTED: uncharacterized protein LOC103961527 isoform X9 [Pyrus 
x bretschneideri]
Length=647

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 121/197 (61%), Gaps = 20/197 (10%)
 Frame = -2

Query  558  KPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSF  379
            KPD + LKGEICL+NL+++ELHE F+ATFGR+T+VKDK WLKRRI+M L+NSCD S T+F
Sbjct  166  KPDVNTLKGEICLDNLSIRELHELFRATFGRETTVKDKLWLKRRITMALTNSCDVSTTTF  225

Query  378  VIEDSRVVKKVKEN-------------------IASVNGSISKDPIVALPNINSGSS-SG  259
             I D+++V K K++                   I + +G +++       N+   +S + 
Sbjct  226  TIVDNKLVNKGKDDSIQNADGMHKLVNKGKDDSIQNADGMLTEGSDGEAKNLGYETSPTS  285

Query  258  HDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesress  79
            H  K+E+   ++     N + E    SE  + +Q AAKR+RKPTKRYIEELSEVES++ S
Sbjct  286  HSSKMENHVTVSGKRFVNISAELDCGSEDLHTDQRAAKRIRKPTKRYIEELSEVESKDCS  345

Query  78   gksmssEKICGYKSTHP  28
             K  S  K  G + T P
Sbjct  346  PKVTSPVKSAGQRQTSP  362



>ref|XP_009372360.1| PREDICTED: uncharacterized protein LOC103961527 isoform X6 [Pyrus 
x bretschneideri]
Length=672

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 121/197 (61%), Gaps = 20/197 (10%)
 Frame = -2

Query  558  KPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSF  379
            KPD + LKGEICL+NL+++ELHE F+ATFGR+T+VKDK WLKRRI+M L+NSCD S T+F
Sbjct  166  KPDVNTLKGEICLDNLSIRELHELFRATFGRETTVKDKLWLKRRITMALTNSCDVSTTTF  225

Query  378  VIEDSRVVKKVKEN-------------------IASVNGSISKDPIVALPNINSGSS-SG  259
             I D+++V K K++                   I + +G +++       N+   +S + 
Sbjct  226  TIVDNKLVNKGKDDSIQNADGMHKLVNKGKDDSIQNADGMLTEGSDGEAKNLGYETSPTS  285

Query  258  HDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesress  79
            H  K+E+   ++     N + E    SE  + +Q AAKR+RKPTKRYIEELSEVES++ S
Sbjct  286  HSSKMENHVTVSGKRFVNISAELDCGSEDLHTDQRAAKRIRKPTKRYIEELSEVESKDCS  345

Query  78   gksmssEKICGYKSTHP  28
             K  S  K  G + T P
Sbjct  346  PKVTSPVKSAGQRQTSP  362



>ref|XP_009372359.1| PREDICTED: uncharacterized protein LOC103961527 isoform X5 [Pyrus 
x bretschneideri]
Length=703

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 121/197 (61%), Gaps = 20/197 (10%)
 Frame = -2

Query  558  KPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSF  379
            KPD + LKGEICL+NL+++ELHE F+ATFGR+T+VKDK WLKRRI+M L+NSCD S T+F
Sbjct  222  KPDVNTLKGEICLDNLSIRELHELFRATFGRETTVKDKLWLKRRITMALTNSCDVSTTTF  281

Query  378  VIEDSRVVKKVKEN-------------------IASVNGSISKDPIVALPNINSGSS-SG  259
             I D+++V K K++                   I + +G +++       N+   +S + 
Sbjct  282  TIVDNKLVNKGKDDSIQNADGMHKLVNKGKDDSIQNADGMLTEGSDGEAKNLGYETSPTS  341

Query  258  HDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesress  79
            H  K+E+   ++     N + E    SE  + +Q AAKR+RKPTKRYIEELSEVES++ S
Sbjct  342  HSSKMENHVTVSGKRFVNISAELDCGSEDLHTDQRAAKRIRKPTKRYIEELSEVESKDCS  401

Query  78   gksmssEKICGYKSTHP  28
             K  S  K  G + T P
Sbjct  402  PKVTSPVKSAGQRQTSP  418



>ref|NP_565045.1| myb family transcription factor TRFL6 [Arabidopsis thaliana]
 gb|AAK73986.1| At1g72650/F28P22_16 [Arabidopsis thaliana]
 gb|AAM70577.1| At1g72650/F28P22_16 [Arabidopsis thaliana]
 gb|AAS10010.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AEE35354.1| myb family transcription factor TRFL6 [Arabidopsis thaliana]
Length=624

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 100/156 (64%), Gaps = 16/156 (10%)
 Frame = -2

Query  573  AGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDF  394
            + A+ KPDFS+++GEICL+NL +K L ETF+ATFGRDT+VKDK WLKRRI+MGL NSCD 
Sbjct  219  SAAAQKPDFSRVRGEICLDNLPIKALQETFRATFGRDTTVKDKTWLKRRIAMGLINSCDV  278

Query  393  SCTSFVIEDSRVVKKVKENIASVNGSISK---DPIVALPNINSGSSSGHDDKVESPANIT  223
              T+  ++D++++   +E    V  +I K   D + A    ++ SS+ H   V   +N  
Sbjct  279  PTTNLRVKDNKLIGN-QEKSNDVTNAIRKEMGDDVRATKMKDAPSSTDH---VNGHSN--  332

Query  222  EGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
             GN           SE ++ EQ AAKRVRKPT+RYI
Sbjct  333  GGN-------HYYASEDYSSEQRAAKRVRKPTRRYI  361



>ref|XP_009372352.1| PREDICTED: uncharacterized protein LOC103961527 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009372353.1| PREDICTED: uncharacterized protein LOC103961527 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009372354.1| PREDICTED: uncharacterized protein LOC103961527 isoform X1 [Pyrus 
x bretschneideri]
Length=728

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 121/197 (61%), Gaps = 20/197 (10%)
 Frame = -2

Query  558  KPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSF  379
            KPD + LKGEICL+NL+++ELHE F+ATFGR+T+VKDK WLKRRI+M L+NSCD S T+F
Sbjct  222  KPDVNTLKGEICLDNLSIRELHELFRATFGRETTVKDKLWLKRRITMALTNSCDVSTTTF  281

Query  378  VIEDSRVVKKVKEN-------------------IASVNGSISKDPIVALPNINSGSS-SG  259
             I D+++V K K++                   I + +G +++       N+   +S + 
Sbjct  282  TIVDNKLVNKGKDDSIQNADGMHKLVNKGKDDSIQNADGMLTEGSDGEAKNLGYETSPTS  341

Query  258  HDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesress  79
            H  K+E+   ++     N + E    SE  + +Q AAKR+RKPTKRYIEELSEVES++ S
Sbjct  342  HSSKMENHVTVSGKRFVNISAELDCGSEDLHTDQRAAKRIRKPTKRYIEELSEVESKDCS  401

Query  78   gksmssEKICGYKSTHP  28
             K  S  K  G + T P
Sbjct  402  PKVTSPVKSAGQRQTSP  418



>ref|XP_009372357.1| PREDICTED: uncharacterized protein LOC103961527 isoform X3 [Pyrus 
x bretschneideri]
Length=715

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 121/197 (61%), Gaps = 20/197 (10%)
 Frame = -2

Query  558  KPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSF  379
            KPD + LKGEICL+NL+++ELHE F+ATFGR+T+VKDK WLKRRI+M L+NSCD S T+F
Sbjct  209  KPDVNTLKGEICLDNLSIRELHELFRATFGRETTVKDKLWLKRRITMALTNSCDVSTTTF  268

Query  378  VIEDSRVVKKVKEN-------------------IASVNGSISKDPIVALPNINSGSS-SG  259
             I D+++V K K++                   I + +G +++       N+   +S + 
Sbjct  269  TIVDNKLVNKGKDDSIQNADGMHKLVNKGKDDSIQNADGMLTEGSDGEAKNLGYETSPTS  328

Query  258  HDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesress  79
            H  K+E+   ++     N + E    SE  + +Q AAKR+RKPTKRYIEELSEVES++ S
Sbjct  329  HSSKMENHVTVSGKRFVNISAELDCGSEDLHTDQRAAKRIRKPTKRYIEELSEVESKDCS  388

Query  78   gksmssEKICGYKSTHP  28
             K  S  K  G + T P
Sbjct  389  PKVTSPVKSAGQRQTSP  405



>ref|XP_009372356.1| PREDICTED: uncharacterized protein LOC103961527 isoform X2 [Pyrus 
x bretschneideri]
Length=727

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 121/197 (61%), Gaps = 20/197 (10%)
 Frame = -2

Query  558  KPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSF  379
            KPD + LKGEICL+NL+++ELHE F+ATFGR+T+VKDK WLKRRI+M L+NSCD S T+F
Sbjct  222  KPDVNTLKGEICLDNLSIRELHELFRATFGRETTVKDKLWLKRRITMALTNSCDVSTTTF  281

Query  378  VIEDSRVVKKVKEN-------------------IASVNGSISKDPIVALPNINSGSS-SG  259
             I D+++V K K++                   I + +G +++       N+   +S + 
Sbjct  282  TIVDNKLVNKGKDDSIQNADGMHKLVNKGKDDSIQNADGMLTEGSDGEAKNLGYETSPTS  341

Query  258  HDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYIeelsevesress  79
            H  K+E+   ++     N + E    SE  + +Q AAKR+RKPTKRYIEELSEVES++ S
Sbjct  342  HSSKMENHVTVSGKRFVNISAELDCGSEDLHTDQRAAKRIRKPTKRYIEELSEVESKDCS  401

Query  78   gksmssEKICGYKSTHP  28
             K  S  K  G + T P
Sbjct  402  PKVTSPVKSAGQRQTSP  418



>ref|NP_974133.1| myb family transcription factor TRFL6 [Arabidopsis thaliana]
 gb|AEE35355.1| myb family transcription factor TRFL6 [Arabidopsis thaliana]
Length=630

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 100/156 (64%), Gaps = 16/156 (10%)
 Frame = -2

Query  573  AGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDF  394
            + A+ KPDFS+++GEICL+NL +K L ETF+ATFGRDT+VKDK WLKRRI+MGL NSCD 
Sbjct  225  SAAAQKPDFSRVRGEICLDNLPIKALQETFRATFGRDTTVKDKTWLKRRIAMGLINSCDV  284

Query  393  SCTSFVIEDSRVVKKVKENIASVNGSISK---DPIVALPNINSGSSSGHDDKVESPANIT  223
              T+  ++D++++   +E    V  +I K   D + A    ++ SS+ H   V   +N  
Sbjct  285  PTTNLRVKDNKLIGN-QEKSNDVTNAIRKEMGDDVRATKMKDAPSSTDH---VNGHSN--  338

Query  222  EGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
             GN           SE ++ EQ AAKRVRKPT+RYI
Sbjct  339  GGN-------HYYASEDYSSEQRAAKRVRKPTRRYI  367



>gb|AAG51859.1|AC010926_22 hypothetical protein; 60264-57191 [Arabidopsis thaliana]
Length=622

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 100/156 (64%), Gaps = 16/156 (10%)
 Frame = -2

Query  573  AGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDF  394
            + A+ KPDFS+++GEICL+NL +K L ETF+ATFGRDT+VKDK WLKRRI+MGL NSCD 
Sbjct  225  SAAAQKPDFSRVRGEICLDNLPIKALQETFRATFGRDTTVKDKTWLKRRIAMGLINSCDV  284

Query  393  SCTSFVIEDSRVVKKVKENIASVNGSISK---DPIVALPNINSGSSSGHDDKVESPANIT  223
              T+  ++D++++   +E    V  +I K   D + A    ++ SS+ H   V   +N  
Sbjct  285  PTTNLRVKDNKLIGN-QEKSNDVTNAIRKEMGDDVRATKMKDAPSSTDH---VNGHSN--  338

Query  222  EGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
             GN           SE ++ EQ AAKRVRKPT+RYI
Sbjct  339  GGN-------HYYASEDYSSEQRAAKRVRKPTRRYI  367



>ref|XP_010471292.1| PREDICTED: uncharacterized protein LOC104751114 isoform X1 [Camelina 
sativa]
 ref|XP_010471293.1| PREDICTED: uncharacterized protein LOC104751114 isoform X1 [Camelina 
sativa]
 ref|XP_010471294.1| PREDICTED: uncharacterized protein LOC104751114 isoform X1 [Camelina 
sativa]
Length=631

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 93/151 (62%), Gaps = 14/151 (9%)
 Frame = -2

Query  567  ASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSC  388
            A+ KPDFS+++GEICL++L +K L ETF+ATFGR+T+VKDK WLKRRI+MGL  SCD   
Sbjct  231  AAQKPDFSRVRGEICLDDLPIKALQETFRATFGRETTVKDKTWLKRRIAMGLVKSCDVPA  290

Query  387  TSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIP  208
            T+  I+D++++ K +E  + +   +SKD              G D +   P         
Sbjct  291  TNLTIKDNKLIGK-QEKSSVMTNVVSKD-------------MGDDVRATKPKEAPSSTDH  336

Query  207  NSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
             +  +    SE ++ EQ AAKRVRKPT+RYI
Sbjct  337  LNATDHYYASEDYSSEQRAAKRVRKPTRRYI  367



>ref|XP_010471295.1| PREDICTED: uncharacterized protein LOC104751114 isoform X2 [Camelina 
sativa]
Length=627

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 93/151 (62%), Gaps = 14/151 (9%)
 Frame = -2

Query  567  ASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSC  388
            A+ KPDFS+++GEICL++L +K L ETF+ATFGR+T+VKDK WLKRRI+MGL  SCD   
Sbjct  227  AAQKPDFSRVRGEICLDDLPIKALQETFRATFGRETTVKDKTWLKRRIAMGLVKSCDVPA  286

Query  387  TSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIP  208
            T+  I+D++++ K +E  + +   +SKD              G D +   P         
Sbjct  287  TNLTIKDNKLIGK-QEKSSVMTNVVSKD-------------MGDDVRATKPKEAPSSTDH  332

Query  207  NSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
             +  +    SE ++ EQ AAKRVRKPT+RYI
Sbjct  333  LNATDHYYASEDYSSEQRAAKRVRKPTRRYI  363



>ref|NP_001240101.1| uncharacterized protein LOC100775511 [Glycine max]
 ref|XP_006582881.1| PREDICTED: uncharacterized protein LOC100775511 isoform X1 [Glycine 
max]
 gb|ACT82840.1| transcription factor MYB884 [Glycine max]
 gb|KHN01395.1| Telomere repeat-binding protein 6 [Glycine soja]
Length=648

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 104/168 (62%), Gaps = 5/168 (3%)
 Frame = -2

Query  612  SDAFSENNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLK  433
            S+   E+   AS   ++ KPD S   GEICL+ L+++ELHE FK TFGR+T+VKDKQWLK
Sbjct  190  SEGVIESGSSASAVYSNLKPDLSMSDGEICLDKLSIRELHELFKVTFGRETTVKDKQWLK  249

Query  432  RRISMGLSNSCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHD  253
            RRI+M L+NSCD S T+F+I+++++V+K +E     +G+++   +++  N+         
Sbjct  250  RRIAMSLTNSCDVSATTFIIKNNKIVRKFEEE---SSGNMNAGSLISSGNMTEEEDVNFK  306

Query  252  DKVESPANITEGN--IPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            D     A   E N  +  +  E  +  E +   Q AAKR+R+PTKRYI
Sbjct  307  DSSAVNACGIEDNQVVSETRPEIGLEDENYQTGQRAAKRIRRPTKRYI  354



>ref|XP_010416024.1| PREDICTED: uncharacterized protein LOC104701948 isoform X4 [Camelina 
sativa]
Length=658

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 94/152 (62%), Gaps = 16/152 (11%)
 Frame = -2

Query  567  ASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSC  388
            A+ KPDFS+++GEICL++L +K L ETF+ATFGR+T+VKDK WLKRRI+MGL  SCD   
Sbjct  258  AAQKPDFSRVRGEICLDDLPIKALQETFRATFGRETTVKDKTWLKRRIAMGLVKSCDVPA  317

Query  387  TSFVIEDSRVV-KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNI  211
            T+  I+D++++ K+ K N+  +   +SKD              G D +   P +      
Sbjct  318  TNLTIKDNKLIGKQEKSNV--ITNVVSKD-------------MGDDVRATKPKDAPSSTD  362

Query  210  PNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
              +  +    SE ++ EQ  AKRVRKPT+RYI
Sbjct  363  HVNATDHYYASEDYSSEQRDAKRVRKPTRRYI  394



>ref|XP_008462322.1| PREDICTED: uncharacterized protein LOC103500701 isoform X3 [Cucumis 
melo]
Length=542

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 95/148 (64%), Gaps = 12/148 (8%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKG+ICL+NL+++EL E FKATFGRDT+VKDK WLKRRI+MGL+NSCD   +SF+
Sbjct  154  PDFSLLKGDICLDNLSIRELRECFKATFGRDTTVKDKSWLKRRIAMGLTNSCDIPASSFI  213

Query  375  IEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIPNST-  199
            I++ + V++   N+      +S  P     NI    S        +  ++   ++ +S  
Sbjct  214  IKEGKFVEESSPNVE----GMSTAPTAETLNIECRVSP-------TTYSLENKDLHHSED  262

Query  198  LEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            +E    SEG + E+ A KRVRKPT+RYI
Sbjct  263  MELDHGSEGQHDERAAVKRVRKPTRRYI  290



>ref|XP_004141697.1| PREDICTED: uncharacterized protein LOC101203003 [Cucumis sativus]
 ref|XP_004167883.1| PREDICTED: uncharacterized protein LOC101227459 [Cucumis sativus]
Length=609

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 95/148 (64%), Gaps = 12/148 (8%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKG++CL+NL+++EL E FKATFGRDT+VKDK WL+RRI MGL+NSCD   +SF+
Sbjct  221  PDFSLLKGDVCLDNLSIRELRECFKATFGRDTTVKDKSWLRRRIVMGLTNSCDIPVSSFI  280

Query  375  IEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIPNST-  199
            I++ + V+++  N+      +S  P     NI    S        S  ++   ++ +S  
Sbjct  281  IKEGKFVEEISPNVE----GLSTAPTAETLNIECRVSP-------STYSLENKDLHHSED  329

Query  198  LEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            +E    SEG + E+ A KRVRKPT+RYI
Sbjct  330  MELDHGSEGQHDERAAVKRVRKPTRRYI  357



>ref|XP_010416023.1| PREDICTED: uncharacterized protein LOC104701948 isoform X3 [Camelina 
sativa]
Length=672

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 94/152 (62%), Gaps = 16/152 (11%)
 Frame = -2

Query  567  ASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSC  388
            A+ KPDFS+++GEICL++L +K L ETF+ATFGR+T+VKDK WLKRRI+MGL  SCD   
Sbjct  272  AAQKPDFSRVRGEICLDDLPIKALQETFRATFGRETTVKDKTWLKRRIAMGLVKSCDVPA  331

Query  387  TSFVIEDSRVV-KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNI  211
            T+  I+D++++ K+ K N+  +   +SKD              G D +   P +      
Sbjct  332  TNLTIKDNKLIGKQEKSNV--ITNVVSKD-------------MGDDVRATKPKDAPSSTD  376

Query  210  PNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
              +  +    SE ++ EQ  AKRVRKPT+RYI
Sbjct  377  HVNATDHYYASEDYSSEQRDAKRVRKPTRRYI  408



>ref|XP_010416020.1| PREDICTED: uncharacterized protein LOC104701948 isoform X1 [Camelina 
sativa]
 ref|XP_010416022.1| PREDICTED: uncharacterized protein LOC104701948 isoform X2 [Camelina 
sativa]
Length=676

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 94/152 (62%), Gaps = 16/152 (11%)
 Frame = -2

Query  567  ASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSC  388
            A+ KPDFS+++GEICL++L +K L ETF+ATFGR+T+VKDK WLKRRI+MGL  SCD   
Sbjct  276  AAQKPDFSRVRGEICLDDLPIKALQETFRATFGRETTVKDKTWLKRRIAMGLVKSCDVPA  335

Query  387  TSFVIEDSRVV-KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNI  211
            T+  I+D++++ K+ K N+  +   +SKD              G D +   P +      
Sbjct  336  TNLTIKDNKLIGKQEKSNV--ITNVVSKD-------------MGDDVRATKPKDAPSSTD  380

Query  210  PNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
              +  +    SE ++ EQ  AKRVRKPT+RYI
Sbjct  381  HVNATDHYYASEDYSSEQRDAKRVRKPTRRYI  412



>ref|XP_008462320.1| PREDICTED: uncharacterized protein LOC103500701 isoform X2 [Cucumis 
melo]
 ref|XP_008462321.1| PREDICTED: uncharacterized protein LOC103500701 isoform X2 [Cucumis 
melo]
Length=559

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 95/148 (64%), Gaps = 12/148 (8%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKG+ICL+NL+++EL E FKATFGRDT+VKDK WLKRRI+MGL+NSCD   +SF+
Sbjct  171  PDFSLLKGDICLDNLSIRELRECFKATFGRDTTVKDKSWLKRRIAMGLTNSCDIPASSFI  230

Query  375  IEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIPNST-  199
            I++ + V++   N+      +S  P     NI    S        +  ++   ++ +S  
Sbjct  231  IKEGKFVEESSPNVE----GMSTAPTAETLNIECRVSP-------TTYSLENKDLHHSED  279

Query  198  LEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            +E    SEG + E+ A KRVRKPT+RYI
Sbjct  280  MELDHGSEGQHDERAAVKRVRKPTRRYI  307



>ref|XP_010428154.1| PREDICTED: uncharacterized protein LOC104712871 [Camelina sativa]
Length=654

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 98/154 (64%), Gaps = 20/154 (13%)
 Frame = -2

Query  567  ASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSC  388
            A+ KPDFS+++GEICL++L +K L ETF+ATFGR+T+VKDK WLKRRI+MGL  SCD   
Sbjct  254  AAQKPDFSRVRGEICLDDLPIKALQETFRATFGRETTVKDKTWLKRRIAMGLVKSCDVPA  313

Query  387  TSFVIEDSRVVKKVKENIASVNGSISK---DPIVALPNINSGSSSGHDDKVESPANITEG  217
            T+  I+D++++ K +E  + +   +SK   D + A    ++ SS+ H        N T  
Sbjct  314  TNLTIKDNKLIGK-QEKSSVMTNVVSKDMCDDVRATKPKDAPSSTDH-------VNAT--  363

Query  216  NIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
                   +    SE ++ EQ AAKRVRKPT+RYI
Sbjct  364  -------DHYYASEDYSSEQRAAKRVRKPTRRYI  390



>ref|XP_008462318.1| PREDICTED: uncharacterized protein LOC103500701 isoform X1 [Cucumis 
melo]
 ref|XP_008462319.1| PREDICTED: uncharacterized protein LOC103500701 isoform X1 [Cucumis 
melo]
Length=598

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 95/148 (64%), Gaps = 12/148 (8%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKG+ICL+NL+++EL E FKATFGRDT+VKDK WLKRRI+MGL+NSCD   +SF+
Sbjct  210  PDFSLLKGDICLDNLSIRELRECFKATFGRDTTVKDKSWLKRRIAMGLTNSCDIPASSFI  269

Query  375  IEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIPNST-  199
            I++ + V++   N+      +S  P     NI    S        +  ++   ++ +S  
Sbjct  270  IKEGKFVEESSPNVE----GMSTAPTAETLNIECRVSP-------TTYSLENKDLHHSED  318

Query  198  LEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            +E    SEG + E+ A KRVRKPT+RYI
Sbjct  319  MELDHGSEGQHDERAAVKRVRKPTRRYI  346



>ref|XP_006300624.1| hypothetical protein CARUB_v10019876mg [Capsella rubella]
 gb|EOA33522.1| hypothetical protein CARUB_v10019876mg [Capsella rubella]
Length=708

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 94/151 (62%), Gaps = 16/151 (11%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            + KPDFS+++G+ICL+NL +K L ETF+ATFGR+T+VKDK WLKRRI+MGL NSCD   T
Sbjct  286  AQKPDFSRVRGDICLDNLPIKALQETFRATFGRETTVKDKTWLKRRIAMGLINSCDVPAT  345

Query  384  SFVIEDSRVV-KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIP  208
            +  I+D+++V  + K N+  +   ISKD              G D +   P +       
Sbjct  346  NLTIKDNKLVGNQEKSNV--MTNVISKD-------------MGDDVRAAKPKDAPSSIDH  390

Query  207  NSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
             +  +    SE ++ EQ AAKRVRKPT+RYI
Sbjct  391  VNASDHYYASEDYSSEQRAAKRVRKPTRRYI  421



>gb|KGN45496.1| hypothetical protein Csa_7G450550 [Cucumis sativus]
Length=854

 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 95/148 (64%), Gaps = 12/148 (8%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKG++CL+NL+++EL E FKATFGRDT+VKDK WL+RRI MGL+NSCD   +SF+
Sbjct  520  PDFSLLKGDVCLDNLSIRELRECFKATFGRDTTVKDKSWLRRRIVMGLTNSCDIPVSSFI  579

Query  375  IEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIPNST-  199
            I++ + V+++  N+      +S  P     NI    S        S  ++   ++ +S  
Sbjct  580  IKEGKFVEEISPNVE----GLSTAPTAETLNIECRVSP-------STYSLENKDLHHSED  628

Query  198  LEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            +E    SEG + E+ A KRVRKPT+RYI
Sbjct  629  MELDHGSEGQHDERAAVKRVRKPTRRYI  656



>ref|XP_006390637.1| hypothetical protein EUTSA_v10018282mg [Eutrema salsugineum]
 gb|ESQ27923.1| hypothetical protein EUTSA_v10018282mg [Eutrema salsugineum]
Length=623

 Score =   123 bits (308),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 99/159 (62%), Gaps = 18/159 (11%)
 Frame = -2

Query  570  GASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFS  391
             A+ KPDFS ++GEICL+NL +K L ETF+ATFGR+T+VKDK WLKRRI+MGL NSC+  
Sbjct  203  AAAQKPDFSLVRGEICLDNLPIKALQETFRATFGRETTVKDKTWLKRRITMGLVNSCNVP  262

Query  390  CTSFVIEDSRVVKKVKENIASVNGSISK---DPIVALPNINSGSSSGHDDKVESPANITE  220
             T+  IED+++V+  +E    V  ++S+   D + A    ++ SS+ H            
Sbjct  263  TTNLTIEDNKLVRN-QEKSNDVTDAVSEDMGDDVRATNLKDAPSSTDH----------MN  311

Query  219  GNIPNS----TLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            GN   S    ++     SE  + E+ AAKRVRKPT+RYI
Sbjct  312  GNPKASGHSLSVNHYCASEDFSCEERAAKRVRKPTRRYI  350



>ref|XP_010685325.1| PREDICTED: uncharacterized protein LOC104899762 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=609

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 93/155 (60%), Gaps = 18/155 (12%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS +KGEI L+ L+++ELHETF+ATFGR TS KDK WLKRRI MGL+NSCD S TSF 
Sbjct  168  PDFSLIKGEIDLDTLSIRELHETFRATFGRRTSAKDKMWLKRRIVMGLTNSCDVSVTSFQ  227

Query  375  IEDSRVVKKVKENI------ASVNGSISKDPIVALPNINSGSSSGHD--DKVESPANITE  220
            I D +++KK +E         SV G I         N+ + S+   D  D VE   ++TE
Sbjct  228  INDGKLLKKEEELSKKLDCEESVAGEICNAGDDGPVNLVACSNLREDIVDDVELRNSLTE  287

Query  219  GNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
                     GC   + H  E  A KRVRKPTKRYI
Sbjct  288  S--------GCGSDDNH--EHRAVKRVRKPTKRYI  312



>ref|XP_010685324.1| PREDICTED: uncharacterized protein LOC104899762 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=619

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 93/155 (60%), Gaps = 18/155 (12%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS +KGEI L+ L+++ELHETF+ATFGR TS KDK WLKRRI MGL+NSCD S TSF 
Sbjct  178  PDFSLIKGEIDLDTLSIRELHETFRATFGRRTSAKDKMWLKRRIVMGLTNSCDVSVTSFQ  237

Query  375  IEDSRVVKKVKENI------ASVNGSISKDPIVALPNINSGSSSGHD--DKVESPANITE  220
            I D +++KK +E         SV G I         N+ + S+   D  D VE   ++TE
Sbjct  238  INDGKLLKKEEELSKKLDCEESVAGEICNAGDDGPVNLVACSNLREDIVDDVELRNSLTE  297

Query  219  GNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
                     GC   + H  E  A KRVRKPTKRYI
Sbjct  298  S--------GCGSDDNH--EHRAVKRVRKPTKRYI  322



>gb|AEV91171.1| MYB-related protein [Triticum aestivum]
Length=643

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 95/160 (59%), Gaps = 18/160 (11%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS L+GE+CL+NLT++EL E F+ATFGR+T+VKDK WLKRRI+MGL+NSCD   +  V
Sbjct  198  PDFSILRGEVCLDNLTIRELQEAFRATFGRETTVKDKLWLKRRITMGLTNSCDVQSSGCV  257

Query  375  IEDSRVV-KKVKENIASVNG----SISKDPIVALPNINSG--------SSSGHDDKVESP  235
            ++D ++V K  K  + ++ G     +    +V    + SG        S    +D+  S 
Sbjct  258  VKDYKIVCKDAKHKLPTIEGLPKVEVEATSLVRFQVLGSGNERDTSSCSYYRSEDQQRSS  317

Query  234  ANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
              +   +  N   EG +       EQ AAKR+RKPTKRYI
Sbjct  318  NRLKGVSTDNDESEGTLQD-----EQGAAKRLRKPTKRYI  352



>ref|XP_009403376.1| PREDICTED: uncharacterized protein LOC103986942 isoform X3 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009403377.1| PREDICTED: uncharacterized protein LOC103986942 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=543

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 92/153 (60%), Gaps = 6/153 (4%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS L+GEICL+N +++EL E F+ TFGR TSVKDK WLKRRI+MGL+NSC    TSF 
Sbjct  98   PDFSILRGEICLDNFSIRELQEAFRTTFGRQTSVKDKLWLKRRIAMGLTNSCHVPSTSFT  157

Query  375  IEDSRVVKKVKENIASVNGSISKDPIVALP-NINSGSSSGHDDKVESPANITEGNIPNST  199
            I+D++++    +         SK+   +L  NI+  ++S  D K     N+T+  +    
Sbjct  158  IKDNKIILSEAKEGEPERLQQSKNEAESLSMNIHLINASSQDFKTTLNNNMTDQQLSGKR  217

Query  198  L-----EGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            L        +  E   ME  AAKR+RKPTKRYI
Sbjct  218  LGLSPSNHDVNDENCQMEHCAAKRMRKPTKRYI  250



>gb|EMT24643.1| hypothetical protein F775_05862 [Aegilops tauschii]
Length=1068

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 95/160 (59%), Gaps = 18/160 (11%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS L+GE+CL+NLT++EL E F+ATFGR+T+VKDK WLKRRI+MGL+NSCD   +  V
Sbjct  345  PDFSILRGEVCLDNLTIRELQEAFRATFGRETTVKDKLWLKRRITMGLTNSCDVQSSGCV  404

Query  375  IEDSRVV-KKVKENIASVNG----SISKDPIVALPNINSG--------SSSGHDDKVESP  235
            ++D ++V K  K  + ++ G     +    +V    + SG        S    +D+  S 
Sbjct  405  VKDYKIVCKDAKHKLPTIEGLPKVEVEATSLVRFQVLGSGNERDTSSCSYYRSEDQQRSS  464

Query  234  ANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
              +   +  N   EG +       EQ AAKR+RKPTKRYI
Sbjct  465  NRLKGVSTDNDESEGTLQD-----EQGAAKRLRKPTKRYI  499



>ref|XP_004954094.1| PREDICTED: uncharacterized protein LOC101768713 isoform X2 [Setaria 
italica]
Length=587

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 99/169 (59%), Gaps = 31/169 (18%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S+ PDFS L+GE+CL++LT++EL E F+ATFGR T+VKDK WLKRRI+MGL+NSCD   +
Sbjct  192  SYVPDFSILRGEVCLDDLTIRELQEAFRATFGRQTTVKDKIWLKRRITMGLTNSCDVPSS  251

Query  384  SFVIEDSRVV-KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIP  208
              V++D ++V K V++ +++  G         +P I   S+    D+V  P N  EG+ P
Sbjct  252  GCVVKDYKIVGKDVRQEVSNTGG---------IPKIGLQSTLVR-DQVTYPGN--EGDSP  299

Query  207  NSTLEGCIVSEG----------HNME--------QTAAKRVRKPTKRYI  115
            +S+       +G          HN E        Q   KR RKPTKRYI
Sbjct  300  SSSYYQSEDQQGSSKRFKRVPIHNDEPQGNLLAGQCTNKRTRKPTKRYI  348



>ref|XP_009403371.1| PREDICTED: uncharacterized protein LOC103986942 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009403372.1| PREDICTED: uncharacterized protein LOC103986942 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009403373.1| PREDICTED: uncharacterized protein LOC103986942 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=655

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 92/153 (60%), Gaps = 6/153 (4%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS L+GEICL+N +++EL E F+ TFGR TSVKDK WLKRRI+MGL+NSC    TSF 
Sbjct  210  PDFSILRGEICLDNFSIRELQEAFRTTFGRQTSVKDKLWLKRRIAMGLTNSCHVPSTSFT  269

Query  375  IEDSRVVKKVKENIASVNGSISKDPIVALP-NINSGSSSGHDDKVESPANITEGNIPNST  199
            I+D++++    +         SK+   +L  NI+  ++S  D K     N+T+  +    
Sbjct  270  IKDNKIILSEAKEGEPERLQQSKNEAESLSMNIHLINASSQDFKTTLNNNMTDQQLSGKR  329

Query  198  L-----EGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            L        +  E   ME  AAKR+RKPTKRYI
Sbjct  330  LGLSPSNHDVNDENCQMEHCAAKRMRKPTKRYI  362



>emb|CDM85538.1| unnamed protein product [Triticum aestivum]
Length=643

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 96/160 (60%), Gaps = 18/160 (11%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS L+GE+CL+NLT++EL E F+ATFGR+T+VKDK WLKRRI+MGL+NSCD   +  V
Sbjct  198  PDFSILRGEVCLDNLTIRELQEAFRATFGRETTVKDKLWLKRRITMGLTNSCDVQSSGCV  257

Query  375  IEDSRVV-KKVKENIASVNG---------SISKDPIVALPNINSGSSSGH---DDKVESP  235
            ++D ++V K  K  + ++ G         S+ +  ++   N     S  +   +D+  S 
Sbjct  258  VKDYKIVCKDAKHELPTIEGIPKAEVEATSLVRYQVLGPGNERDTPSCSYYRSEDQQRSS  317

Query  234  ANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
              +   +  N   EG +       EQ AAKR+RKPTKRYI
Sbjct  318  NRLKGVSTDNDESEGTLQD-----EQGAAKRLRKPTKRYI  352



>ref|XP_009403374.1| PREDICTED: uncharacterized protein LOC103986942 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=644

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 92/153 (60%), Gaps = 6/153 (4%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS L+GEICL+N +++EL E F+ TFGR TSVKDK WLKRRI+MGL+NSC    TSF 
Sbjct  199  PDFSILRGEICLDNFSIRELQEAFRTTFGRQTSVKDKLWLKRRIAMGLTNSCHVPSTSFT  258

Query  375  IEDSRVVKKVKENIASVNGSISKDPIVALP-NINSGSSSGHDDKVESPANITEGNIPNST  199
            I+D++++    +         SK+   +L  NI+  ++S  D K     N+T+  +    
Sbjct  259  IKDNKIILSEAKEGEPERLQQSKNEAESLSMNIHLINASSQDFKTTLNNNMTDQQLSGKR  318

Query  198  L-----EGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            L        +  E   ME  AAKR+RKPTKRYI
Sbjct  319  LGLSPSNHDVNDENCQMEHCAAKRMRKPTKRYI  351



>ref|XP_004954093.1| PREDICTED: uncharacterized protein LOC101768713 isoform X1 [Setaria 
italica]
Length=623

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 99/169 (59%), Gaps = 31/169 (18%)
 Frame = -2

Query  564  SWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCT  385
            S+ PDFS L+GE+CL++LT++EL E F+ATFGR T+VKDK WLKRRI+MGL+NSCD   +
Sbjct  192  SYVPDFSILRGEVCLDDLTIRELQEAFRATFGRQTTVKDKIWLKRRITMGLTNSCDVPSS  251

Query  384  SFVIEDSRVV-KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIP  208
              V++D ++V K V++ +++  G         +P I   S+    D+V  P N  EG+ P
Sbjct  252  GCVVKDYKIVGKDVRQEVSNTGG---------IPKIGLQSTLVR-DQVTYPGN--EGDSP  299

Query  207  NSTLEGCIVSEG----------HNME--------QTAAKRVRKPTKRYI  115
            +S+       +G          HN E        Q   KR RKPTKRYI
Sbjct  300  SSSYYQSEDQQGSSKRFKRVPIHNDEPQGNLLAGQCTNKRTRKPTKRYI  348



>ref|XP_009104846.1| PREDICTED: uncharacterized protein LOC103830781 isoform X2 [Brassica 
rapa]
Length=586

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 94/159 (59%), Gaps = 24/159 (15%)
 Frame = -2

Query  582  ASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS  403
            A+    + +PDFS ++GEICL NL +K L ETFKATFGR+T+VKDK WLKRRI+MGL+NS
Sbjct  195  AAPPATAQRPDFSLVRGEICLNNLPIKALQETFKATFGRETTVKDKTWLKRRITMGLTNS  254

Query  402  CDFSCTSFVIEDSRVV---KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPA  232
            C+   T+  I +S++V    K  +    V  +  KD     P  ++ +++GH        
Sbjct  255  CNVPTTNLRITNSKLVGNQDKANDLTDDVRATNLKD----APPSSTDNANGH--------  302

Query  231  NITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
                     S   G  ++E  + E+ AAKRVRKPT+RYI
Sbjct  303  ---------SNASGHSLTEDFSSEERAAKRVRKPTRRYI  332



>ref|XP_009104845.1| PREDICTED: uncharacterized protein LOC103830781 isoform X1 [Brassica 
rapa]
Length=592

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 94/159 (59%), Gaps = 24/159 (15%)
 Frame = -2

Query  582  ASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS  403
            A+    + +PDFS ++GEICL NL +K L ETFKATFGR+T+VKDK WLKRRI+MGL+NS
Sbjct  201  AAPPATAQRPDFSLVRGEICLNNLPIKALQETFKATFGRETTVKDKTWLKRRITMGLTNS  260

Query  402  CDFSCTSFVIEDSRVV---KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPA  232
            C+   T+  I +S++V    K  +    V  +  KD     P  ++ +++GH        
Sbjct  261  CNVPTTNLRITNSKLVGNQDKANDLTDDVRATNLKD----APPSSTDNANGH--------  308

Query  231  NITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
                     S   G  ++E  + E+ AAKRVRKPT+RYI
Sbjct  309  ---------SNASGHSLTEDFSSEERAAKRVRKPTRRYI  338



>ref|XP_009105586.1| PREDICTED: uncharacterized protein LOC103831454 [Brassica rapa]
Length=592

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 94/159 (59%), Gaps = 24/159 (15%)
 Frame = -2

Query  582  ASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS  403
            A+    + +PDFS ++GEICL NL +K L ETFKATFGR+T+VKDK WLKRRI+MGL+NS
Sbjct  201  AAPPATAQRPDFSLVRGEICLNNLPIKALQETFKATFGRETTVKDKTWLKRRITMGLTNS  260

Query  402  CDFSCTSFVIEDSRVV---KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPA  232
            C+   T+  I +S++V    K  +    V  +  KD     P  ++ +++GH        
Sbjct  261  CNVPTTNLRITNSKLVGNQDKANDLTDDVRATNLKD----APPSSTDNANGH--------  308

Query  231  NITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
                     S   G  ++E  + E+ AAKRVRKPT+RYI
Sbjct  309  ---------SNASGHSLTEDFSSEERAAKRVRKPTRRYI  338



>emb|CDX68258.1| BnaA07g22980D [Brassica napus]
Length=592

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 94/159 (59%), Gaps = 24/159 (15%)
 Frame = -2

Query  582  ASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS  403
            A+    + +PDFS ++GEICL NL +K L ETFKATFGR+T+VKDK WLKRRI+MGL+NS
Sbjct  201  AAPPATAQRPDFSLVRGEICLNNLPIKALQETFKATFGRETTVKDKTWLKRRITMGLTNS  260

Query  402  CDFSCTSFVIEDSRVV---KKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPA  232
            C+   T+  I +S++V    K  +    V  +  KD     P  ++ +++GH        
Sbjct  261  CNVPTTNLRITNSKLVGNQDKANDLTDDVRATNLKD----APPSSTDNANGH--------  308

Query  231  NITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
                     S   G  ++E  + E+ AAKRVRKPT+RYI
Sbjct  309  ---------SNASGHSLTEDFSSEERAAKRVRKPTRRYI  338



>gb|AGT15966.1| MYB-related protein [Saccharum hybrid cultivar R570]
 gb|AGT16635.1| MYB-related protein [Saccharum hybrid cultivar R570]
Length=565

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 98/156 (63%), Gaps = 14/156 (9%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS L+GE+CL++LT++EL E F+ATFGR T+VKDK WLKRRI+MGL+NSCD   +  V
Sbjct  137  PDFSILRGEVCLDDLTIRELQEAFRATFGRQTTVKDKIWLKRRITMGLTNSCDVPSSGCV  196

Query  375  IEDSRVV-KKVKENIASVN----GSISKDPIVALPN--INSGSSSGH--DDKVESPANIT  223
            ++D ++V K  K++I+ ++      +    +V  P    +S SSS +  +D+ +S   + 
Sbjct  197  VKDYKIVGKDAKKDISDMDERDKTGLRATSLVIYPGNEGDSPSSSYYQSEDQQDSSKRVK  256

Query  222  EGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
               I N   +G ++      EQ   KR RKPTKRYI
Sbjct  257  RVQIHNDEPQGNLLG-----EQCTNKRTRKPTKRYI  287



>gb|AGT16747.1| MYB-related protein [Saccharum hybrid cultivar R570]
Length=604

 Score =   117 bits (292),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 98/156 (63%), Gaps = 14/156 (9%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS L+GE+CL++LT++EL E F+ATFGR T+VKDK WLKRRI+MGL+NSCD   +  V
Sbjct  183  PDFSILRGEVCLDDLTIRELQEAFRATFGRQTTVKDKIWLKRRITMGLTNSCDVPSSGCV  242

Query  375  IEDSRVV-KKVKENIASVN----GSISKDPIVALP--NINSGSSSGH--DDKVESPANIT  223
            ++D ++V K  K++I+ ++      +    +V  P    +S SSS +  +D+ +S   + 
Sbjct  243  VKDYKIVGKDAKKDISDMDERDKTGLRATSLVIYPGNEGDSPSSSYYQSEDQQDSSKRVK  302

Query  222  EGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
               I N   +G ++      EQ   KR RKPTKRYI
Sbjct  303  RVQIHNDEPQGNLLG-----EQCTNKRTRKPTKRYI  333



>gb|AGT16617.1| MYB-related protein [Saccharum hybrid cultivar R570]
Length=606

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 98/156 (63%), Gaps = 14/156 (9%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS L+GE+CL++LT++EL E F+ATFGR T+VKDK WLKRRI+MGL+NSCD   +  V
Sbjct  185  PDFSILRGEVCLDDLTIRELQEAFRATFGRQTTVKDKIWLKRRITMGLTNSCDVPSSGCV  244

Query  375  IEDSRVV-KKVKENIASVN----GSISKDPIVALP--NINSGSSSGH--DDKVESPANIT  223
            ++D ++V K  K++I+ ++      +    +V  P    +S SSS +  +D+ +S   + 
Sbjct  245  VKDYKIVGKDAKKDISDMDERDKTGLRATSLVIYPGNEGDSPSSSYYQSEDQQDSSKRVK  304

Query  222  EGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
               I N   +G ++      EQ   KR RKPTKRYI
Sbjct  305  RVQIHNDEPQGNLLG-----EQCTNKRTRKPTKRYI  335



>gb|AGT16702.1| MYB-related protein [Saccharum hybrid cultivar R570]
Length=625

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 98/156 (63%), Gaps = 14/156 (9%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS L+GE+CL++LT++EL E F+ATFGR T+VKDK WLKRRI+MGL+NSCD   +  V
Sbjct  197  PDFSILRGEVCLDDLTIRELQEAFRATFGRQTTVKDKIWLKRRITMGLTNSCDVPSSGCV  256

Query  375  IEDSRVV-KKVKENIASVN----GSISKDPIVALP--NINSGSSSGH--DDKVESPANIT  223
            ++D ++V K  K++I+ ++      +    +V  P    +S SSS +  +D+ +S   + 
Sbjct  257  VKDYKIVGKDAKKDISDMDERDKTGLRATSLVIYPGNEGDSPSSSYYQSEDQQDSSKRVK  316

Query  222  EGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
               I N   +G ++      EQ   KR RKPTKRYI
Sbjct  317  RVQIHNDEPQGNLLG-----EQCTNKRTRKPTKRYI  347



>gb|AGT16112.1| MYB-related protein [Saccharum hybrid cultivar R570]
 gb|AGT16581.1| MYB-related protein [Saccharum hybrid cultivar R570]
 gb|AGT16652.1| MYB-related protein [Saccharum hybrid cultivar R570]
Length=624

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 98/156 (63%), Gaps = 14/156 (9%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS L+GE+CL++LT++EL E F+ATFGR T+VKDK WLKRRI+MGL+NSCD   +  V
Sbjct  197  PDFSILRGEVCLDDLTIRELQEAFRATFGRQTTVKDKIWLKRRITMGLTNSCDVPSSGCV  256

Query  375  IEDSRVV-KKVKENIASVN----GSISKDPIVALP--NINSGSSSGH--DDKVESPANIT  223
            ++D ++V K  K++I+ ++      +    +V  P    +S SSS +  +D+ +S   + 
Sbjct  257  VKDYKIVGKDAKKDISDMDERDKTGLRATSLVIYPGNEGDSPSSSYYQSEDQQDSSKRVK  316

Query  222  EGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
               I N   +G ++      EQ   KR RKPTKRYI
Sbjct  317  RVQIHNDEPQGNLLG-----EQCTNKRTRKPTKRYI  347



>gb|AGT16716.1| MYB-related protein [Saccharum hybrid cultivar R570]
 gb|AGT16939.1| MYB-related protein [Saccharum hybrid cultivar R570]
Length=624

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 98/156 (63%), Gaps = 14/156 (9%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS L+GE+CL++LT++EL E F+ATFGR T+VKDK WLKRRI+MGL+NSCD   +  V
Sbjct  197  PDFSILRGEVCLDDLTIRELQEAFRATFGRQTTVKDKIWLKRRITMGLTNSCDVPSSGCV  256

Query  375  IEDSRVV-KKVKENIASVN----GSISKDPIVALP--NINSGSSSGH--DDKVESPANIT  223
            ++D ++V K  K++I+ ++      +    +V  P    +S SSS +  +D+ +S   + 
Sbjct  257  VKDYKIVGKDAKKDISDMDERDKTGLRATSLVIYPGNEGDSPSSSYYQSEDQQDSSKRVK  316

Query  222  EGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
               I N   +G ++      EQ   KR RKPTKRYI
Sbjct  317  RVQIHNDEPQGNLLG-----EQCTNKRTRKPTKRYI  347



>gb|AGT16673.1| MYB-related protein [Saccharum hybrid cultivar R570]
Length=624

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 98/156 (63%), Gaps = 14/156 (9%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS L+GE+CL++LT++EL E F+ATFGR T+VKDK WLKRRI+MGL+NSCD   +  V
Sbjct  197  PDFSILRGEVCLDDLTIRELQEAFRATFGRQTTVKDKIWLKRRITMGLTNSCDVPSSGCV  256

Query  375  IEDSRVV-KKVKENIASVN----GSISKDPIVALP--NINSGSSSGH--DDKVESPANIT  223
            ++D ++V K  K++I+ ++      +    +V  P    +S SSS +  +D+ +S   + 
Sbjct  257  VKDYKIVGKDAKKDISDMDERDKTGLRATSLVIYPGNEGDSPSSSYYQSEDQQDSSKRVK  316

Query  222  EGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
               I N   +G ++      EQ   KR RKPTKRYI
Sbjct  317  RVQIHNDEPQGNLLG-----EQCTNKRTRKPTKRYI  347



>emb|CDX72932.1| BnaC06g33800D [Brassica napus]
Length=595

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 95/153 (62%), Gaps = 10/153 (7%)
 Frame = -2

Query  573  AGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDF  394
            A AS KPDF+ ++GEICL+NL +K L ETF+ATFGR+T+VKDK WLKRRI+MGL+ S D 
Sbjct  195  AAASQKPDFALVRGEICLDNLPIKALQETFRATFGRETTVKDKTWLKRRITMGLTKSFDV  254

Query  393  SCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGN  214
              T+  I+D+++V  +K+    V+  +    +   P+ ++   +GH           + +
Sbjct  255  PTTNLTIKDNKLV-GIKDKSNDVSDDVRATNVKEAPSSSAYHVNGHS---------KDAS  304

Query  213  IPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
              +  +     +E  + E+ AAKRVRKPT+RYI
Sbjct  305  AHSLGVNHYWATEDLSCEERAAKRVRKPTRRYI  337



>ref|XP_009402132.1| PREDICTED: uncharacterized protein LOC103985999 [Musa acuminata 
subsp. malaccensis]
Length=659

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 93/153 (61%), Gaps = 8/153 (5%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS L+GEICL+N +++EL E F+ATFGR TSVKDK WLKRRI+MGL+NSC      F 
Sbjct  213  PDFSILRGEICLDNFSIRELQEAFRATFGRHTSVKDKLWLKRRIAMGLTNSCHVPTARFT  272

Query  375  IEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIPNSTL  196
            I+D++++    +  A +  S  +   +++ +I++ + S  D K      +    +    L
Sbjct  273  IKDNKIILSDLKEPARLQQSTIETESLSM-DIHATNVSPRDIKTCLNNQMEFQQVSGKRL  331

Query  195  EGCIVS------EGHNMEQTAAKRVRKPTKRYI  115
             G + S      E   MEQ AAKR+RKPTKRYI
Sbjct  332  -GVLPSNDDVKDENIQMEQCAAKRMRKPTKRYI  363



>gb|AGT16984.1| MYB-related protein [Saccharum hybrid cultivar R570]
Length=624

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 98/156 (63%), Gaps = 14/156 (9%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS L+GE+CL++LT++EL E F+ATFGR T+VKDK WLKRRI+MGL+NSC+   +  V
Sbjct  197  PDFSILRGEVCLDDLTIRELQEAFRATFGRQTTVKDKIWLKRRITMGLTNSCNVPSSGCV  256

Query  375  IEDSRVV-KKVKENIASVN----GSISKDPIVALP--NINSGSSSGH--DDKVESPANIT  223
            ++D ++V K  K++I+ ++      +    +V  P    +S SSS +  +D+ +S   + 
Sbjct  257  VKDYKIVGKDAKKDISDMDERDKTGLRATSLVIYPGNEGDSPSSSYYQSEDQQDSSKRVK  316

Query  222  EGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
               I N   +G ++      EQ   KR RKPTKRYI
Sbjct  317  RVQIHNDEPQGNLLG-----EQCTNKRTRKPTKRYI  347



>gb|EMS60332.1| Telomere repeat-binding protein 4 [Triticum urartu]
Length=942

 Score =   115 bits (289),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 95/160 (59%), Gaps = 18/160 (11%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS L+GE+ L+NLT++EL E F+ATFGR+T+VKDK WLKRRI+MGL+NSCD   +  V
Sbjct  212  PDFSILRGEVSLDNLTIRELQEAFRATFGRETTVKDKLWLKRRITMGLTNSCDVQSSGCV  271

Query  375  IEDSRVV-KKVKENIASVNG---------SISKDPIVALPNINSGSSSGH---DDKVESP  235
            ++D ++V K  K  + ++ G         S+ +  ++   N     S  +   +D+  S 
Sbjct  272  VKDYKIVCKDAKHELPTIGGIPKAEVEATSLVRYQVLGPGNERDTPSCSYYRSEDQQRSS  331

Query  234  ANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
              +   +  N   EG +       EQ AAKR+RKPTKRYI
Sbjct  332  NRLKGVSTDNDESEGTLQD-----EQGAAKRLRKPTKRYI  366



>emb|CDY11162.1| BnaC06g24140D [Brassica napus]
Length=556

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 86/148 (58%), Gaps = 31/148 (21%)
 Frame = -2

Query  558  KPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSF  379
            +PDFS ++GEICL NL +K L ETFKATFGR T+V DK WLKRRI+MGL+NSC+   T+ 
Sbjct  187  RPDFSLVRGEICLNNLPIKALQETFKATFGRATTVTDKTWLKRRITMGLTNSCNVPTTNL  246

Query  378  VIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIPNST  199
             ++D    KK+ EN    N              ++ SS+ H D              +S 
Sbjct  247  TVKD----KKLVENQDKAN--------------DAPSSTDHADG-------------HSN  275

Query  198  LEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
              G  ++E  + E+ AAKRVRKPT+RYI
Sbjct  276  ASGHSLTEDFSSEERAAKRVRKPTRRYI  303



>ref|XP_003570524.1| PREDICTED: uncharacterized protein LOC100846611 [Brachypodium 
distachyon]
Length=627

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 94/160 (59%), Gaps = 18/160 (11%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS L+GE+ L+ LT++EL E F+ATFGR T+VKDK WLKRRI+MGL++SCD   +  V
Sbjct  197  PDFSILRGEVFLDTLTIRELQEAFRATFGRQTTVKDKLWLKRRITMGLTHSCDVPSSGCV  256

Query  375  IEDSRVV-KKVKENIASVNG---------SISKDPIVALPNINSGSSSGH---DDKVESP  235
            I+D  VV K  KE + ++ G         S+++D ++   N     SS +   +D+  S 
Sbjct  257  IKDYIVVGKDAKEELPTIEGILKVEVEATSLARDQVLDHANERDTPSSSYYQSEDQQRSS  316

Query  234  ANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
              +   +  N    G +       EQ  AKR+RKPTKRYI
Sbjct  317  KRLKGISTDNDESLGTLQD-----EQGTAKRLRKPTKRYI  351



>gb|KHN29760.1| hypothetical protein glysoja_035446 [Glycine soja]
Length=304

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = -2

Query  582  ASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS  403
            AS   ++ KPD S   GEICL+ L+++ELHE FK TFGR+T+VKDKQWLKRRI+M L+NS
Sbjct  97   ASAVYSNLKPDLSMSDGEICLDKLSIRELHELFKVTFGRETTVKDKQWLKRRIAMSLTNS  156

Query  402  CDFSCTSFVIEDSRVVKKVKE  340
            CD S T+F+I+++++V+K +E
Sbjct  157  CDVSATTFIIKNNKIVRKFEE  177



>emb|CDX96424.1| BnaA07g30350D [Brassica napus]
Length=582

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 92/153 (60%), Gaps = 11/153 (7%)
 Frame = -2

Query  573  AGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDF  394
            + AS KPDF+ ++GEICL +L +K L ETF+ATFGR+T+VKDK WLKRRI+MGL+ S D 
Sbjct  182  SAASQKPDFALVRGEICLNDLPIKALQETFRATFGRETTVKDKTWLKRRITMGLTKSFDV  241

Query  393  SCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGN  214
              T+  I+D+++V  +K+    V+  +    +   P+ ++   +GH +       +    
Sbjct  242  PTTNLTIKDNKLV-GIKDKSNDVSDDVRATNVKEAPSSSAYHVNGHSNASGRSLGVNH--  298

Query  213  IPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
                       +E  + E+ AAKRVRKPT+RYI
Sbjct  299  --------YWATEDFSSEERAAKRVRKPTRRYI  323



>ref|XP_009105926.1| PREDICTED: uncharacterized protein LOC103831770 isoform X3 [Brassica 
rapa]
Length=593

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 92/153 (60%), Gaps = 11/153 (7%)
 Frame = -2

Query  573  AGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDF  394
            + AS KPDF+ ++GEICL +L +K L ETF+ATFGR+T+VKDK WLKRRI+MGL+ S D 
Sbjct  191  SAASQKPDFALVRGEICLNDLPIKALQETFRATFGRETTVKDKTWLKRRITMGLTKSFDV  250

Query  393  SCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGN  214
              T+  I+D+++V  +K+    V+  +    +   P+ ++   +GH +       +    
Sbjct  251  PTTNLTIKDNKLV-GIKDKSNDVSDDVRATNVKEAPSSSAYHVNGHSNASGRSLGVNH--  307

Query  213  IPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
                       +E  + E+ AAKRVRKPT+RYI
Sbjct  308  --------YWATEDFSSEERAAKRVRKPTRRYI  332



>ref|XP_009105925.1| PREDICTED: uncharacterized protein LOC103831770 isoform X2 [Brassica 
rapa]
Length=595

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 92/153 (60%), Gaps = 11/153 (7%)
 Frame = -2

Query  573  AGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDF  394
            + AS KPDF+ ++GEICL +L +K L ETF+ATFGR+T+VKDK WLKRRI+MGL+ S D 
Sbjct  195  SAASQKPDFALVRGEICLNDLPIKALQETFRATFGRETTVKDKTWLKRRITMGLTKSFDV  254

Query  393  SCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGN  214
              T+  I+D+++V  +K+    V+  +    +   P+ ++   +GH +       +    
Sbjct  255  PTTNLTIKDNKLV-GIKDKSNDVSDDVRATNVKEAPSSSAYHVNGHSNASGRSLGVNH--  311

Query  213  IPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
                       +E  + E+ AAKRVRKPT+RYI
Sbjct  312  --------YWATEDFSSEERAAKRVRKPTRRYI  336



>ref|XP_009105924.1| PREDICTED: uncharacterized protein LOC103831770 isoform X1 [Brassica 
rapa]
Length=597

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 92/153 (60%), Gaps = 11/153 (7%)
 Frame = -2

Query  573  AGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDF  394
            + AS KPDF+ ++GEICL +L +K L ETF+ATFGR+T+VKDK WLKRRI+MGL+ S D 
Sbjct  195  SAASQKPDFALVRGEICLNDLPIKALQETFRATFGRETTVKDKTWLKRRITMGLTKSFDV  254

Query  393  SCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGN  214
              T+  I+D+++V  +K+    V+  +    +   P+ ++   +GH +       +    
Sbjct  255  PTTNLTIKDNKLV-GIKDKSNDVSDDVRATNVKEAPSSSAYHVNGHSNASGRSLGVNH--  311

Query  213  IPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
                       +E  + E+ AAKRVRKPT+RYI
Sbjct  312  --------YWATEDFSSEERAAKRVRKPTRRYI  336



>ref|XP_006647993.1| PREDICTED: uncharacterized protein LOC102707465 isoform X1 [Oryza 
brachyantha]
 ref|XP_006647994.1| PREDICTED: uncharacterized protein LOC102707465 isoform X2 [Oryza 
brachyantha]
Length=617

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 103/179 (58%), Gaps = 14/179 (8%)
 Frame = -2

Query  612  SDAFSE--NNLLASKAGASWK---PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKD  448
            +DA SE  NN  A ++ + +    PDFS L+GE+CL+NLT++EL E F+ATFGR T+VKD
Sbjct  170  ADACSEPVNNTSACQSVSGFTSSVPDFSILRGEVCLDNLTIRELQEAFRATFGRQTTVKD  229

Query  447  KQWLKRRISMGLSNSCDFSCTSFVIEDSRVV-KKVKENIASVNGSISKDPIVALPNINSG  271
            K WLKRRI+MGL+NSCD   +  V++D +V+    K+ IA+V G I K  + A    +  
Sbjct  230  KLWLKRRIAMGLTNSCDVPSSGCVVKDYKVIGMGSKQEIAAVEG-IPKMELEATLVRDQV  288

Query  270  SSSGHDDKVES--PANITEGNIPNSTLEGCIVSEGHNM-----EQTAAKRVRKPTKRYI  115
             + GH   + S  P +  E    +  L+                Q   KR+RKPTKRYI
Sbjct  289  LNPGHQRDLPSSFPYHSEEQQRSSKRLKRVPTDNDEPQVTIFTGQGTTKRIRKPTKRYI  347



>gb|AAF97307.1|AC007843_10 Hypothetical protein [Arabidopsis thaliana]
Length=575

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 96/158 (61%), Gaps = 18/158 (11%)
 Frame = -2

Query  567  ASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSC  388
            A+ KPDFS++ GEI L NL++KEL ETF+ATFGR+T+ KDK+WLKRRI MGL NSC    
Sbjct  191  AASKPDFSRVPGEISLANLSIKELQETFRATFGRETTSKDKRWLKRRIKMGLINSCVVPT  250

Query  387  TSFVIEDSRVVKKVKENI-ASVNGSISKDPIVALPNINSGSSS----GH-DDKVESPA-N  229
            T+  I DS+++   ++ I A   G++ ++   A  +I++ +S     GH +D   SP   
Sbjct  251  TTLTINDSKLIGGDQDAIDAFSKGTVDEE--TATESIDTPASPDGIKGHSNDFGHSPVET  308

Query  228  ITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
              +    N   EG         E  +AKRVRKPT+RYI
Sbjct  309  FVDHYSGNEDFEG---------EDGSAKRVRKPTRRYI  337



>gb|AAF79464.1|AC022492_8 F1L3.16 [Arabidopsis thaliana]
Length=587

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 96/158 (61%), Gaps = 18/158 (11%)
 Frame = -2

Query  567  ASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSC  388
            A+ KPDFS++ GEI L NL++KEL ETF+ATFGR+T+ KDK+WLKRRI MGL NSC    
Sbjct  189  AASKPDFSRVPGEISLANLSIKELQETFRATFGRETTSKDKRWLKRRIKMGLINSCVVPT  248

Query  387  TSFVIEDSRVVKKVKENI-ASVNGSISKDPIVALPNINSGSSS----GH-DDKVESPA-N  229
            T+  I DS+++   ++ I A   G++ ++   A  +I++ +S     GH +D   SP   
Sbjct  249  TTLTINDSKLIGGDQDAIDAFSKGTVDEE--TATESIDTPASPDGIKGHSNDFGHSPVET  306

Query  228  ITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
              +    N   EG         E  +AKRVRKPT+RYI
Sbjct  307  FVDHYSGNEDFEG---------EDGSAKRVRKPTRRYI  335



>ref|NP_564025.2| protein TRF-like 3 [Arabidopsis thaliana]
 gb|AAL86341.1| unknown protein [Arabidopsis thaliana]
 gb|AAM67499.1| unknown protein [Arabidopsis thaliana]
 gb|AAS10007.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AEE29593.1| protein TRF-like 3 [Arabidopsis thaliana]
Length=604

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 96/158 (61%), Gaps = 18/158 (11%)
 Frame = -2

Query  567  ASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSC  388
            A+ KPDFS++ GEI L NL++KEL ETF+ATFGR+T+ KDK+WLKRRI MGL NSC    
Sbjct  191  AASKPDFSRVPGEISLANLSIKELQETFRATFGRETTSKDKRWLKRRIKMGLINSCVVPT  250

Query  387  TSFVIEDSRVVKKVKENI-ASVNGSISKDPIVALPNINSGSSS----GH-DDKVESPA-N  229
            T+  I DS+++   ++ I A   G++ ++   A  +I++ +S     GH +D   SP   
Sbjct  251  TTLTINDSKLIGGDQDAIDAFSKGTVDEE--TATESIDTPASPDGIKGHSNDFGHSPVET  308

Query  228  ITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
              +    N   EG         E  +AKRVRKPT+RYI
Sbjct  309  FVDHYSGNEDFEG---------EDGSAKRVRKPTRRYI  337



>ref|NP_001185023.1| protein TRF-like 3 [Arabidopsis thaliana]
 gb|AEE29594.1| protein TRF-like 3 [Arabidopsis thaliana]
Length=624

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 96/158 (61%), Gaps = 18/158 (11%)
 Frame = -2

Query  567  ASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSC  388
            A+ KPDFS++ GEI L NL++KEL ETF+ATFGR+T+ KDK+WLKRRI MGL NSC    
Sbjct  211  AASKPDFSRVPGEISLANLSIKELQETFRATFGRETTSKDKRWLKRRIKMGLINSCVVPT  270

Query  387  TSFVIEDSRVVKKVKENI-ASVNGSISKDPIVALPNINSGSSS----GH-DDKVESPA-N  229
            T+  I DS+++   ++ I A   G++ ++   A  +I++ +S     GH +D   SP   
Sbjct  271  TTLTINDSKLIGGDQDAIDAFSKGTVDEE--TATESIDTPASPDGIKGHSNDFGHSPVET  328

Query  228  ITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
              +    N   EG         E  +AKRVRKPT+RYI
Sbjct  329  FVDHYSGNEDFEG---------EDGSAKRVRKPTRRYI  357



>ref|XP_003554936.1| PREDICTED: uncharacterized protein LOC100777434 [Glycine max]
Length=303

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = -2

Query  582  ASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS  403
            AS   ++ K D S   GEICL+ L+++ELHE FK TFGR+T+VKDKQWLKRRI+M L+NS
Sbjct  96   ASAVYSNLKLDLSMSDGEICLDKLSIRELHELFKVTFGRETTVKDKQWLKRRIAMSLTNS  155

Query  402  CDFSCTSFVIEDSRVVKKVKE  340
            CD S T+F+I+++++V+K +E
Sbjct  156  CDVSATTFIIKNNKIVRKFEE  176



>ref|XP_008644056.1| PREDICTED: uncharacterized protein LOC100383302 isoform X4 [Zea 
mays]
 ref|XP_008644057.1| PREDICTED: uncharacterized protein LOC100383302 isoform X4 [Zea 
mays]
 gb|AFW73719.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
Length=624

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 93/156 (60%), Gaps = 17/156 (11%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS L+GE+CL++LT++EL E F+ATFGR T+VKDK WLKRRI+MGL+NS D   +  V
Sbjct  196  PDFSILRGEVCLDDLTIRELQEAFRATFGRQTNVKDKIWLKRRITMGLTNSYDVPSSGCV  255

Query  375  IEDSRVVKKVKENIAS-----VNGSISKDPIVALP--NINSGSSSGH--DDKVESPANIT  223
            ++D ++V K  +N  S         +    +V  P    +S SSS +  +D+ +S   + 
Sbjct  256  VKDYKIVGKDAKNDMSDMDERAKTGLRATSVVIYPGNEGDSPSSSYYQSEDQEDSSKRVP  315

Query  222  EGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
               I N   +G ++      EQ   KR RKPTKRYI
Sbjct  316  ---IHNDEPQGNLLG-----EQCTDKRTRKPTKRYI  343



>gb|AFA45125.1| MYB-related protein [Zea mays]
Length=626

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 93/156 (60%), Gaps = 17/156 (11%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS L+GE+CL++LT++EL E F+ATFGR T+VKDK WLKRRI+MGL+NS D   +  V
Sbjct  202  PDFSILRGEVCLDDLTIRELQEAFRATFGRQTNVKDKIWLKRRITMGLTNSYDVPSSGCV  261

Query  375  IEDSRVVKKVKENIAS-----VNGSISKDPIVALPN--INSGSSSGH--DDKVESPANIT  223
            ++D ++V K  +N  S         +    +V  P    +S SSS +  +D+ +S   + 
Sbjct  262  VKDYKIVGKDAKNDMSDMDERAKTGLRATSVVIYPGNEGDSPSSSYYQSEDQEDSSKRVP  321

Query  222  EGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
               I N   +G ++      EQ   KR RKPTKRYI
Sbjct  322  ---IHNDEPQGNLLG-----EQCTDKRTRKPTKRYI  349



>ref|XP_008644055.1| PREDICTED: uncharacterized protein LOC100383302 isoform X3 [Zea 
mays]
Length=626

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 93/156 (60%), Gaps = 17/156 (11%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS L+GE+CL++LT++EL E F+ATFGR T+VKDK WLKRRI+MGL+NS D   +  V
Sbjct  202  PDFSILRGEVCLDDLTIRELQEAFRATFGRQTNVKDKIWLKRRITMGLTNSYDVPSSGCV  261

Query  375  IEDSRVVKKVKENIAS-----VNGSISKDPIVALP--NINSGSSSGH--DDKVESPANIT  223
            ++D ++V K  +N  S         +    +V  P    +S SSS +  +D+ +S   + 
Sbjct  262  VKDYKIVGKDAKNDMSDMDERAKTGLRATSVVIYPGNEGDSPSSSYYQSEDQEDSSKRVP  321

Query  222  EGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
               I N   +G ++      EQ   KR RKPTKRYI
Sbjct  322  ---IHNDEPQGNLLG-----EQCTDKRTRKPTKRYI  349



>ref|NP_001169431.1| uncharacterized protein LOC100383302 [Zea mays]
 ref|XP_008644053.1| PREDICTED: uncharacterized protein LOC100383302 isoform X1 [Zea 
mays]
 gb|ACN33741.1| unknown [Zea mays]
 gb|AFW73718.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|AIB05229.1| MYB-related transcription factor, partial [Zea mays]
Length=630

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 93/156 (60%), Gaps = 17/156 (11%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS L+GE+CL++LT++EL E F+ATFGR T+VKDK WLKRRI+MGL+NS D   +  V
Sbjct  202  PDFSILRGEVCLDDLTIRELQEAFRATFGRQTNVKDKIWLKRRITMGLTNSYDVPSSGCV  261

Query  375  IEDSRVVKKVKENIAS-----VNGSISKDPIVALP--NINSGSSSGH--DDKVESPANIT  223
            ++D ++V K  +N  S         +    +V  P    +S SSS +  +D+ +S   + 
Sbjct  262  VKDYKIVGKDAKNDMSDMDERAKTGLRATSVVIYPGNEGDSPSSSYYQSEDQEDSSKRVP  321

Query  222  EGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
               I N   +G ++      EQ   KR RKPTKRYI
Sbjct  322  ---IHNDEPQGNLLG-----EQCTDKRTRKPTKRYI  349



>ref|XP_008644054.1| PREDICTED: uncharacterized protein LOC100383302 isoform X2 [Zea 
mays]
Length=629

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 93/156 (60%), Gaps = 17/156 (11%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS L+GE+CL++LT++EL E F+ATFGR T+VKDK WLKRRI+MGL+NS D   +  V
Sbjct  205  PDFSILRGEVCLDDLTIRELQEAFRATFGRQTNVKDKIWLKRRITMGLTNSYDVPSSGCV  264

Query  375  IEDSRVVKKVKENIAS-----VNGSISKDPIVALP--NINSGSSSGH--DDKVESPANIT  223
            ++D ++V K  +N  S         +    +V  P    +S SSS +  +D+ +S   + 
Sbjct  265  VKDYKIVGKDAKNDMSDMDERAKTGLRATSVVIYPGNEGDSPSSSYYQSEDQEDSSKRVP  324

Query  222  EGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
               I N   +G ++      EQ   KR RKPTKRYI
Sbjct  325  ---IHNDEPQGNLLG-----EQCTDKRTRKPTKRYI  352



>ref|XP_008644058.1| PREDICTED: uncharacterized protein LOC100383302 isoform X5 [Zea 
mays]
Length=633

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 93/156 (60%), Gaps = 17/156 (11%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS L+GE+CL++LT++EL E F+ATFGR T+VKDK WLKRRI+MGL+NS D   +  V
Sbjct  205  PDFSILRGEVCLDDLTIRELQEAFRATFGRQTNVKDKIWLKRRITMGLTNSYDVPSSGCV  264

Query  375  IEDSRVVKKVKENIAS-----VNGSISKDPIVALP--NINSGSSSGH--DDKVESPANIT  223
            ++D ++V K  +N  S         +    +V  P    +S SSS +  +D+ +S   + 
Sbjct  265  VKDYKIVGKDAKNDMSDMDERAKTGLRATSVVIYPGNEGDSPSSSYYQSEDQEDSSKRVP  324

Query  222  EGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
               I N   +G ++      EQ   KR RKPTKRYI
Sbjct  325  ---IHNDEPQGNLLG-----EQCTDKRTRKPTKRYI  352



>ref|NP_001048286.1| Os02g0776700 [Oryza sativa Japonica Group]
 dbj|BAD16961.1| MYB transcription factor-like [Oryza sativa Japonica Group]
 dbj|BAD17382.1| MYB transcription factor-like [Oryza sativa Japonica Group]
 dbj|BAF10200.1| Os02g0776700 [Oryza sativa Japonica Group]
 dbj|BAG91925.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57898.1| hypothetical protein OsJ_08581 [Oryza sativa Japonica Group]
 gb|ADB84635.1| Myb transcription factor [Oryza sativa Japonica Group]
Length=621

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 88/163 (54%), Gaps = 25/163 (15%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKGE+CL++LT++EL E F+ATFGR T+VKDK WLKRRI+MGL NSCD   +  V
Sbjct  198  PDFSILKGEVCLDDLTMRELQEAFRATFGRQTTVKDKLWLKRRIAMGLINSCDVPSSGCV  257

Query  375  IEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANI----------  226
            + D +V+    +    V  +I K  + A    +   + GH+  + S  +           
Sbjct  258  VRDYKVIAMGAKQEIPVVEAIPKMELEANLVRDQVMNPGHERDLPSSLSYHSEEQQRSSK  317

Query  225  ------TEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
                  T+ + P  T+           EQ   KR+RKPTKRYI
Sbjct  318  RLKRVPTDNDEPQVTIFA---------EQGTTKRIRKPTKRYI  351



>gb|EEC74099.1| hypothetical protein OsI_09146 [Oryza sativa Indica Group]
Length=621

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 88/163 (54%), Gaps = 25/163 (15%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKGE+CL++LT++EL E F+ATFGR T+VKDK WLKRRI+MGL NSCD   +  V
Sbjct  198  PDFSILKGEVCLDDLTMRELQEAFRATFGRQTTVKDKLWLKRRIAMGLINSCDVPSSGCV  257

Query  375  IEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANI----------  226
            + D +V+    +    V  +I K  + A    +   + GH+  + S  +           
Sbjct  258  VRDYKVIAMGAKQEIPVVEAIPKMELEANLVRDQVMNPGHERDLPSSLSYHSEEQQRSSK  317

Query  225  ------TEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
                  T+ + P  T+           EQ   KR+RKPTKRYI
Sbjct  318  RLKRVPTDNDEPQVTIFA---------EQGTTKRIRKPTKRYI  351



>ref|XP_002890227.1| hypothetical protein ARALYDRAFT_471953 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66486.1| hypothetical protein ARALYDRAFT_471953 [Arabidopsis lyrata subsp. 
lyrata]
Length=611

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 99/168 (59%), Gaps = 28/168 (17%)
 Frame = -2

Query  582  ASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS  403
            A+ + A+ KP+ S++ GEICL+NL+++ L ETF+ATFGR+T+ KD +WLKRRI+MGL NS
Sbjct  189  AALSTAASKPEVSRVAGEICLDNLSIRALQETFRATFGRETTCKDNRWLKRRITMGLINS  248

Query  402  CDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPI---VALPNINSGSS----SGHDDK-  247
            C    T+  I D++++   ++ I     + SKD +    A+ + ++ SS     GH D  
Sbjct  249  CVVPTTTLTINDNKLIGGDQDAI----DAFSKDTLDEERAIESKDTPSSPDCIKGHLDDF  304

Query  246  ----VESPANITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
                VE+  +   GN            E  + E  +AKRVRKPT+RYI
Sbjct  305  GHTSVETFVDYYSGN------------EDFDGEHRSAKRVRKPTRRYI  340



>ref|XP_006416700.1| hypothetical protein EUTSA_v10007199mg [Eutrema salsugineum]
 gb|ESQ35053.1| hypothetical protein EUTSA_v10007199mg [Eutrema salsugineum]
Length=576

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 94/168 (56%), Gaps = 17/168 (10%)
 Frame = -2

Query  594  NNLLASKAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMG  415
            N   + K  ++ KP FS+  G+ CL+NL++K L ETF+ATFGR+T+ KDK+WLKRRI+MG
Sbjct  141  NATCSPKVPSASKPGFSRDTGDKCLDNLSIKSLQETFRATFGRETTCKDKRWLKRRITMG  200

Query  414  LSNSCDFSCTSFVIEDSRVVKKVKENIASVNGSISKDPI-VALPNINSGSSS-----GH-  256
            L NSC    T   + D++++   ++N      + SKD +     N N   SS     GH 
Sbjct  201  LINSCVIPTTGLTVNDNKLIGGGQDNYNDTIDAYSKDTVDEGRANCNDTPSSPDCRKGHS  260

Query  255  DDKVESPA-NITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
            +D   SP  +  +    N   EG         E  +AKRVRKPT+R+I
Sbjct  261  NDFQRSPVESFVDQYSGNEDFEG---------ELRSAKRVRKPTRRFI  299



>dbj|BAM74414.1| carboxyl-terminal Myb1 short polypeptide [Oryza sativa Japonica 
Group]
Length=621

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 87/163 (53%), Gaps = 25/163 (15%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            PDFS LKGE+CL++LT++EL E F+ATFGR T+VKDK WLKRRI+MGL NSCD   +  V
Sbjct  198  PDFSILKGEVCLDDLTMRELQEAFRATFGRQTTVKDKLWLKRRIAMGLINSCDVPSSGCV  257

Query  375  IEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANI----------  226
            + D +V+    +    V  +I K  + A    +   + GH+  + S  +           
Sbjct  258  VRDYKVIAMGAKQEIPVVEAIPKMELEANLVRDQVMNPGHESDLPSSLSYHSEEQQRSSK  317

Query  225  ------TEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
                  T+ + P  T+           EQ   K +RKPTKRYI
Sbjct  318  RLKRVPTDNDEPQVTIFA---------EQGTTKGIRKPTKRYI  351



>ref|XP_010476899.1| PREDICTED: uncharacterized protein LOC104756078 isoform X2 [Camelina 
sativa]
Length=598

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 89/151 (59%), Gaps = 4/151 (3%)
 Frame = -2

Query  567  ASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSC  388
            A+ KP+ S++ GEICL+NL++K L +TF+A FGR+T+ K KQWLKRRI+MG+ NS     
Sbjct  181  AASKPEVSRVAGEICLDNLSIKSLQDTFRAKFGRETTCKSKQWLKRRITMGMINSSIVPT  240

Query  387  TSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIP  208
            TS  I D+++V   ++     + + S D +     + S  +    D ++  +N    +  
Sbjct  241  TSLTIYDNKLVGGSQD----TSDAFSNDTVDEARAMESKDTPSRPDCLKGHSNDFGRSPV  296

Query  207  NSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
             + ++    +E    E  +AKRVRKPT+RYI
Sbjct  297  ETFVDHYSGNEDFEGEDRSAKRVRKPTRRYI  327



>ref|XP_010476898.1| PREDICTED: uncharacterized protein LOC104756078 isoform X1 [Camelina 
sativa]
Length=623

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 89/151 (59%), Gaps = 4/151 (3%)
 Frame = -2

Query  567  ASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSC  388
            A+ KP+ S++ GEICL+NL++K L +TF+A FGR+T+ K KQWLKRRI+MG+ NS     
Sbjct  206  AASKPEVSRVAGEICLDNLSIKSLQDTFRAKFGRETTCKSKQWLKRRITMGMINSSIVPT  265

Query  387  TSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIP  208
            TS  I D+++V   ++     + + S D +     + S  +    D ++  +N    +  
Sbjct  266  TSLTIYDNKLVGGSQD----TSDAFSNDTVDEARAMESKDTPSRPDCLKGHSNDFGRSPV  321

Query  207  NSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
             + ++    +E    E  +AKRVRKPT+RYI
Sbjct  322  ETFVDHYSGNEDFEGEDRSAKRVRKPTRRYI  352



>ref|XP_010498099.1| PREDICTED: uncharacterized protein LOC104775857 [Camelina sativa]
Length=592

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 93/160 (58%), Gaps = 18/160 (11%)
 Frame = -2

Query  576  KAGASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCD  397
            K  A+ KP+ S++ GEICL++L++K L +TF+A FGR+T+ K KQWLKRRI+MG+ NS  
Sbjct  174  KEPAACKPEVSRVAGEICLDDLSIKSLQDTFRAKFGRETTCKSKQWLKRRITMGMINSSI  233

Query  396  FSCTSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSS----GH-DDKVESPA  232
               TS  I D+++V   ++N  S N ++  D   A+ + ++ SS     GH +D   SP 
Sbjct  234  VPTTSLKIYDNKLVGGGQDNAFS-NDTV--DEARAMESKDTPSSPDCLKGHSNDFGRSPV  290

Query  231  -NITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
                +    N   EG   S         AKRVRKP++RYI
Sbjct  291  ETFVDHYSGNEDFEGGYRS---------AKRVRKPSRRYI  321



>ref|XP_010459342.1| PREDICTED: uncharacterized protein LOC104740442 [Camelina sativa]
Length=624

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 90/160 (56%), Gaps = 22/160 (14%)
 Frame = -2

Query  567  ASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSC  388
            A+ KP+ S++ GEICL+NL++K L +T +A FGR+T+ K KQWLKRRI+MG+ +SC    
Sbjct  207  AASKPEVSRVAGEICLDNLSIKSLQDTIRAKFGRETTCKSKQWLKRRITMGMIDSCIVPT  266

Query  387  TSFVIEDSRVVKKVKE-NIASVNGSI-------SKDPIVALPNINSGSSSGHDDKVESPA  232
            TS  I D+++V   ++ + A  N ++       SKD   + P+   G SS   D   SP 
Sbjct  267  TSLAIYDNKLVGGGQDTSDAFSNDTVDESRAMESKD-TPSRPDCLKGHSS---DLGRSPV  322

Query  231  -NITEGNIPNSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
                +    N   EG         E  +AKRVRK T+RYI
Sbjct  323  ETFVDHYFGNEDFEG---------EDRSAKRVRKRTRRYI  353



>ref|XP_006304808.1| hypothetical protein CARUB_v10012426mg [Capsella rubella]
 gb|EOA37706.1| hypothetical protein CARUB_v10012426mg [Capsella rubella]
Length=599

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 87/151 (58%), Gaps = 4/151 (3%)
 Frame = -2

Query  567  ASWKPDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSC  388
            A+ + +FS++ GE  L+NL++K L ETF+A FGR+T+ KDKQWLKRRI++G  NSC    
Sbjct  185  AASQTEFSRVAGETYLDNLSIKALQETFRAKFGRETTCKDKQWLKRRITLGSINSCVVPT  244

Query  387  TSFVIEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIP  208
            TS  I +++++   +++      + SKD +       S  +    D  +  +N    +  
Sbjct  245  TSLTIANNKLISGGQDS----GEAFSKDAVDEERATESKDTPSSPDCTKGHSNDFGYSPV  300

Query  207  NSTLEGCIVSEGHNMEQTAAKRVRKPTKRYI  115
             + ++    +E    E  +AKRVRKPT+RYI
Sbjct  301  ETFVDHYSGNEDFEGEYRSAKRVRKPTRRYI  331



>emb|CDY48303.1| BnaC05g13570D [Brassica napus]
Length=775

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 82/155 (53%), Gaps = 22/155 (14%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            P  S+   EICL NL++K L +TF+ATFGR+T+ KDK WL+R+I MG  N C    TS  
Sbjct  344  PGASRDTEEICLGNLSIKALQDTFRATFGRETTCKDKLWLQRKIKMGRVNPCVIPTTSQT  403

Query  375  IEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIPN---  205
            + D++++   ++N                 +++ G +S       SP +  +G+ PN   
Sbjct  404  VNDNKLILGGQDNCNDT-------------SVDEGRASNCKGTPSSPNDFVKGH-PNDFE  449

Query  204  -STLEGCI----VSEGHNMEQTAAKRVRKPTKRYI  115
             S +E  +     +E    E  +AKRVRK T+RYI
Sbjct  450  YSPVEAFVDHYSGNEDFEGEYRSAKRVRKATRRYI  484



>emb|CDY26243.1| BnaA06g11740D [Brassica napus]
Length=646

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 78/153 (51%), Gaps = 22/153 (14%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            P  S+   EICL NL++K L +TF+ATFGR+T+ KDK WL+R+I MG  N C    TS  
Sbjct  217  PGASRDTEEICLGNLSIKALQDTFRATFGRETTCKDKLWLERKIKMGRINPCVIPTTSLT  276

Query  375  IEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITE--GNIPNS  202
            ++D++++           G    D +VA       S    D+   SP  I     +   S
Sbjct  277  VDDTKLIL----------GGQDSDMVVAF------SKDTFDEGRASPDCIKRHPNDFGYS  320

Query  201  TLEGCI----VSEGHNMEQTAAKRVRKPTKRYI  115
             +E  +     +E    E  +AKRVRK T+RYI
Sbjct  321  PVEAFVDHYSGNEDFEGEYRSAKRVRKATRRYI  353



>ref|XP_009149196.1| PREDICTED: uncharacterized protein LOC103872532 [Brassica rapa]
Length=628

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 78/153 (51%), Gaps = 22/153 (14%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFV  376
            P  S+   EICL NL++K L +TF+ATFGR+T+ KDK WL+R+I MG  N C    TS  
Sbjct  211  PGASRDTEEICLGNLSIKALQDTFRATFGRETTCKDKLWLERKIKMGRINPCVIPTTSLT  270

Query  375  IEDSRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITE--GNIPNS  202
            ++D++++           G    D +VA       S    D+   SP  I     +   S
Sbjct  271  VDDTKLIL----------GGQDSDMVVAF------SKDTFDEGRASPDCIKRHPNDFGYS  314

Query  201  TLEGCI----VSEGHNMEQTAAKRVRKPTKRYI  115
             +E  +     +E    E  +AKRVRK T+RYI
Sbjct  315  PVEAFVDHYSGNEDFEGEYRSAKRVRKATRRYI  347



>ref|XP_010253930.1| PREDICTED: uncharacterized protein LOC104595064 [Nelumbo nucifera]
 ref|XP_010253931.1| PREDICTED: uncharacterized protein LOC104595064 [Nelumbo nucifera]
 ref|XP_010253932.1| PREDICTED: uncharacterized protein LOC104595064 [Nelumbo nucifera]
Length=582

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 76/145 (52%), Gaps = 5/145 (3%)
 Frame = -2

Query  537  KGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFVIED--S  364
            + E  L+ +T++EL E F+ TFGR+TSVKDKQWLKRRIS GL N  +F   S ++E   S
Sbjct  200  QNESLLDRMTIRELQEAFRTTFGRETSVKDKQWLKRRISFGLENLVEFENVSSLLESGTS  259

Query  363  RVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIPNSTLEGCI  184
                +V   + S N S  K P +    + + +     D VE     TE ++   T E   
Sbjct  260  SNENEVDMIVTSSNDSCGKMPSLCTSMLGNMAKPLRQD-VERKNLATENDLMTVTPEAGK  318

Query  183  V--SEGHNMEQTAAKRVRKPTKRYI  115
            V    G        KR+RKPT+RYI
Sbjct  319  VGLGLGDRGLLVTPKRLRKPTRRYI  343



>dbj|BAD16962.1| MYB transcription factor-like [Oryza sativa Japonica Group]
 dbj|BAD17383.1| MYB transcription factor-like [Oryza sativa Japonica Group]
Length=409

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 72/138 (52%), Gaps = 7/138 (5%)
 Frame = -2

Query  507  VKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFVIEDSRVVKKVKENIAS  328
            ++EL E F+ATFGR T+VKDK WLKRRI+MGL NSCD   +  V+ D +V+    +    
Sbjct  1    MRELQEAFRATFGRQTTVKDKLWLKRRIAMGLINSCDVPSSGCVVRDYKVIAMGAKQEIP  60

Query  327  VNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIPNSTLEGCIVSEGHN------  166
            V  +I K  + A    +   + GH+  + S  +        S+     V   ++      
Sbjct  61   VVEAIPKMELEANLVRDQVMNPGHERDLPSSLSYHSEEQQRSSKRLKRVPTDNDEPQVTI  120

Query  165  -MEQTAAKRVRKPTKRYI  115
              EQ   KR+RKPTKRYI
Sbjct  121  FAEQGTTKRIRKPTKRYI  138



>ref|XP_006827445.1| hypothetical protein AMTR_s00009p00103030 [Amborella trichopoda]
 gb|ERM94861.1| hypothetical protein AMTR_s00009p00103030 [Amborella trichopoda]
Length=631

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 11/156 (7%)
 Frame = -2

Query  555  PDFSKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS-CDFSCTSF  379
            P+    +  ICLENLT++ELHE F+ TFGR+TSVKDK+WLKR IS+GL N     + +SF
Sbjct  227  PEAKYDQSSICLENLTIRELHEAFRTTFGRETSVKDKRWLKRHISLGLHNFLVSENASSF  286

Query  378  VIEDSRVVKKVKENI--ASVNGSISKDPIVALPNI----NSGSSSGHDDKVESPANITEG  217
            +  D +V     + +   + +   S++   +   +    +S   SG   K +   +    
Sbjct  287  L--DGKVSSNESDEVKPYAFDNDSSEEICDSFAKVACKRDSADGSGVSRKRQGRKDSVTT  344

Query  216  NIPNSTLEGCIVSEGHNMEQ--TAAKRVRKPTKRYI  115
            ++     EG  VS     E+     KR+RKPT+RYI
Sbjct  345  HLQGVAKEGFGVSHVEETERALVGRKRLRKPTRRYI  380



>ref|XP_010262885.1| PREDICTED: uncharacterized protein LOC104601289 [Nelumbo nucifera]
Length=605

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/194 (31%), Positives = 90/194 (46%), Gaps = 50/194 (26%)
 Frame = -2

Query  600  SENNLLASKAGASWKPDFSKL---------KGEICLENLTVKELHETFKATFGRDTSVKD  448
            S+ + L+ K   +  PD ++          + E  L+ +T+ +L E F+ TFGR+TSVKD
Sbjct  177  SQPSCLSGKNSITQMPDLTETIPVLESTSDQSEFLLDKMTIYDLQEAFRTTFGRETSVKD  236

Query  447  KQWLKRRISMGLSNSCDFSCTSFVIED----------------------SRVVKKVKENI  334
            KQWLKRRIS GL N  +F   S ++E                         +   V  N+
Sbjct  237  KQWLKRRISFGLQNLVEFGDVSDLLESGIPNGNEGDMIFTSSNDSSGRMQSLFTNVLGNV  296

Query  333  AS-VNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIPNSTLEGCIVSEGHNMEQ  157
            A  V+  + ++ +VA  ++ +GSS          A  T G +     EG +V        
Sbjct  297  AKPVSQDVERESMVAGEDLITGSSD---------AGKTFGVLDLGDGEGVLV--------  339

Query  156  TAAKRVRKPTKRYI  115
             A KR+RKPT+RYI
Sbjct  340  -APKRLRKPTRRYI  352



>dbj|BAM74415.1| carboxyl-terminal Myb1 short polypeptide [Oryza sativa Japonica 
Group]
Length=408

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 71/138 (51%), Gaps = 7/138 (5%)
 Frame = -2

Query  507  VKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFVIEDSRVVKKVKENIAS  328
            ++EL E F+ATFGR T+VKDK WLKRRI+MGL NSCD   +  V+ D +V+    +    
Sbjct  1    MRELQEAFRATFGRQTTVKDKLWLKRRIAMGLINSCDVPSSGCVVRDYKVIAMGAKQEIP  60

Query  327  VNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIPNSTLEGCIVSEGHN------  166
            V  +I K  + A    +   + GH+  + S  +        S+     V   ++      
Sbjct  61   VVEAIPKMELEANLVRDQVMNPGHESDLPSSLSYHSEEQQRSSKRLKRVPTDNDEPQVTI  120

Query  165  -MEQTAAKRVRKPTKRYI  115
              EQ   K +RKPTKRYI
Sbjct  121  FAEQGTTKGIRKPTKRYI  138



>ref|XP_010918708.1| PREDICTED: uncharacterized protein LOC105043012 [Elaeis guineensis]
Length=726

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/145 (34%), Positives = 76/145 (52%), Gaps = 12/145 (8%)
 Frame = -2

Query  522  LENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFVIEDSRVVKKVK  343
            L+N++  ELH+ F++ FGRDT V DKQWLK RI  GL N  +    S ++E      +  
Sbjct  335  LDNMSADELHDAFRSMFGRDTCVTDKQWLKHRILFGLQNHTEVGSASSLLECGLSSIEND  394

Query  342  ENIASVNGSISKDPIVALPNINSGSS----SGHDDKVESPANITEGNIPNSTLEGCIVSE  175
            +N+  +  ++ +   + L NI   S+    +G   +  S  ++   NI      G    E
Sbjct  395  DNMIWIPKNVPEGICIPLTNIFGSSTLVVGTGAGKEGHSCEDVPVANISKVGKAGF---E  451

Query  174  GHNMEQ-----TAAKRVRKPTKRYI  115
              N+E+     TA+KR+RKPT+RYI
Sbjct  452  PLNLEERPSALTASKRLRKPTRRYI  476



>ref|XP_008800050.1| PREDICTED: uncharacterized protein LOC103714543 isoform X2 [Phoenix 
dactylifera]
Length=605

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 76/145 (52%), Gaps = 12/145 (8%)
 Frame = -2

Query  522  LENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFVIEDSRVVKKVK  343
            L+N++  ELH+ F++ FGRDT V DKQWLK R+  GL N  +    S ++E      +  
Sbjct  207  LDNMSTDELHDAFRSMFGRDTCVMDKQWLKHRVLFGLQNHTEVGYASSLLECGLSSVEND  266

Query  342  ENIASVNGSISKDPIVALPNINSGSS----SGHDDKVESPANITEGNIPNSTLEGCIVSE  175
            +++  +  ++ ++  + L NI   S+    +G   +  S  ++   NI      G    E
Sbjct  267  DDMIWIPKNVPEEICIPLTNIFGSSALVVGTGAGKERHSCEDVAVANISKVGKAGF---E  323

Query  174  GHNMEQ-----TAAKRVRKPTKRYI  115
              N+E+     TA KR+RKPT+RYI
Sbjct  324  PLNLEERPSALTATKRLRKPTRRYI  348



>ref|XP_008800048.1| PREDICTED: uncharacterized protein LOC103714543 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008800049.1| PREDICTED: uncharacterized protein LOC103714543 isoform X1 [Phoenix 
dactylifera]
Length=610

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 76/145 (52%), Gaps = 12/145 (8%)
 Frame = -2

Query  522  LENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFVIEDSRVVKKVK  343
            L+N++  ELH+ F++ FGRDT V DKQWLK R+  GL N  +    S ++E      +  
Sbjct  212  LDNMSTDELHDAFRSMFGRDTCVMDKQWLKHRVLFGLQNHTEVGYASSLLECGLSSVEND  271

Query  342  ENIASVNGSISKDPIVALPNINSGSS----SGHDDKVESPANITEGNIPNSTLEGCIVSE  175
            +++  +  ++ ++  + L NI   S+    +G   +  S  ++   NI      G    E
Sbjct  272  DDMIWIPKNVPEEICIPLTNIFGSSALVVGTGAGKERHSCEDVAVANISKVGKAGF---E  328

Query  174  GHNMEQ-----TAAKRVRKPTKRYI  115
              N+E+     TA KR+RKPT+RYI
Sbjct  329  PLNLEERPSALTATKRLRKPTRRYI  353



>ref|XP_001760535.1| predicted protein [Physcomitrella patens]
 gb|EDQ74610.1| predicted protein [Physcomitrella patens]
Length=759

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -2

Query  531  EICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMG  415
            E+ LENL+++ELHE F+AT+GRDTSVKDK WLKR+IS G
Sbjct  308  EVSLENLSIRELHEAFRATYGRDTSVKDKHWLKRQISAG  346



>ref|XP_001773667.1| predicted protein [Physcomitrella patens]
 gb|EDQ61555.1| predicted protein [Physcomitrella patens]
Length=929

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -2

Query  546  SKLKGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMG  415
            S+   E+ L+NL+++ELHE F+AT+GRDTSVKDK WLKR+IS G
Sbjct  299  SRAHEEVSLDNLSIRELHEAFRATYGRDTSVKDKHWLKRQISAG  342



>emb|CAN66760.1| hypothetical protein VITISV_006318 [Vitis vinifera]
Length=587

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 67/138 (49%), Gaps = 6/138 (4%)
 Frame = -2

Query  519  ENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFVIEDSRVV--KKV  346
            +N+T+  LHE FK  FG  TS+KDKQWLK  IS GL N  +      +++        + 
Sbjct  170  DNMTIHGLHEDFKNIFGGGTSIKDKQWLKLHISFGLQNLVELDNGLNLLKQGVTFNENEA  229

Query  345  KENIASVNGSISKDPIVALPNINSGSSSGHDD-KVESPANITEGNIPNSTLEGCIVSEGH  169
            K N +S N   S   I     +N  + SG    K +S   ++     ++ +  CI+  G 
Sbjct  230  KSNFSSRNEFCSSAFISFSSVVNDKTVSGRQQVKNDSLQTLSSD---DNRVGFCILDSGE  286

Query  168  NMEQTAAKRVRKPTKRYI  115
                   KR+RKPT+RYI
Sbjct  287  KDLLVTQKRLRKPTRRYI  304



>emb|CBI16344.3| unnamed protein product [Vitis vinifera]
Length=755

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 67/138 (49%), Gaps = 6/138 (4%)
 Frame = -2

Query  519  ENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFVIEDSRVV--KKV  346
            +N+T+  LHE FK  FG  TS+KDKQWLK  IS GL N  +      +++        + 
Sbjct  170  DNMTIHGLHEDFKNIFGGGTSIKDKQWLKLHISFGLQNLVELDNGLNLLKQGVTFNENEA  229

Query  345  KENIASVNGSISKDPIVALPNINSGSSSGHDD-KVESPANITEGNIPNSTLEGCIVSEGH  169
            K N +S N   S   I     +N  + SG    K +S   ++     ++ +  CI+  G 
Sbjct  230  KSNFSSRNEFCSSAFISFSSVVNDKTVSGRQQVKNDSLQTLSSD---DNRVGFCILDSGE  286

Query  168  NMEQTAAKRVRKPTKRYI  115
                   KR+RKPT+RYI
Sbjct  287  KDLLVTQKRLRKPTRRYI  304



>ref|XP_010651207.1| PREDICTED: uncharacterized protein LOC100853565 isoform X3 [Vitis 
vinifera]
Length=574

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 67/138 (49%), Gaps = 6/138 (4%)
 Frame = -2

Query  519  ENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFVIEDSRVV--KKV  346
            +N+T+  LHE FK  FG  TS+KDKQWLK  IS GL N  +      +++        + 
Sbjct  195  DNMTIHGLHEDFKNIFGGGTSIKDKQWLKLHISFGLQNLVELDNGLNLLKQGVTFNENEA  254

Query  345  KENIASVNGSISKDPIVALPNINSGSSSGHDD-KVESPANITEGNIPNSTLEGCIVSEGH  169
            K N +S N   S   I     +N  + SG    K +S   ++     ++ +  CI+  G 
Sbjct  255  KSNFSSRNEFCSSAFISFSSVVNDKTVSGRQQVKNDSLQTLSS---DDNRVGFCILDSGE  311

Query  168  NMEQTAAKRVRKPTKRYI  115
                   KR+RKPT+RYI
Sbjct  312  KDLLVTQKRLRKPTRRYI  329



>ref|XP_010651206.1| PREDICTED: uncharacterized protein LOC100853565 isoform X2 [Vitis 
vinifera]
Length=583

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 67/138 (49%), Gaps = 6/138 (4%)
 Frame = -2

Query  519  ENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFVIEDSRVV--KKV  346
            +N+T+  LHE FK  FG  TS+KDKQWLK  IS GL N  +      +++        + 
Sbjct  194  DNMTIHGLHEDFKNIFGGGTSIKDKQWLKLHISFGLQNLVELDNGLNLLKQGVTFNENEA  253

Query  345  KENIASVNGSISKDPIVALPNINSGSSSGHDD-KVESPANITEGNIPNSTLEGCIVSEGH  169
            K N +S N   S   I     +N  + SG    K +S   ++     ++ +  CI+  G 
Sbjct  254  KSNFSSRNEFCSSAFISFSSVVNDKTVSGRQQVKNDSLQTLSS---DDNRVGFCILDSGE  310

Query  168  NMEQTAAKRVRKPTKRYI  115
                   KR+RKPT+RYI
Sbjct  311  KDLLVTQKRLRKPTRRYI  328



>ref|XP_010651205.1| PREDICTED: uncharacterized protein LOC100853565 isoform X1 [Vitis 
vinifera]
Length=584

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 67/138 (49%), Gaps = 6/138 (4%)
 Frame = -2

Query  519  ENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNSCDFSCTSFVIEDSRVV--KKV  346
            +N+T+  LHE FK  FG  TS+KDKQWLK  IS GL N  +      +++        + 
Sbjct  195  DNMTIHGLHEDFKNIFGGGTSIKDKQWLKLHISFGLQNLVELDNGLNLLKQGVTFNENEA  254

Query  345  KENIASVNGSISKDPIVALPNINSGSSSGHDD-KVESPANITEGNIPNSTLEGCIVSEGH  169
            K N +S N   S   I     +N  + SG    K +S   ++     ++ +  CI+  G 
Sbjct  255  KSNFSSRNEFCSSAFISFSSVVNDKTVSGRQQVKNDSLQTLSS---DDNRVGFCILDSGE  311

Query  168  NMEQTAAKRVRKPTKRYI  115
                   KR+RKPT+RYI
Sbjct  312  KDLLVTQKRLRKPTRRYI  329



>ref|XP_010031963.1| PREDICTED: uncharacterized protein LOC104421640 isoform X2 [Eucalyptus 
grandis]
 gb|KCW51361.1| hypothetical protein EUGRSUZ_J009051 [Eucalyptus grandis]
Length=530

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 75/148 (51%), Gaps = 16/148 (11%)
 Frame = -2

Query  528  ICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS------CDFSCTSFVIED  367
            + L+++TV+EL + F + FGR+T+V DKQWLKRRI  GL N+       + +C   + ++
Sbjct  188  VSLDHMTVRELQDAFHSMFGRETAVIDKQWLKRRILFGLHNNNELDRPLNLTCCGSISQE  247

Query  366  SRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIPNSTLEGC  187
                K+ K  +AS  G+ S +     P          D+K++  ++ ++ N  +   E  
Sbjct  248  ----KEDKSTVAS--GTESSENAFNSPKWMLDGGFKMDEKMKGSSSDSQTNYSSGASESD  301

Query  186  IVSEGHNMEQTA----AKRVRKPTKRYI  115
            +   G +  +       KRV KP +RYI
Sbjct  302  VSFHGKDENEVGGLVTGKRVHKPPRRYI  329



>gb|KCW51363.1| hypothetical protein EUGRSUZ_J009051 [Eucalyptus grandis]
Length=511

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 75/148 (51%), Gaps = 16/148 (11%)
 Frame = -2

Query  528  ICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS------CDFSCTSFVIED  367
            + L+++TV+EL + F + FGR+T+V DKQWLKRRI  GL N+       + +C   + ++
Sbjct  188  VSLDHMTVRELQDAFHSMFGRETAVIDKQWLKRRILFGLHNNNELDRPLNLTCCGSISQE  247

Query  366  SRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIPNSTLEGC  187
                K+ K  +AS  G+ S +     P          D+K++  ++ ++ N  +   E  
Sbjct  248  ----KEDKSTVAS--GTESSENAFNSPKWMLDGGFKMDEKMKGSSSDSQTNYSSGASESD  301

Query  186  IVSEGHNMEQTA----AKRVRKPTKRYI  115
            +   G +  +       KRV KP +RYI
Sbjct  302  VSFHGKDENEVGGLVTGKRVHKPPRRYI  329



>ref|XP_010031962.1| PREDICTED: uncharacterized protein LOC104421640 isoform X1 [Eucalyptus 
grandis]
 gb|KCW51360.1| hypothetical protein EUGRSUZ_J009051 [Eucalyptus grandis]
Length=549

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 75/148 (51%), Gaps = 16/148 (11%)
 Frame = -2

Query  528  ICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS------CDFSCTSFVIED  367
            + L+++TV+EL + F + FGR+T+V DKQWLKRRI  GL N+       + +C   + ++
Sbjct  188  VSLDHMTVRELQDAFHSMFGRETAVIDKQWLKRRILFGLHNNNELDRPLNLTCCGSISQE  247

Query  366  SRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIPNSTLEGC  187
                K+ K  +AS  G+ S +     P          D+K++  ++ ++ N  +   E  
Sbjct  248  ----KEDKSTVAS--GTESSENAFNSPKWMLDGGFKMDEKMKGSSSDSQTNYSSGASESD  301

Query  186  IVSEGHNMEQTA----AKRVRKPTKRYI  115
            +   G +  +       KRV KP +RYI
Sbjct  302  VSFHGKDENEVGGLVTGKRVHKPPRRYI  329



>ref|XP_010031965.1| PREDICTED: uncharacterized protein LOC104421640 isoform X4 [Eucalyptus 
grandis]
 gb|KCW51362.1| hypothetical protein EUGRSUZ_J009051 [Eucalyptus grandis]
Length=494

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 75/148 (51%), Gaps = 16/148 (11%)
 Frame = -2

Query  528  ICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS------CDFSCTSFVIED  367
            + L+++TV+EL + F + FGR+T+V DKQWLKRRI  GL N+       + +C   + ++
Sbjct  188  VSLDHMTVRELQDAFHSMFGRETAVIDKQWLKRRILFGLHNNNELDRPLNLTCCGSISQE  247

Query  366  SRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIPNSTLEGC  187
                K+ K  +AS  G+ S +     P          D+K++  ++ ++ N  +   E  
Sbjct  248  ----KEDKSTVAS--GTESSENAFNSPKWMLDGGFKMDEKMKGSSSDSQTNYSSGASESD  301

Query  186  IVSEGHNMEQTA----AKRVRKPTKRYI  115
            +   G +  +       KRV KP +RYI
Sbjct  302  VSFHGKDENEVGGLVTGKRVHKPPRRYI  329



>ref|XP_010031964.1| PREDICTED: uncharacterized protein LOC104421640 isoform X3 [Eucalyptus 
grandis]
Length=513

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 75/148 (51%), Gaps = 16/148 (11%)
 Frame = -2

Query  528  ICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSNS------CDFSCTSFVIED  367
            + L+++TV+EL + F + FGR+T+V DKQWLKRRI  GL N+       + +C   + ++
Sbjct  188  VSLDHMTVRELQDAFHSMFGRETAVIDKQWLKRRILFGLHNNNELDRPLNLTCCGSISQE  247

Query  366  SRVVKKVKENIASVNGSISKDPIVALPNINSGSSSGHDDKVESPANITEGNIPNSTLEGC  187
                K+ K  +AS  G+ S +     P          D+K++  ++ ++ N  +   E  
Sbjct  248  ----KEDKSTVAS--GTESSENAFNSPKWMLDGGFKMDEKMKGSSSDSQTNYSSGASESD  301

Query  186  IVSEGHNMEQTA----AKRVRKPTKRYI  115
            +   G +  +       KRV KP +RYI
Sbjct  302  VSFHGKDENEVGGLVTGKRVHKPPRRYI  329



>ref|XP_002529433.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32959.1| conserved hypothetical protein [Ricinus communis]
Length=473

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = -2

Query  537  KGEICLENLTVKELHETFKATFGRDTSVKDKQWLKRRISMGLSN  406
            K  + L+ +T ++L + F   FGR+TSV DKQWLKR I  GL N
Sbjct  87   KNSLLLDKMTAQDLRQVFSGMFGRETSVLDKQWLKRHILFGLQN  130



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660