BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP010E10 659 bp,

Length=614
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011101573.1|  PREDICTED: tubby-like F-box protein 8              136   3e-34   Sesamum indicum [beniseed]
emb|CAN82256.1|  hypothetical protein VITISV_009404                     135   5e-34   Vitis vinifera
ref|XP_002267914.1|  PREDICTED: tubby-like F-box protein 8              135   1e-33   Vitis vinifera
ref|XP_010241698.1|  PREDICTED: tubby-like F-box protein 8              134   2e-33   Nelumbo nucifera [Indian lotus]
ref|XP_006432266.1|  hypothetical protein CICLE_v10001261mg             130   4e-33   Citrus clementina
ref|XP_008237608.1|  PREDICTED: tubby-like F-box protein 8              130   4e-33   Prunus mume [ume]
ref|XP_010260950.1|  PREDICTED: tubby-like F-box protein 8              133   5e-33   Nelumbo nucifera [Indian lotus]
gb|KJB59395.1|  hypothetical protein B456_009G254100                    131   1e-32   Gossypium raimondii
ref|XP_006597337.1|  PREDICTED: tubby-like F-box protein 8-like i...    132   1e-32   Glycine max [soybeans]
gb|KJB32749.1|  hypothetical protein B456_005G259600                    131   2e-32   Gossypium raimondii
ref|XP_006432270.1|  hypothetical protein CICLE_v10001261mg             130   2e-32   Citrus clementina
gb|KJB59393.1|  hypothetical protein B456_009G254100                    131   2e-32   Gossypium raimondii
ref|XP_010680670.1|  PREDICTED: tubby-like F-box protein 8              131   2e-32   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|AED87506.1|  F-box protein                                           131   2e-32   Gossypium hirsutum [American cotton]
gb|KHG03411.1|  Tubby-like F-box protein 8                              131   2e-32   Gossypium arboreum [tree cotton]
ref|XP_011087815.1|  PREDICTED: tubby-like F-box protein 8              131   2e-32   Sesamum indicum [beniseed]
ref|XP_008218837.1|  PREDICTED: tubby-like F-box protein 8              127   3e-32   Prunus mume [ume]
ref|XP_006432267.1|  hypothetical protein CICLE_v10001261mg             130   3e-32   Citrus clementina
ref|XP_010062111.1|  PREDICTED: tubby-like F-box protein 8              130   3e-32   Eucalyptus grandis [rose gum]
gb|KDO50624.1|  hypothetical protein CISIN_1g014405mg                   130   3e-32   Citrus sinensis [Valencia orange]
ref|XP_004140892.1|  PREDICTED: tubby-like F-box protein 14-like        130   4e-32   Cucumis sativus [cucumbers]
ref|XP_011092391.1|  PREDICTED: tubby-like F-box protein 8              130   4e-32   Sesamum indicum [beniseed]
ref|XP_009414588.1|  PREDICTED: tubby-like F-box protein 8              130   5e-32   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDO97502.1|  unnamed protein product                                130   5e-32   Coffea canephora [robusta coffee]
gb|KDP30771.1|  hypothetical protein JCGZ_15200                         130   6e-32   Jatropha curcas
ref|XP_006434458.1|  hypothetical protein CICLE_v10001251mg             130   6e-32   Citrus clementina
ref|XP_004485526.1|  PREDICTED: tubby-like F-box protein 8-like         130   6e-32   Cicer arietinum [garbanzo]
gb|ABK94204.1|  unknown                                                 130   6e-32   Populus trichocarpa [western balsam poplar]
ref|XP_002306697.1|  hypothetical protein POPTR_0005s21450g             130   6e-32   Populus trichocarpa [western balsam poplar]
ref|XP_006473057.1|  PREDICTED: tubby-like F-box protein 8-like i...    130   6e-32   Citrus sinensis [Valencia orange]
gb|KDO83735.1|  hypothetical protein CISIN_1g014365mg                   129   6e-32   Citrus sinensis [Valencia orange]
ref|XP_002524285.1|  phosphoric diester hydrolase, putative             130   7e-32   Ricinus communis
ref|XP_011044216.1|  PREDICTED: tubby-like F-box protein 8 isofor...    129   1e-31   Populus euphratica
ref|XP_010930978.1|  PREDICTED: tubby-like F-box protein 14             129   1e-31   Elaeis guineensis
ref|XP_002302178.1|  F-box family protein                               129   1e-31   Populus trichocarpa [western balsam poplar]
ref|NP_001280941.1|  tubby-like F-box protein 8                         129   1e-31   Malus domestica [apple tree]
ref|XP_009416896.1|  PREDICTED: tubby-like F-box protein 8              129   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011044215.1|  PREDICTED: tubby-like F-box protein 8 isofor...    129   2e-31   Populus euphratica
ref|XP_007148458.1|  hypothetical protein PHAVU_006G210500g             129   2e-31   Phaseolus vulgaris [French bean]
ref|XP_010108639.1|  Tubby-like F-box protein 8                         129   2e-31   Morus notabilis
ref|XP_008445764.1|  PREDICTED: tubby-like F-box protein 8              129   2e-31   Cucumis melo [Oriental melon]
ref|XP_007201025.1|  hypothetical protein PRUPE_ppa006121mg             128   2e-31   Prunus persica
ref|XP_008781418.1|  PREDICTED: tubby-like F-box protein 8              128   2e-31   Phoenix dactylifera
ref|XP_004496469.1|  PREDICTED: tubby-like F-box protein 8-like i...    128   2e-31   
ref|XP_011044224.1|  PREDICTED: tubby-like F-box protein 8 isofor...    127   3e-31   Populus euphratica
ref|XP_010911994.1|  PREDICTED: tubby-like F-box protein 8 isofor...    127   3e-31   Elaeis guineensis
ref|XP_007041585.1|  Tubby like protein 10 isoform 1                    128   3e-31   Theobroma cacao [chocolate]
ref|XP_010063867.1|  PREDICTED: tubby-like F-box protein 8              128   3e-31   Eucalyptus grandis [rose gum]
ref|XP_008218843.1|  PREDICTED: tubby-like F-box protein 8              128   4e-31   Prunus mume [ume]
ref|XP_002266692.1|  PREDICTED: tubby-like F-box protein 8              127   4e-31   Vitis vinifera
ref|XP_007222448.1|  hypothetical protein PRUPE_ppa006177mg             127   4e-31   Prunus persica
ref|XP_006339926.1|  PREDICTED: tubby-like F-box protein 8-like i...    127   4e-31   Solanum tuberosum [potatoes]
ref|XP_004290516.1|  PREDICTED: tubby-like F-box protein 8              127   4e-31   Fragaria vesca subsp. vesca
ref|XP_011044217.1|  PREDICTED: tubby-like F-box protein 8 isofor...    127   4e-31   Populus euphratica
ref|XP_010539730.1|  PREDICTED: tubby-like F-box protein 1              127   4e-31   Tarenaya hassleriana [spider flower]
ref|XP_010911991.1|  PREDICTED: tubby-like F-box protein 8 isofor...    127   5e-31   Elaeis guineensis
emb|CAN68201.1|  hypothetical protein VITISV_003183                     128   5e-31   Vitis vinifera
ref|XP_008785830.1|  PREDICTED: tubby-like F-box protein 8              127   6e-31   Phoenix dactylifera
gb|KHG16429.1|  Tubby-like F-box protein 8                              127   7e-31   Gossypium arboreum [tree cotton]
ref|XP_009615512.1|  PREDICTED: tubby-like F-box protein 8              127   8e-31   Nicotiana tomentosiformis
ref|XP_009351377.1|  PREDICTED: tubby-like F-box protein 8              127   8e-31   Pyrus x bretschneideri [bai li]
ref|XP_003531569.1|  PREDICTED: tubby-like F-box protein 8-like i...    127   9e-31   Glycine max [soybeans]
gb|KJB15992.1|  hypothetical protein B456_002G207100                    127   9e-31   Gossypium raimondii
ref|XP_002306698.1|  hypothetical protein POPTR_0005s21460g             126   9e-31   Populus trichocarpa [western balsam poplar]
ref|XP_008381822.1|  PREDICTED: tubby-like F-box protein 8              126   1e-30   Malus domestica [apple tree]
ref|XP_010912431.1|  PREDICTED: tubby-like F-box protein 14             126   1e-30   Elaeis guineensis
ref|XP_007019500.1|  Tubby like protein 10 isoform 1                    126   1e-30   Theobroma cacao [chocolate]
ref|XP_008365270.1|  PREDICTED: tubby-like F-box protein 8              126   1e-30   Malus domestica [apple tree]
ref|XP_009341307.1|  PREDICTED: tubby-like F-box protein 8              126   1e-30   Pyrus x bretschneideri [bai li]
ref|XP_011042854.1|  PREDICTED: tubby-like F-box protein 8              126   1e-30   Populus euphratica
ref|XP_004961952.1|  PREDICTED: tubby-like F-box protein 8-like         126   2e-30   Setaria italica
ref|XP_004287069.1|  PREDICTED: tubby-like F-box protein 8              125   2e-30   Fragaria vesca subsp. vesca
ref|XP_004248812.1|  PREDICTED: tubby-like F-box protein 8              125   2e-30   
ref|XP_003518598.1|  PREDICTED: tubby-like F-box protein 8-like i...    125   2e-30   Glycine max [soybeans]
ref|XP_006598751.1|  PREDICTED: uncharacterized protein LOC100803...    125   2e-30   Glycine max [soybeans]
ref|XP_004237792.1|  PREDICTED: tubby-like F-box protein 8              125   3e-30   Solanum lycopersicum
ref|XP_008237579.1|  PREDICTED: tubby-like F-box protein 8              125   3e-30   Prunus mume [ume]
ref|XP_008784162.1|  PREDICTED: tubby-like F-box protein 8 isofor...    125   3e-30   Phoenix dactylifera
ref|XP_006359816.1|  PREDICTED: tubby-like F-box protein 8-like         125   3e-30   Solanum tuberosum [potatoes]
ref|XP_008784163.1|  PREDICTED: tubby-like F-box protein 8 isofor...    125   3e-30   Phoenix dactylifera
ref|XP_009783834.1|  PREDICTED: tubby-like F-box protein 8              125   4e-30   Nicotiana sylvestris
ref|XP_004140690.1|  PREDICTED: tubby-like F-box protein 8-like         125   4e-30   
ref|XP_004163912.1|  PREDICTED: tubby-like F-box protein 8-like         125   5e-30   
ref|XP_007152022.1|  hypothetical protein PHAVU_004G095000g             124   5e-30   Phaseolus vulgaris [French bean]
ref|NP_001280861.1|  tubby-like F-box protein 8                         124   5e-30   Malus domestica [apple tree]
ref|XP_008456108.1|  PREDICTED: tubby-like F-box protein 8              124   5e-30   Cucumis melo [Oriental melon]
ref|XP_009419406.1|  PREDICTED: tubby-like F-box protein 8 isofor...    123   6e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010530245.1|  PREDICTED: tubby-like F-box protein 8              124   8e-30   Tarenaya hassleriana [spider flower]
ref|XP_010927387.1|  PREDICTED: tubby-like F-box protein 8              124   1e-29   Elaeis guineensis
ref|NP_001242468.1|  uncharacterized protein LOC100803729               123   1e-29   Glycine max [soybeans]
ref|XP_006351828.1|  PREDICTED: tubby-like F-box protein 8-like         123   2e-29   Solanum tuberosum [potatoes]
ref|XP_009419403.1|  PREDICTED: tubby-like F-box protein 8 isofor...    123   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004230571.1|  PREDICTED: tubby-like F-box protein 8              123   2e-29   Solanum lycopersicum
ref|XP_002441166.1|  hypothetical protein SORBIDRAFT_09g021590          123   2e-29   Sorghum bicolor [broomcorn]
emb|CDP11400.1|  unnamed protein product                                121   6e-29   Coffea canephora [robusta coffee]
ref|XP_008793936.1|  PREDICTED: tubby-like F-box protein 8              121   7e-29   Phoenix dactylifera
ref|XP_003592106.1|  Tubby-like F-box protein                           121   7e-29   Medicago truncatula
ref|XP_004516626.1|  PREDICTED: tubby-like F-box protein 8-like i...    121   8e-29   Cicer arietinum [garbanzo]
ref|XP_006390145.1|  hypothetical protein EUTSA_v10018551mg             121   9e-29   Eutrema salsugineum
ref|XP_009629482.1|  PREDICTED: tubby-like F-box protein 8 isofor...    120   1e-28   Nicotiana tomentosiformis
ref|XP_010416614.1|  PREDICTED: tubby-like F-box protein 1              120   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_003593111.1|  Tubby-like F-box protein                           120   2e-28   Medicago truncatula
ref|XP_009393408.1|  PREDICTED: tubby-like F-box protein 8              120   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010471851.1|  PREDICTED: tubby-like F-box protein 1              120   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_009629484.1|  PREDICTED: tubby-like F-box protein 8 isofor...    119   2e-28   Nicotiana tomentosiformis
ref|XP_006654462.1|  PREDICTED: tubby-like F-box protein 8-like         120   2e-28   Oryza brachyantha
ref|XP_004140966.1|  PREDICTED: tubby-like F-box protein 14-like        120   2e-28   Cucumis sativus [cucumbers]
ref|XP_008441515.1|  PREDICTED: tubby-like F-box protein 8              120   2e-28   Cucumis melo [Oriental melon]
ref|XP_010428756.1|  PREDICTED: tubby-like F-box protein 1              120   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_006588484.1|  PREDICTED: uncharacterized protein LOC100810...    120   3e-28   Glycine max [soybeans]
ref|NP_001055656.1|  Os05g0437900                                       120   3e-28   
dbj|BAJ34070.1|  unnamed protein product                                119   3e-28   Eutrema halophilum
ref|NP_001242014.1|  uncharacterized protein LOC100810531               119   3e-28   Glycine max [soybeans]
emb|CDY45959.1|  BnaA02g17850D                                          119   4e-28   Brassica napus [oilseed rape]
gb|EMT05453.1|  hypothetical protein F775_20277                         119   4e-28   Aegilops tauschii
ref|XP_009124582.1|  PREDICTED: tubby-like F-box protein 1              119   4e-28   Brassica rapa
ref|XP_006302213.1|  hypothetical protein CARUB_v10020231mg             119   5e-28   Capsella rubella
gb|EYU18525.1|  hypothetical protein MIMGU_mgv1a006446mg                119   5e-28   Erythranthe guttata [common monkey flower]
emb|CDY65845.1|  BnaCnng48830D                                          119   5e-28   Brassica napus [oilseed rape]
dbj|BAJ85290.1|  predicted protein                                      119   6e-28   Hordeum vulgare subsp. vulgare [barley]
ref|XP_009411929.1|  PREDICTED: tubby-like F-box protein 8              119   6e-28   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS46947.1|  Tubby-like F-box protein 8                              118   7e-28   Triticum urartu
emb|CDY13570.1|  BnaC02g23810D                                          118   8e-28   Brassica napus [oilseed rape]
ref|XP_007143538.1|  hypothetical protein PHAVU_007G079900g             118   9e-28   Phaseolus vulgaris [French bean]
emb|CDX87562.1|  BnaA07g33110D                                          118   9e-28   Brassica napus [oilseed rape]
ref|XP_009106351.1|  PREDICTED: tubby-like F-box protein 1              118   1e-27   Brassica rapa
ref|XP_009800903.1|  PREDICTED: tubby-like F-box protein 8              116   3e-27   Nicotiana sylvestris
ref|XP_010232609.1|  PREDICTED: tubby-like F-box protein 3              116   4e-27   Brachypodium distachyon [annual false brome]
ref|NP_177816.1|  tubby-like F-box protein 1                            116   5e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887661.1|  hypothetical protein ARALYDRAFT_476847             116   5e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_009604537.1|  PREDICTED: tubby-like F-box protein 14             116   5e-27   Nicotiana tomentosiformis
ref|XP_009762099.1|  PREDICTED: tubby-like F-box protein 8 isofor...    115   8e-27   Nicotiana sylvestris
ref|XP_010479015.1|  PREDICTED: tubby-like F-box protein 5 isofor...    114   9e-27   Camelina sativa [gold-of-pleasure]
gb|EMT04337.1|  hypothetical protein F775_32198                         115   1e-26   Aegilops tauschii
gb|KHN46417.1|  Tubby-like F-box protein 8                              115   1e-26   Glycine soja [wild soybean]
ref|XP_009762107.1|  PREDICTED: tubby-like F-box protein 8 isofor...    114   1e-26   Nicotiana sylvestris
gb|EMS66001.1|  Tubby-like F-box protein 13                             115   1e-26   Triticum urartu
ref|XP_003556153.1|  PREDICTED: tubby-like F-box protein 8-like i...    115   1e-26   Glycine max [soybeans]
ref|XP_003568372.1|  PREDICTED: tubby-like F-box protein 8              115   1e-26   Brachypodium distachyon [annual false brome]
gb|ABV26700.1|  putative transcription factor                           115   1e-26   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010479014.1|  PREDICTED: tubby-like F-box protein 5 isofor...    115   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_006653064.1|  PREDICTED: tubby-like F-box protein 7-like i...    115   1e-26   Oryza brachyantha
emb|CBH32570.1|  tubby-like protein, putative, expressed                115   2e-26   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001066230.1|  Os12g0163400                                       114   2e-26   
gb|EAY82366.1|  hypothetical protein OsI_37578                          114   2e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_003580872.1|  PREDICTED: tubby-like F-box protein 7              114   3e-26   Brachypodium distachyon [annual false brome]
gb|AAD39275.1|AC007203_7  Hypothetical protein                          114   3e-26   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ32494.1|  hypothetical protein OsJ_16713                          114   3e-26   Oryza sativa Japonica Group [Japonica rice]
emb|CAB53492.1|  CAA303719.1 protein                                    114   4e-26   Oryza sativa [red rice]
ref|NP_564485.1|  tubby like protein 5                                  113   4e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001054335.1|  Os04g0687900                                       114   4e-26   
ref|XP_006645077.1|  PREDICTED: tubby-like F-box protein 3-like i...    112   8e-26   Oryza brachyantha
gb|EYU35420.1|  hypothetical protein MIMGU_mgv1a006260mg                112   9e-26   Erythranthe guttata [common monkey flower]
gb|EMT26423.1|  hypothetical protein F775_17552                         112   1e-25   Aegilops tauschii
ref|XP_004970704.1|  PREDICTED: tubby-like F-box protein 3-like         112   1e-25   Setaria italica
dbj|BAK00725.1|  predicted protein                                      112   1e-25   Hordeum vulgare subsp. vulgare [barley]
ref|XP_006663846.1|  PREDICTED: tubby-like F-box protein 14-like        112   2e-25   Oryza brachyantha
ref|NP_001044910.1|  Os01g0866800                                       112   2e-25   
ref|XP_003578872.1|  PREDICTED: tubby-like F-box protein 14             111   2e-25   Brachypodium distachyon [annual false brome]
ref|XP_010500111.1|  PREDICTED: tubby-like F-box protein 5              110   2e-25   Camelina sativa [gold-of-pleasure]
tpg|DAA56673.1|  TPA: hypothetical protein ZEAMMB73_492533              111   2e-25   Zea mays [maize]
ref|XP_006662761.1|  PREDICTED: tubby-like F-box protein 13-like        111   3e-25   Oryza brachyantha
ref|XP_006307514.1|  hypothetical protein CARUB_v10009138mg             110   4e-25   Capsella rubella
ref|NP_001130799.1|  uncharacterized protein LOC100191903               111   4e-25   Zea mays [maize]
gb|EMS52647.1|  Tubby-like F-box protein 3                              111   4e-25   Triticum urartu
emb|CBI20006.3|  unnamed protein product                                110   4e-25   Vitis vinifera
ref|XP_008661891.1|  PREDICTED: LOC100281492 isoform X1                 110   4e-25   Zea mays [maize]
ref|NP_001147882.1|  LOC100281492                                       110   5e-25   Zea mays [maize]
ref|XP_002456692.1|  hypothetical protein SORBIDRAFT_03g040940          111   5e-25   Sorghum bicolor [broomcorn]
gb|EMT21705.1|  hypothetical protein F775_29357                         110   7e-25   Aegilops tauschii
emb|CDY36119.1|  BnaA08g19290D                                          110   8e-25   Brassica napus [oilseed rape]
ref|XP_004977310.1|  PREDICTED: tubby-like F-box protein 14-like ...    110   8e-25   
ref|XP_009109870.1|  PREDICTED: tubby-like F-box protein 10             110   8e-25   Brassica rapa
ref|XP_004959977.1|  PREDICTED: tubby-like F-box protein 7-like         109   1e-24   Setaria italica
ref|NP_973909.1|  tubby-like F-box protein 10                           107   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893958.1|  hypothetical protein ARALYDRAFT_473770             108   2e-24   Arabidopsis lyrata subsp. lyrata
gb|EMS53157.1|  Tubby-like F-box protein 7                              109   2e-24   Triticum urartu
ref|XP_004978763.1|  PREDICTED: tubby-like F-box protein 13-like ...    108   2e-24   Setaria italica
dbj|BAJ94970.1|  predicted protein                                      108   3e-24   Hordeum vulgare subsp. vulgare [barley]
dbj|BAH19883.1|  AT1G25280                                              107   3e-24   Arabidopsis thaliana [mouse-ear cress]
gb|ACG43268.1|  tubby-like protein                                      108   4e-24   Zea mays [maize]
gb|AAN46232.1|  unknown protein                                         107   4e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AAN46223.1|  unknown protein                                         107   4e-24   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ88633.1|  predicted protein                                      106   4e-24   Hordeum vulgare subsp. vulgare [barley]
gb|AAN46234.1|  unknown protein                                         107   5e-24   Arabidopsis lyrata [lyrate rockcress]
ref|NP_173899.1|  tubby-like F-box protein 10                           107   5e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893953.1|  hypothetical protein ARALYDRAFT_891335             107   5e-24   Arabidopsis lyrata subsp. lyrata
ref|XP_006307530.1|  hypothetical protein CARUB_v10009152mg             107   6e-24   Capsella rubella
ref|XP_010460402.1|  PREDICTED: tubby-like F-box protein 10             107   6e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010477951.1|  PREDICTED: tubby-like F-box protein 10             107   6e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010499129.1|  PREDICTED: tubby-like F-box protein 10             107   6e-24   Camelina sativa [gold-of-pleasure]
ref|XP_006415851.1|  hypothetical protein EUTSA_v10007625mg             107   8e-24   Eutrema salsugineum
emb|CDY42119.1|  BnaA09g28410D                                          107   8e-24   Brassica napus [oilseed rape]
ref|XP_009115300.1|  PREDICTED: tubby-like F-box protein 10             107   1e-23   Brassica rapa
gb|AAN46233.1|  unknown protein                                         106   1e-23   Arabidopsis thaliana [mouse-ear cress]
emb|CDX84977.1|  BnaC05g20780D                                          106   2e-23   Brassica napus [oilseed rape]
ref|XP_003577813.1|  PREDICTED: tubby-like F-box protein 13             106   2e-23   Brachypodium distachyon [annual false brome]
gb|EMS62143.1|  Tubby-like F-box protein 14                             105   3e-23   Triticum urartu
tpg|DAA36762.1|  TPA: hypothetical protein ZEAMMB73_526243              104   3e-23   Zea mays [maize]
emb|CDY51990.1|  BnaC03g75660D                                          105   4e-23   Brassica napus [oilseed rape]
ref|NP_001147678.1|  LOC100281288                                       105   5e-23   Zea mays [maize]
gb|EPS72900.1|  hypothetical protein M569_01857                         104   6e-23   Genlisea aurea
ref|XP_002447368.1|  hypothetical protein SORBIDRAFT_06g033820          104   8e-23   Sorghum bicolor [broomcorn]
ref|XP_009103059.1|  PREDICTED: tubby-like F-box protein 10             104   9e-23   Brassica rapa
emb|CDY66464.1|  BnaCnng51010D                                          103   1e-22   Brassica napus [oilseed rape]
emb|CDY72036.1|  BnaA07g36880D                                          103   1e-22   Brassica napus [oilseed rape]
gb|AEW08551.1|  hypothetical protein CL454Contig1_04                  98.6    1e-22   Pinus lambertiana
gb|ACG46316.1|  tubby-like protein                                      103   1e-22   Zea mays [maize]
ref|XP_008676606.1|  PREDICTED: uncharacterized protein LOC100193...    103   1e-22   Zea mays [maize]
gb|ACG37338.1|  tubby-like protein                                      103   1e-22   Zea mays [maize]
ref|NP_001132473.1|  uncharacterized protein LOC100193930               103   1e-22   Zea mays [maize]
ref|XP_008667909.1|  PREDICTED: LOC100281288 isoform X1                 104   2e-22   Zea mays [maize]
ref|XP_006878561.1|  hypothetical protein AMTR_s00011p00238180          102   3e-22   
gb|EMT26507.1|  hypothetical protein F775_27998                         102   5e-22   Aegilops tauschii
ref|XP_010531933.1|  PREDICTED: tubby-like F-box protein 10             101   7e-22   Tarenaya hassleriana [spider flower]
ref|XP_002964280.1|  hypothetical protein SELMODRAFT_230435             100   2e-21   Selaginella moellendorffii
ref|XP_006307685.1|  hypothetical protein CARUB_v10009311mg             100   2e-21   Capsella rubella
dbj|BAA82866.1|  tubby-like protein                                     100   2e-21   Lemna paucicostata
ref|XP_009786613.1|  PREDICTED: tubby-like F-box protein 5            99.8    3e-21   Nicotiana sylvestris
ref|XP_002989529.1|  hypothetical protein SELMODRAFT_160180             100   3e-21   Selaginella moellendorffii
ref|XP_004232417.1|  PREDICTED: tubby-like F-box protein 5            98.2    1e-20   Solanum lycopersicum
gb|ABK24436.1|  unknown                                               98.2    1e-20   Picea sitchensis
gb|EYU17436.1|  hypothetical protein MIMGU_mgv1a007105mg              97.4    2e-20   Erythranthe guttata [common monkey flower]
ref|XP_009610594.1|  PREDICTED: tubby-like F-box protein 5            97.4    2e-20   Nicotiana tomentosiformis
ref|XP_009603271.1|  PREDICTED: tubby-like F-box protein 5            96.7    4e-20   Nicotiana tomentosiformis
ref|XP_002449042.1|  hypothetical protein SORBIDRAFT_05g003900        97.1    5e-20   Sorghum bicolor [broomcorn]
emb|CDP02006.1|  unnamed protein product                              96.3    6e-20   Coffea canephora [robusta coffee]
emb|CBI17501.3|  unnamed protein product                              95.5    6e-20   Vitis vinifera
ref|XP_004972405.1|  PREDICTED: tubby-like F-box protein 12-like      96.3    8e-20   Setaria italica
ref|XP_010926002.1|  PREDICTED: tubby-like F-box protein 5            95.5    1e-19   Elaeis guineensis
ref|XP_006340635.1|  PREDICTED: tubby-like F-box protein 5-like i...  95.5    1e-19   Solanum tuberosum [potatoes]
ref|XP_002265804.1|  PREDICTED: tubby-like F-box protein 5            95.5    1e-19   Vitis vinifera
ref|XP_009803929.1|  PREDICTED: tubby-like F-box protein 5            95.1    1e-19   Nicotiana sylvestris
gb|KJB23182.1|  hypothetical protein B456_004G085800                  94.7    2e-19   Gossypium raimondii
ref|XP_011099633.1|  PREDICTED: tubby-like F-box protein 5            94.7    2e-19   Sesamum indicum [beniseed]
ref|XP_004237815.1|  PREDICTED: tubby-like F-box protein 5            94.4    2e-19   Solanum lycopersicum
ref|XP_007156059.1|  hypothetical protein PHAVU_003G254900g           94.7    2e-19   Phaseolus vulgaris [French bean]
emb|CBI18204.3|  unnamed protein product                              93.6    2e-19   Vitis vinifera
ref|XP_007147863.1|  hypothetical protein PHAVU_006G161100g           94.0    3e-19   Phaseolus vulgaris [French bean]
ref|XP_006363440.1|  PREDICTED: tubby-like F-box protein 5-like       94.4    3e-19   Solanum tuberosum [potatoes]
gb|EPS60718.1|  hypothetical protein M569_14084                       93.2    3e-19   Genlisea aurea
ref|XP_009590675.1|  PREDICTED: tubby-like F-box protein 5            94.0    3e-19   Nicotiana tomentosiformis
gb|EMT26643.1|  hypothetical protein F775_07511                       94.7    3e-19   Aegilops tauschii
gb|EMS66196.1|  Tubby-like F-box protein 12                           94.4    4e-19   Triticum urartu
ref|XP_009390170.1|  PREDICTED: tubby-like F-box protein 5            94.0    4e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002982271.1|  hypothetical protein SELMODRAFT_116378           94.0    4e-19   Selaginella moellendorffii
ref|XP_002966201.1|  hypothetical protein SELMODRAFT_85745            94.0    4e-19   Selaginella moellendorffii
gb|KJB41991.1|  hypothetical protein B456_007G131500                  93.2    5e-19   Gossypium raimondii
ref|XP_009380364.1|  PREDICTED: tubby-like F-box protein 5            94.0    5e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001065832.2|  Os11g0163600                                     92.8    5e-19   
gb|KJB41989.1|  hypothetical protein B456_007G131500                  93.2    6e-19   Gossypium raimondii
ref|XP_003573256.1|  PREDICTED: tubby-like F-box protein 12           93.6    6e-19   Brachypodium distachyon [annual false brome]
ref|NP_001280988.1|  tubby-like F-box protein 5                       93.2    7e-19   Malus domestica [apple tree]
gb|KJB71035.1|  hypothetical protein B456_011G101400                  92.8    8e-19   Gossypium raimondii
ref|XP_006574698.1|  PREDICTED: tubby-like F-box protein 5-like       92.8    9e-19   Glycine max [soybeans]
gb|EAY80057.1|  hypothetical protein OsI_35223                        92.8    1e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_004134184.1|  PREDICTED: tubby-like F-box protein 3-like       92.0    1e-18   
ref|XP_008438799.1|  PREDICTED: tubby-like F-box protein 3            92.0    1e-18   Cucumis melo [Oriental melon]
ref|XP_006659019.1|  PREDICTED: tubby-like F-box protein 12-like ...  92.8    1e-18   Oryza brachyantha
ref|XP_007046900.1|  Tubby-like F-box protein 5 isoform 1             92.4    1e-18   Theobroma cacao [chocolate]
ref|XP_007154224.1|  hypothetical protein PHAVU_003G100700g           91.7    1e-18   Phaseolus vulgaris [French bean]
ref|XP_010258386.1|  PREDICTED: tubby-like F-box protein 5            92.4    1e-18   Nelumbo nucifera [Indian lotus]
ref|XP_003546101.1|  PREDICTED: tubby-like F-box protein 3-like       92.0    1e-18   Glycine max [soybeans]
gb|ABR18042.1|  unknown                                               92.0    1e-18   Picea sitchensis
gb|KHN33114.1|  Tubby-like F-box protein 6                            91.3    2e-18   Glycine soja [wild soybean]
gb|KHF99338.1|  Tubby-like F-box protein 3                            92.0    2e-18   Gossypium arboreum [tree cotton]
ref|XP_002965452.1|  hypothetical protein SELMODRAFT_83983            92.4    2e-18   Selaginella moellendorffii
ref|XP_010921736.1|  PREDICTED: tubby-like F-box protein 3 isofor...  91.7    2e-18   Elaeis guineensis
ref|XP_010921734.1|  PREDICTED: tubby-like F-box protein 3 isofor...  91.7    2e-18   Elaeis guineensis
ref|XP_001777506.1|  predicted protein                                92.0    2e-18   Physcomitrella patens
gb|EYU40188.1|  hypothetical protein MIMGU_mgv1a007253mg              92.0    2e-18   Erythranthe guttata [common monkey flower]
ref|XP_010095256.1|  Tubby-like F-box protein 5                       92.0    2e-18   Morus notabilis
ref|XP_002984539.1|  hypothetical protein SELMODRAFT_181065           92.0    2e-18   Selaginella moellendorffii
ref|XP_009405557.1|  PREDICTED: tubby-like F-box protein 6 isofor...  91.7    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003594006.1|  Tubby-like F-box protein                         91.3    3e-18   Medicago truncatula
sp|Q53PP5.1|TLP13_ORYSJ  RecName: Full=Tubby-like F-box protein 1...  92.0    3e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008810717.1|  PREDICTED: tubby-like F-box protein 5            91.7    3e-18   Phoenix dactylifera
gb|KGN57066.1|  hypothetical protein Csa_3G151430                     92.0    3e-18   Cucumis sativus [cucumbers]
gb|KEH36706.1|  tubby-F-box-like protein                              90.5    3e-18   Medicago truncatula
ref|XP_010921732.1|  PREDICTED: tubby-like F-box protein 3 isofor...  91.3    3e-18   
ref|XP_009779244.1|  PREDICTED: tubby-like F-box protein 5            91.3    4e-18   
emb|CBI32266.3|  unnamed protein product                              89.4    4e-18   
ref|XP_008241696.1|  PREDICTED: tubby-like F-box protein 5            90.9    4e-18   
gb|EEC82763.1|  hypothetical protein OsI_27490                        91.3    4e-18   
gb|KHG30423.1|  Tubby-like F-box protein 5                            90.9    4e-18   
ref|XP_007202166.1|  hypothetical protein PRUPE_ppa006428mg           90.9    5e-18   
ref|XP_006855409.1|  hypothetical protein AMTR_s00057p00153680        90.9    5e-18   
ref|XP_010274452.1|  PREDICTED: tubby-like F-box protein 9            90.5    5e-18   
ref|NP_001060771.1|  Os08g0103300                                     91.3    5e-18   
gb|AFK47786.1|  unknown                                               90.5    6e-18   
ref|XP_009340733.1|  PREDICTED: tubby-like F-box protein 5            90.5    7e-18   
ref|XP_003542914.1|  PREDICTED: tubby-like F-box protein 3-like       90.1    7e-18   
ref|XP_008338328.1|  PREDICTED: tubby-like F-box protein 5            90.5    7e-18   
gb|KDO75060.1|  hypothetical protein CISIN_1g0164722mg                88.6    8e-18   
gb|KHN47289.1|  Tubby-like F-box protein 6                            89.4    8e-18   
ref|XP_004233524.1|  PREDICTED: tubby-like F-box protein 5            90.1    9e-18   
ref|XP_002269323.1|  PREDICTED: tubby-like F-box protein 3            89.7    1e-17   
ref|XP_009383506.1|  PREDICTED: tubby-like F-box protein 14           90.1    1e-17   
ref|XP_001777504.1|  predicted protein                                90.1    1e-17   
ref|XP_001772602.1|  predicted protein                                90.1    1e-17   
ref|XP_006425657.1|  hypothetical protein CICLE_v10025715mg           89.7    1e-17   
ref|XP_001768253.1|  tubby-like protein                               89.7    1e-17   
gb|KDO70942.1|  hypothetical protein CISIN_1g014979mg                 89.7    1e-17   
gb|ABR16075.1|  unknown                                               89.7    1e-17   
ref|XP_003612033.1|  Tubby-like F-box protein                         89.7    1e-17   
gb|KJB48407.1|  hypothetical protein B456_008G067400                  89.4    2e-17   
gb|KJB48406.1|  hypothetical protein B456_008G067400                  89.4    2e-17   
gb|KHN03006.1|  Tubby-like F-box protein 3                            88.6    2e-17   
ref|XP_003529593.1|  PREDICTED: tubby-like F-box protein 3-like i...  88.6    2e-17   
ref|XP_003537592.1|  PREDICTED: tubby-like F-box protein 5-like i...  89.4    2e-17   
ref|XP_004234552.1|  PREDICTED: tubby-like F-box protein 5            89.0    2e-17   
ref|XP_009365542.1|  PREDICTED: tubby-like F-box protein 5            89.4    2e-17   
gb|KDO75058.1|  hypothetical protein CISIN_1g0164722mg                87.4    2e-17   
ref|NP_001060572.1|  Os07g0667000                                     89.0    2e-17   
ref|XP_003517227.1|  PREDICTED: tubby-like F-box protein 5-like i...  89.0    2e-17   
ref|XP_008812302.1|  PREDICTED: tubby-like F-box protein 6 isofor...  89.0    3e-17   
gb|ABK94895.1|  unknown                                               88.6    3e-17   
ref|XP_011009467.1|  PREDICTED: tubby-like F-box protein 3 isofor...  87.8    3e-17   
ref|XP_006380027.1|  putative Tub family protein                      88.6    3e-17   
ref|XP_002314408.1|  putative Tub family protein                      88.2    3e-17   
ref|XP_010254793.1|  PREDICTED: tubby-like F-box protein 5            88.6    3e-17   
ref|XP_011009466.1|  PREDICTED: tubby-like F-box protein 3 isofor...  88.2    3e-17   
gb|KJB40194.1|  hypothetical protein B456_007G050300                  87.4    4e-17   
ref|XP_009403904.1|  PREDICTED: tubby-like F-box protein 5            88.6    4e-17   
gb|EYU46657.1|  hypothetical protein MIMGU_mgv1a007454mg              88.2    4e-17   
ref|XP_002520685.1|  phosphoric diester hydrolase, putative           88.6    4e-17   
ref|XP_006419672.1|  hypothetical protein CICLE_v10005517mg           87.0    4e-17   
ref|XP_004486066.1|  PREDICTED: tubby-like F-box protein 3-like i...  87.8    4e-17   
gb|KJB40192.1|  hypothetical protein B456_007G050300                  88.2    4e-17   
ref|XP_001776881.1|  tubby-like protein                               88.2    5e-17   
ref|XP_004512053.1|  PREDICTED: tubby-like F-box protein 5-like       87.8    5e-17   
ref|XP_006419673.1|  hypothetical protein CICLE_v10005517mg           87.4    6e-17   
gb|KDO75053.1|  hypothetical protein CISIN_1g0164722mg                87.4    6e-17   
ref|XP_007222682.1|  hypothetical protein PRUPE_ppa006363mg           87.8    6e-17   
gb|KDO75054.1|  hypothetical protein CISIN_1g0164722mg                87.4    6e-17   
ref|XP_010102079.1|  Tubby-like F-box protein 5                       87.8    6e-17   
gb|KHG21851.1|  Tubby-like F-box protein 5                            87.8    7e-17   
ref|XP_008388046.1|  PREDICTED: tubby-like F-box protein 5            87.4    7e-17   
ref|XP_010545046.1|  PREDICTED: tubby-like F-box protein 3 isofor...  87.4    8e-17   
ref|XP_010545048.1|  PREDICTED: tubby-like F-box protein 3 isofor...  87.4    8e-17   
ref|XP_008649690.1|  PREDICTED: tubby-like F-box protein 8            88.2    8e-17   
ref|XP_004287886.1|  PREDICTED: tubby-like F-box protein 5            87.4    9e-17   
gb|KHN36105.1|  Tubby-like F-box protein 5                            87.0    9e-17   
ref|NP_001265963.1|  tubby-like F-box protein 5-like                  87.4    9e-17   
ref|XP_010925627.1|  PREDICTED: tubby-like F-box protein 1            86.7    1e-16   
ref|XP_009336161.1|  PREDICTED: tubby-like F-box protein 5            87.0    1e-16   
ref|XP_010029781.1|  PREDICTED: tubby-like F-box protein 5            87.0    1e-16   
emb|CAJ91134.1|  tubby protein                                        85.1    1e-16   
ref|XP_009378902.1|  PREDICTED: tubby-like F-box protein 3            86.7    1e-16   
ref|XP_004166452.1|  PREDICTED: LOW QUALITY PROTEIN: tubby-like F...  86.7    1e-16   
ref|XP_006346954.1|  PREDICTED: tubby-like F-box protein 5-like i...  86.7    1e-16   
ref|XP_008458493.1|  PREDICTED: tubby-like F-box protein 3            86.3    1e-16   
emb|CDP03548.1|  unnamed protein product                              86.7    1e-16   
ref|NP_001148856.1|  tubby protein                                    86.7    1e-16   
ref|XP_010105019.1|  hypothetical protein L484_008460                 86.3    2e-16   
ref|XP_010523605.1|  PREDICTED: tubby-like F-box protein 6 isofor...  87.0    2e-16   
ref|XP_004144973.1|  PREDICTED: tubby-like F-box protein 6-like       86.3    2e-16   
ref|XP_011090855.1|  PREDICTED: tubby-like F-box protein 6            86.3    2e-16   
emb|CBI26117.3|  unnamed protein product                              85.9    2e-16   
ref|XP_008676416.1|  PREDICTED: tubby protein isoform X1              86.7    2e-16   
gb|KHN22738.1|  Tubby-like F-box protein 8                            84.7    2e-16   
ref|XP_002276906.1|  PREDICTED: tubby-like F-box protein 3            85.9    2e-16   
ref|XP_002310813.1|  hypothetical protein POPTR_0007s13040g           86.7    2e-16   
ref|XP_011025813.1|  PREDICTED: tubby-like F-box protein 5            86.7    2e-16   
ref|XP_009410931.1|  PREDICTED: tubby-like F-box protein 1            85.9    2e-16   
gb|EYU43888.1|  hypothetical protein MIMGU_mgv1a007913mg              85.9    2e-16   
gb|EYU43889.1|  hypothetical protein MIMGU_mgv1a007913mg              85.9    3e-16   
ref|NP_001239813.1|  uncharacterized protein LOC100777506             85.9    3e-16   
ref|XP_009371611.1|  PREDICTED: tubby-like F-box protein 5            85.9    3e-16   
dbj|BAH20382.1|  AT2G47900                                            84.0    3e-16   
ref|XP_007050786.1|  Tubby like protein 3 isoform 1                   85.9    3e-16   
emb|CDP07499.1|  unnamed protein product                              85.9    3e-16   
ref|XP_002521568.1|  phosphoric diester hydrolase, putative           85.9    3e-16   
ref|XP_008781391.1|  PREDICTED: tubby-like F-box protein 1            84.7    3e-16   
ref|XP_009394194.1|  PREDICTED: tubby-like F-box protein 1 isofor...  85.1    4e-16   
ref|XP_006584279.1|  PREDICTED: tubby-like F-box protein 8-like       82.4    4e-16   
ref|XP_008220821.1|  PREDICTED: tubby-like F-box protein 5            85.5    4e-16   
ref|XP_009394195.1|  PREDICTED: tubby-like F-box protein 1 isofor...  85.1    4e-16   
ref|XP_004247460.1|  PREDICTED: tubby-like F-box protein 3            85.1    4e-16   
ref|XP_008386616.1|  PREDICTED: tubby-like F-box protein 3            85.5    4e-16   
ref|XP_006359433.1|  PREDICTED: tubby-like F-box protein 3-like       85.1    4e-16   
ref|XP_011034223.1|  PREDICTED: tubby-like F-box protein 3 isofor...  85.1    4e-16   
gb|EMS68726.1|  hypothetical protein TRIUR3_30361                     84.3    4e-16   
ref|XP_002282152.1|  PREDICTED: tubby-like F-box protein 5            85.5    5e-16   
ref|XP_009369102.1|  PREDICTED: tubby-like F-box protein 3            85.1    5e-16   
ref|XP_009364972.1|  PREDICTED: tubby-like F-box protein 5            85.1    6e-16   
gb|KDP28083.1|  hypothetical protein JCGZ_13854                       85.1    6e-16   
ref|XP_007156957.1|  hypothetical protein PHAVU_002G031500g           85.1    6e-16   
ref|XP_008793042.1|  PREDICTED: tubby-like F-box protein 1 isofor...  84.0    6e-16   
gb|ABF95934.1|  Tubby protein, putative, expressed                    83.2    7e-16   
ref|NP_001131796.1|  tub family member                                83.2    7e-16   
ref|XP_003557885.1|  PREDICTED: tubby-like F-box protein 6            84.7    7e-16   
ref|NP_001280765.1|  tubby-like F-box protein 3                       84.7    7e-16   
ref|XP_011471001.1|  PREDICTED: tubby-like F-box protein 3            84.7    7e-16   
ref|XP_011082500.1|  PREDICTED: tubby-like F-box protein 3            84.7    8e-16   
ref|XP_006435014.1|  hypothetical protein CICLE_v10001275mg           84.7    8e-16   
gb|KJB63639.1|  hypothetical protein B456_010G009400                  84.3    9e-16   
gb|KJB63638.1|  hypothetical protein B456_010G009400                  84.3    9e-16   
gb|AAP40448.1|  putative F-box containing tubby family protein        84.3    9e-16   
ref|XP_008234991.1|  PREDICTED: tubby-like F-box protein 3            84.3    9e-16   
ref|XP_006473522.1|  PREDICTED: tubby-like F-box protein 5-like i...  84.7    9e-16   
gb|EMT28122.1|  hypothetical protein F775_52580                       84.3    9e-16   
gb|KDO84593.1|  hypothetical protein CISIN_1g014578mg                 84.7    9e-16   
ref|XP_006435015.1|  hypothetical protein CICLE_v10001275mg           84.7    9e-16   
gb|KJB63640.1|  hypothetical protein B456_010G009400                  84.3    9e-16   
gb|KDO84592.1|  hypothetical protein CISIN_1g014578mg                 84.7    9e-16   
ref|XP_007199898.1|  hypothetical protein PRUPE_ppa006662mg           84.3    9e-16   
ref|XP_006851394.1|  hypothetical protein AMTR_s00040p00040910        85.1    9e-16   
ref|XP_006473523.1|  PREDICTED: tubby-like F-box protein 5-like i...  84.3    1e-15   
ref|XP_008793040.1|  PREDICTED: tubby-like F-box protein 1 isofor...  84.0    1e-15   
ref|XP_008793041.1|  PREDICTED: tubby-like F-box protein 1 isofor...  84.0    1e-15   
ref|NP_849975.1|  Tubby-like F-box protein 2                          84.3    1e-15   
gb|KDO84594.1|  hypothetical protein CISIN_1g014578mg                 84.3    1e-15   
ref|NP_001189775.1|  Tubby-like F-box protein 3                       84.3    1e-15   
ref|NP_850481.1|  Tubby-like F-box protein 3                          84.3    1e-15   
ref|NP_001050117.1|  Os03g0351400                                     82.8    1e-15   
gb|KDP31657.1|  hypothetical protein JCGZ_14973                       84.3    1e-15   
ref|XP_010276984.1|  PREDICTED: tubby-like F-box protein 1            84.0    1e-15   
gb|AHZ96987.1|  TLP transcription factor M                            82.4    1e-15   
ref|XP_006651378.1|  PREDICTED: tubby-like F-box protein 6-like       83.6    1e-15   
ref|XP_010679743.1|  PREDICTED: tubby-like F-box protein 5            84.3    1e-15   
ref|XP_006479875.1|  PREDICTED: tubby-like F-box protein 3-like i...  84.0    1e-15   
ref|XP_002307367.2|  tubby-like protein 2                             84.3    1e-15   
ref|NP_001280806.1|  tubby-like F-box protein 3                       84.0    1e-15   
ref|XP_004984372.1|  PREDICTED: tubby-like F-box protein 6-like i...  84.0    1e-15   
gb|AHZ96984.1|  TLP transcription factor H                            81.3    1e-15   
ref|XP_004984381.1|  PREDICTED: tubby-like F-box protein 6-like i...  83.6    1e-15   
gb|AAD15508.1|  putative Tub family protein                           83.6    1e-15   
ref|XP_008784902.1|  PREDICTED: tubby-like F-box protein 5 isofor...  83.6    2e-15   
gb|KHN11108.1|  Tubby-like F-box protein 5                            83.6    2e-15   
ref|XP_011083899.1|  PREDICTED: tubby-like F-box protein 5            83.2    2e-15   
ref|XP_010245367.1|  PREDICTED: tubby-like F-box protein 3            83.2    2e-15   
ref|XP_008676529.1|  PREDICTED: tub family member isoform X2          83.2    2e-15   
gb|KDO87397.1|  hypothetical protein CISIN_1g015792mg                 81.6    2e-15   
sp|Q10LG8.1|TLP6_ORYSJ  RecName: Full=Tubby-like F-box protein 6;...  83.2    2e-15   
ref|XP_004291869.1|  PREDICTED: tubby-like F-box protein 2            83.6    3e-15   
ref|XP_010531041.1|  PREDICTED: tubby-like F-box protein 2            82.8    3e-15   
ref|XP_008784901.1|  PREDICTED: tubby-like F-box protein 5 isofor...  83.6    3e-15   
ref|XP_002882136.1|  hypothetical protein ARALYDRAFT_322431           83.2    3e-15   
ref|XP_002516864.1|  phosphoric diester hydrolase, putative           82.8    3e-15   
ref|XP_010414142.1|  PREDICTED: tubby-like F-box protein 2            82.8    3e-15   
ref|XP_010467642.1|  PREDICTED: tubby-like F-box protein 2            82.8    3e-15   
ref|XP_010489533.1|  PREDICTED: tubby-like F-box protein 2            82.8    3e-15   
gb|KHG22721.1|  Tubby-like F-box protein 5                            82.4    3e-15   
gb|KDO87396.1|  hypothetical protein CISIN_1g015792mg                 81.6    3e-15   
ref|XP_010518507.1|  PREDICTED: tubby-like F-box protein 3 isofor...  82.8    4e-15   
ref|XP_010024559.1|  PREDICTED: tubby-like F-box protein 3 isofor...  82.8    4e-15   
ref|XP_010518508.1|  PREDICTED: tubby-like F-box protein 3 isofor...  82.8    4e-15   
gb|AAL66203.1|AF386521_1  putative Tub family protein                 80.9    4e-15   
ref|XP_010024560.1|  PREDICTED: tubby-like F-box protein 3 isofor...  82.8    4e-15   
ref|XP_007035473.1|  Tubby like protein 3 isoform 2                   81.3    4e-15   
ref|XP_008676527.1|  PREDICTED: tub family member isoform X1          83.2    4e-15   
ref|XP_010507835.1|  PREDICTED: tubby-like F-box protein 3 isofor...  82.8    4e-15   
ref|XP_010507836.1|  PREDICTED: tubby-like F-box protein 3 isofor...  82.8    4e-15   
ref|XP_007035474.1|  Tubby like protein 3 isoform 3                   82.4    4e-15   
ref|XP_010506830.1|  PREDICTED: tubby-like F-box protein 3 isofor...  82.4    4e-15   
ref|XP_010506833.1|  PREDICTED: tubby-like F-box protein 3 isofor...  82.4    4e-15   
emb|CDP06020.1|  unnamed protein product                              82.4    4e-15   
ref|XP_010924599.1|  PREDICTED: tubby-like F-box protein 1            82.0    4e-15   
ref|XP_007035472.1|  Tubby-like F-box protein 3 isoform 1             82.4    4e-15   
ref|XP_009395247.1|  PREDICTED: tubby-like F-box protein 1            82.0    5e-15   
ref|XP_010546915.1|  PREDICTED: tubby-like F-box protein 11           82.0    5e-15   
ref|XP_010061302.1|  PREDICTED: tubby-like F-box protein 5 isofor...  82.4    5e-15   
ref|XP_009631710.1|  PREDICTED: tubby-like F-box protein 7            82.4    5e-15   
ref|XP_009792511.1|  PREDICTED: tubby-like F-box protein 3 isofor...  82.0    5e-15   
dbj|BAD08036.1|  putative tubby-like protein                          81.3    5e-15   
ref|XP_006655484.1|  PREDICTED: tubby-like F-box protein 9-like       80.9    5e-15   
ref|XP_009796557.1|  PREDICTED: tubby-like F-box protein 3            82.0    5e-15   
ref|NP_001047866.2|  Os02g0705300                                     81.3    5e-15   
ref|XP_010241159.1|  PREDICTED: tubby-like F-box protein 3            82.0    6e-15   
ref|XP_008390740.1|  PREDICTED: tubby-like F-box protein 3            82.0    6e-15   
ref|XP_006444230.1|  hypothetical protein CICLE_v10020468mg           82.0    7e-15   
ref|XP_006287908.1|  hypothetical protein CARUB_v10001142mg           82.0    7e-15   
gb|EEC79524.1|  hypothetical protein OsI_20611                        81.6    7e-15   
ref|XP_010061299.1|  PREDICTED: tubby-like F-box protein 5 isofor...  82.0    7e-15   
ref|NP_001056033.1|  Os05g0514300                                     81.6    7e-15   
ref|XP_009392664.1|  PREDICTED: tubby-like F-box protein 6            81.6    8e-15   
ref|XP_007149579.1|  hypothetical protein PHAVU_005G082200g           81.3    8e-15   
gb|KHN46381.1|  Tubby-like F-box protein 3                            80.5    8e-15   
emb|CDY27467.1|  BnaC04g51080D                                        81.6    9e-15   
ref|XP_006295942.1|  hypothetical protein CARUB_v10025079mg           81.6    9e-15   
ref|XP_003568116.1|  PREDICTED: tubby-like F-box protein 9            81.3    9e-15   
gb|KJB59796.1|  hypothetical protein B456_009G272900                  81.6    9e-15   
gb|KDO87393.1|  hypothetical protein CISIN_1g015792mg                 81.6    1e-14   
ref|XP_006342738.1|  PREDICTED: tubby-like F-box protein 6-like i...  81.3    1e-14   
ref|XP_009616927.1|  PREDICTED: tubby-like F-box protein 5 isofor...  81.6    1e-14   
ref|XP_009616928.1|  PREDICTED: tubby-like F-box protein 5 isofor...  81.6    1e-14   
ref|XP_009616929.1|  PREDICTED: tubby-like F-box protein 5 isofor...  81.6    1e-14   
ref|XP_002884125.1|  hypothetical protein ARALYDRAFT_480735           81.3    1e-14   
ref|XP_009616926.1|  PREDICTED: tubby-like F-box protein 5 isofor...  81.6    1e-14   
gb|KFK37542.1|  hypothetical protein AALP_AA4G270500                  81.3    1e-14   
ref|XP_009390188.1|  PREDICTED: tubby-like F-box protein 5            81.3    1e-14   
ref|XP_009587286.1|  PREDICTED: tubby-like F-box protein 3            81.3    1e-14   
emb|CDY55525.1|  BnaA04g29500D                                        81.3    1e-14   
gb|KHG17863.1|  Tubby-like F-box protein 6                            81.6    1e-14   
ref|XP_009118192.1|  PREDICTED: tubby-like F-box protein 3            81.3    1e-14   
ref|XP_008789372.1|  PREDICTED: tubby-like F-box protein 1 isofor...  80.9    1e-14   
gb|KJB59797.1|  hypothetical protein B456_009G272900                  82.0    1e-14   
ref|XP_009346673.1|  PREDICTED: tubby-like F-box protein 3            80.9    1e-14   
gb|EEE57650.1|  hypothetical protein OsJ_08083                        81.3    1e-14   



>ref|XP_011101573.1| PREDICTED: tubby-like F-box protein 8 [Sesamum indicum]
Length=425

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  RSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVLG  42
            RSNFLGTKFIIYDTQPP+NS+ +S PGCTSRRFY KKVSPKVP+GSYNIAQV YELNVLG
Sbjct  190  RSNFLGTKFIIYDTQPPHNSSDVSHPGCTSRRFYSKKVSPKVPSGSYNIAQVAYELNVLG  249

Query  41   TRGPRKMHCAMYS  3
            TRGPR+MHC M+S
Sbjct  250  TRGPRRMHCIMHS  262


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKRNRRTT TEY+ISM+ADNISRSS+ YIGK+RS  LGT
Sbjct  145  PALLVENGKFLLSAKRNRRTTCTEYVISMDADNISRSSSCYIGKVRSNFLGT  196



>emb|CAN82256.1| hypothetical protein VITISV_009404 [Vitis vinifera]
Length=380

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN + +S PG TSRRFY KKVSPKVPTGSYNIAQVTYELNVL
Sbjct  144  LRSNFLGTKFIIYDTQPPYNGSQLSPPGRTSRRFYSKKVSPKVPTGSYNIAQVTYELNVL  203

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  204  GTRGPRRMHCTMHS  217


 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKRNRRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  100  PALLVENGKFLLSAKRNRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  151



>ref|XP_002267914.1| PREDICTED: tubby-like F-box protein 8 [Vitis vinifera]
 ref|XP_010665127.1| PREDICTED: tubby-like F-box protein 8 [Vitis vinifera]
 ref|XP_010665128.1| PREDICTED: tubby-like F-box protein 8 [Vitis vinifera]
 ref|XP_010665129.1| PREDICTED: tubby-like F-box protein 8 [Vitis vinifera]
Length=425

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN + +S PG TSRRFY KKVSPKVPTGSYNIAQVTYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNGSQLSPPGRTSRRFYSKKVSPKVPTGSYNIAQVTYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  249  GTRGPRRMHCTMHS  262


 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKRNRRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRNRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  196



>ref|XP_010241698.1| PREDICTED: tubby-like F-box protein 8 [Nelumbo nucifera]
 ref|XP_010241699.1| PREDICTED: tubby-like F-box protein 8 [Nelumbo nucifera]
 ref|XP_010241700.1| PREDICTED: tubby-like F-box protein 8 [Nelumbo nucifera]
 ref|XP_010241701.1| PREDICTED: tubby-like F-box protein 8 [Nelumbo nucifera]
Length=424

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYD QPPYN  H+S PG TSRRFY KKVSPKVP+GSYNIAQ+TYELNVL
Sbjct  188  LRSNFLGTKFIIYDNQPPYNCAHVSPPGRTSRRFYSKKVSPKVPSGSYNIAQITYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  248  GTRGPRRMHCTMHS  261


 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKRNRRTT TEY+ISM+ADNISRSSNTYIGKLRS  LGT
Sbjct  144  PALLVENGKFLLSAKRNRRTTCTEYVISMDADNISRSSNTYIGKLRSNFLGT  195



>ref|XP_006432266.1| hypothetical protein CICLE_v10001261mg [Citrus clementina]
 ref|XP_006432271.1| hypothetical protein CICLE_v10001261mg [Citrus clementina]
 gb|ESR45506.1| hypothetical protein CICLE_v10001261mg [Citrus clementina]
 gb|ESR45511.1| hypothetical protein CICLE_v10001261mg [Citrus clementina]
Length=253

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPP+ S +I+  GCTSRRFY KKVSPKVP+GSYNIAQ+ YELNVL
Sbjct  17   LRSNFLGTKFIIYDTQPPHTSANITPSGCTSRRFYSKKVSPKVPSGSYNIAQIAYELNVL  76

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  77   GTRGPRRMHCIMHS  90



>ref|XP_008237608.1| PREDICTED: tubby-like F-box protein 8 [Prunus mume]
Length=254

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -1

Query  230  MCFRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELN  51
            + FRSNFLGTKFIIYDTQPPYNS  +  PG  SRRFY KKVSPKVPTGSYNIAQVTYELN
Sbjct  15   IIFRSNFLGTKFIIYDTQPPYNSAQLYPPG-QSRRFYSKKVSPKVPTGSYNIAQVTYELN  73

Query  50   VLGTRGPRKMHCAMYS  3
            VLGTRGPR+MHC M+S
Sbjct  74   VLGTRGPRRMHCNMHS  89



>ref|XP_010260950.1| PREDICTED: tubby-like F-box protein 8 [Nelumbo nucifera]
 ref|XP_010260951.1| PREDICTED: tubby-like F-box protein 8 [Nelumbo nucifera]
Length=422

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN  H+S PG  SRRFY KKVSPKVPTGSYNIAQVTYELNVL
Sbjct  188  LRSNFLGTKFIIYDTQPPYNGAHVSPPG-RSRRFYSKKVSPKVPTGSYNIAQVTYELNVL  246

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  247  GTRGPRRMHCVMHS  260


 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKRNRRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  144  PALLVENGKFLLSAKRNRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  195



>gb|KJB59395.1| hypothetical protein B456_009G254100 [Gossypium raimondii]
 gb|KJB59396.1| hypothetical protein B456_009G254100 [Gossypium raimondii]
Length=398

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 67/74 (91%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  +S PG  SRRFY KKVSPKVPTGSYNIAQV+YELNVL
Sbjct  163  LRSNFLGTKFIIYDTQPPYNNAQLSPPG-RSRRFYSKKVSPKVPTGSYNIAQVSYELNVL  221

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC+MYS
Sbjct  222  GTRGPRRMHCSMYS  235


 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  119  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  170



>ref|XP_006597337.1| PREDICTED: tubby-like F-box protein 8-like isoform X1 [Glycine 
max]
 ref|XP_006597338.1| PREDICTED: tubby-like F-box protein 8-like isoform X2 [Glycine 
max]
 gb|KHN33484.1| Tubby-like F-box protein 8 [Glycine soja]
Length=427

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 67/76 (88%), Gaps = 2/76 (3%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGC--TSRRFYPKKVSPKVPTGSYNIAQVTYELN  51
             RSNFLGTKFIIYDTQPPY+S HI  PG   TSRRFY KKVSPKVP+GSYNIAQVTYELN
Sbjct  189  LRSNFLGTKFIIYDTQPPYSSAHICPPGTGKTSRRFYSKKVSPKVPSGSYNIAQVTYELN  248

Query  50   VLGTRGPRKMHCAMYS  3
            VLGTRGPRKMHC M+S
Sbjct  249  VLGTRGPRKMHCVMHS  264


 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT+TEY+ISM+ADNISRSSNTYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTYTEYVISMDADNISRSSNTYIGKLRSNFLGT  196



>gb|KJB32749.1| hypothetical protein B456_005G259600 [Gossypium raimondii]
 gb|KJB32750.1| hypothetical protein B456_005G259600 [Gossypium raimondii]
Length=425

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQP Y S H+  PG TSRRFY KKVSPKVPTGSYNIAQ+TYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPAYTSAHVPPPGRTSRRFYSKKVSPKVPTGSYNIAQITYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  249  GTRGPRRMHCMMHS  262


 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEYIISMNADNISRSS++YIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTSTEYIISMNADNISRSSSSYIGKLRSNFLGT  196



>ref|XP_006432270.1| hypothetical protein CICLE_v10001261mg [Citrus clementina]
 gb|ESR45510.1| hypothetical protein CICLE_v10001261mg [Citrus clementina]
Length=332

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPP+ S +I+  GCTSRRFY KKVSPKVP+GSYNIAQ+ YELNVL
Sbjct  96   LRSNFLGTKFIIYDTQPPHTSANITPSGCTSRRFYSKKVSPKVPSGSYNIAQIAYELNVL  155

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  156  GTRGPRRMHCIMHS  169


 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  52   PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  103



>gb|KJB59393.1| hypothetical protein B456_009G254100 [Gossypium raimondii]
 gb|KJB59394.1| hypothetical protein B456_009G254100 [Gossypium raimondii]
 gb|KJB59397.1| hypothetical protein B456_009G254100 [Gossypium raimondii]
Length=424

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 67/74 (91%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  +S PG  SRRFY KKVSPKVPTGSYNIAQV+YELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNNAQLSPPG-RSRRFYSKKVSPKVPTGSYNIAQVSYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC+MYS
Sbjct  248  GTRGPRRMHCSMYS  261


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  196



>ref|XP_010680670.1| PREDICTED: tubby-like F-box protein 8 [Beta vulgaris subsp. vulgaris]
Length=426

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPP+NS+  S PG +SRRFY KKVSPKVPTGSYNIAQVTYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPHNSSQSSPPGRSSRRFYSKKVSPKVPTGSYNIAQVTYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M S
Sbjct  249  GTRGPRRMHCVMQS  262


 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  196



>gb|AED87506.1| F-box protein [Gossypium hirsutum]
Length=424

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 67/74 (91%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  +S PG  SRRFY KKVSPKVPTGSYNIAQV+YELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNNAQLSPPG-RSRRFYSKKVSPKVPTGSYNIAQVSYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC+MYS
Sbjct  248  GTRGPRRMHCSMYS  261


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  196



>gb|KHG03411.1| Tubby-like F-box protein 8 [Gossypium arboreum]
Length=424

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 67/74 (91%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  +S PG  SRRFY KKVSPKVPTGSYNIAQV+YELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNNAQLSPPG-RSRRFYSKKVSPKVPTGSYNIAQVSYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC+MYS
Sbjct  248  GTRGPRRMHCSMYS  261


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  196



>ref|XP_011087815.1| PREDICTED: tubby-like F-box protein 8 [Sesamum indicum]
 ref|XP_011087816.1| PREDICTED: tubby-like F-box protein 8 [Sesamum indicum]
 ref|XP_011087817.1| PREDICTED: tubby-like F-box protein 8 [Sesamum indicum]
 ref|XP_011087818.1| PREDICTED: tubby-like F-box protein 8 [Sesamum indicum]
Length=425

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPP+  +HI  PG TSRRFY KKVSPKVPTGSYNIAQ+TYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPHTCSHIPPPGRTSRRFYSKKVSPKVPTGSYNIAQITYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  249  GTRGPRRMHCIMHS  262


 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  196



>ref|XP_008218837.1| PREDICTED: tubby-like F-box protein 8 [Prunus mume]
Length=252

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFI+YDTQP Y S HI  PG TSRRF  KKVSPKVPTGSYNIAQ+TYELNVL
Sbjct  17   LRSNFLGTKFIVYDTQPAYTSEHIPPPGRTSRRFNSKKVSPKVPTGSYNIAQITYELNVL  76

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  77   GTRGPRRMHCIMHS  90



>ref|XP_006432267.1| hypothetical protein CICLE_v10001261mg [Citrus clementina]
 ref|XP_006432268.1| hypothetical protein CICLE_v10001261mg [Citrus clementina]
 ref|XP_006432269.1| hypothetical protein CICLE_v10001261mg [Citrus clementina]
 ref|XP_006491842.1| PREDICTED: tubby-like F-box protein 8-like isoform X1 [Citrus 
sinensis]
 ref|XP_006491843.1| PREDICTED: tubby-like F-box protein 8-like isoform X2 [Citrus 
sinensis]
 ref|XP_006491844.1| PREDICTED: tubby-like F-box protein 8-like isoform X3 [Citrus 
sinensis]
 gb|ESR45507.1| hypothetical protein CICLE_v10001261mg [Citrus clementina]
 gb|ESR45508.1| hypothetical protein CICLE_v10001261mg [Citrus clementina]
 gb|ESR45509.1| hypothetical protein CICLE_v10001261mg [Citrus clementina]
Length=425

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPP+ S +I+  GCTSRRFY KKVSPKVP+GSYNIAQ+ YELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPHTSANITPSGCTSRRFYSKKVSPKVPSGSYNIAQIAYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  249  GTRGPRRMHCIMHS  262


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  196



>ref|XP_010062111.1| PREDICTED: tubby-like F-box protein 8 [Eucalyptus grandis]
 ref|XP_010062112.1| PREDICTED: tubby-like F-box protein 8 [Eucalyptus grandis]
 gb|KCW69179.1| hypothetical protein EUGRSUZ_F02703 [Eucalyptus grandis]
 gb|KCW69180.1| hypothetical protein EUGRSUZ_F02703 [Eucalyptus grandis]
Length=424

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  +S PG  SRRFY KKVSPKVPTGSYNIAQV YELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNNAQLSPPG-RSRRFYSKKVSPKVPTGSYNIAQVAYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHCAM+S
Sbjct  248  GTRGPRRMHCAMHS  261


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -3

Query  543  ALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  146  ALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  196



>gb|KDO50624.1| hypothetical protein CISIN_1g014405mg [Citrus sinensis]
 gb|KDO50625.1| hypothetical protein CISIN_1g014405mg [Citrus sinensis]
 gb|KDO50626.1| hypothetical protein CISIN_1g014405mg [Citrus sinensis]
Length=425

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPP+ S +I+  GCTSRRFY KKVSPKVP+GSYNIAQ+ YELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPHTSANITPSGCTSRRFYSKKVSPKVPSGSYNIAQIAYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  249  GTRGPRRMHCIMHS  262


 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  196



>ref|XP_004140892.1| PREDICTED: tubby-like F-box protein 14-like [Cucumis sativus]
 ref|XP_004159470.1| PREDICTED: tubby-like F-box protein 14-like [Cucumis sativus]
 gb|KGN46018.1| hypothetical protein Csa_6G043990 [Cucumis sativus]
Length=430

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  IS PG  SRRFY KKVSPKVPTGSY+IAQVTYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNNAQISPPG-RSRRFYSKKVSPKVPTGSYDIAQVTYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPRKMHC M+S
Sbjct  248  GTRGPRKMHCTMHS  261


 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLV+NGKFLLSAKR RRTT TEY+ISM+ADNISRSSNTYIGKLRS  LGT
Sbjct  145  PALLVDNGKFLLSAKRTRRTTCTEYVISMDADNISRSSNTYIGKLRSNFLGT  196



>ref|XP_011092391.1| PREDICTED: tubby-like F-box protein 8 [Sesamum indicum]
Length=434

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFI+YDTQPP+  +HI  PG TSRRFY KKVSPKVPTGSYNIAQ+TYELNVL
Sbjct  189  LRSNFLGTKFIVYDTQPPHTCSHIPPPGRTSRRFYSKKVSPKVPTGSYNIAQITYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M S
Sbjct  249  GTRGPRRMHCVMRS  262


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  196



>ref|XP_009414588.1| PREDICTED: tubby-like F-box protein 8 [Musa acuminata subsp. 
malaccensis]
Length=433

 Score =   130 bits (327),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN   I  PG TSRRFY KKVSPKVP+GSY+IAQVTYELNVL
Sbjct  192  LRSNFLGTKFIIYDTQPPYNGAAICPPGRTSRRFYSKKVSPKVPSGSYSIAQVTYELNVL  251

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  252  GTRGPRRMHCVMHS  265


 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             A+LVENGKFLLSAKR RRT  TEY+ISM+A+NISRS+NTYIGKLRS  LGT
Sbjct  148  PAVLVENGKFLLSAKRIRRTACTEYVISMDANNISRSTNTYIGKLRSNFLGT  199



>emb|CDO97502.1| unnamed protein product [Coffea canephora]
Length=425

 Score =   130 bits (327),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPY  T++  PG TSRRFY KKVSPKVPTGSYNIAQ+TYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYTCTNVPPPGRTSRRFYSKKVSPKVPTGSYNIAQITYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M S
Sbjct  249  GTRGPRRMHCVMQS  262


 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  196



>gb|KDP30771.1| hypothetical protein JCGZ_15200 [Jatropha curcas]
Length=424

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  +S PG  SRRFY KKVSPKVPTGSYNIAQVTYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNNAQLSPPG-RSRRFYSKKVSPKVPTGSYNIAQVTYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  248  GTRGPRRMHCTMHS  261


 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+A+NISRSS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDAENISRSSSTYIGKLRSNFLGT  196



>ref|XP_006434458.1| hypothetical protein CICLE_v10001251mg [Citrus clementina]
 ref|XP_006434459.1| hypothetical protein CICLE_v10001251mg [Citrus clementina]
 gb|ESR47698.1| hypothetical protein CICLE_v10001251mg [Citrus clementina]
 gb|ESR47699.1| hypothetical protein CICLE_v10001251mg [Citrus clementina]
Length=426

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYNS  +S PG  SRRFY KKVSPKVPTGSYNIAQV+YELNVL
Sbjct  190  LRSNFLGTKFIIYDTQPPYNSAQLSPPG-RSRRFYSKKVSPKVPTGSYNIAQVSYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  249  GTRGPRRMHCTMHS  262


 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  146  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  197



>ref|XP_004485526.1| PREDICTED: tubby-like F-box protein 8-like [Cicer arietinum]
Length=428

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 67/76 (88%), Gaps = 2/76 (3%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGC--TSRRFYPKKVSPKVPTGSYNIAQVTYELN  51
             RSNFLGT+FIIYDTQPPY+S HI  PG   TSRRFY KKVSPKVP+GSYNIAQVTYELN
Sbjct  189  LRSNFLGTRFIIYDTQPPYSSAHICPPGTGKTSRRFYSKKVSPKVPSGSYNIAQVTYELN  248

Query  50   VLGTRGPRKMHCAMYS  3
            VLGTRGPRKMHC M+S
Sbjct  249  VLGTRGPRKMHCIMHS  264


 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (87%), Gaps = 4/60 (7%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGTYIPPRYIL  367
             ALLVENGKFLLSAKR RRTT+TEY+ISM+ADNISRSSNTYIGKLRS  LGT    R+I+
Sbjct  145  PALLVENGKFLLSAKRTRRTTYTEYVISMDADNISRSSNTYIGKLRSNFLGT----RFII  200



>gb|ABK94204.1| unknown [Populus trichocarpa]
Length=423

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  +S PG  SRRFY KKVSPKVPTGSYNIAQVTYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNNAQLSPPG-RSRRFYSKKVSPKVPTGSYNIAQVTYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  248  GTRGPRRMHCTMHS  261


 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  196



>ref|XP_002306697.1| hypothetical protein POPTR_0005s21450g [Populus trichocarpa]
 gb|EEE93693.1| hypothetical protein POPTR_0005s21450g [Populus trichocarpa]
Length=423

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  +S PG  SRRFY KKVSPKVPTGSYNIAQVTYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNNAQLSPPG-RSRRFYSKKVSPKVPTGSYNIAQVTYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  248  GTRGPRRMHCTMHS  261


 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  196



>ref|XP_006473057.1| PREDICTED: tubby-like F-box protein 8-like isoform X1 [Citrus 
sinensis]
 ref|XP_006473058.1| PREDICTED: tubby-like F-box protein 8-like isoform X2 [Citrus 
sinensis]
 gb|KDO83731.1| hypothetical protein CISIN_1g014365mg [Citrus sinensis]
 gb|KDO83732.1| hypothetical protein CISIN_1g014365mg [Citrus sinensis]
 gb|KDO83733.1| hypothetical protein CISIN_1g014365mg [Citrus sinensis]
 gb|KDO83734.1| hypothetical protein CISIN_1g014365mg [Citrus sinensis]
Length=426

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYNS  +S PG  SRRFY KKVSPKVPTGSYNIAQV+YELNVL
Sbjct  190  LRSNFLGTKFIIYDTQPPYNSAQLSPPG-RSRRFYSKKVSPKVPTGSYNIAQVSYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  249  GTRGPRRMHCTMHS  262


 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  146  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  197



>gb|KDO83735.1| hypothetical protein CISIN_1g014365mg [Citrus sinensis]
Length=396

 Score =   129 bits (325),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYNS  +S PG  SRRFY KKVSPKVPTGSYNIAQV+YELNVL
Sbjct  160  LRSNFLGTKFIIYDTQPPYNSAQLSPPG-RSRRFYSKKVSPKVPTGSYNIAQVSYELNVL  218

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  219  GTRGPRRMHCTMHS  232



>ref|XP_002524285.1| phosphoric diester hydrolase, putative [Ricinus communis]
 gb|EEF38025.1| phosphoric diester hydrolase, putative [Ricinus communis]
Length=424

 Score =   130 bits (326),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  +S PG  SRRFY KKVSPKVPTGSYNIAQVTYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNNAQLSPPG-RSRRFYSKKVSPKVPTGSYNIAQVTYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  248  GTRGPRRMHCTMHS  261


 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSSNTYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSNTYIGKLRSNFLGT  196



>ref|XP_011044216.1| PREDICTED: tubby-like F-box protein 8 isoform X2 [Populus euphratica]
Length=423

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  ++ PG  SRRFY KKVSPKVPTGSYNIAQVTYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNNAQLAPPG-RSRRFYSKKVSPKVPTGSYNIAQVTYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  248  GTRGPRRMHCTMHS  261


 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  196



>ref|XP_010930978.1| PREDICTED: tubby-like F-box protein 14 [Elaeis guineensis]
Length=432

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF+IYDTQP YN   IS PG TSRRFY KKVSPK P+GSYNIAQVTYELNVL
Sbjct  189  LRSNFLGTKFVIYDTQPAYNRAAISQPGKTSRRFYSKKVSPKFPSGSYNIAQVTYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  249  GTRGPRRMHCIMHS  262


 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             A+LVENGKFLLSAKR RRTT TEYIIS +A+NISRSSNTYIGKLRS  LGT
Sbjct  145  PAVLVENGKFLLSAKRTRRTTCTEYIISTDAENISRSSNTYIGKLRSNFLGT  196



>ref|XP_002302178.1| F-box family protein [Populus trichocarpa]
 gb|EEE81451.1| F-box family protein [Populus trichocarpa]
Length=424

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  ++ PG  SRRFY KKVSPKVPTGSYNIAQVTYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNNAQLAPPG-RSRRFYSKKVSPKVPTGSYNIAQVTYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  248  GTRGPRRMHCTMHS  261


 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRT  TEY+ISM+ADN+SRSS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRKRRTACTEYVISMDADNVSRSSSTYIGKLRSNFLGT  196



>ref|NP_001280941.1| tubby-like F-box protein 8 [Malus domestica]
 gb|ADL36842.1| TLP domain class transcription factor [Malus domestica]
Length=426

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYNS  +S PG  SRRFY KKVSPK+PTGSYNIAQV+YELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNSAQLSPPG-RSRRFYSKKVSPKLPTGSYNIAQVSYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  248  GTRGPRRMHCTMHS  261


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSSN YIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSNKYIGKLRSNFLGT  196



>ref|XP_009416896.1| PREDICTED: tubby-like F-box protein 8 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009416897.1| PREDICTED: tubby-like F-box protein 8 [Musa acuminata subsp. 
malaccensis]
Length=432

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF++YDTQPPYN T  S PG  S+RFY +KVSPKVPTGSYN+AQVTYELNVL
Sbjct  189  LRSNFLGTKFVMYDTQPPYNGTASSQPGKISQRFYSRKVSPKVPTGSYNVAQVTYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  249  GTRGPRRMHCVMHS  262


 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             A+LVENGKFLLSAKR RR T TEYIIS NA  I+RSSNTYIGKLRS  LGT
Sbjct  145  PAVLVENGKFLLSAKRIRRATCTEYIISTNACKITRSSNTYIGKLRSNFLGT  196



>ref|XP_011044215.1| PREDICTED: tubby-like F-box protein 8 isoform X1 [Populus euphratica]
Length=431

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  ++ PG  SRRFY KKVSPKVPTGSYNIAQVTYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNNAQLAPPG-RSRRFYSKKVSPKVPTGSYNIAQVTYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  248  GTRGPRRMHCTMHS  261


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  196



>ref|XP_007148458.1| hypothetical protein PHAVU_006G210500g [Phaseolus vulgaris]
 ref|XP_007148459.1| hypothetical protein PHAVU_006G210500g [Phaseolus vulgaris]
 gb|ESW20452.1| hypothetical protein PHAVU_006G210500g [Phaseolus vulgaris]
 gb|ESW20453.1| hypothetical protein PHAVU_006G210500g [Phaseolus vulgaris]
Length=427

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 66/76 (87%), Gaps = 2/76 (3%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGC--TSRRFYPKKVSPKVPTGSYNIAQVTYELN  51
             RSNFLGTKFII DTQPPY+S HI  PG   TSRRFY KKVSPKVP+GSYNIAQVTYELN
Sbjct  189  LRSNFLGTKFIINDTQPPYSSAHICPPGTGKTSRRFYSKKVSPKVPSGSYNIAQVTYELN  248

Query  50   VLGTRGPRKMHCAMYS  3
            VLGTRGPRKMHC M+S
Sbjct  249  VLGTRGPRKMHCVMHS  264


 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT+TEY+ISM+ADNISRSSNTYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTYTEYVISMDADNISRSSNTYIGKLRSNFLGT  196



>ref|XP_010108639.1| Tubby-like F-box protein 8 [Morus notabilis]
 gb|EXC19895.1| Tubby-like F-box protein 8 [Morus notabilis]
Length=464

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN   +S PG  SRRFY KKVSPKVPTGSYNIAQVTYELNVL
Sbjct  229  LRSNFLGTKFIIYDTQPPYNIAQLSPPG-RSRRFYSKKVSPKVPTGSYNIAQVTYELNVL  287

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  288  GTRGPRRMHCVMHS  301


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  185  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  236



>ref|XP_008445764.1| PREDICTED: tubby-like F-box protein 8 [Cucumis melo]
Length=430

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  IS PG  SRR Y KKVSPKVPTGSY+IAQVTYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNNAQISPPG-RSRRLYSKKVSPKVPTGSYDIAQVTYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPRKMHC M+S
Sbjct  248  GTRGPRKMHCTMHS  261


 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLV+NGKFLLSAKR RRTT TEY+ISM+ADNISRSSNTYIGKLRS  LGT
Sbjct  145  PALLVDNGKFLLSAKRTRRTTCTEYVISMDADNISRSSNTYIGKLRSNFLGT  196



>ref|XP_007201025.1| hypothetical protein PRUPE_ppa006121mg [Prunus persica]
 gb|EMJ02224.1| hypothetical protein PRUPE_ppa006121mg [Prunus persica]
Length=426

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYNS  +  PG  SRRFY KKVSPKVPTGSYNIAQVTYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNSAQLYPPG-QSRRFYSKKVSPKVPTGSYNIAQVTYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  248  GTRGPRRMHCNMHS  261


 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSSNTYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSNTYIGKLRSNFLGT  196



>ref|XP_008781418.1| PREDICTED: tubby-like F-box protein 8 [Phoenix dactylifera]
Length=432

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN   IS PG TSRRFY KKVSPK P+GSYNIA+VTYELN+L
Sbjct  189  LRSNFLGTKFIIYDTQPPYNRAAISQPGKTSRRFYSKKVSPKFPSGSYNIAEVTYELNLL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC ++S
Sbjct  249  GTRGPRRMHCIIHS  262


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             A+LVENGKFLLSAKR RRTT  EYIIS +ADNISRSSNTYIGKLRS  LGT
Sbjct  145  PAVLVENGKFLLSAKRTRRTTCREYIISTDADNISRSSNTYIGKLRSNFLGT  196



>ref|XP_004496469.1| PREDICTED: tubby-like F-box protein 8-like isoform X1 [Cicer 
arietinum]
 ref|XP_004496470.1| PREDICTED: tubby-like F-box protein 8-like isoform X2 [Cicer 
arietinum]
 ref|XP_004496471.1| PREDICTED: tubby-like F-box protein 8-like isoform X3 [Cicer 
arietinum]
Length=432

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 67/74 (91%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  ++ PG  SRRFY KKVSPKVP+GSYNIAQVTYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNNAQLAPPG-RSRRFYSKKVSPKVPSGSYNIAQVTYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+CAMYS
Sbjct  248  GTRGPRRMNCAMYS  261


 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEYIISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYIISMDADNISRSSSTYIGKLRSNFLGT  196



>ref|XP_011044224.1| PREDICTED: tubby-like F-box protein 8 isoform X2 [Populus euphratica]
Length=352

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  +S PG  SRRFY KKVSPKVPTGSYNIA VTYELNVL
Sbjct  117  LRSNFLGTKFIIYDTQPPYNNAQLSPPG-RSRRFYSKKVSPKVPTGSYNIAHVTYELNVL  175

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  176  GTRGPRRMHCTMHS  189


 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR+RRTT TEY+ISM+ADNIS+SS+TYIGKLRS  LGT
Sbjct  73   PALLVENGKFLLSAKRSRRTTCTEYVISMDADNISKSSSTYIGKLRSNFLGT  124



>ref|XP_010911994.1| PREDICTED: tubby-like F-box protein 8 isoform X2 [Elaeis guineensis]
Length=340

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDP-GCTSRRFYPKKVSPKVPTGSYNIAQVTYELNV  48
             RSNFLGTKFIIYDTQPPYN   +  P G TSRRFY KKVSPKVP+GSYNIAQVTYELNV
Sbjct  96   LRSNFLGTKFIIYDTQPPYNGAALCPPPGRTSRRFYSKKVSPKVPSGSYNIAQVTYELNV  155

Query  47   LGTRGPRKMHCAMYS  3
            LGTRGPR+MHC MYS
Sbjct  156  LGTRGPRRMHCIMYS  170


 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             A++VENGKFLLSAKRNRRTT TEYIISM+A+NISRSSNTYIGKLRS  LGT
Sbjct  52   PAVVVENGKFLLSAKRNRRTTCTEYIISMDAENISRSSNTYIGKLRSNFLGT  103



>ref|XP_007041585.1| Tubby like protein 10 isoform 1 [Theobroma cacao]
 ref|XP_007041586.1| Tubby like protein 10 isoform 1 [Theobroma cacao]
 gb|EOX97416.1| Tubby like protein 10 isoform 1 [Theobroma cacao]
 gb|EOX97417.1| Tubby like protein 10 isoform 1 [Theobroma cacao]
Length=425

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQP   S H+  PG TSRRFY KKVSPKVPTGSYNIAQ+TYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPACTSAHVPPPGRTSRRFYSKKVSPKVPTGSYNIAQITYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  249  GTRGPRRMHCIMHS  262


 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEYIISMNADNISRSS++YIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTSTEYIISMNADNISRSSSSYIGKLRSNFLGT  196



>ref|XP_010063867.1| PREDICTED: tubby-like F-box protein 8 [Eucalyptus grandis]
 ref|XP_010063868.1| PREDICTED: tubby-like F-box protein 8 [Eucalyptus grandis]
 ref|XP_010063869.1| PREDICTED: tubby-like F-box protein 8 [Eucalyptus grandis]
 gb|KCW71140.1| hypothetical protein EUGRSUZ_F04238 [Eucalyptus grandis]
Length=435

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  +S PG  SRRF+ KKVSPKVPTGSYNIAQVTYELNVL
Sbjct  188  LRSNFLGTKFIIYDTQPPYNNAQLSPPG-RSRRFHSKKVSPKVPTGSYNIAQVTYELNVL  246

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  247  GTRGPRRMHCIMHS  260


 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADN+SRSSNTYIGKLRS  LGT
Sbjct  144  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNVSRSSNTYIGKLRSNFLGT  195



>ref|XP_008218843.1| PREDICTED: tubby-like F-box protein 8 [Prunus mume]
 ref|XP_008218844.1| PREDICTED: tubby-like F-box protein 8 [Prunus mume]
Length=424

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFI+YDTQP Y S HI  PG TSRRF  KKVSPKVPTGSYNIAQ+TYELNVL
Sbjct  189  LRSNFLGTKFIVYDTQPAYTSEHIPPPGRTSRRFNSKKVSPKVPTGSYNIAQITYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  249  GTRGPRRMHCIMHS  262


 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSS+ YIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSAYIGKLRSNFLGT  196



>ref|XP_002266692.1| PREDICTED: tubby-like F-box protein 8 [Vitis vinifera]
 ref|XP_010657561.1| PREDICTED: tubby-like F-box protein 8 [Vitis vinifera]
Length=424

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPP+   HI  PG TS+RFY KKVSPKVPTGSYNIA +TYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPHTCAHIPPPGRTSKRFYSKKVSPKVPTGSYNIAHITYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  249  GTRGPRRMHCTMHS  262


 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKRNRRTT TEY+ISM+A+NISRSS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRNRRTTCTEYVISMDAENISRSSSTYIGKLRSNFLGT  196



>ref|XP_007222448.1| hypothetical protein PRUPE_ppa006177mg [Prunus persica]
 gb|EMJ23647.1| hypothetical protein PRUPE_ppa006177mg [Prunus persica]
Length=424

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFI+YDTQP Y S HI  PG TSRRF  KKVSPKVPTGSYNIAQ+TYELNVL
Sbjct  189  LRSNFLGTKFIVYDTQPAYTSEHIPPPGRTSRRFNSKKVSPKVPTGSYNIAQITYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  249  GTRGPRRMHCIMHS  262


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSSN YIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSNAYIGKLRSNFLGT  196



>ref|XP_006339926.1| PREDICTED: tubby-like F-box protein 8-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006339927.1| PREDICTED: tubby-like F-box protein 8-like isoform X2 [Solanum 
tuberosum]
Length=426

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF+IYDTQPPY S +I  PG +SRRFY KKVSPKVPTGSY+IAQ+ YELNVL
Sbjct  189  LRSNFLGTKFVIYDTQPPYTSANIPPPGRSSRRFYSKKVSPKVPTGSYSIAQIKYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPRKMHC M+S
Sbjct  249  GTRGPRKMHCVMHS  262


 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+A+NISRSSNT IGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDAENISRSSNTCIGKLRSNFLGT  196



>ref|XP_004290516.1| PREDICTED: tubby-like F-box protein 8 [Fragaria vesca subsp. 
vesca]
 ref|XP_011458506.1| PREDICTED: tubby-like F-box protein 8 [Fragaria vesca subsp. 
vesca]
Length=429

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  +S PG  SRRF  KKVSPKVPTGSYNIAQVTYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNNAQLSPPG-RSRRFNSKKVSPKVPTGSYNIAQVTYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC+M+S
Sbjct  248  GTRGPRRMHCSMHS  261


 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSSN YIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSNKYIGKLRSNFLGT  196



>ref|XP_011044217.1| PREDICTED: tubby-like F-box protein 8 isoform X1 [Populus euphratica]
 ref|XP_011044218.1| PREDICTED: tubby-like F-box protein 8 isoform X1 [Populus euphratica]
 ref|XP_011044219.1| PREDICTED: tubby-like F-box protein 8 isoform X1 [Populus euphratica]
 ref|XP_011044221.1| PREDICTED: tubby-like F-box protein 8 isoform X1 [Populus euphratica]
 ref|XP_011044222.1| PREDICTED: tubby-like F-box protein 8 isoform X1 [Populus euphratica]
 ref|XP_011044223.1| PREDICTED: tubby-like F-box protein 8 isoform X1 [Populus euphratica]
Length=424

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  +S PG  SRRFY KKVSPKVPTGSYNIA VTYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNNAQLSPPG-RSRRFYSKKVSPKVPTGSYNIAHVTYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  248  GTRGPRRMHCTMHS  261


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR+RRTT TEY+ISM+ADNIS+SS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRSRRTTCTEYVISMDADNISKSSSTYIGKLRSNFLGT  196



>ref|XP_010539730.1| PREDICTED: tubby-like F-box protein 1 [Tarenaya hassleriana]
Length=433

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN + +  PG  SRRFY KKVSPKVP+GSYNIAQV+YELNVL
Sbjct  192  IRSNFLGTKFIIYDTQPPYNHSQVQPPG-RSRRFYSKKVSPKVPSGSYNIAQVSYELNVL  250

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHCAM+S
Sbjct  251  GTRGPRRMHCAMHS  264


 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT+TEY+ISM+AD+ISRSSNTYIGK+RS  LGT
Sbjct  148  PALLVENGKFLLSAKRMRRTTYTEYVISMHADSISRSSNTYIGKIRSNFLGT  199



>ref|XP_010911991.1| PREDICTED: tubby-like F-box protein 8 isoform X1 [Elaeis guineensis]
 ref|XP_010911992.1| PREDICTED: tubby-like F-box protein 8 isoform X1 [Elaeis guineensis]
 ref|XP_010911993.1| PREDICTED: tubby-like F-box protein 8 isoform X1 [Elaeis guineensis]
Length=436

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDP-GCTSRRFYPKKVSPKVPTGSYNIAQVTYELNV  48
             RSNFLGTKFIIYDTQPPYN   +  P G TSRRFY KKVSPKVP+GSYNIAQVTYELNV
Sbjct  192  LRSNFLGTKFIIYDTQPPYNGAALCPPPGRTSRRFYSKKVSPKVPSGSYNIAQVTYELNV  251

Query  47   LGTRGPRKMHCAMYS  3
            LGTRGPR+MHC MYS
Sbjct  252  LGTRGPRRMHCIMYS  266


 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             A++VENGKFLLSAKRNRRTT TEYIISM+A+NISRSSNTYIGKLRS  LGT
Sbjct  148  PAVVVENGKFLLSAKRNRRTTCTEYIISMDAENISRSSNTYIGKLRSNFLGT  199



>emb|CAN68201.1| hypothetical protein VITISV_003183 [Vitis vinifera]
Length=579

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPP+   HI  PG TS+RFY KKVSPKVPTGSYNIA +TYELNVL
Sbjct  256  LRSNFLGTKFIIYDTQPPHTCAHIPPPGRTSKRFYSKKVSPKVPTGSYNIAHITYELNVL  315

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  316  GTRGPRRMHCTMHS  329


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKRNRRTT TEY+ISM+A+NISRSS+TYIGKLRS  LGT
Sbjct  212  PALLVENGKFLLSAKRNRRTTCTEYVISMDAENISRSSSTYIGKLRSNFLGT  263



>ref|XP_008785830.1| PREDICTED: tubby-like F-box protein 8 [Phoenix dactylifera]
 ref|XP_008785832.1| PREDICTED: tubby-like F-box protein 8 [Phoenix dactylifera]
 ref|XP_008785833.1| PREDICTED: tubby-like F-box protein 8 [Phoenix dactylifera]
 ref|XP_008785834.1| PREDICTED: tubby-like F-box protein 8 [Phoenix dactylifera]
 ref|XP_008785835.1| PREDICTED: tubby-like F-box protein 8 [Phoenix dactylifera]
Length=436

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDP-GCTSRRFYPKKVSPKVPTGSYNIAQVTYELNV  48
             RSNFLGTKFIIYDTQPPYN   +  P G TSRRFY KKVSPKVP+GSYNIAQVTYELNV
Sbjct  192  LRSNFLGTKFIIYDTQPPYNGAALCPPPGRTSRRFYSKKVSPKVPSGSYNIAQVTYELNV  251

Query  47   LGTRGPRKMHCAMYS  3
            LGTRGPR+MHC MYS
Sbjct  252  LGTRGPRRMHCIMYS  266


 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             A+LVENGKFLLSAKRNRRTT TEYIISM+ADNISRSSNTYIGKLRS  LGT
Sbjct  148  PAVLVENGKFLLSAKRNRRTTCTEYIISMDADNISRSSNTYIGKLRSNFLGT  199



>gb|KHG16429.1| Tubby-like F-box protein 8 [Gossypium arboreum]
Length=421

 Score =   127 bits (318),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 66/75 (88%), Gaps = 1/75 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYN-STHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNV  48
             RSNFLGTKFIIYDTQP Y  S+H+  PG TSRRFY KKVSPKVPTGSYNIAQ++YELNV
Sbjct  189  LRSNFLGTKFIIYDTQPAYTASSHVPPPGRTSRRFYSKKVSPKVPTGSYNIAQISYELNV  248

Query  47   LGTRGPRKMHCAMYS  3
            LGTRGPRKMHC M+S
Sbjct  249  LGTRGPRKMHCIMHS  263


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSA+R RRTT TEYIISMNADNISRSS++YIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAQRTRRTTSTEYIISMNADNISRSSSSYIGKLRSNFLGT  196



>ref|XP_009615512.1| PREDICTED: tubby-like F-box protein 8 [Nicotiana tomentosiformis]
Length=427

 Score =   127 bits (318),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPY   H+  PG TSRRF  KKVSPKVPTGSY+I+QVTYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYTCAHVPAPGRTSRRFNSKKVSPKVPTGSYSISQVTYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  249  GTRGPRRMHCVMHS  262


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+A+NISRSSNTYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDAENISRSSNTYIGKLRSNFLGT  196



>ref|XP_009351377.1| PREDICTED: tubby-like F-box protein 8 [Pyrus x bretschneideri]
Length=426

 Score =   127 bits (318),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYNS  +  PG  SRRFY KKVSPK+PTGSYNIAQV+YELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNSAQLPPPG-RSRRFYSKKVSPKLPTGSYNIAQVSYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  248  GTRGPRRMHCTMHS  261


 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSSN YIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSNKYIGKLRSNFLGT  196



>ref|XP_003531569.1| PREDICTED: tubby-like F-box protein 8-like isoform X1 [Glycine 
max]
 ref|XP_006585459.1| PREDICTED: tubby-like F-box protein 8-like isoform X2 [Glycine 
max]
 ref|XP_006585460.1| PREDICTED: tubby-like F-box protein 8-like isoform X3 [Glycine 
max]
 ref|XP_006585461.1| PREDICTED: tubby-like F-box protein 8-like isoform X4 [Glycine 
max]
 ref|XP_006585462.1| PREDICTED: tubby-like F-box protein 8-like isoform X5 [Glycine 
max]
 ref|XP_006585463.1| PREDICTED: tubby-like F-box protein 8-like isoform X6 [Glycine 
max]
 gb|KHN26708.1| Tubby-like F-box protein 8 [Glycine soja]
Length=427

 Score =   127 bits (318),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 66/76 (87%), Gaps = 2/76 (3%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDP--GCTSRRFYPKKVSPKVPTGSYNIAQVTYELN  51
             RSNFLGT+FII DTQPPY+S HI  P  G TSRRFY KKVSPKVP+GSYNIAQVTYELN
Sbjct  189  LRSNFLGTRFIICDTQPPYSSAHICPPMTGKTSRRFYSKKVSPKVPSGSYNIAQVTYELN  248

Query  50   VLGTRGPRKMHCAMYS  3
            VLGTRGPRKMHC M+S
Sbjct  249  VLGTRGPRKMHCVMHS  264


 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (87%), Gaps = 4/60 (7%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGTYIPPRYIL  367
             ALLVENGKFLLSAKR RRTT+TEY+ISM+ADNISRSSNTYIGKLRS  LGT    R+I+
Sbjct  145  PALLVENGKFLLSAKRTRRTTYTEYVISMDADNISRSSNTYIGKLRSNFLGT----RFII  200



>gb|KJB15992.1| hypothetical protein B456_002G207100 [Gossypium raimondii]
 gb|KJB15993.1| hypothetical protein B456_002G207100 [Gossypium raimondii]
 gb|KJB15994.1| hypothetical protein B456_002G207100 [Gossypium raimondii]
Length=421

 Score =   127 bits (318),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 66/75 (88%), Gaps = 1/75 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYN-STHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNV  48
             RSNFLGTKFIIYDTQP Y  S+H+  PG TSRRFY KKVSPKVPTGSYNIAQ++YELNV
Sbjct  189  LRSNFLGTKFIIYDTQPTYTASSHVPPPGRTSRRFYSKKVSPKVPTGSYNIAQISYELNV  248

Query  47   LGTRGPRKMHCAMYS  3
            LGTRGPRKMHC M+S
Sbjct  249  LGTRGPRKMHCIMHS  263


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSA+R RRTT TEYIISMNADNISRSS++YIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAQRTRRTTSTEYIISMNADNISRSSSSYIGKLRSNFLGT  196



>ref|XP_002306698.1| hypothetical protein POPTR_0005s21460g [Populus trichocarpa]
 ref|XP_006383624.1| hypothetical protein POPTR_0005s21460g [Populus trichocarpa]
 ref|XP_006383625.1| hypothetical protein POPTR_0005s21460g [Populus trichocarpa]
 ref|XP_006383626.1| hypothetical protein POPTR_0005s21460g [Populus trichocarpa]
 gb|EEE93694.1| hypothetical protein POPTR_0005s21460g [Populus trichocarpa]
 gb|ERP61421.1| hypothetical protein POPTR_0005s21460g [Populus trichocarpa]
 gb|ERP61422.1| hypothetical protein POPTR_0005s21460g [Populus trichocarpa]
 gb|ERP61423.1| hypothetical protein POPTR_0005s21460g [Populus trichocarpa]
Length=424

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  ++ PG  SRRFY KKVSPKVPTGSYNIA VTYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNNAQLAPPG-RSRRFYSKKVSPKVPTGSYNIAHVTYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  248  GTRGPRRMHCTMHS  261


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR+RRTT TEY+ISM+ADNIS+SS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRSRRTTCTEYVISMDADNISKSSSTYIGKLRSNFLGT  196



>ref|XP_008381822.1| PREDICTED: tubby-like F-box protein 8 [Malus domestica]
Length=426

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYNS  +  PG  SRRFY KKVSPK+PTGSYNIAQV+YELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNSAQLPPPG-RSRRFYSKKVSPKLPTGSYNIAQVSYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  248  GTRGPRRMHCTMHS  261


 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSSN YIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSNKYIGKLRSNFLGT  196



>ref|XP_010912431.1| PREDICTED: tubby-like F-box protein 14 [Elaeis guineensis]
 ref|XP_010912432.1| PREDICTED: tubby-like F-box protein 14 [Elaeis guineensis]
Length=432

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF+IYD QPP+N   +S PG TSRRFY KKVSPKVP+GSY IAQVTYELNVL
Sbjct  189  LRSNFLGTKFLIYDIQPPHNGAALSQPGKTSRRFYSKKVSPKVPSGSYVIAQVTYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  249  GTRGPRRMHCIMHS  262


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            +A+LVENGKFLLSAKR RRTT TEY+ISM+ADNISRS+NTYIGKLRS  LGT
Sbjct  145  SAVLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSNNTYIGKLRSNFLGT  196



>ref|XP_007019500.1| Tubby like protein 10 isoform 1 [Theobroma cacao]
 ref|XP_007019501.1| Tubby like protein 10 isoform 1 [Theobroma cacao]
 gb|EOY16725.1| Tubby like protein 10 isoform 1 [Theobroma cacao]
 gb|EOY16726.1| Tubby like protein 10 isoform 1 [Theobroma cacao]
Length=424

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  +  PG  SRRFY KKVSPKVPTGSYNIAQV+YELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNNAQLPPPG-RSRRFYSKKVSPKVPTGSYNIAQVSYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  248  GTRGPRRMHCTMHS  261


 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+IS++ADNISRSS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISIDADNISRSSSTYIGKLRSNFLGT  196



>ref|XP_008365270.1| PREDICTED: tubby-like F-box protein 8 [Malus domestica]
 ref|XP_008365271.1| PREDICTED: tubby-like F-box protein 8 [Malus domestica]
 ref|XP_008365272.1| PREDICTED: tubby-like F-box protein 8 [Malus domestica]
Length=424

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFI+YDTQP Y S H+  PG +SRRF  KKVSPKVPTGSYNIAQ+TYELNVL
Sbjct  189  LRSNFLGTKFIVYDTQPAYTSEHVPPPGRSSRRFNSKKVSPKVPTGSYNIAQITYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  249  GTRGPRRMHCIMHS  262


 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSS++YIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSSYIGKLRSNFLGT  196



>ref|XP_009341307.1| PREDICTED: tubby-like F-box protein 8 [Pyrus x bretschneideri]
 ref|XP_009341308.1| PREDICTED: tubby-like F-box protein 8 [Pyrus x bretschneideri]
Length=424

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFI+YDTQP Y S H+  PG +SRRF  KKVSPKVPTGSYNIAQ+TYELNVL
Sbjct  189  LRSNFLGTKFIVYDTQPAYTSEHVPPPGRSSRRFNSKKVSPKVPTGSYNIAQITYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  249  GTRGPRRMHCIMHS  262


 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSS++YIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSSYIGKLRSNFLGT  196



>ref|XP_011042854.1| PREDICTED: tubby-like F-box protein 8 [Populus euphratica]
 ref|XP_011042855.1| PREDICTED: tubby-like F-box protein 8 [Populus euphratica]
Length=424

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQP YN+  ++ PG  SRRFY KKVSPKVPTGSYNIAQVTYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPSYNNAQLAPPG-RSRRFYSKKVSPKVPTGSYNIAQVTYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  248  GTRGPRRMHCTMHS  261


 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR +RTT TEY+ISM+ADN+SRS++TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTQRTTCTEYVISMDADNVSRSNSTYIGKLRSNFLGT  196



>ref|XP_004961952.1| PREDICTED: tubby-like F-box protein 8-like [Setaria italica]
Length=452

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF+IYDTQPPYN   +   G TSRRF  KKVSPKVPTGSYNIAQVTYELNVL
Sbjct  195  LRSNFLGTKFMIYDTQPPYNGAVVPHAGRTSRRFNSKKVSPKVPTGSYNIAQVTYELNVL  254

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  255  GTRGPRRMHCVMHS  268


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            TA+L ENGKFLLSAKRNR+TT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  151  TAVLTENGKFLLSAKRNRKTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  202



>ref|XP_004287069.1| PREDICTED: tubby-like F-box protein 8 [Fragaria vesca subsp. 
vesca]
Length=427

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFI+YDTQP   S HI+ PG TSRRF  KKVSPKVPTGSYNIAQ+TYELNVL
Sbjct  189  LRSNFLGTKFIVYDTQPACTSEHITPPGRTSRRFTSKKVSPKVPTGSYNIAQITYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  249  GTRGPRRMHCMMHS  262


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSSNTYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSNTYIGKLRSNFLGT  196



>ref|XP_004248812.1| PREDICTED: tubby-like F-box protein 8 [Solanum lycopersicum]
 ref|XP_004248813.1| PREDICTED: tubby-like F-box protein 8 [Solanum lycopersicum]
 ref|XP_010327505.1| PREDICTED: tubby-like F-box protein 8 [Solanum lycopersicum]
Length=426

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF+IYDTQPPY   ++  PG TSRRFY KKVSPKVPTGSY+IAQ+ YELNVL
Sbjct  189  LRSNFLGTKFVIYDTQPPYTFANVPPPGRTSRRFYSKKVSPKVPTGSYSIAQIKYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPRKMHC M+S
Sbjct  249  GTRGPRKMHCVMHS  262


 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+A+NISRSSNTYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDAENISRSSNTYIGKLRSNFLGT  196



>ref|XP_003518598.1| PREDICTED: tubby-like F-box protein 8-like isoform X1 [Glycine 
max]
 ref|XP_006574801.1| PREDICTED: tubby-like F-box protein 8-like isoform X2 [Glycine 
max]
 ref|XP_006574802.1| PREDICTED: tubby-like F-box protein 8-like isoform X3 [Glycine 
max]
 gb|KHN00762.1| Tubby-like F-box protein 8 [Glycine soja]
Length=424

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  +S PG  SRRFY KKVSPKVP+GSYNIAQ+TYELNVL
Sbjct  187  LRSNFLGTKFIIYDTQPPYNNAQLSPPG-RSRRFYSKKVSPKVPSGSYNIAQITYELNVL  245

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M+S
Sbjct  246  GTRGPRRMNCTMHS  259


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEYIISM+ADNISRS++TYIGKLRS  LGT
Sbjct  143  PALLVENGKFLLSAKRTRRTTCTEYIISMDADNISRSNSTYIGKLRSNFLGT  194



>ref|XP_006598751.1| PREDICTED: uncharacterized protein LOC100803729 isoform X1 [Glycine 
max]
 ref|XP_006598752.1| PREDICTED: uncharacterized protein LOC100803729 isoform X2 [Glycine 
max]
 gb|KHN41272.1| Tubby-like F-box protein 8 [Glycine soja]
Length=424

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  +S PG  SRRFY KKVSPKVP+GSYNIAQ+TYELNVL
Sbjct  187  LRSNFLGTKFIIYDTQPPYNNAQLSPPG-RSRRFYSKKVSPKVPSGSYNIAQITYELNVL  245

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M+S
Sbjct  246  GTRGPRRMNCTMHS  259


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEYIISM+ADNISRS++TYIGKLRS  LGT
Sbjct  143  PALLVENGKFLLSAKRTRRTTCTEYIISMDADNISRSNSTYIGKLRSNFLGT  194



>ref|XP_004237792.1| PREDICTED: tubby-like F-box protein 8 [Solanum lycopersicum]
Length=426

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYNS+ I  PG  SRRFY KKVSPKVPTG+YNIAQV+YELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNSSSIPPPG-GSRRFYSKKVSPKVPTGTYNIAQVSYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M+S
Sbjct  248  GTRGPRRMNCVMHS  261


 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKRNRRTT TEYIISMNADNISRS+++YIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRNRRTTCTEYIISMNADNISRSNSSYIGKLRSNFLGT  196



>ref|XP_008237579.1| PREDICTED: tubby-like F-box protein 8 [Prunus mume]
Length=426

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYNS  +  PG  SRRFY KKVSPKVPTGSYNIAQVTYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNSAQLYPPG-QSRRFYSKKVSPKVPTGSYNIAQVTYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTR PR+MHC M+S
Sbjct  248  GTRRPRRMHCNMHS  261


 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSSNTYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSNTYIGKLRSNFLGT  196



>ref|XP_008784162.1| PREDICTED: tubby-like F-box protein 8 isoform X1 [Phoenix dactylifera]
Length=432

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF+IYDTQP +N   +S PG TSRRFY KKVSPKVP+GSY IAQVTYELNVL
Sbjct  189  LRSNFLGTKFLIYDTQPAHNGAALSQPGKTSRRFYSKKVSPKVPSGSYVIAQVTYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  249  GTRGPRRMHCIMHS  262


 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             A+LVENGKFLLSAKR RRTT TEYIISM+ADNISRSSNTYIGKLRS  LGT
Sbjct  145  PAVLVENGKFLLSAKRTRRTTCTEYIISMDADNISRSSNTYIGKLRSNFLGT  196



>ref|XP_006359816.1| PREDICTED: tubby-like F-box protein 8-like [Solanum tuberosum]
Length=426

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYNS+ I  PG  SRRFY KKVSPKVPTG+YNIAQV+YELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNSSSIPPPG-GSRRFYSKKVSPKVPTGTYNIAQVSYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M+S
Sbjct  248  GTRGPRRMNCVMHS  261


 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKRNRRTT TEYIISMNADNISRS+++YIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRNRRTTCTEYIISMNADNISRSNSSYIGKLRSNFLGT  196



>ref|XP_008784163.1| PREDICTED: tubby-like F-box protein 8 isoform X2 [Phoenix dactylifera]
Length=431

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF+IYDTQP +N   +S PG TSRRFY KKVSPKVP+GSY IAQVTYELNVL
Sbjct  188  LRSNFLGTKFLIYDTQPAHNGAALSQPGKTSRRFYSKKVSPKVPSGSYVIAQVTYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  248  GTRGPRRMHCIMHS  261


 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -3

Query  558  FVTFTALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            ++  + +LVENGKFLLSAKR RRTT TEYIISM+ADNISRSSNTYIGKLRS  LGT
Sbjct  140  YLCLSPVLVENGKFLLSAKRTRRTTCTEYIISMDADNISRSSNTYIGKLRSNFLGT  195



>ref|XP_009783834.1| PREDICTED: tubby-like F-box protein 8 [Nicotiana sylvestris]
Length=427

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPY   H+  PG TSRRF  KKVSPKVPTGSY I+Q+TYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYTCAHVPAPGRTSRRFNSKKVSPKVPTGSYIISQITYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  249  GTRGPRRMHCVMHS  262


 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+A+NISRSSNTYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDAENISRSSNTYIGKLRSNFLGT  196



>ref|XP_004140690.1| PREDICTED: tubby-like F-box protein 8-like [Cucumis sativus]
Length=428

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFI+YDTQPPY +  +  PG TSRRFY KKVSPKVPTGSYNIA ++YELNVL
Sbjct  190  LRSNFLGTKFIVYDTQPPYTAAPLPPPGKTSRRFYSKKVSPKVPTGSYNIAHISYELNVL  249

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  250  GTRGPRRMHCIMHS  263


 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEYIISM A+NI RSS++YIGKLRS  LGT
Sbjct  146  PALLVENGKFLLSAKRTRRTTSTEYIISMGAENILRSSSSYIGKLRSNFLGT  197



>ref|XP_004163912.1| PREDICTED: tubby-like F-box protein 8-like [Cucumis sativus]
 gb|KGN57550.1| hypothetical protein Csa_3G209470 [Cucumis sativus]
Length=428

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFI+YDTQPPY +  +  PG TSRRFY KKVSPKVPTGSYNIA ++YELNVL
Sbjct  190  LRSNFLGTKFIVYDTQPPYTAAPLPPPGKTSRRFYSKKVSPKVPTGSYNIAHISYELNVL  249

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  250  GTRGPRRMHCIMHS  263


 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEYIISM+A+NISRSS++YIGKLRS  LGT
Sbjct  146  PALLVENGKFLLSAKRTRRTTSTEYIISMDAENISRSSSSYIGKLRSNFLGT  197



>ref|XP_007152022.1| hypothetical protein PHAVU_004G095000g [Phaseolus vulgaris]
 gb|ESW24016.1| hypothetical protein PHAVU_004G095000g [Phaseolus vulgaris]
Length=425

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 67/74 (91%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+T +S PG  SRRF  KKVSPKVP+GSYNIAQ+TYELNVL
Sbjct  187  LRSNFLGTKFIIYDTQPPYNNTQLSPPG-RSRRFNSKKVSPKVPSGSYNIAQITYELNVL  245

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C+M+S
Sbjct  246  GTRGPRRMNCSMHS  259


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY ISM+ADNISRSSNTYIGKLRS  LGT
Sbjct  143  PALLVENGKFLLSAKRTRRTTCTEYTISMDADNISRSSNTYIGKLRSNFLGT  194



>ref|NP_001280861.1| tubby-like F-box protein 8 [Malus domestica]
 gb|ADL36846.1| TLP domain class transcription factor [Malus domestica]
Length=424

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFI+YDTQP Y S H+  PG +SRRF  KKVSPKVPTGSYNIAQ+ YELNVL
Sbjct  189  LRSNFLGTKFIVYDTQPAYTSEHVPPPGRSSRRFNSKKVSPKVPTGSYNIAQIAYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  249  GTRGPRRMHCIMHS  262


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSS++YIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSSYIGKLRSNFLGT  196



>ref|XP_008456108.1| PREDICTED: tubby-like F-box protein 8 [Cucumis melo]
Length=428

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFI+YDTQPPY +  +  PG TSRRFY KKVSPKVPTGSYNIA ++YELNVL
Sbjct  190  LRSNFLGTKFIVYDTQPPYTAAPLPPPGKTSRRFYSKKVSPKVPTGSYNIAHISYELNVL  249

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  250  GTRGPRRMHCIMHS  263


 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEYIISM+A+NISRSS++YIGKLRS  LGT
Sbjct  146  PALLVENGKFLLSAKRTRRTTSTEYIISMDAENISRSSSSYIGKLRSNFLGT  197



>ref|XP_009419406.1| PREDICTED: tubby-like F-box protein 8 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=313

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNF+GTKF IYDTQPPYN   +  PG TSRRFY KKVSPKVP+GSY IAQVTYELNVL
Sbjct  67   LRSNFIGTKFRIYDTQPPYNGAALCPPGRTSRRFYSKKVSPKVPSGSYPIAQVTYELNVL  126

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  127  GTRGPRRMHCIMHS  140


 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             A+LVENGKFLLSAKRN RTT TEY+IS +A NISRSS+TY+GKLRS  +GT
Sbjct  23   PAVLVENGKFLLSAKRNPRTTCTEYVISTDAGNISRSSSTYVGKLRSNFIGT  74



>ref|XP_010530245.1| PREDICTED: tubby-like F-box protein 8 [Tarenaya hassleriana]
 ref|XP_010530246.1| PREDICTED: tubby-like F-box protein 8 [Tarenaya hassleriana]
Length=428

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN++ +S PG  SRRFY KKVSPKVPTGSY+IA ++YELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNNSQLSPPG-RSRRFYSKKVSPKVPTGSYSIAHISYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  248  GTRGPRRMHCIMHS  261


 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT+TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTYTEYVISMHADNISRSSSTYIGKLRSNFLGT  196



>ref|XP_010927387.1| PREDICTED: tubby-like F-box protein 8 [Elaeis guineensis]
 ref|XP_010927388.1| PREDICTED: tubby-like F-box protein 8 [Elaeis guineensis]
Length=432

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN   +   G TSRRFY KKVSPKVP+GSYNIAQVTYELNVL
Sbjct  192  LRSNFLGTKFIIYDTQPPYNGAALCPLGRTSRRFYSKKVSPKVPSGSYNIAQVTYELNVL  251

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MH  M+S
Sbjct  252  GTRGPRRMHIIMHS  265


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            +A+LVENGKFLLSAKRNRRTT TEYIISM+AD ISRSSNTYIGKLRS  LGT
Sbjct  148  SAVLVENGKFLLSAKRNRRTTCTEYIISMDADTISRSSNTYIGKLRSNFLGT  199



>ref|NP_001242468.1| uncharacterized protein LOC100803729 [Glycine max]
 gb|ACU18297.1| unknown [Glycine max]
Length=424

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  +S PG  SRRFY KKVSPKVP+GSYNI Q+TYELNVL
Sbjct  187  LRSNFLGTKFIIYDTQPPYNNAQLSPPG-RSRRFYSKKVSPKVPSGSYNITQITYELNVL  245

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M+S
Sbjct  246  GTRGPRRMNCTMHS  259


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEYIISM+ADNISRS++TYIGKLRS  LGT
Sbjct  143  PALLVENGKFLLSAKRTRRTTCTEYIISMDADNISRSNSTYIGKLRSNFLGT  194



>ref|XP_006351828.1| PREDICTED: tubby-like F-box protein 8-like [Solanum tuberosum]
Length=427

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPP+   H+  PG TSRRF  KKVSPKVPTGSY I+Q+TYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPHTGAHVPPPGRTSRRFTSKKVSPKVPTGSYIISQITYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  249  GTRGPRRMHCVMHS  262


 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+A+NISRSSNTYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDAENISRSSNTYIGKLRSNFLGT  196



>ref|XP_009419403.1| PREDICTED: tubby-like F-box protein 8 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009419404.1| PREDICTED: tubby-like F-box protein 8 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009419405.1| PREDICTED: tubby-like F-box protein 8 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=438

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNF+GTKF IYDTQPPYN   +  PG TSRRFY KKVSPKVP+GSY IAQVTYELNVL
Sbjct  192  LRSNFIGTKFRIYDTQPPYNGAALCPPGRTSRRFYSKKVSPKVPSGSYPIAQVTYELNVL  251

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  252  GTRGPRRMHCIMHS  265


 Score = 79.0 bits (193),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             A+LVENGKFLLSAKRN RTT TEY+IS +A NISRSS+TY+GKLRS  +GT
Sbjct  148  PAVLVENGKFLLSAKRNPRTTCTEYVISTDAGNISRSSSTYVGKLRSNFIGT  199



>ref|XP_004230571.1| PREDICTED: tubby-like F-box protein 8 [Solanum lycopersicum]
Length=427

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPP+   H+  PG TSRRF  KKVSPKVPTGSY I+Q+TYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPHTGAHVPPPGRTSRRFTSKKVSPKVPTGSYIISQITYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  249  GTRGPRRMHCVMHS  262


 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+A+NISRSSNTYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDAENISRSSNTYIGKLRSNFLGT  196



>ref|XP_002441166.1| hypothetical protein SORBIDRAFT_09g021590 [Sorghum bicolor]
 gb|EES19596.1| hypothetical protein SORBIDRAFT_09g021590 [Sorghum bicolor]
Length=450

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF+I DTQPPYN   +   G TSRRF  KKVSPKVPTGSYNIAQVTYELNVL
Sbjct  195  LRSNFLGTKFMISDTQPPYNGAVVPHAGRTSRRFNSKKVSPKVPTGSYNIAQVTYELNVL  254

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  255  GTRGPRRMHCVMHS  268


 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            TA+L+ENGKFLLSAKRNR+TT TEY+ISM+A+NISRSS+TYIGKLRS  LGT
Sbjct  151  TAVLMENGKFLLSAKRNRKTTCTEYVISMDAENISRSSSTYIGKLRSNFLGT  202



>emb|CDP11400.1| unnamed protein product [Coffea canephora]
Length=428

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPP N   +  PG TSRRFY KKVSPKVP G+YNIAQ+ YELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPCNGAQVVPPGRTSRRFYSKKVSPKVPAGNYNIAQIMYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M+S
Sbjct  249  GTRGPRRMNCTMHS  262


 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKRNRRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRNRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  196



>ref|XP_008793936.1| PREDICTED: tubby-like F-box protein 8 [Phoenix dactylifera]
Length=432

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN   +   G TSRRFY KKVSPKVP+GSY+IAQVTYELNVL
Sbjct  192  LRSNFLGTKFIIYDTQPPYNGAALCPLGRTSRRFYSKKVSPKVPSGSYSIAQVTYELNVL  251

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MH  M+S
Sbjct  252  GTRGPRRMHIIMHS  265


 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             A+LVENGKFLLSAKRNRRTT TEYIISM+AD ISRSSNTYIGKLRS  LGT
Sbjct  148  PAVLVENGKFLLSAKRNRRTTCTEYIISMDADTISRSSNTYIGKLRSNFLGT  199



>ref|XP_003592106.1| Tubby-like F-box protein [Medicago truncatula]
 gb|AES62357.1| tubby-F-box-like protein [Medicago truncatula]
Length=431

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  ++ PG  SRRF  KKVSPKVP+GSYNIAQVTYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNNAQLAPPG-RSRRFNSKKVSPKVPSGSYNIAQVTYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M+S
Sbjct  248  GTRGPRRMNCTMHS  261


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSSNTYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSNTYIGKLRSNFLGT  196



>ref|XP_004516626.1| PREDICTED: tubby-like F-box protein 8-like isoform X1 [Cicer 
arietinum]
 ref|XP_004516627.1| PREDICTED: tubby-like F-box protein 8-like isoform X2 [Cicer 
arietinum]
 ref|XP_004516628.1| PREDICTED: tubby-like F-box protein 8-like isoform X3 [Cicer 
arietinum]
Length=421

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  +S PG  SRRF  KKVSPKVP+GSYNIAQ+TYELNV+
Sbjct  189  LRSNFLGTKFIIYDTQPPYNNAQLSPPG-RSRRFNSKKVSPKVPSGSYNIAQITYELNVI  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPRKM+C M S
Sbjct  248  GTRGPRKMNCTMSS  261


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEYIISMNADNISRSS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYIISMNADNISRSSSTYIGKLRSNFLGT  196



>ref|XP_006390145.1| hypothetical protein EUTSA_v10018551mg [Eutrema salsugineum]
 ref|XP_006390146.1| hypothetical protein EUTSA_v10018551mg [Eutrema salsugineum]
 gb|ESQ27431.1| hypothetical protein EUTSA_v10018551mg [Eutrema salsugineum]
 gb|ESQ27432.1| hypothetical protein EUTSA_v10018551mg [Eutrema salsugineum]
Length=445

 Score =   121 bits (303),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 64/76 (84%), Gaps = 2/76 (3%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYN--STHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELN  51
             RSNFLGTKFIIYDTQPPYN  ++  S P   SRRFY K+VSPKVP+GSY IAQV+YELN
Sbjct  193  IRSNFLGTKFIIYDTQPPYNNKASQASQPVGLSRRFYSKRVSPKVPSGSYKIAQVSYELN  252

Query  50   VLGTRGPRKMHCAMYS  3
            VLGTRGPR+MHCAM S
Sbjct  253  VLGTRGPRRMHCAMQS  268


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT+TEY+ISM+AD ISRSSNTYIGK+RS  LGT
Sbjct  149  PALLVENGKFLLSAKRIRRTTYTEYVISMHADTISRSSNTYIGKIRSNFLGT  200



>ref|XP_009629482.1| PREDICTED: tubby-like F-box protein 8 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009629483.1| PREDICTED: tubby-like F-box protein 8 isoform X1 [Nicotiana tomentosiformis]
Length=426

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYNS+ I  PG  SRRF  KKVSPKVPTG+Y IAQVTYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNSSSIPPPG-GSRRFNSKKVSPKVPTGTYKIAQVTYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M+S
Sbjct  248  GTRGPRRMNCVMHS  261


 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKRNRRTT TEY+ISMNADNISRSS +YIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRNRRTTCTEYVISMNADNISRSSRSYIGKLRSNFLGT  196



>ref|XP_010416614.1| PREDICTED: tubby-like F-box protein 1 [Camelina sativa]
 ref|XP_010416615.1| PREDICTED: tubby-like F-box protein 1 [Camelina sativa]
Length=458

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 64/77 (83%), Gaps = 3/77 (4%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHIS---DPGCTSRRFYPKKVSPKVPTGSYNIAQVTYEL  54
             RSNFLGTKFIIYDTQP YNS + S    P   SRRFY K+VSPKVPTGSY IAQV+YEL
Sbjct  193  IRSNFLGTKFIIYDTQPAYNSNNTSRVVQPVGLSRRFYSKRVSPKVPTGSYKIAQVSYEL  252

Query  53   NVLGTRGPRKMHCAMYS  3
            NVLGTRGPR+MHCAM+S
Sbjct  253  NVLGTRGPRRMHCAMHS  269


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT+TEY+ISM+AD ISRSSNTYIGK+RS  LGT
Sbjct  149  PALLVENGKFLLSAKRIRRTTYTEYVISMHADTISRSSNTYIGKIRSNFLGT  200



>ref|XP_003593111.1| Tubby-like F-box protein [Medicago truncatula]
 gb|AES63362.1| tubby-F-box-like protein [Medicago truncatula]
Length=427

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 64/76 (84%), Gaps = 3/76 (4%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGC--TSRRFYPKKVSPKVPTGSYNIAQVTYELN  51
             RSNFLGTKFIIYDTQPP  S HI  PG   TSRRF  KKVSPKVP+GSYNIAQVTYELN
Sbjct  190  LRSNFLGTKFIIYDTQPPCTSAHICPPGTGKTSRRF-SKKVSPKVPSGSYNIAQVTYELN  248

Query  50   VLGTRGPRKMHCAMYS  3
            VLGTRGPRKMHC M+S
Sbjct  249  VLGTRGPRKMHCIMHS  264


 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT+TEY+ISM+ADNISRSSNTYIGKLRS  LGT
Sbjct  146  PALLVENGKFLLSAKRTRRTTYTEYVISMDADNISRSSNTYIGKLRSNFLGT  197



>ref|XP_009393408.1| PREDICTED: tubby-like F-box protein 8 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393409.1| PREDICTED: tubby-like F-box protein 8 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393410.1| PREDICTED: tubby-like F-box protein 8 [Musa acuminata subsp. 
malaccensis]
Length=441

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF+IYDTQPPYN   +  PG TS RF  KKVSPKVP+GSY+IAQVTYELNVL
Sbjct  199  LRSNFLGTKFVIYDTQPPYNGAALCPPGRTSHRF-SKKVSPKVPSGSYSIAQVTYELNVL  257

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC MYS
Sbjct  258  GTRGPRRMHCVMYS  271


 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ++LVE GKFLLSAKRNRRTT TEYIISM+A NISRSS +YIGKLRS  LGT
Sbjct  155  PSVLVETGKFLLSAKRNRRTTCTEYIISMDAANISRSSYSYIGKLRSNFLGT  206



>ref|XP_010471851.1| PREDICTED: tubby-like F-box protein 1 [Camelina sativa]
 ref|XP_010471852.1| PREDICTED: tubby-like F-box protein 1 [Camelina sativa]
Length=460

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 64/77 (83%), Gaps = 3/77 (4%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNS---THISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYEL  54
             RSNFLGTKFIIYDTQP YNS   + +  P   SRRFY K+VSPKVPTGSY IAQV+YEL
Sbjct  193  IRSNFLGTKFIIYDTQPAYNSNTTSRVVQPVGLSRRFYSKRVSPKVPTGSYKIAQVSYEL  252

Query  53   NVLGTRGPRKMHCAMYS  3
            NVLGTRGPR+MHCAM+S
Sbjct  253  NVLGTRGPRRMHCAMHS  269


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT+TEY+ISM+AD ISRSSNTYIGK+RS  LGT
Sbjct  149  PALLVENGKFLLSAKRIRRTTYTEYVISMHADTISRSSNTYIGKIRSNFLGT  200



>ref|XP_009629484.1| PREDICTED: tubby-like F-box protein 8 isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009629485.1| PREDICTED: tubby-like F-box protein 8 isoform X2 [Nicotiana tomentosiformis]
Length=363

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYNS+ I  PG  SRRF  KKVSPKVPTG+Y IAQVTYELNVL
Sbjct  126  LRSNFLGTKFIIYDTQPPYNSSSIPPPG-GSRRFNSKKVSPKVPTGTYKIAQVTYELNVL  184

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M+S
Sbjct  185  GTRGPRRMNCVMHS  198


 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKRNRRTT TEY+ISMNADNISRSS +YIGKLRS  LGT
Sbjct  82   PALLVENGKFLLSAKRNRRTTCTEYVISMNADNISRSSRSYIGKLRSNFLGT  133



>ref|XP_006654462.1| PREDICTED: tubby-like F-box protein 8-like [Oryza brachyantha]
Length=445

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN   I   G +S RF  KKVSPKVP+GSYNIAQVTYELNVL
Sbjct  195  LRSNFLGTKFIIYDTQPPYNGAVIPPVGRSSCRFNSKKVSPKVPSGSYNIAQVTYELNVL  254

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  255  GTRGPRRMHCVMHS  268


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            TA+L ++GKFLLSAKR R+TT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  151  TAVLADSGKFLLSAKRYRKTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  202



>ref|XP_004140966.1| PREDICTED: tubby-like F-box protein 14-like [Cucumis sativus]
 ref|XP_004160310.1| PREDICTED: tubby-like F-box protein 14-like [Cucumis sativus]
 gb|KGN46139.1| hypothetical protein Csa_6G056560 [Cucumis sativus]
Length=432

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 62/74 (84%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYNS  I   G  SRRFY KKVSPKVP GSY+IAQ+ YELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNSNQIPTLG-RSRRFYSKKVSPKVPAGSYSIAQIAYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C MYS
Sbjct  248  GTRGPRRMNCTMYS  261


 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+IS+ AD+ISRSSN YIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTSTEYVISLAADDISRSSNGYIGKLRSNFLGT  196



>ref|XP_008441515.1| PREDICTED: tubby-like F-box protein 8 [Cucumis melo]
 ref|XP_008441516.1| PREDICTED: tubby-like F-box protein 8 [Cucumis melo]
 ref|XP_008441517.1| PREDICTED: tubby-like F-box protein 8 [Cucumis melo]
Length=432

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 62/74 (84%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYNS  I   G  SRRFY KKVSPKVP GSY+IAQ+ YELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNSNQIPTLG-RSRRFYSKKVSPKVPAGSYSIAQIAYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C MYS
Sbjct  248  GTRGPRRMNCTMYS  261


 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+IS+ AD+ISRSSN YIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTSTEYVISLAADDISRSSNGYIGKLRSNFLGT  196



>ref|XP_010428756.1| PREDICTED: tubby-like F-box protein 1 [Camelina sativa]
 ref|XP_010428757.1| PREDICTED: tubby-like F-box protein 1 [Camelina sativa]
Length=459

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 64/78 (82%), Gaps = 4/78 (5%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNS----THISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYE  57
             RSNFLGTKFIIYDTQP YNS    + +  P   SRRFY K+VSPKVPTGSY IAQV+YE
Sbjct  193  IRSNFLGTKFIIYDTQPAYNSNNNTSRVVQPVGLSRRFYSKRVSPKVPTGSYKIAQVSYE  252

Query  56   LNVLGTRGPRKMHCAMYS  3
            LNVLGTRGPR+MHCAM+S
Sbjct  253  LNVLGTRGPRRMHCAMHS  270


 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT+TEY+ISM+AD ISRSSNTY GK+RS  LGT
Sbjct  149  PALLVENGKFLLSAKRIRRTTYTEYVISMHADTISRSSNTYTGKIRSNFLGT  200



>ref|XP_006588484.1| PREDICTED: uncharacterized protein LOC100810531 isoform X1 [Glycine 
max]
 gb|KHN17010.1| Tubby-like F-box protein 8 [Glycine soja]
Length=430

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 65/74 (88%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  +S PG  SRRF  KKVSPKVP+GSYNIAQVTYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNNAMLSPPG-RSRRFS-KKVSPKVPSGSYNIAQVTYELNVL  246

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C MYS
Sbjct  247  GTRGPRRMNCTMYS  260


 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  196



>ref|NP_001055656.1| Os05g0437900 [Oryza sativa Japonica Group]
 sp|Q75HX5.1|TLP8_ORYSJ RecName: Full=Tubby-like F-box protein 8; Short=OsTLP8; AltName: 
Full=Tubby-like F-box protein 1; Short=OsTLP1 [Oryza sativa 
Japonica Group]
 gb|AAT07611.1| putative tubby protein [Oryza sativa Japonica Group]
 gb|AAV59313.1| putative tubby protein [Oryza sativa Japonica Group]
 dbj|BAF17570.1| Os05g0437900 [Oryza sativa Japonica Group]
 gb|EAY98188.1| hypothetical protein OsI_20103 [Oryza sativa Indica Group]
 dbj|BAG96153.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63852.1| hypothetical protein OsJ_18676 [Oryza sativa Japonica Group]
Length=445

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQP YN   I   G +SRRF  KKVSPK+P+GSYNIAQVTYELNVL
Sbjct  195  LRSNFLGTKFIIYDTQPSYNGAVIPPVGRSSRRFNSKKVSPKMPSGSYNIAQVTYELNVL  254

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC M+S
Sbjct  255  GTRGPRRMHCVMHS  268


 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            TA+L ++GKFLLSAKR+R+TT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  151  TAVLADSGKFLLSAKRHRKTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  202



>dbj|BAJ34070.1| unnamed protein product [Thellungiella halophila]
Length=445

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 63/76 (83%), Gaps = 2/76 (3%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYN--STHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELN  51
             RSNFLGTKFIIYDTQPPYN  ++  S P   SRRFY K+VSPKVP+GSY IAQV+YELN
Sbjct  193  IRSNFLGTKFIIYDTQPPYNNKASQASQPVGLSRRFYSKRVSPKVPSGSYKIAQVSYELN  252

Query  50   VLGTRGPRKMHCAMYS  3
            VLGTRGPR MHCAM S
Sbjct  253  VLGTRGPRGMHCAMQS  268


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT+TEY+ISM+AD ISRSSNTYIGK+RS  LGT
Sbjct  149  PALLVENGKFLLSAKRIRRTTYTEYVISMHADTISRSSNTYIGKIRSNFLGT  200



>ref|NP_001242014.1| uncharacterized protein LOC100810531 [Glycine max]
 gb|ACU18200.1| unknown [Glycine max]
Length=430

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 65/74 (88%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  +S PG  SRRF  KKVSPKVP+GSYNIAQVTYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNNAMLSPPG-RSRRFS-KKVSPKVPSGSYNIAQVTYELNVL  246

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C MYS
Sbjct  247  GTRGPRRMNCTMYS  260


 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  196



>emb|CDY45959.1| BnaA02g17850D [Brassica napus]
Length=429

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNS-THISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNV  48
             RSNFLGTKFIIYDTQPPYN  +    P   SRRFY K+VSPKVP+GSY IAQV+YELNV
Sbjct  198  IRSNFLGTKFIIYDTQPPYNKPSQALQPLGLSRRFYSKRVSPKVPSGSYKIAQVSYELNV  257

Query  47   LGTRGPRKMHCAMYS  3
            LGTRGPR+MHCAM+S
Sbjct  258  LGTRGPRRMHCAMHS  272


 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RR+T+TEY+ISM+AD ISRSSNTYIGK+RS  LGT
Sbjct  154  PALLVENGKFLLSAKRIRRSTYTEYVISMHADTISRSSNTYIGKIRSNFLGT  205



>gb|EMT05453.1| hypothetical protein F775_20277 [Aegilops tauschii]
Length=371

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFI+YDTQPPYN   +   G +SRRF  KKVSPKVP+GSYNIAQV+YELNVL
Sbjct  195  LRSNFLGTKFIVYDTQPPYNGALVPPVGRSSRRFNSKKVSPKVPSGSYNIAQVSYELNVL  254

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M+S
Sbjct  255  GTRGPRRMNCIMHS  268


 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -3

Query  543  ALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            A+LVENGKFLLSAKR RRTT TEY+ISM+A+NISRSS+TYIGKLRS  LGT
Sbjct  152  AVLVENGKFLLSAKRIRRTTCTEYVISMDAENISRSSSTYIGKLRSNFLGT  202



>ref|XP_009124582.1| PREDICTED: tubby-like F-box protein 1 [Brassica rapa]
 ref|XP_009124583.1| PREDICTED: tubby-like F-box protein 1 [Brassica rapa]
 ref|XP_009124584.1| PREDICTED: tubby-like F-box protein 1 [Brassica rapa]
Length=447

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNS-THISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNV  48
             RSNFLGTKFIIYDTQPPYN  +    P   SRRFY K+VSPKVP+GSY IAQV+YELNV
Sbjct  198  IRSNFLGTKFIIYDTQPPYNKPSQALQPLGLSRRFYSKRVSPKVPSGSYKIAQVSYELNV  257

Query  47   LGTRGPRKMHCAMYS  3
            LGTRGPR+MHCAM+S
Sbjct  258  LGTRGPRRMHCAMHS  272


 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RR+T+TEY+ISM+AD ISRSSNTYIGK+RS  LGT
Sbjct  154  PALLVENGKFLLSAKRIRRSTYTEYVISMHADTISRSSNTYIGKIRSNFLGT  205



>ref|XP_006302213.1| hypothetical protein CARUB_v10020231mg [Capsella rubella]
 gb|EOA35111.1| hypothetical protein CARUB_v10020231mg [Capsella rubella]
Length=469

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 64/76 (84%), Gaps = 2/76 (3%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNS--THISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELN  51
             RSNFLGTKFIIYDTQP YNS  + +  P   SRRFY K++SPKVP+GSY IAQV+YELN
Sbjct  193  IRSNFLGTKFIIYDTQPAYNSNTSRVVQPVGISRRFYSKRISPKVPSGSYKIAQVSYELN  252

Query  50   VLGTRGPRKMHCAMYS  3
            VLGTRGPR+MHCAM+S
Sbjct  253  VLGTRGPRRMHCAMHS  268


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT+TEY+ISM+AD ISRSSNTYIGK+RS  LGT
Sbjct  149  PALLVENGKFLLSAKRIRRTTYTEYVISMHADTISRSSNTYIGKIRSNFLGT  200



>gb|EYU18525.1| hypothetical protein MIMGU_mgv1a006446mg [Erythranthe guttata]
Length=444

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 64/76 (84%), Gaps = 2/76 (3%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYN-STHISDP-GCTSRRFYPKKVSPKVPTGSYNIAQVTYELN  51
             RSNFLGTKFIIYDTQPP+  S  I+ P G TSRRFY KKVSPKVP GSYNIAQ+ YELN
Sbjct  193  LRSNFLGTKFIIYDTQPPHACSAQIAPPPGKTSRRFYSKKVSPKVPNGSYNIAQIAYELN  252

Query  50   VLGTRGPRKMHCAMYS  3
            VLGTRGPR+MHC M+S
Sbjct  253  VLGTRGPRRMHCLMHS  268


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  149  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  200



>emb|CDY65845.1| BnaCnng48830D [Brassica napus]
Length=450

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 63/78 (81%), Gaps = 4/78 (5%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYN----STHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYE  57
             RSNFLGTKFIIYDTQPPYN    ++    P   SRRFY K+VSPKVPTGSY IAQV+YE
Sbjct  219  IRSNFLGTKFIIYDTQPPYNNNNKASQAVQPLGLSRRFYSKRVSPKVPTGSYKIAQVSYE  278

Query  56   LNVLGTRGPRKMHCAMYS  3
            LNVLGTRGPR+MHCAM S
Sbjct  279  LNVLGTRGPRRMHCAMDS  296


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT+TEY+ISM+AD ISRSSNTYIGK+RS  LGT
Sbjct  175  PALLVENGKFLLSAKRIRRTTYTEYVISMHADTISRSSNTYIGKIRSNFLGT  226



>dbj|BAJ85290.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07853.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93187.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=452

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF++YDTQPPYN   +   G +SRRF  KKVSPKVP+GSYNIAQV+YELNVL
Sbjct  195  LRSNFLGTKFVVYDTQPPYNGAIVPSVGRSSRRFNSKKVSPKVPSGSYNIAQVSYELNVL  254

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M+S
Sbjct  255  GTRGPRRMNCIMHS  268


 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -3

Query  543  ALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            A+L ENGKFLLSAKRNR+TT TEY+ISM+A+NISRSS+TYIGKLRS  LGT
Sbjct  152  AVLAENGKFLLSAKRNRKTTCTEYVISMDAENISRSSSTYIGKLRSNFLGT  202



>ref|XP_009411929.1| PREDICTED: tubby-like F-box protein 8 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009411930.1| PREDICTED: tubby-like F-box protein 8 [Musa acuminata subsp. 
malaccensis]
Length=434

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF+IYDTQPPY+   +  PG TSRRF  KKVSPKVP+GSY+IAQ+ YELNVL
Sbjct  192  LRSNFLGTKFVIYDTQPPYSGAALCPPGRTSRRF-SKKVSPKVPSGSYSIAQIKYELNVL  250

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+MHC MYS
Sbjct  251  GTRGPRRMHCVMYS  264


 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ++L E GKFLLSAKRNRRTT TEYIISM+ DNISRSSNTYIGKLRS  LGT
Sbjct  148  PSVLAETGKFLLSAKRNRRTTCTEYIISMDVDNISRSSNTYIGKLRSNFLGT  199



>gb|EMS46947.1| Tubby-like F-box protein 8 [Triticum urartu]
Length=421

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFI+YDTQPPYN   +   G +SRRF  KKVSPKVP+GSYNIAQV+YELNVL
Sbjct  195  LRSNFLGTKFIVYDTQPPYNGALVPPVGRSSRRFNSKKVSPKVPSGSYNIAQVSYELNVL  254

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M+S
Sbjct  255  GTRGPRRMNCIMHS  268


 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -3

Query  543  ALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            A+LVENGKFLLSAKR RRTT TEY+ISM+A+NISRSS+TYIGKLRS  LGT
Sbjct  152  AVLVENGKFLLSAKRIRRTTCTEYVISMDAENISRSSSTYIGKLRSNFLGT  202



>emb|CDY13570.1| BnaC02g23810D [Brassica napus]
Length=425

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNS-THISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNV  48
             RSNFLGTKFIIYDTQPPYN  +    P   SRRFY K+VSPKVP+GSY IAQV+YELNV
Sbjct  196  IRSNFLGTKFIIYDTQPPYNKPSQPLQPLGLSRRFYSKRVSPKVPSGSYKIAQVSYELNV  255

Query  47   LGTRGPRKMHCAMYS  3
            LGTRGPR+MHCAM+S
Sbjct  256  LGTRGPRRMHCAMHS  270


 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RR+T+TEY+ISM+AD ISRSSNTYIGK+RS  LGT
Sbjct  152  PALLVENGKFLLSAKRIRRSTYTEYVISMHADTISRSSNTYIGKIRSNFLGT  203



>ref|XP_007143538.1| hypothetical protein PHAVU_007G079900g [Phaseolus vulgaris]
 gb|ESW15532.1| hypothetical protein PHAVU_007G079900g [Phaseolus vulgaris]
Length=431

 Score =   118 bits (296),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 64/74 (86%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  +S PG  SRRF  KKVSPKVP+GSYNI QVTYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYNNAMLSPPG-RSRRF-SKKVSPKVPSGSYNIGQVTYELNVL  246

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C MYS
Sbjct  247  GTRGPRRMNCTMYS  260


 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEYIISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYIISMDADNISRSSSTYIGKLRSNFLGT  196



>emb|CDX87562.1| BnaA07g33110D [Brassica napus]
Length=451

 Score =   118 bits (296),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 63/78 (81%), Gaps = 4/78 (5%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNS----THISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYE  57
             RSNFLGTKFIIYDTQPPYN+    +    P   SRRFY K+VSPKVPTGSY IAQV+YE
Sbjct  220  IRSNFLGTKFIIYDTQPPYNNNNKPSQAVQPLGLSRRFYSKRVSPKVPTGSYKIAQVSYE  279

Query  56   LNVLGTRGPRKMHCAMYS  3
            LNVLGTRGPR+MHCAM S
Sbjct  280  LNVLGTRGPRRMHCAMDS  297


 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT+TEY+ISM+AD ISRSSNTYIGK+RS  LGT
Sbjct  176  PALLVENGKFLLSAKRIRRTTYTEYVISMHADTISRSSNTYIGKIRSNFLGT  227



>ref|XP_009106351.1| PREDICTED: tubby-like F-box protein 1 [Brassica rapa]
 ref|XP_009106352.1| PREDICTED: tubby-like F-box protein 1 [Brassica rapa]
Length=446

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 63/78 (81%), Gaps = 4/78 (5%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNS----THISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYE  57
             RSNFLGTKFIIYDTQPPYN+    +    P   SRRFY K+VSPKVPTGSY IAQV+YE
Sbjct  201  IRSNFLGTKFIIYDTQPPYNNNNKPSQAVQPLGLSRRFYSKRVSPKVPTGSYKIAQVSYE  260

Query  56   LNVLGTRGPRKMHCAMYS  3
            LNVLGTRGPR+MHCAM S
Sbjct  261  LNVLGTRGPRRMHCAMDS  278


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT+TEY+ISM+AD ISRSSNTYIGK+RS  LGT
Sbjct  157  PALLVENGKFLLSAKRIRRTTYTEYVISMHADTISRSSNTYIGKIRSNFLGT  208



>ref|XP_009800903.1| PREDICTED: tubby-like F-box protein 8 [Nicotiana sylvestris]
 ref|XP_009800904.1| PREDICTED: tubby-like F-box protein 8 [Nicotiana sylvestris]
Length=425

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPP  S +I  PG TSRRF  KKVSPKVPTGSY+IAQ+ YELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPCTSANIPPPGRTSRRF-SKKVSPKVPTGSYSIAQIKYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPRKM+C M+S
Sbjct  248  GTRGPRKMNCVMHS  261


 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISMNA+NISRSSNTY+GKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMNAENISRSSNTYVGKLRSNFLGT  196



>ref|XP_010232609.1| PREDICTED: tubby-like F-box protein 3 [Brachypodium distachyon]
Length=448

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF+IYDTQPPYN   +   G TSRRF   KVSPKVP GSYNIAQVTYELNVL
Sbjct  195  LRSNFLGTKFLIYDTQPPYNGAVVPPVGRTSRRFNSTKVSPKVPAGSYNIAQVTYELNVL  254

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M C M+S
Sbjct  255  GTRGPRRMRCIMHS  268


 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -3

Query  534  VENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             E GKFLLSAKRNR+T+ TEY ISM+  N SRS+ TYIGKLRS  LGT
Sbjct  155  AETGKFLLSAKRNRKTSCTEYAISMDTGNTSRSNRTYIGKLRSNFLGT  202



>ref|NP_177816.1| tubby-like F-box protein 1 [Arabidopsis thaliana]
 ref|NP_849894.1| tubby-like F-box protein 1 [Arabidopsis thaliana]
 sp|Q9ZP59.1|TLP1_ARATH RecName: Full=Tubby-like F-box protein 1; Short=AtTLP1 [Arabidopsis 
thaliana]
 gb|AAG51146.1|AC079283_3 Tub family protein, putative [Arabidopsis thaliana]
 gb|AAQ06240.1|AF487267_1 tubby-like protein TULP1 [Arabidopsis thaliana]
 gb|AAC00626.1| similar to 'tub' protein gp|U82468|2072162 [Arabidopsis thaliana]
 gb|AAM98079.1| At1g76900/F7O12_7 [Arabidopsis thaliana]
 gb|AAO23604.1| At1g76900/F7O12_7 [Arabidopsis thaliana]
 gb|AEE35900.1| tubby-like F-box protein 1 [Arabidopsis thaliana]
 gb|AEE35901.1| tubby-like F-box protein 1 [Arabidopsis thaliana]
Length=455

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 61/76 (80%), Gaps = 2/76 (3%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNS--THISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELN  51
             RSNFLGTKFIIYDTQP YNS       P   SRRFY K+VSPKVP+GSY IAQV+YELN
Sbjct  193  IRSNFLGTKFIIYDTQPAYNSNIARAVQPVGLSRRFYSKRVSPKVPSGSYKIAQVSYELN  252

Query  50   VLGTRGPRKMHCAMYS  3
            VLGTRGPR+MHCAM S
Sbjct  253  VLGTRGPRRMHCAMNS  268


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT+TEY+ISM+AD ISRSSNTYIGK+RS  LGT
Sbjct  149  PALLVENGKFLLSAKRIRRTTYTEYVISMHADTISRSSNTYIGKIRSNFLGT  200



>ref|XP_002887661.1| hypothetical protein ARALYDRAFT_476847 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63920.1| hypothetical protein ARALYDRAFT_476847 [Arabidopsis lyrata subsp. 
lyrata]
Length=457

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 61/76 (80%), Gaps = 2/76 (3%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNS--THISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELN  51
             RSNFLGTKF+IYDTQP YNS    +  P   SRRFY K+VSPKVP GSY IAQV+YELN
Sbjct  193  IRSNFLGTKFVIYDTQPAYNSNTARVVQPVGLSRRFYSKRVSPKVPGGSYKIAQVSYELN  252

Query  50   VLGTRGPRKMHCAMYS  3
            VLGTRGPR+MHCAM S
Sbjct  253  VLGTRGPRRMHCAMNS  268


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT+TEY+ISM+AD ISRSSNTYIGK+RS  LGT
Sbjct  149  PALLVENGKFLLSAKRIRRTTYTEYVISMHADTISRSSNTYIGKIRSNFLGT  200



>ref|XP_009604537.1| PREDICTED: tubby-like F-box protein 14 [Nicotiana tomentosiformis]
 ref|XP_009604538.1| PREDICTED: tubby-like F-box protein 14 [Nicotiana tomentosiformis]
Length=425

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF+IYDTQPP  S +I  PG TSRRF  KKVSPKVPTGSY+IAQ+ YELNVL
Sbjct  189  LRSNFLGTKFVIYDTQPPCTSANIPPPGRTSRRF-SKKVSPKVPTGSYSIAQIKYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPRKM+C M+S
Sbjct  248  GTRGPRKMNCVMHS  261


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISMNA++ISRSSNTY+GKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYVISMNAESISRSSNTYVGKLRSNFLGT  196



>ref|XP_009762099.1| PREDICTED: tubby-like F-box protein 8 isoform X1 [Nicotiana sylvestris]
Length=426

 Score =   115 bits (288),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 61/74 (82%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFI+YD QPPYNS+ I  PG  SRRF  KKVSPKVPTGSY IA VTYELNVL
Sbjct  189  LRSNFLGTKFIVYDMQPPYNSSSIPPPG-GSRRFNSKKVSPKVPTGSYKIAHVTYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M S
Sbjct  248  GTRGPRRMNCVMNS  261


 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKRNRRTT TEY+ISMNADNISRSS++YIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRNRRTTCTEYVISMNADNISRSSSSYIGKLRSNFLGT  196



>ref|XP_010479015.1| PREDICTED: tubby-like F-box protein 5 isoform X2 [Camelina sativa]
Length=302

 Score =   114 bits (285),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -1

Query  236  FLMCFRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYE  57
            ++   RSNFLGTKFIIYDT P  N   I  P   SRRF  KKVSPKVP+G+YN+AQVTYE
Sbjct  51   YIAKLRSNFLGTKFIIYDTAPANNGCQILSPPNRSRRFNSKKVSPKVPSGNYNVAQVTYE  110

Query  56   LNVLGTRGPRKMHCAMYS  3
            LN+LGTRGPRKMHC M+S
Sbjct  111  LNLLGTRGPRKMHCTMHS  128


 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVE+GKFLLSAKR RRTT TEY+ISM+ADNIS SS+TYI KLRS  LGT
Sbjct  11   PALLVESGKFLLSAKRTRRTTFTEYVISMDADNISSSSSTYIAKLRSNFLGT  62



>gb|EMT04337.1| hypothetical protein F775_32198 [Aegilops tauschii]
Length=440

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF++YDTQPPYN++ +S  G TSRRFY KK S KVP  +Y+IAQV+YELNVL
Sbjct  189  MRSNFLGTKFVMYDTQPPYNASSVSHSGTTSRRFYSKKGSTKVPCSTYSIAQVSYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M C M+S
Sbjct  249  GTRGPRRMRCVMHS  262


 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            +A+LVENGKFLLSAKR  R T TEYIISMNA++ISRS++TYIGK+RS  LGT
Sbjct  145  SAVLVENGKFLLSAKRICRATCTEYIISMNANSISRSTDTYIGKMRSNFLGT  196



>gb|KHN46417.1| Tubby-like F-box protein 8 [Glycine soja]
Length=466

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 64/74 (86%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPY++  +S PG  SRRF  KKVSPKVP+GSYNIA VTYELNVL
Sbjct  225  LRSNFLGTKFIIYDTQPPYHNAMLSPPG-RSRRF-SKKVSPKVPSGSYNIAHVTYELNVL  282

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C MYS
Sbjct  283  GTRGPRRMNCTMYS  296


 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEYIISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  181  PALLVENGKFLLSAKRTRRTTCTEYIISMDADNISRSSSTYIGKLRSNFLGT  232



>ref|XP_009762107.1| PREDICTED: tubby-like F-box protein 8 isoform X2 [Nicotiana sylvestris]
 ref|XP_009762115.1| PREDICTED: tubby-like F-box protein 8 isoform X3 [Nicotiana sylvestris]
Length=363

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 61/74 (82%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFI+YD QPPYNS+ I  PG  SRRF  KKVSPKVPTGSY IA VTYELNVL
Sbjct  126  LRSNFLGTKFIVYDMQPPYNSSSIPPPG-GSRRFNSKKVSPKVPTGSYKIAHVTYELNVL  184

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M S
Sbjct  185  GTRGPRRMNCVMNS  198


 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKRNRRTT TEY+ISMNADNISRSS++YIGKLRS  LGT
Sbjct  82   PALLVENGKFLLSAKRNRRTTCTEYVISMNADNISRSSSSYIGKLRSNFLGT  133



>gb|EMS66001.1| Tubby-like F-box protein 13 [Triticum urartu]
Length=440

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF++YDTQPPYN++ +S  G TSRRFY KK S KVP  +Y+IAQV+YELNVL
Sbjct  189  MRSNFLGTKFVMYDTQPPYNASSVSHSGTTSRRFYSKKGSTKVPCSTYSIAQVSYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M C M+S
Sbjct  249  GTRGPRRMRCVMHS  262


 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            +A+LVENGKFLLSAKR  R T TEYIISMNA++ISRS++TYIGK+RS  LGT
Sbjct  145  SAVLVENGKFLLSAKRICRATCTEYIISMNANSISRSTDTYIGKMRSNFLGT  196



>ref|XP_003556153.1| PREDICTED: tubby-like F-box protein 8-like isoform X1 [Glycine 
max]
 ref|XP_006606165.1| PREDICTED: tubby-like F-box protein 8-like isoform X2 [Glycine 
max]
Length=430

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 64/74 (86%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPY++  +S PG  SRRF  KKVSPKVP+GSYNIA VTYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPYHNAMLSPPG-RSRRFS-KKVSPKVPSGSYNIAHVTYELNVL  246

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C MYS
Sbjct  247  GTRGPRRMNCTMYS  260


 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEYIISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRTRRTTCTEYIISMDADNISRSSSTYIGKLRSNFLGT  196



>ref|XP_003568372.1| PREDICTED: tubby-like F-box protein 8 [Brachypodium distachyon]
Length=445

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFI+YDTQPP++   +   G +SRRF  KKVSPKVP+GSYNIAQVTYELNVL
Sbjct  195  LRSNFLGTKFIVYDTQPPHDGAVVPPVGRSSRRFNSKKVSPKVPSGSYNIAQVTYELNVL  254

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M S
Sbjct  255  GTRGPRRMNCIMQS  268


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            TA+LVENGKFLLSAKRNR+TT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  151  TAVLVENGKFLLSAKRNRKTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  202



>gb|ABV26700.1| putative transcription factor [Triticum aestivum]
Length=440

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF++YDTQPPYN++ +S  G TSRRFY KK S KVP  +Y+IAQV+YELNVL
Sbjct  189  MRSNFLGTKFVMYDTQPPYNASSVSHSGTTSRRFYSKKGSTKVPCSTYSIAQVSYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M C M+S
Sbjct  249  GTRGPRRMRCVMHS  262


 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            +A+LVENGKFLLSAKR  R T TEYIISMNA++ISRS++TYIGK+RS  LGT
Sbjct  145  SAVLVENGKFLLSAKRICRATCTEYIISMNANSISRSTDTYIGKMRSNFLGT  196



>ref|XP_010479014.1| PREDICTED: tubby-like F-box protein 5 isoform X1 [Camelina sativa]
Length=439

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -1

Query  236  FLMCFRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYE  57
            ++   RSNFLGTKFIIYDT P  N   I  P   SRRF  KKVSPKVP+G+YN+AQVTYE
Sbjct  188  YIAKLRSNFLGTKFIIYDTAPANNGCQILSPPNRSRRFNSKKVSPKVPSGNYNVAQVTYE  247

Query  56   LNVLGTRGPRKMHCAMYS  3
            LN+LGTRGPRKMHC M+S
Sbjct  248  LNLLGTRGPRKMHCTMHS  265


 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVE+GKFLLSAKR RRTT TEY+ISM+ADNIS SS+TYI KLRS  LGT
Sbjct  148  PALLVESGKFLLSAKRTRRTTFTEYVISMDADNISSSSSTYIAKLRSNFLGT  199



>ref|XP_006653064.1| PREDICTED: tubby-like F-box protein 7-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006653065.1| PREDICTED: tubby-like F-box protein 7-like isoform X2 [Oryza 
brachyantha]
Length=459

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  +     TSRRF  +KVSPKVPTG Y IAQV YELNVL
Sbjct  195  LRSNFLGTKFIIYDTQPPYNAGTLCSQERTSRRFSSRKVSPKVPTGCYPIAQVNYELNVL  254

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M CAM+S
Sbjct  255  GTRGPRRMQCAMHS  268


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            +A+L E GKFLLSAKR+RRTTHT+YIISM++ NISRSS+ YIGKLRS  LGT
Sbjct  151  SAVLDETGKFLLSAKRSRRTTHTDYIISMDSKNISRSSSGYIGKLRSNFLGT  202



>emb|CBH32570.1| tubby-like protein, putative, expressed [Triticum aestivum]
 emb|CDM85142.1| unnamed protein product [Triticum aestivum]
Length=450

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF+IYDTQPPYN   +   G +SRRF   +VSPKVP GSYNIAQVTYELNVL
Sbjct  195  LRSNFLGTKFLIYDTQPPYNGAVVPPVGRSSRRFNSTRVSPKVPAGSYNIAQVTYELNVL  254

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M C M+S
Sbjct  255  GTRGPRRMRCIMHS  268


 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -3

Query  534  VENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             E+GKFLLSAKRNR+T+ TEY ISM++ N SRS+ TYIGKLRS  LGT
Sbjct  155  AESGKFLLSAKRNRKTSCTEYAISMDSANTSRSNRTYIGKLRSNFLGT  202



>ref|NP_001066230.1| Os12g0163400 [Oryza sativa Japonica Group]
 sp|Q2QXB2.1|TLP14_ORYSJ RecName: Full=Tubby-like F-box protein 14; Short=OsTLP14; AltName: 
Full=Tubby-like F-box protein 4; Short=OsTLP4 [Oryza sativa 
Japonica Group]
 gb|ABA95864.1| Tubby protein, putative, expressed [Oryza sativa Japonica Group]
 gb|ABG21895.1| Tubby protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF29249.1| Os12g0163400 [Oryza sativa Japonica Group]
 gb|EAZ19745.1| hypothetical protein OsJ_35323 [Oryza sativa Japonica Group]
 gb|ACJ54907.1| TUBBY protein [Oryza sativa Japonica Group]
Length=445

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSN LGTKF+IYDTQPP N+ ++S  G TSRRFY +KVSPK P+ +Y+IAQV+YELNVL
Sbjct  195  LRSNLLGTKFVIYDTQPPCNTANVSQSGKTSRRFYSRKVSPKNPSSTYSIAQVSYELNVL  254

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M+S
Sbjct  255  GTRGPRRMNCVMHS  268


 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            +A+LVE+GKFLLSAKR  R T TEY I M+ADN SRSSN YIGKLRS  LGT
Sbjct  151  SAVLVESGKFLLSAKRYSRATCTEYTIFMSADNTSRSSNMYIGKLRSNLLGT  202



>gb|EAY82366.1| hypothetical protein OsI_37578 [Oryza sativa Indica Group]
Length=445

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSN LGTKF+IYDTQPP N+ ++S  G TSRRFY +KVSPK P+ +Y+IAQV+YELNVL
Sbjct  195  LRSNLLGTKFVIYDTQPPCNTANVSQSGKTSRRFYSRKVSPKNPSSTYSIAQVSYELNVL  254

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M+S
Sbjct  255  GTRGPRRMNCVMHS  268


 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            +A+LVE+GKFLLSAKR  R T TEY I M+ADN SRSSN YIGKLRS  LGT
Sbjct  151  SAVLVESGKFLLSAKRYSRATCTEYTIFMSADNTSRSSNMYIGKLRSNLLGT  202



>ref|XP_003580872.1| PREDICTED: tubby-like F-box protein 7 [Brachypodium distachyon]
Length=455

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  +      SRRF  +KVSPKVPTGSY IAQV YELNVL
Sbjct  195  LRSNFLGTKFIIYDTQPPYNAGKLCSQERASRRFSSRKVSPKVPTGSYPIAQVNYELNVL  254

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M C M+S
Sbjct  255  GTRGPRRMQCTMHS  268


 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            +A+L +NGKFLLSAKR+RRTT+T+Y ISM++ NISRSS+ YIGKLRS  LGT
Sbjct  151  SAVLDDNGKFLLSAKRSRRTTYTDYAISMDSKNISRSSSGYIGKLRSNFLGT  202



>gb|AAD39275.1|AC007203_7 Hypothetical protein [Arabidopsis thaliana]
Length=415

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             +SNFLGTKFI+YDT P YNS+ I  P   SR F  KKVSPKVP+GSYNIAQVTYELN+L
Sbjct  177  LKSNFLGTKFIVYDTAPAYNSSQILSPPNRSRSFNSKKVSPKVPSGSYNIAQVTYELNLL  236

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M+S
Sbjct  237  GTRGPRRMNCIMHS  250


 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             A+LVE+GKFLLSAKR+RR T+TEY+ISM+ADNISRSS+TYIGKL+S  LGT
Sbjct  133  PAILVESGKFLLSAKRSRRATYTEYVISMDADNISRSSSTYIGKLKSNFLGT  184



>gb|EAZ32494.1| hypothetical protein OsJ_16713 [Oryza sativa Japonica Group]
Length=419

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  +     TSRRF  +KVSPKVPTG Y I QV YELNVL
Sbjct  192  LRSNFLGTKFIIYDTQPPYNARTLCSQERTSRRFSSRKVSPKVPTGCYPIVQVNYELNVL  251

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M CAM+S
Sbjct  252  GTRGPRRMQCAMHS  265


 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            +A+L E GKFLLSAKR+RRTTHT+YIISM++ NISRSS+ YIGKLRS  LGT
Sbjct  148  SAVLDETGKFLLSAKRSRRTTHTDYIISMDSKNISRSSSGYIGKLRSNFLGT  199



>emb|CAB53492.1| CAA303719.1 protein [Oryza sativa]
 emb|CAJ86142.1| H0701F11.8 [Oryza sativa Indica Group]
 emb|CAJ86334.1| H0814G11.1 [Oryza sativa Indica Group]
Length=462

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  +     TSRRF  +KVSPKVPTG Y I QV YELNVL
Sbjct  192  LRSNFLGTKFIIYDTQPPYNARTLCSQERTSRRFSSRKVSPKVPTGCYPIVQVNYELNVL  251

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M CAM+S
Sbjct  252  GTRGPRRMQCAMHS  265


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            +A+L E GKFLLSAKR+RRTTHT+YIISM++ NISRSS+ YIGKLRS  LGT
Sbjct  148  SAVLDETGKFLLSAKRSRRTTHTDYIISMDSKNISRSSSGYIGKLRSNFLGT  199



>ref|NP_564485.1| tubby like protein 5 [Arabidopsis thaliana]
 sp|Q944S3.1|TLP5_ARATH RecName: Full=Tubby-like F-box protein 5; Short=AtTLP5 [Arabidopsis 
thaliana]
 gb|AAL11559.1|AF424565_1 At1g43640/T10P12_16 [Arabidopsis thaliana]
 gb|AAL59976.1| unknown protein [Arabidopsis thaliana]
 gb|AAM67505.1| unknown protein [Arabidopsis thaliana]
 gb|AAL03977.1| tubby-like protein 5 [Arabidopsis thaliana]
 gb|AEE31979.1| tubby like protein 5 [Arabidopsis thaliana]
Length=429

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             +SNFLGTKFI+YDT P YNS+ I  P   SR F  KKVSPKVP+GSYNIAQVTYELN+L
Sbjct  191  LKSNFLGTKFIVYDTAPAYNSSQILSPPNRSRSFNSKKVSPKVPSGSYNIAQVTYELNLL  250

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M+S
Sbjct  251  GTRGPRRMNCIMHS  264


 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             A+LVE+GKFLLSAKR+RR T+TEY+ISM+ADNISRSS+TYIGKL+S  LGT
Sbjct  147  PAILVESGKFLLSAKRSRRATYTEYVISMDADNISRSSSTYIGKLKSNFLGT  198



>ref|NP_001054335.1| Os04g0687900 [Oryza sativa Japonica Group]
 sp|Q7XSV4.1|TLP7_ORYSJ RecName: Full=Tubby-like F-box protein 7; Short=OsTLP7; AltName: 
Full=Tubby-like F-box protein 3; Short=OsTLP3 [Oryza sativa 
Japonica Group]
 emb|CAE01783.1| OSJNBa0039K24.2 [Oryza sativa Japonica Group]
 dbj|BAF16249.1| Os04g0687900 [Oryza sativa Japonica Group]
 dbj|BAG96605.1| unnamed protein product [Oryza sativa Japonica Group]
Length=462

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN+  +     TSRRF  +KVSPKVPTG Y I QV YELNVL
Sbjct  192  LRSNFLGTKFIIYDTQPPYNARTLCSQERTSRRFSSRKVSPKVPTGCYPIVQVNYELNVL  251

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M CAM+S
Sbjct  252  GTRGPRRMQCAMHS  265


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            +A+L E GKFLLSAKR+RRTTHT+YIISM++ NISRSS+ YIGKLRS  LGT
Sbjct  148  SAVLDETGKFLLSAKRSRRTTHTDYIISMDSKNISRSSSGYIGKLRSNFLGT  199



>ref|XP_006645077.1| PREDICTED: tubby-like F-box protein 3-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006645078.1| PREDICTED: tubby-like F-box protein 3-like isoform X2 [Oryza 
brachyantha]
Length=448

 Score =   112 bits (281),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 75/102 (74%), Gaps = 5/102 (5%)
 Frame = -1

Query  308  CLLWSINLLEGINHSLFSHRTL*PFLMCFRSNFLGTKFIIYDTQPPYNSTHISDPGCTSR  129
            C  ++I+++ G N S  S RT   ++   RSNFLGTKFIIYDTQPPYN   I   G TS+
Sbjct  172  CTEYTISMVSG-NISR-SSRT---YIGKLRSNFLGTKFIIYDTQPPYNGAVIPHVGRTSK  226

Query  128  RFYPKKVSPKVPTGSYNIAQVTYELNVLGTRGPRKMHCAMYS  3
            RF   KVSPKVP+ +YNIAQV+YELNVLGTRGPR+M C M+S
Sbjct  227  RFNSTKVSPKVPSVTYNIAQVSYELNVLGTRGPRRMRCIMHS  268


 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -3

Query  531  ENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            E GKF+LSAKR+R+TT TEY ISM + NISRSS TYIGKLRS  LGT
Sbjct  156  EGGKFVLSAKRHRKTTCTEYTISMVSGNISRSSRTYIGKLRSNFLGT  202



>gb|EYU35420.1| hypothetical protein MIMGU_mgv1a006260mg [Erythranthe guttata]
Length=450

 Score =   112 bits (281),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 64/78 (82%), Gaps = 4/78 (5%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDP----GCTSRRFYPKKVSPKVPTGSYNIAQVTYE  57
             RSNFLGTKFIIYDTQPP+ S   + P    G  SRRFY KKVSPKVP+G+Y+IA ++YE
Sbjct  190  LRSNFLGTKFIIYDTQPPHTSCSHNPPQGGRGPPSRRFYSKKVSPKVPSGNYSIAHISYE  249

Query  56   LNVLGTRGPRKMHCAMYS  3
            LNVLGTRGPR+MHCAM+S
Sbjct  250  LNVLGTRGPRRMHCAMHS  267


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  146  PALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  197



>gb|EMT26423.1| hypothetical protein F775_17552 [Aegilops tauschii]
Length=421

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF+IYDTQPPYN   +   G +SRRF   +VSPKVP  SYNIAQVTYELNVL
Sbjct  195  LRSNFLGTKFLIYDTQPPYNGAVVPPVGRSSRRFNSTRVSPKVPAVSYNIAQVTYELNVL  254

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M C M+S
Sbjct  255  GTRGPRRMRCIMHS  268


 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -3

Query  534  VENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             E GKFLLSAKRNR+T+ TEY ISM++ N SRS+ TYIGKLRS  LGT
Sbjct  155  AETGKFLLSAKRNRKTSCTEYAISMDSANTSRSNRTYIGKLRSNFLGT  202



>ref|XP_004970704.1| PREDICTED: tubby-like F-box protein 3-like [Setaria italica]
Length=480

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF+IYDTQPPYN   +   G TSRRF   KVSPK+P+ SYNIAQV+YELNVL
Sbjct  197  IRSNFLGTKFLIYDTQPPYNGAVVPPVGRTSRRFNSTKVSPKLPSVSYNIAQVSYELNVL  256

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M C+M+S
Sbjct  257  GTRGPRRMRCSMHS  270


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -3

Query  531  ENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            E+GKFLLSA+R+R+TT TEY ISM++ N SRSS TYIGK+RS  LGT
Sbjct  158  ESGKFLLSARRHRKTTCTEYTISMDSGNTSRSSRTYIGKIRSNFLGT  204



>dbj|BAK00725.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF+IYDTQPPYN   +   G +SRRF   KVSPKVP  SYNIAQVTYELNVL
Sbjct  195  LRSNFLGTKFLIYDTQPPYNGAVVPPVGRSSRRFNSTKVSPKVPAVSYNIAQVTYELNVL  254

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M C M+S
Sbjct  255  GTRGPRRMRCIMHS  268


 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -3

Query  534  VENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             E GKFLLSAKRNR+T+ TEY ISM++ N SRS+ TYIGKLRS  LGT
Sbjct  155  AETGKFLLSAKRNRKTSCTEYAISMDSANTSRSNRTYIGKLRSNFLGT  202



>ref|XP_006663846.1| PREDICTED: tubby-like F-box protein 14-like [Oryza brachyantha]
Length=442

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSN LGTKF+IYDTQPP N+ ++S  G TSRRFY +KVS K  + +YNIAQVTYELNVL
Sbjct  192  LRSNILGTKFVIYDTQPPCNTANVSQSGKTSRRFYSRKVSLKSSSNTYNIAQVTYELNVL  251

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M+S
Sbjct  252  GTRGPRRMNCVMHS  265


 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            +A+LVE+GKFLLSAKR    T TEY I MNADN SRSSN YIGKLRS  LGT
Sbjct  148  SAVLVESGKFLLSAKRYSHATCTEYTIFMNADNTSRSSNMYIGKLRSNILGT  199



>ref|NP_001044910.1| Os01g0866800 [Oryza sativa Japonica Group]
 sp|Q8LJA9.1|TLP3_ORYSJ RecName: Full=Tubby-like F-box protein 3; Short=OsTLP3; AltName: 
Full=Tubby-like F-box protein 5; Short=OsTLP5 [Oryza sativa 
Japonica Group]
 dbj|BAC01219.1| putative tubby-like protein TULP10 [Oryza sativa Japonica Group]
 dbj|BAF06824.1| Os01g0866800 [Oryza sativa Japonica Group]
 gb|EAY76613.1| hypothetical protein OsI_04563 [Oryza sativa Indica Group]
 gb|EAZ14277.1| hypothetical protein OsJ_04202 [Oryza sativa Japonica Group]
Length=448

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPPYN   +   G TS+RF   KVSPKVP+ +YNIAQV+YELNVL
Sbjct  195  LRSNFLGTKFIIYDTQPPYNGAVVPHVGRTSKRFNSTKVSPKVPSVTYNIAQVSYELNVL  254

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M C M+S
Sbjct  255  GTRGPRRMRCMMHS  268


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -3

Query  531  ENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            E GKF+L+AKR+R+TT TEY ISM + NISRSS T IGKLRS  LGT
Sbjct  156  EGGKFVLAAKRHRKTTCTEYTISMVSGNISRSSRTNIGKLRSNFLGT  202



>ref|XP_003578872.1| PREDICTED: tubby-like F-box protein 14 [Brachypodium distachyon]
Length=439

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSN LGTKF+IYDTQPP N   +S PG TSRRFY +KVS K P+ +Y+IAQV+YELNVL
Sbjct  189  LRSNLLGTKFVIYDTQPPCNIPSVSQPGKTSRRFYSRKVSLKAPSSTYSIAQVSYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M+S
Sbjct  249  GTRGPRRMNCVMHS  262


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            +A+LVE+GKFLL AKR  R T TEY I MNADN SRSSN YIGKLRS  LGT
Sbjct  145  SAVLVESGKFLLLAKRYSRPTCTEYTIFMNADNTSRSSNMYIGKLRSNLLGT  196



>ref|XP_010500111.1| PREDICTED: tubby-like F-box protein 5 [Camelina sativa]
Length=302

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFI YDT P  N   I  P   SRRF   KVSPKVP+G+YNIAQVTYELN+L
Sbjct  55   LRSNFLGTKFITYDTAPANNGCQILSPPNQSRRFNSNKVSPKVPSGNYNIAQVTYELNLL  114

Query  44   GTRGPRKMHCAMYS  3
            GTRGPRKMHC M+S
Sbjct  115  GTRGPRKMHCTMHS  128


 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVE+GKFLLSAKR RRTT+TEY+ISM+ADNIS SS+TYIGKLRS  LGT
Sbjct  11   PALLVESGKFLLSAKRTRRTTYTEYVISMDADNISSSSSTYIGKLRSNFLGT  62



>tpg|DAA56673.1| TPA: hypothetical protein ZEAMMB73_492533 [Zea mays]
Length=381

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  RSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVLG  42
            RSNFLGT+F+IYDTQPPYN   +   G TSRRF   KVSPK+P+ SYNIAQV+YELNVLG
Sbjct  99   RSNFLGTRFLIYDTQPPYNGAVVPPAGRTSRRFNSTKVSPKLPSVSYNIAQVSYELNVLG  158

Query  41   TRGPRKMHCAMYS  3
            TRGPR+M C M+S
Sbjct  159  TRGPRRMRCIMHS  171


 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -3

Query  531  ENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            E+GKFLLSAKR+R+TT TEY ISM++ NISRS  TYIGK+RS  LGT
Sbjct  59   ESGKFLLSAKRHRKTTCTEYTISMDSGNISRSKRTYIGKIRSNFLGT  105



>ref|XP_006662761.1| PREDICTED: tubby-like F-box protein 13-like [Oryza brachyantha]
Length=441

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF+IYDT PPYN+T +S PG TSRRFY  K + K+P  +YNIA ++YELNV 
Sbjct  189  LRSNFLGTKFVIYDTHPPYNATSVSQPGKTSRRFYSNKGTAKLPCSTYNIANISYELNVF  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M C M+S
Sbjct  249  GTRGPRRMRCLMHS  262


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            +A+LV+NGKFLLSAKRN R T TEY+ISMNA+NISRS+NTYIGKLRS  LGT
Sbjct  145  SAVLVDNGKFLLSAKRNCRATCTEYVISMNANNISRSTNTYIGKLRSNFLGT  196



>ref|XP_006307514.1| hypothetical protein CARUB_v10009138mg [Capsella rubella]
 gb|EOA40412.1| hypothetical protein CARUB_v10009138mg [Capsella rubella]
Length=444

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDT P YNS  I  P   S RF  KKVSP VP+GSYNIAQVTYELN L
Sbjct  197  MRSNFLGTKFIIYDTVPAYNSCQILSPPNRSCRFISKKVSPNVPSGSYNIAQVTYELNFL  256

Query  44   GTRGPRKMHCAMYS  3
            G RGPRKMHC M+S
Sbjct  257  GPRGPRKMHCIMHS  270


 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -3

Query  534  VENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            VENGKFLLSAKR RRTT+TEY+ISM+ADN SRSS+TYIGK+RS  LGT
Sbjct  157  VENGKFLLSAKRTRRTTYTEYVISMDADNNSRSSSTYIGKMRSNFLGT  204



>ref|NP_001130799.1| uncharacterized protein LOC100191903 [Zea mays]
 ref|XP_008672051.1| PREDICTED: uncharacterized protein LOC100191903 isoform X1 [Zea 
mays]
 ref|XP_008672052.1| PREDICTED: uncharacterized protein LOC100191903 isoform X1 [Zea 
mays]
 gb|ACF79155.1| unknown [Zea mays]
 gb|ACF79387.1| unknown [Zea mays]
 gb|ACN26553.1| unknown [Zea mays]
 gb|ACN34157.1| unknown [Zea mays]
 gb|AFT82627.1| TUB2 TUB type transcription factor, partial [Zea mays subsp. 
mays]
 tpg|DAA56670.1| TPA: tubby-like protein isoform 1 [Zea mays]
 tpg|DAA56671.1| TPA: tubby-like protein isoform 2 [Zea mays]
 tpg|DAA56672.1| TPA: tubby-like protein isoform 3 [Zea mays]
Length=480

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGT+F+IYDTQPPYN   +   G TSRRF   KVSPK+P+ SYNIAQV+YELNVL
Sbjct  197  IRSNFLGTRFLIYDTQPPYNGAVVPPAGRTSRRFNSTKVSPKLPSVSYNIAQVSYELNVL  256

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M C M+S
Sbjct  257  GTRGPRRMRCIMHS  270


 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -3

Query  531  ENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            E+GKFLLSAKR+R+TT TEY ISM++ NISRS  TYIGK+RS  LGT
Sbjct  158  ESGKFLLSAKRHRKTTCTEYTISMDSGNISRSKRTYIGKIRSNFLGT  204



>gb|EMS52647.1| Tubby-like F-box protein 3 [Triticum urartu]
Length=463

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF+IYDTQPPYN   +   G +SRRF   +VSPKVP  SYNIAQVTYELNVL
Sbjct  236  LRSNFLGTKFLIYDTQPPYNGAVVPPVGRSSRRFNSTRVSPKVPAVSYNIAQVTYELNVL  295

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M C M+S
Sbjct  296  GTRGPRRMRCIMHS  309


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -3

Query  534  VENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             E GKFLLSAKRNR+T+ TEY ISM++ N SRS+ TYIGKLRS  LGT
Sbjct  196  AETGKFLLSAKRNRKTSCTEYAISMDSANTSRSNRTYIGKLRSNFLGT  243



>emb|CBI20006.3| unnamed protein product [Vitis vinifera]
Length=310

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDTQPP+   HI  PG TS+RFY KKVSPKVPTGSYNIA +TYELNVL
Sbjct  189  LRSNFLGTKFIIYDTQPPHTCAHIPPPGRTSKRFYSKKVSPKVPTGSYNIAHITYELNVL  248

Query  44   GTRGPRKM  21
            GTR P  +
Sbjct  249  GTRQPELL  256


 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKRNRRTT TEY+ISM+A+NISRSS+TYIGKLRS  LGT
Sbjct  145  PALLVENGKFLLSAKRNRRTTCTEYVISMDAENISRSSSTYIGKLRSNFLGT  196



>ref|XP_008661891.1| PREDICTED: LOC100281492 isoform X1 [Zea mays]
 ref|XP_008661892.1| PREDICTED: LOC100281492 isoform X1 [Zea mays]
 ref|XP_008661893.1| PREDICTED: LOC100281492 isoform X1 [Zea mays]
 ref|XP_008661894.1| PREDICTED: LOC100281492 isoform X1 [Zea mays]
 gb|ACR36164.1| unknown [Zea mays]
 gb|AFW56160.1| tubby-like protein isoform 1 [Zea mays]
 gb|AFW56161.1| tubby-like protein isoform 2 [Zea mays]
 gb|AIB05490.1| TUB transcription factor, partial [Zea mays]
Length=436

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 62/74 (84%), Gaps = 3/74 (4%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSN LGTKF IYDTQPP N+   ++PG TSRRFY +KVSPKV + +YNIAQV+YELNVL
Sbjct  189  LRSNLLGTKFAIYDTQPPCNA---AEPGKTSRRFYSRKVSPKVSSSTYNIAQVSYELNVL  245

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M+S
Sbjct  246  GTRGPRRMNCVMHS  259


 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            TA+LVE+GKFLL AKR  R T TEY I MN++N+SRSS  YIGKLRS  LGT
Sbjct  145  TAVLVESGKFLLCAKRTSRPTCTEYTIFMNSENLSRSSKMYIGKLRSNLLGT  196



>ref|NP_001147882.1| LOC100281492 [Zea mays]
 gb|ACG29002.1| tubby-like protein [Zea mays]
Length=437

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 62/74 (84%), Gaps = 3/74 (4%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSN LGTKF IYDTQPP N+   ++PG TSRRFY +KVSPKV + +YNIAQV+YELNVL
Sbjct  189  LRSNLLGTKFAIYDTQPPCNA---AEPGKTSRRFYSRKVSPKVSSSTYNIAQVSYELNVL  245

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M+S
Sbjct  246  GTRGPRRMNCVMHS  259


 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            TA+LVE+GKFLL AKR  R T TEY I MN++N+SRSS  YIGKLRS  LGT
Sbjct  145  TAVLVESGKFLLCAKRTSRPTCTEYTIFMNSENLSRSSKMYIGKLRSNLLGT  196



>ref|XP_002456692.1| hypothetical protein SORBIDRAFT_03g040940 [Sorghum bicolor]
 gb|EES01812.1| hypothetical protein SORBIDRAFT_03g040940 [Sorghum bicolor]
Length=480

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGT+F+IYDTQPPYN   +   G TSRRF   KVSPK+P+ SYNIAQV+YELNVL
Sbjct  197  IRSNFLGTRFLIYDTQPPYNGAVVPPSGRTSRRFNSTKVSPKLPSVSYNIAQVSYELNVL  256

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M C M+S
Sbjct  257  GTRGPRRMRCIMHS  270


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -3

Query  531  ENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            E+GKFLLSAKR+R+TT TEY ISM++ NISRSS TYIGK+RS  LGT
Sbjct  158  ESGKFLLSAKRHRKTTCTEYTISMDSGNISRSSRTYIGKIRSNFLGT  204



>gb|EMT21705.1| hypothetical protein F775_29357 [Aegilops tauschii]
Length=440

 Score =   110 bits (274),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 60/76 (79%), Gaps = 2/76 (3%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVP--TGSYNIAQVTYELN  51
             RSNFLGTKFIIYDTQPPYN++ +     TSRRF  +KVSPKVP  TGSY IAQV YELN
Sbjct  246  LRSNFLGTKFIIYDTQPPYNASKLCPQERTSRRFSSRKVSPKVPAATGSYPIAQVNYELN  305

Query  50   VLGTRGPRKMHCAMYS  3
            VLGTRGPR+M C M S
Sbjct  306  VLGTRGPRRMQCTMNS  321


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            +A+L +NGKFLLSAKR+RRTT+T+Y ISM+  NISRSS+ YIGKLRS  LGT
Sbjct  202  SAVLDDNGKFLLSAKRSRRTTYTDYAISMDPKNISRSSSGYIGKLRSNFLGT  253



>emb|CDY36119.1| BnaA08g19290D [Brassica napus]
Length=422

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 66/84 (79%), Gaps = 8/84 (10%)
 Frame = -1

Query  236  FLMCFRSNFLGTKFIIYDTQPPYN-----STHISDPGCTSR-RFYPKKVSPKVPTGSYNI  75
            +L   RSNFLGTKF++YDTQPP N     S  I+D   TSR RF+ K+VSPKVP+GSYNI
Sbjct  186  YLGKLRSNFLGTKFLVYDTQPPQNTPSSSSALITDQ--TSRSRFHSKRVSPKVPSGSYNI  243

Query  74   AQVTYELNVLGTRGPRKMHCAMYS  3
            AQ+TYELNVLGTRGPR+MHC M S
Sbjct  244  AQITYELNVLGTRGPRRMHCTMNS  267


 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEYIISM+ADNISRSSN+Y+GKLRS  LGT
Sbjct  146  PALLVENGKFLLSAKRTRRTTRTEYIISMDADNISRSSNSYLGKLRSNFLGT  197



>ref|XP_004977310.1| PREDICTED: tubby-like F-box protein 14-like isoform X1 [Setaria 
italica]
 ref|XP_004977311.1| PREDICTED: tubby-like F-box protein 14-like isoform X2 [Setaria 
italica]
Length=436

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 60/74 (81%), Gaps = 3/74 (4%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSN LGTKF IYDTQPP N+     PG TSRRFY +KVSPKV + +YNIAQV+YELNVL
Sbjct  189  LRSNLLGTKFAIYDTQPPCNAAQ---PGKTSRRFYSRKVSPKVSSSTYNIAQVSYELNVL  245

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M+S
Sbjct  246  GTRGPRRMNCVMHS  259


 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            TA+LVE+GKFLL AKR  R T TEY I MN++NISRSS  YIGKLRS  LGT
Sbjct  145  TAVLVESGKFLLCAKRTSRPTCTEYTIFMNSENISRSSKMYIGKLRSNLLGT  196



>ref|XP_009109870.1| PREDICTED: tubby-like F-box protein 10 [Brassica rapa]
 ref|XP_009109871.1| PREDICTED: tubby-like F-box protein 10 [Brassica rapa]
Length=439

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 66/84 (79%), Gaps = 8/84 (10%)
 Frame = -1

Query  236  FLMCFRSNFLGTKFIIYDTQPPYN-----STHISDPGCTSR-RFYPKKVSPKVPTGSYNI  75
            +L   RSNFLGTKF++YDTQPP N     S  I+D   TSR RF+ K+VSPKVP+GSYNI
Sbjct  186  YLGKLRSNFLGTKFLVYDTQPPQNTPSSSSALITDQ--TSRSRFHSKRVSPKVPSGSYNI  243

Query  74   AQVTYELNVLGTRGPRKMHCAMYS  3
            AQ+TYELNVLGTRGPR+MHC M S
Sbjct  244  AQITYELNVLGTRGPRRMHCTMNS  267


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEYIISM+ADNISRSSN+Y+GKLRS  LGT
Sbjct  146  PALLVENGKFLLSAKRTRRTTRTEYIISMDADNISRSSNSYLGKLRSNFLGT  197



>ref|XP_004959977.1| PREDICTED: tubby-like F-box protein 7-like [Setaria italica]
Length=438

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHI-SDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNV  48
             RSNFLGTKFIIYDTQPPYN+  + S     SRRF  +KVSPKVP GSY IAQV YELNV
Sbjct  187  LRSNFLGTKFIIYDTQPPYNAGRLCSQERAPSRRFSSRKVSPKVPIGSYPIAQVNYELNV  246

Query  47   LGTRGPRKMHCAMYS  3
            LGTRGPR+M C M S
Sbjct  247  LGTRGPRRMQCTMQS  261


 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            +A+L ENGKFLL+AKR+RRTTHT+Y ISM++ N SRSS  YIGKLRS  LGT
Sbjct  143  SAVLDENGKFLLAAKRSRRTTHTDYAISMDSKNFSRSSTGYIGKLRSNFLGT  194



>ref|NP_973909.1| tubby-like F-box protein 10 [Arabidopsis thaliana]
 ref|NP_001117353.1| tubby-like F-box protein 10 [Arabidopsis thaliana]
 gb|AAN72008.1| unknown protein [Arabidopsis thaliana]
 gb|AAP13398.1| At1g25280 [Arabidopsis thaliana]
 gb|AEE30600.1| tubby-like F-box protein 10 [Arabidopsis thaliana]
 gb|AEE30601.1| tubby-like F-box protein 10 [Arabidopsis thaliana]
Length=267

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 66/82 (80%), Gaps = 6/82 (7%)
 Frame = -1

Query  236  FLMCFRSNFLGTKFIIYDTQPPYN---STHISDPGCTSR-RFYPKKVSPKVPTGSYNIAQ  69
            +L   RSNFLGTKF++YDTQPP N   S  I+D   TSR RF+ ++VSPKVP+GSYNIAQ
Sbjct  13   YLGKLRSNFLGTKFLVYDTQPPPNTSSSALITDR--TSRSRFHSRRVSPKVPSGSYNIAQ  70

Query  68   VTYELNVLGTRGPRKMHCAMYS  3
            +TYELNVLGTRGPR+MHC M S
Sbjct  71   ITYELNVLGTRGPRRMHCIMNS  92



>ref|XP_002893958.1| hypothetical protein ARALYDRAFT_473770 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70217.1| hypothetical protein ARALYDRAFT_473770 [Arabidopsis lyrata subsp. 
lyrata]
Length=428

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFI+YDT P YNS+ I  P   S RF  +KVSPKVP+GSYNIAQVTYELNV 
Sbjct  186  LRSNFLGTKFIVYDTAPAYNSSQILSPPNRSPRFNSEKVSPKVPSGSYNIAQVTYELNVF  245

Query  44   GTRGPRKMHCAMYS  3
            GTR PR+M+C M+S
Sbjct  246  GTRRPRRMNCTMHS  259


 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  489  TTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            TT+TEY++SM+ADNISRSS+TYIGKLRS  LGT
Sbjct  161  TTYTEYVMSMDADNISRSSSTYIGKLRSNFLGT  193



>gb|EMS53157.1| Tubby-like F-box protein 7 [Triticum urartu]
Length=507

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 60/76 (79%), Gaps = 2/76 (3%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVP--TGSYNIAQVTYELN  51
             RSNFLGTKFIIYDTQPPYN++ +     TSRRF  +KVSPKVP  TGSY IAQV YELN
Sbjct  231  LRSNFLGTKFIIYDTQPPYNASKLCPQERTSRRFSSRKVSPKVPAATGSYPIAQVNYELN  290

Query  50   VLGTRGPRKMHCAMYS  3
            VLGTRGPR+M C M S
Sbjct  291  VLGTRGPRRMQCTMNS  306


 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            +A+L +NGKFLLSAKR+RRTT+T+Y ISM+  NISRSS+ YIGKLRS  LGT
Sbjct  187  SAVLDDNGKFLLSAKRSRRTTYTDYAISMDPKNISRSSSGYIGKLRSNFLGT  238



>ref|XP_004978763.1| PREDICTED: tubby-like F-box protein 13-like isoform X1 [Setaria 
italica]
 ref|XP_004978764.1| PREDICTED: tubby-like F-box protein 13-like isoform X2 [Setaria 
italica]
Length=442

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF+IYDTQPPYN+   +  G TS+RFY KK S KV    Y+IAQV+YELNVL
Sbjct  191  LRSNFLGTKFVIYDTQPPYNAASATQSGKTSQRFYSKKASTKVSRSRYSIAQVSYELNVL  250

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M+S
Sbjct  251  GTRGPRRMNCVMHS  264


 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 2/54 (4%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRS--SNTYIGKLRSVCLGT  391
            + +LVENGKFLLSAKRN R T TEYIISMN+ N+SRS  +NTYIGKLRS  LGT
Sbjct  145  STVLVENGKFLLSAKRNIRPTCTEYIISMNSGNVSRSTNTNTYIGKLRSNFLGT  198



>dbj|BAJ94970.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=477

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 59/76 (78%), Gaps = 2/76 (3%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVP--TGSYNIAQVTYELN  51
             RSNFLGTKFIIYDTQPPYN+  +     TSRRF  +KVSPKVP  TGSY IAQV YELN
Sbjct  195  LRSNFLGTKFIIYDTQPPYNAGKLCPQERTSRRFSSRKVSPKVPAATGSYPIAQVNYELN  254

Query  50   VLGTRGPRKMHCAMYS  3
            VLGTRGPR+M C M S
Sbjct  255  VLGTRGPRRMQCTMNS  270


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            +A+L +NGKFLLSAKR+RRTT+T+Y ISM+  NISRSS+ YIGKLRS  LGT
Sbjct  151  SAVLDDNGKFLLSAKRSRRTTYTDYAISMDPKNISRSSSGYIGKLRSNFLGT  202



>dbj|BAH19883.1| AT1G25280 [Arabidopsis thaliana]
Length=317

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 66/82 (80%), Gaps = 6/82 (7%)
 Frame = -1

Query  236  FLMCFRSNFLGTKFIIYDTQPPYN---STHISDPGCTSR-RFYPKKVSPKVPTGSYNIAQ  69
            +L   RSNFLGTKF++YDTQPP N   S  I+D   TSR RF+ ++VSPKVP+GSYNIAQ
Sbjct  63   YLGKLRSNFLGTKFLVYDTQPPPNTSSSALITDR--TSRSRFHSRRVSPKVPSGSYNIAQ  120

Query  68   VTYELNVLGTRGPRKMHCAMYS  3
            +TYELNVLGTRGPR+MHC M S
Sbjct  121  ITYELNVLGTRGPRRMHCIMNS  142


 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEYIISM+ADNISRSSN+Y+GKLRS  LGT
Sbjct  23   PALLVENGKFLLSAKRTRRTTRTEYIISMDADNISRSSNSYLGKLRSNFLGT  74



>gb|ACG43268.1| tubby-like protein [Zea mays]
Length=480

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGT+F+IYDTQ PYN   +   G TSRRF   KVSPK+P+ SYNIAQV+YELNVL
Sbjct  197  IRSNFLGTRFLIYDTQAPYNGAVVPPAGRTSRRFNSTKVSPKLPSVSYNIAQVSYELNVL  256

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M C M+S
Sbjct  257  GTRGPRRMRCIMHS  270


 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -3

Query  531  ENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            E+GKFLLSAKR+R+TT TEY ISM++ NISRS  TYIGK+RS  LGT
Sbjct  158  ESGKFLLSAKRHRKTTCTEYTISMDSGNISRSKRTYIGKIRSNFLGT  204



>gb|AAN46232.1| unknown protein, partial [Arabidopsis thaliana]
Length=415

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 66/82 (80%), Gaps = 6/82 (7%)
 Frame = -1

Query  236  FLMCFRSNFLGTKFIIYDTQPPYN---STHISDPGCTSR-RFYPKKVSPKVPTGSYNIAQ  69
            +L   RSNFLGTKF++YDTQPP N   S  I+D   TSR RF+ ++VSPKVP+GSYNIAQ
Sbjct  174  YLGKLRSNFLGTKFLVYDTQPPPNTSSSALITDR--TSRSRFHSRRVSPKVPSGSYNIAQ  231

Query  68   VTYELNVLGTRGPRKMHCAMYS  3
            +TYELNVLGTRGPR+MHC M S
Sbjct  232  ITYELNVLGTRGPRRMHCIMNS  253


 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEYIISM+ADNISRSSN+Y+GKLRS  LGT
Sbjct  134  PALLVENGKFLLSAKRTRRTTRTEYIISMDADNISRSSNSYLGKLRSNFLGT  185



>gb|AAN46223.1| unknown protein, partial [Arabidopsis thaliana]
 gb|AAN46224.1| unknown protein, partial [Arabidopsis thaliana]
 gb|AAN46225.1| unknown protein, partial [Arabidopsis thaliana]
 gb|AAN46226.1| unknown protein, partial [Arabidopsis thaliana]
 gb|AAN46227.1| unknown protein, partial [Arabidopsis thaliana]
 gb|AAN46228.1| unknown protein, partial [Arabidopsis thaliana]
 gb|AAN46229.1| unknown protein, partial [Arabidopsis thaliana]
 gb|AAN46230.1| unknown protein, partial [Arabidopsis thaliana]
 gb|AAN46231.1| unknown protein, partial [Arabidopsis thaliana]
Length=415

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 66/82 (80%), Gaps = 6/82 (7%)
 Frame = -1

Query  236  FLMCFRSNFLGTKFIIYDTQPPYN---STHISDPGCTSR-RFYPKKVSPKVPTGSYNIAQ  69
            +L   RSNFLGTKF++YDTQPP N   S  I+D   TSR RF+ ++VSPKVP+GSYNIAQ
Sbjct  174  YLGKLRSNFLGTKFLVYDTQPPPNTSSSALITDR--TSRSRFHSRRVSPKVPSGSYNIAQ  231

Query  68   VTYELNVLGTRGPRKMHCAMYS  3
            +TYELNVLGTRGPR+MHC M S
Sbjct  232  ITYELNVLGTRGPRRMHCIMNS  253


 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEYIISM+ADNISRSSN+Y+GKLRS  LGT
Sbjct  134  PALLVENGKFLLSAKRTRRTTRTEYIISMDADNISRSSNSYLGKLRSNFLGT  185



>dbj|BAJ88633.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=266

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSN LGTKF+IYDTQ P N  ++S  G TSRRFY +KVSPK  + +Y+IAQV+YELNVL
Sbjct  16   LRSNLLGTKFVIYDTQLPCNIPNVSQSGKTSRRFYSRKVSPKASSSTYSIAQVSYELNVL  75

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M S
Sbjct  76   GTRGPRRMNCVMNS  89



>gb|AAN46234.1| unknown protein, partial [Arabidopsis lyrata]
 gb|AAN46235.1| unknown protein, partial [Arabidopsis lyrata]
 gb|AAN46236.1| unknown protein, partial [Arabidopsis lyrata]
 gb|AAN46237.1| unknown protein, partial [Arabidopsis lyrata]
Length=413

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 66/82 (80%), Gaps = 6/82 (7%)
 Frame = -1

Query  236  FLMCFRSNFLGTKFIIYDTQPPYN---STHISDPGCTSR-RFYPKKVSPKVPTGSYNIAQ  69
            +L   RSNFLGTKF++YDTQPP N   S  I+D   TSR RF+ ++VSPKVP+GSYNIAQ
Sbjct  174  YLGKLRSNFLGTKFLVYDTQPPPNTSSSALITDR--TSRSRFHSRRVSPKVPSGSYNIAQ  231

Query  68   VTYELNVLGTRGPRKMHCAMYS  3
            +TYELNVLGTRGPR+MHC M S
Sbjct  232  ITYELNVLGTRGPRRMHCIMNS  253


 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEYIISM+ADNISRSSN+Y+GKLRS  LGT
Sbjct  134  PALLVENGKFLLSAKRTRRTTRTEYIISMDADNISRSSNSYLGKLRSNFLGT  185



>ref|NP_173899.1| tubby-like F-box protein 10 [Arabidopsis thaliana]
 sp|Q9FRH7.1|TLP10_ARATH RecName: Full=Tubby-like F-box protein 10; Short=AtTLP10; AltName: 
Full=SKP1-interacting partner 26 [Arabidopsis thaliana]
 gb|AAG28805.1|AC079374_8 unknown protein [Arabidopsis thaliana]
 gb|AAQ06244.1|AF487271_1 tubby-like protein TULP10 [Arabidopsis thaliana]
 gb|AEE30599.1| tubby-like F-box protein 10 [Arabidopsis thaliana]
Length=445

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 66/82 (80%), Gaps = 6/82 (7%)
 Frame = -1

Query  236  FLMCFRSNFLGTKFIIYDTQPPYN---STHISDPGCTSR-RFYPKKVSPKVPTGSYNIAQ  69
            +L   RSNFLGTKF++YDTQPP N   S  I+D   TSR RF+ ++VSPKVP+GSYNIAQ
Sbjct  191  YLGKLRSNFLGTKFLVYDTQPPPNTSSSALITDR--TSRSRFHSRRVSPKVPSGSYNIAQ  248

Query  68   VTYELNVLGTRGPRKMHCAMYS  3
            +TYELNVLGTRGPR+MHC M S
Sbjct  249  ITYELNVLGTRGPRRMHCIMNS  270


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEYIISM+ADNISRSSN+Y+GKLRS  LGT
Sbjct  151  PALLVENGKFLLSAKRTRRTTRTEYIISMDADNISRSSNSYLGKLRSNFLGT  202



>ref|XP_002893953.1| hypothetical protein ARALYDRAFT_891335 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70212.1| hypothetical protein ARALYDRAFT_891335 [Arabidopsis lyrata subsp. 
lyrata]
Length=363

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF+IYDT P +N   I      SRRF  KKVSPKVP+GSYNIAQVTYELN+L
Sbjct  181  MRSNFLGTKFVIYDTAPAHNGCQIMSSPSRSRRFSSKKVSPKVPSGSYNIAQVTYELNLL  240

Query  44   GTRGPRKMHCAMYS  3
            GTRGPRKMHC M+S
Sbjct  241  GTRGPRKMHCIMHS  254


 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -3

Query  534  VENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            VE+GKFLLSAKR RR T+ EY+ISM+ADNIS+SS++YIGK+RS  LGT
Sbjct  141  VESGKFLLSAKRTRRATYIEYVISMDADNISQSSSSYIGKMRSNFLGT  188



>ref|XP_006307530.1| hypothetical protein CARUB_v10009152mg [Capsella rubella]
 gb|EOA40428.1| hypothetical protein CARUB_v10009152mg [Capsella rubella]
Length=442

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 66/82 (80%), Gaps = 6/82 (7%)
 Frame = -1

Query  236  FLMCFRSNFLGTKFIIYDTQPPYN---STHISDPGCTSR-RFYPKKVSPKVPTGSYNIAQ  69
            +L   RSNFLGTKF++YDTQPP N   S  I+D   TSR RF+ ++VSPKVP+GSYNIAQ
Sbjct  191  YLGKLRSNFLGTKFLVYDTQPPPNTSSSALITDR--TSRSRFHSRRVSPKVPSGSYNIAQ  248

Query  68   VTYELNVLGTRGPRKMHCAMYS  3
            +TYELNVLGTRGPR+MHC M S
Sbjct  249  ITYELNVLGTRGPRRMHCIMNS  270


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEYIISM+ADNISRSSN+Y+GKLRS  LGT
Sbjct  151  PALLVENGKFLLSAKRTRRTTRTEYIISMDADNISRSSNSYLGKLRSNFLGT  202



>ref|XP_010460402.1| PREDICTED: tubby-like F-box protein 10 [Camelina sativa]
Length=448

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 66/82 (80%), Gaps = 6/82 (7%)
 Frame = -1

Query  236  FLMCFRSNFLGTKFIIYDTQPPYN---STHISDPGCTSR-RFYPKKVSPKVPTGSYNIAQ  69
            +L   RSNFLGTKF++YDTQPP N   S  I+D   TSR RF+ ++VSPKVP+GSYNIAQ
Sbjct  191  YLGKLRSNFLGTKFLVYDTQPPPNTSSSALITDR--TSRSRFHSRRVSPKVPSGSYNIAQ  248

Query  68   VTYELNVLGTRGPRKMHCAMYS  3
            +TYELNVLGTRGPR+MHC M S
Sbjct  249  ITYELNVLGTRGPRRMHCIMNS  270


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEYIISM+ADNISRSSN+Y+GKLRS  LGT
Sbjct  151  PALLVENGKFLLSAKRTRRTTRTEYIISMDADNISRSSNSYLGKLRSNFLGT  202



>ref|XP_010477951.1| PREDICTED: tubby-like F-box protein 10 [Camelina sativa]
Length=449

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 66/82 (80%), Gaps = 6/82 (7%)
 Frame = -1

Query  236  FLMCFRSNFLGTKFIIYDTQPPYN---STHISDPGCTSR-RFYPKKVSPKVPTGSYNIAQ  69
            +L   RSNFLGTKF++YDTQPP N   S  I+D   TSR RF+ ++VSPKVP+GSYNIAQ
Sbjct  191  YLGKLRSNFLGTKFLVYDTQPPPNTSSSALITDR--TSRSRFHSRRVSPKVPSGSYNIAQ  248

Query  68   VTYELNVLGTRGPRKMHCAMYS  3
            +TYELNVLGTRGPR+MHC M S
Sbjct  249  ITYELNVLGTRGPRRMHCIMNS  270


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEYIISM+ADNISRSSN+Y+GKLRS  LGT
Sbjct  151  PALLVENGKFLLSAKRTRRTTRTEYIISMDADNISRSSNSYLGKLRSNFLGT  202



>ref|XP_010499129.1| PREDICTED: tubby-like F-box protein 10 [Camelina sativa]
Length=446

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 66/82 (80%), Gaps = 6/82 (7%)
 Frame = -1

Query  236  FLMCFRSNFLGTKFIIYDTQPPYN---STHISDPGCTSR-RFYPKKVSPKVPTGSYNIAQ  69
            +L   RSNFLGTKF++YDTQPP N   S  I+D   TSR RF+ ++VSPKVP+GSYNIAQ
Sbjct  191  YLGKLRSNFLGTKFLVYDTQPPPNTSSSALITDR--TSRSRFHSRRVSPKVPSGSYNIAQ  248

Query  68   VTYELNVLGTRGPRKMHCAMYS  3
            +TYELNVLGTRGPR+MHC M S
Sbjct  249  ITYELNVLGTRGPRRMHCIMNS  270


 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEYIISM+ADNISRSSN+Y+GKLRS  LGT
Sbjct  151  PALLVENGKFLLSAKRTRRTTRTEYIISMDADNISRSSNSYLGKLRSNFLGT  202



>ref|XP_006415851.1| hypothetical protein EUTSA_v10007625mg [Eutrema salsugineum]
 dbj|BAJ33625.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ34204.1| hypothetical protein EUTSA_v10007625mg [Eutrema salsugineum]
Length=448

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 66/82 (80%), Gaps = 6/82 (7%)
 Frame = -1

Query  236  FLMCFRSNFLGTKFIIYDTQPPYN---STHISDPGCTSR-RFYPKKVSPKVPTGSYNIAQ  69
            +L   RSNFLGTKF++YDTQPP N   S  I+D   TSR RF+ ++VSPKVP+GSYNIAQ
Sbjct  191  YLGKLRSNFLGTKFLVYDTQPPPNTSSSALITDR--TSRSRFHSRRVSPKVPSGSYNIAQ  248

Query  68   VTYELNVLGTRGPRKMHCAMYS  3
            +TYELNVLGTRGPR+MHC M S
Sbjct  249  ITYELNVLGTRGPRRMHCIMNS  270


 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEYIISM+ADNISRSSN Y+GKLRS  LGT
Sbjct  151  PALLVENGKFLLSAKRTRRTTRTEYIISMDADNISRSSNAYLGKLRSNFLGT  202



>emb|CDY42119.1| BnaA09g28410D [Brassica napus]
Length=437

 Score =   107 bits (266),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 65/84 (77%), Gaps = 8/84 (10%)
 Frame = -1

Query  236  FLMCFRSNFLGTKFIIYDTQPPYN-----STHISDPGCTSR-RFYPKKVSPKVPTGSYNI  75
            +L   RSNFLGTKF++YDTQPP N     S  I+D   TSR RF+ K+VSPK+P+GSYNI
Sbjct  186  YLGKLRSNFLGTKFVVYDTQPPQNTPSSSSALITDQ--TSRSRFHSKRVSPKLPSGSYNI  243

Query  74   AQVTYELNVLGTRGPRKMHCAMYS  3
            A +TYELNVLGTRGPR+MHC M S
Sbjct  244  AHITYELNVLGTRGPRRMHCVMNS  267


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             AL+VENGKFLLSAKR RRTT TEYIISM+ADNISRSSN+Y+GKLRS  LGT
Sbjct  146  PALVVENGKFLLSAKRTRRTTKTEYIISMDADNISRSSNSYLGKLRSNFLGT  197



>ref|XP_009115300.1| PREDICTED: tubby-like F-box protein 10 [Brassica rapa]
Length=438

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 65/84 (77%), Gaps = 8/84 (10%)
 Frame = -1

Query  236  FLMCFRSNFLGTKFIIYDTQPPYN-----STHISDPGCTSRR-FYPKKVSPKVPTGSYNI  75
            +L   RSNFLGTKF++YDTQPP N     S  I+D   TSR  F+ K+VSPK+P+GSYNI
Sbjct  187  YLGKLRSNFLGTKFVVYDTQPPQNTPSSSSALITDQ--TSRSMFHSKRVSPKLPSGSYNI  244

Query  74   AQVTYELNVLGTRGPRKMHCAMYS  3
            AQ+TYELNVLGTRGPR+MHC M S
Sbjct  245  AQITYELNVLGTRGPRRMHCVMNS  268


 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             AL+VENGKFLLSAKR RRTT TEYIISM+ADNISRSSN+Y+GKLRS  LGT
Sbjct  147  PALVVENGKFLLSAKRTRRTTKTEYIISMDADNISRSSNSYLGKLRSNFLGT  198



>gb|AAN46233.1| unknown protein, partial [Arabidopsis thaliana]
Length=415

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 66/82 (80%), Gaps = 6/82 (7%)
 Frame = -1

Query  236  FLMCFRSNFLGTKFIIYDTQPPYN---STHISDPGCTSR-RFYPKKVSPKVPTGSYNIAQ  69
            +L   RSNFLGTKF++YDTQPP N   S  I+D   TSR RF+ ++VSPKVP+GS+NIAQ
Sbjct  174  YLGKLRSNFLGTKFLVYDTQPPPNTSSSALITDR--TSRSRFHSRRVSPKVPSGSFNIAQ  231

Query  68   VTYELNVLGTRGPRKMHCAMYS  3
            +TYELNVLGTRGPR+MHC M S
Sbjct  232  ITYELNVLGTRGPRRMHCIMNS  253


 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEYIISM+ADNISRSSN+Y+GKLRS  LGT
Sbjct  134  PALLVENGKFLLSAKRTRRTTRTEYIISMDADNISRSSNSYLGKLRSNFLGT  185



>emb|CDX84977.1| BnaC05g20780D [Brassica napus]
Length=420

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 65/84 (77%), Gaps = 8/84 (10%)
 Frame = -1

Query  236  FLMCFRSNFLGTKFIIYDTQPPYN-----STHISDPGCTSRR-FYPKKVSPKVPTGSYNI  75
            +L   RSNFLGTKF++YDTQPP N     S  I+D   TSR  F+ K+VSPK+P+GSYNI
Sbjct  187  YLGKLRSNFLGTKFLVYDTQPPQNTPSSSSALITDQ--TSRSMFHSKRVSPKLPSGSYNI  244

Query  74   AQVTYELNVLGTRGPRKMHCAMYS  3
            AQ+TYELNVLGTRGPR+MHC M S
Sbjct  245  AQITYELNVLGTRGPRRMHCVMNS  268


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -3

Query  540  LLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            L +ENGKFLLSAKR RRTT TEYIISM+ADNISRSSN+Y+GKLRS  LGT
Sbjct  149  LSLENGKFLLSAKRTRRTTRTEYIISMDADNISRSSNSYLGKLRSNFLGT  198



>ref|XP_003577813.1| PREDICTED: tubby-like F-box protein 13 [Brachypodium distachyon]
Length=445

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -1

Query  236  FLMCFRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYE  57
            +L   RSN +GTKFI+YDTQPPYNS+ +S+ G  S+RFY K  S KVP   Y+IAQV+Y+
Sbjct  185  YLGKMRSNVIGTKFIMYDTQPPYNSSTVSNSGKPSQRFYSKNGSTKVPCSLYSIAQVSYK  244

Query  56   LNVLGTRGPRKMHCAMYS  3
            LNVLGTRGPR+MHC M+S
Sbjct  245  LNVLGTRGPRRMHCVMHS  262


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            +A+LVENGKFLLSAKR  R T TEYIISMNA++IS SSNTY+GK+RS  +GT
Sbjct  145  SAVLVENGKFLLSAKRICRATWTEYIISMNANSISSSSNTYLGKMRSNVIGT  196



>gb|EMS62143.1| Tubby-like F-box protein 14 [Triticum urartu]
Length=439

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSN LGTKF+IYDTQ P N  ++S  G TSRRFY +KVSPK  + +Y+IAQV+YELNVL
Sbjct  189  LRSNLLGTKFVIYDTQHPCNIPNVSQSGKTSRRFYSRKVSPKASSSTYSIAQVSYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M S
Sbjct  249  GTRGPRRMNCVMNS  262


 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            +A++ ENGKFLL AKR+ R T TEY I MN DN SRSSN YIGKLRS  LGT
Sbjct  145  SAVVAENGKFLLLAKRHSRPTCTEYTIFMNTDNTSRSSNMYIGKLRSNLLGT  196



>tpg|DAA36762.1| TPA: hypothetical protein ZEAMMB73_526243 [Zea mays]
Length=279

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHI-SDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNV  48
             RSNFLGTKFIIYDTQ PYN   + +     SRR   +KVSP+VP+GSY +AQV YELNV
Sbjct  26   LRSNFLGTKFIIYDTQAPYNGGRVCTQERAPSRRLSSRKVSPRVPSGSYPVAQVNYELNV  85

Query  47   LGTRGPRKMHCAMYS  3
            LGTRGPR+M CAM+S
Sbjct  86   LGTRGPRRMQCAMHS  100



>emb|CDY51990.1| BnaC03g75660D [Brassica napus]
Length=423

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 65/83 (78%), Gaps = 7/83 (8%)
 Frame = -1

Query  236  FLMCFRSNFLGTKFIIYDTQPPY----NSTHISDPGCTSR-RFYPKKVSPKVPTGSYNIA  72
            +L   RSNFLGTKF++YDTQPP     +S  I+D   TSR RF+ K+VSPKVP+GSYN A
Sbjct  186  YLGKLRSNFLGTKFLVYDTQPPQTPSSSSALITDQ--TSRSRFHSKRVSPKVPSGSYNNA  243

Query  71   QVTYELNVLGTRGPRKMHCAMYS  3
            Q+TYELNVLGTRGPR+MHC M S
Sbjct  244  QITYELNVLGTRGPRRMHCTMNS  266


 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEYIISM+ADNISRSSN+Y+GKLRS  LGT
Sbjct  146  PALLVENGKFLLSAKRTRRTTRTEYIISMDADNISRSSNSYLGKLRSNFLGT  197



>ref|NP_001147678.1| LOC100281288 [Zea mays]
 gb|ACG28353.1| tubby-like protein [Zea mays]
Length=438

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHI-SDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNV  48
             RSNFLGTKFIIYDTQ PYN   + +     SRR   +KVSP+VP+GSY +AQV YELNV
Sbjct  187  LRSNFLGTKFIIYDTQAPYNGGRVCTQERAPSRRLSSRKVSPRVPSGSYPVAQVNYELNV  246

Query  47   LGTRGPRKMHCAMYS  3
            LGTRGPR+M CAM+S
Sbjct  247  LGTRGPRRMQCAMHS  261


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            + +L ENGKFLL+AKR+RR  HTEY I M++ N SRSS  YIGKLRS  LGT
Sbjct  143  SGVLDENGKFLLAAKRSRRMAHTEYAIFMDSRNFSRSSTGYIGKLRSNFLGT  194



>gb|EPS72900.1| hypothetical protein M569_01857 [Genlisea aurea]
Length=427

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 59/76 (78%), Gaps = 2/76 (3%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTS--RRFYPKKVSPKVPTGSYNIAQVTYELN  51
             RSNFLGTKFIIYDTQPP   T       ++  RR + KKVSPKVPTGSY+IA +TYELN
Sbjct  187  LRSNFLGTKFIIYDTQPPPAQTWSHHHHVSASSRRLHSKKVSPKVPTGSYSIAHITYELN  246

Query  50   VLGTRGPRKMHCAMYS  3
            VLGTRGPR+MHC M+S
Sbjct  247  VLGTRGPRRMHCIMHS  262


 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  143  PALLVENGKFLLSAKRTRRTTSTEYVISMDADNISRSSSTYIGKLRSNFLGT  194



>ref|XP_002447368.1| hypothetical protein SORBIDRAFT_06g033820 [Sorghum bicolor]
 gb|EES11696.1| hypothetical protein SORBIDRAFT_06g033820 [Sorghum bicolor]
Length=402

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHI-SDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNV  48
             RSNFLGTKFIIYDTQPPYN+  + +     SRR   +KVSP+VPTGSY IAQV Y+LNV
Sbjct  187  LRSNFLGTKFIIYDTQPPYNAGKLCAQERAPSRRLSSRKVSPRVPTGSYPIAQVNYKLNV  246

Query  47   LGTRGPRKMHCAMYS  3
            LGTRGPR+M  AM+S
Sbjct  247  LGTRGPRRMQSAMHS  261


 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            +A+L ENGKFLL+AKR+RR  HTEY I M + N SRSS  YIGKLRS  LGT
Sbjct  143  SAVLDENGKFLLAAKRSRRMAHTEYAIFMGSRNFSRSSTGYIGKLRSNFLGT  194



>ref|XP_009103059.1| PREDICTED: tubby-like F-box protein 10 [Brassica rapa]
Length=443

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 65/83 (78%), Gaps = 5/83 (6%)
 Frame = -1

Query  236  FLMCFRSNFLGTKFIIYDTQPPYNSTHISDPGC----TSR-RFYPKKVSPKVPTGSYNIA  72
            +L   RSNFLGTKF++YDTQPP +++  S        TSR RF+ ++VSPKVP+GSYNIA
Sbjct  188  YLGKLRSNFLGTKFLVYDTQPPPDTSSSSSSALITDRTSRSRFHSRRVSPKVPSGSYNIA  247

Query  71   QVTYELNVLGTRGPRKMHCAMYS  3
            Q+TYELNVLGTRGPR+MHC M S
Sbjct  248  QITYELNVLGTRGPRRMHCIMNS  270


 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             AL+VENGKFLLSAKR RRTT TEYIISM+A+NISRSSN+Y+GKLRS  LGT
Sbjct  148  PALIVENGKFLLSAKRTRRTTRTEYIISMDAENISRSSNSYLGKLRSNFLGT  199



>emb|CDY66464.1| BnaCnng51010D [Brassica napus]
Length=429

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 65/83 (78%), Gaps = 5/83 (6%)
 Frame = -1

Query  236  FLMCFRSNFLGTKFIIYDTQPPYNSTHISDPGC----TSR-RFYPKKVSPKVPTGSYNIA  72
            +L   RSNFLGTKF++YDTQPP +++  S        TSR RF+ ++VSPKVP+GSYNIA
Sbjct  188  YLGKLRSNFLGTKFLVYDTQPPPDTSSSSSSALITDRTSRSRFHSRRVSPKVPSGSYNIA  247

Query  71   QVTYELNVLGTRGPRKMHCAMYS  3
            Q+TYELNVLGTRGPR+MHC M S
Sbjct  248  QITYELNVLGTRGPRRMHCIMNS  270


 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             AL+VENGKFLLSAKR RRTT TEYIISM+A+NISRSSN+Y+GKLRS  LGT
Sbjct  148  PALIVENGKFLLSAKRTRRTTRTEYIISMDAENISRSSNSYLGKLRSNFLGT  199



>emb|CDY72036.1| BnaA07g36880D [Brassica napus]
Length=443

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 65/83 (78%), Gaps = 5/83 (6%)
 Frame = -1

Query  236  FLMCFRSNFLGTKFIIYDTQPPYNSTHISDPGC----TSR-RFYPKKVSPKVPTGSYNIA  72
            +L   RSNFLGTKF++YDTQPP +++  S        TSR RF+ ++VSPKVP+GSYNIA
Sbjct  188  YLGKLRSNFLGTKFLVYDTQPPPDTSSSSSSALITDRTSRSRFHSRRVSPKVPSGSYNIA  247

Query  71   QVTYELNVLGTRGPRKMHCAMYS  3
            Q+TYELNVLGTRGPR+MHC M S
Sbjct  248  QITYELNVLGTRGPRRMHCIMNS  270


 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             AL+VENGKFLLSAKR RRTT TEYIISM+A+NISRSSN+Y+GKLRS  LGT
Sbjct  148  PALIVENGKFLLSAKRTRRTTRTEYIISMDAENISRSSNSYLGKLRSNFLGT  199



>gb|AEW08551.1| hypothetical protein CL454Contig1_04, partial [Pinus lambertiana]
 gb|AEW08552.1| hypothetical protein CL454Contig1_04, partial [Pinus radiata]
 gb|AFB34521.1| hypothetical protein CL454Contig1_04, partial [Pinus mugo]
 gb|AFG63693.1| hypothetical protein CL454Contig1_04, partial [Pinus taeda]
 gb|AFG63694.1| hypothetical protein CL454Contig1_04, partial [Pinus taeda]
 gb|AFG63695.1| hypothetical protein CL454Contig1_04, partial [Pinus taeda]
 gb|AFG63696.1| hypothetical protein CL454Contig1_04, partial [Pinus taeda]
 gb|AFG63697.1| hypothetical protein CL454Contig1_04, partial [Pinus taeda]
 gb|AFG63698.1| hypothetical protein CL454Contig1_04, partial [Pinus taeda]
 gb|AFG63699.1| hypothetical protein CL454Contig1_04, partial [Pinus taeda]
 gb|AFG63700.1| hypothetical protein CL454Contig1_04, partial [Pinus taeda]
 gb|AFG63701.1| hypothetical protein CL454Contig1_04, partial [Pinus taeda]
 gb|AFG63702.1| hypothetical protein CL454Contig1_04, partial [Pinus taeda]
 gb|AFG63703.1| hypothetical protein CL454Contig1_04, partial [Pinus taeda]
 gb|AFG63704.1| hypothetical protein CL454Contig1_04, partial [Pinus taeda]
 gb|AFG63705.1| hypothetical protein CL454Contig1_04, partial [Pinus taeda]
 gb|AFG63706.1| hypothetical protein CL454Contig1_04, partial [Pinus taeda]
 gb|AFG63707.1| hypothetical protein CL454Contig1_04, partial [Pinus taeda]
Length=104

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = -1

Query  236  FLMCFRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYE  57
            ++   RSNFLGTKF IYD+QPP+ S  I+      RR   K+VSP+VP GSYNIA + YE
Sbjct  9    YVGKLRSNFLGTKFTIYDSQPPH-SGAIASTSRAGRRVGAKQVSPRVPAGSYNIAHIGYE  67

Query  56   LNVLGTRGPRKMHCAMYS  3
            LNVLGTRGPR+M C M+S
Sbjct  68   LNVLGTRGPRRMQCIMHS  85



>gb|ACG46316.1| tubby-like protein [Zea mays]
Length=448

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF+IYDT PPYN T  +  G TS+RFY KK S KV    Y+IAQ++YELNVL
Sbjct  191  LRSNFLGTKFVIYDTHPPYNGTSQTVAGKTSQRFYSKKGSTKVSCRWYSIAQISYELNVL  250

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M+S
Sbjct  251  GTRGPRRMNCVMHS  264


 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 49/59 (83%), Gaps = 3/59 (5%)
 Frame = -3

Query  558  FVTFT-ALLVENGKFLLSAKRNRRTTHTEYIISMNADNISR--SSNTYIGKLRSVCLGT  391
            +++F+ A+ VENGKFLLSAKRN R T+TEYIIS+N+ + SR  S+NTYIGKLRS  LGT
Sbjct  140  YLSFSSAVPVENGKFLLSAKRNCRATYTEYIISINSGDTSRCTSNNTYIGKLRSNFLGT  198



>ref|XP_008676606.1| PREDICTED: uncharacterized protein LOC100193930 isoform X1 [Zea 
mays]
 ref|XP_008676607.1| PREDICTED: uncharacterized protein LOC100193930 isoform X1 [Zea 
mays]
 ref|XP_008676608.1| PREDICTED: uncharacterized protein LOC100193930 isoform X1 [Zea 
mays]
 ref|XP_008676609.1| PREDICTED: uncharacterized protein LOC100193930 isoform X1 [Zea 
mays]
 gb|ACF78780.1| unknown [Zea mays]
 gb|ACL52746.1| unknown [Zea mays]
 gb|ACN29218.1| unknown [Zea mays]
 gb|ACR36751.1| unknown [Zea mays]
 gb|AFW65621.1| tubby-like protein isoform 1 [Zea mays]
 gb|AFW65622.1| tubby-like protein isoform 2 [Zea mays]
 gb|AFW65623.1| tubby-like protein isoform 3 [Zea mays]
 gb|AFW65624.1| tubby-like protein isoform 4 [Zea mays]
 gb|AIB05452.1| TUB transcription factor, partial [Zea mays]
Length=448

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF+IYDT PPYN T  +  G TS+RFY KK S KV    Y+IAQ++YELNVL
Sbjct  191  LRSNFLGTKFVIYDTHPPYNGTSQTVAGKTSQRFYSKKGSTKVSCRWYSIAQISYELNVL  250

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M+S
Sbjct  251  GTRGPRRMNCVMHS  264


 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 49/59 (83%), Gaps = 3/59 (5%)
 Frame = -3

Query  558  FVTFT-ALLVENGKFLLSAKRNRRTTHTEYIISMNADNISR--SSNTYIGKLRSVCLGT  391
            +++F+ A+ VENGKFLLSAKRN R T+TEYIIS+N+ + SR  S+NTYIGKLRS  LGT
Sbjct  140  YLSFSSAVPVENGKFLLSAKRNCRATYTEYIISINSGDTSRCTSNNTYIGKLRSNFLGT  198



>gb|ACG37338.1| tubby-like protein [Zea mays]
Length=448

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF+IYDT PPYN T  +  G TS+RFY KK S KV    Y+IAQ++YELNVL
Sbjct  191  LRSNFLGTKFVIYDTHPPYNGTSQTVAGKTSQRFYSKKGSTKVSCRWYSIAQISYELNVL  250

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M+S
Sbjct  251  GTRGPRRMNCVMHS  264


 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 49/59 (83%), Gaps = 3/59 (5%)
 Frame = -3

Query  558  FVTFT-ALLVENGKFLLSAKRNRRTTHTEYIISMNADNISR--SSNTYIGKLRSVCLGT  391
            +++F+ A+ VENGKFLLSAKRN R T+TEYIIS+N+ + SR  S+NTYIGKLRS  LGT
Sbjct  140  YLSFSSAVPVENGKFLLSAKRNCRATYTEYIISINSGDTSRCTSNNTYIGKLRSNFLGT  198



>ref|NP_001132473.1| uncharacterized protein LOC100193930 [Zea mays]
 gb|ACF81323.1| unknown [Zea mays]
Length=448

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF+IYDT PPYN T  +  G TS+RFY KK S KV    Y+IAQ++YELNVL
Sbjct  191  LRSNFLGTKFVIYDTHPPYNGTSQTVAGKTSQRFYSKKGSTKVSCRWYSIAQISYELNVL  250

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M+S
Sbjct  251  GTRGPRRMNCVMHS  264


 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 49/59 (83%), Gaps = 3/59 (5%)
 Frame = -3

Query  558  FVTFT-ALLVENGKFLLSAKRNRRTTHTEYIISMNADNISR--SSNTYIGKLRSVCLGT  391
            +++F+ A+ VENGKFLLSAKRN R T+TEYIIS+N+ + SR  S+NTYIGKLRS  LGT
Sbjct  140  YLSFSSAVPVENGKFLLSAKRNCRATYTEYIISINSGDTSRCTSNNTYIGKLRSNFLGT  198



>ref|XP_008667909.1| PREDICTED: LOC100281288 isoform X1 [Zea mays]
 tpg|DAA36760.1| TPA: tubby-like protein [Zea mays]
 gb|AIB05331.1| TUB transcription factor, partial [Zea mays]
Length=592

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHI-SDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNV  48
             RSNFLGTKFIIYDTQ PYN   + +     SRR   +KVSP+VP+GSY +AQV YELNV
Sbjct  339  LRSNFLGTKFIIYDTQAPYNGGRVCTQERAPSRRLSSRKVSPRVPSGSYPVAQVNYELNV  398

Query  47   LGTRGPRKMHCAMYS  3
            LGTRGPR+M CAM+S
Sbjct  399  LGTRGPRRMQCAMHS  413


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            + +L ENGKFLL+AKR+RR  HTEY I M++ N SRSS  YIGKLRS  LGT
Sbjct  295  SGVLDENGKFLLAAKRSRRMAHTEYAIFMDSRNFSRSSTGYIGKLRSNFLGT  346



>ref|XP_006878561.1| hypothetical protein AMTR_s00011p00238180 [Amborella trichopoda]
 gb|ERM94706.1| hypothetical protein AMTR_s00011p00238180 [Amborella trichopoda]
Length=326

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF IYD+QPP++S  +S+   +SRR + K+VSP+VP GSYNIA + YELNVL
Sbjct  102  LRSNFLGTKFTIYDSQPPHSSAVLSNRR-SSRRIHSKQVSPRVPAGSYNIATIAYELNVL  160

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M C M S
Sbjct  161  GTRGPRRMQCTMNS  174


 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLV+NGK LL+A++ RR T T++IIS++AD+ SR+SNTY+GKLRS  LGT
Sbjct  58   PALLVQNGKLLLAARKIRRATSTDFIISLDADDFSRASNTYVGKLRSNFLGT  109



>gb|EMT26507.1| hypothetical protein F775_27998 [Aegilops tauschii]
Length=439

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSN LGTKF+IYDTQ P N  ++S  G TS RFY +KVSPK  + +Y+IAQV+YELNVL
Sbjct  189  LRSNLLGTKFVIYDTQHPCNIPNVSQSGKTSCRFYSRKVSPKASSSTYSIAQVSYELNVL  248

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M S
Sbjct  249  GTRGPRRMNCVMNS  262


 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            +A++ ENGKFLL AKR+ R T TEY I MN DN SRSSN YIGKLRS  LGT
Sbjct  145  SAVVAENGKFLLLAKRHSRPTCTEYTIFMNTDNTSRSSNMYIGKLRSNLLGT  196



>ref|XP_010531933.1| PREDICTED: tubby-like F-box protein 10 [Tarenaya hassleriana]
 ref|XP_010531941.1| PREDICTED: tubby-like F-box protein 10 [Tarenaya hassleriana]
 ref|XP_010531950.1| PREDICTED: tubby-like F-box protein 10 [Tarenaya hassleriana]
 ref|XP_010531960.1| PREDICTED: tubby-like F-box protein 10 [Tarenaya hassleriana]
Length=436

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = -1

Query  236  FLMCFRSNFLGTKFIIYDTQPPYNSTHISDPGCTSR-RFYPKKVSPKVPTGSYNIAQVTY  60
            +L   RSNFLGTKF++YDTQPP  S+       TSR RF+ K+VSPK+P+GSY IAQ+TY
Sbjct  189  YLGKLRSNFLGTKFLVYDTQPPCISSRSLVTDQTSRSRFHSKRVSPKIPSGSYTIAQITY  248

Query  59   ELNVLGTRGPRKMHCAMYS  3
            ELNVLGTRGPR+M+C + S
Sbjct  249  ELNVLGTRGPRRMNCILNS  267


 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKR RRTT TEYIISM+A NISRSSN+Y+GKLRS  LGT
Sbjct  149  PALLVENGKFLLSAKRTRRTTRTEYIISMDAGNISRSSNSYLGKLRSNFLGT  200



>ref|XP_002964280.1| hypothetical protein SELMODRAFT_230435 [Selaginella moellendorffii]
 gb|EFJ34613.1| hypothetical protein SELMODRAFT_230435 [Selaginella moellendorffii]
Length=357

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF IYDTQPP+ S  I+      RR   K+VSPKVP GSYN+A ++YELNVL
Sbjct  142  LRSNFLGTKFAIYDTQPPH-SGAIASTNRAGRRVAAKQVSPKVPAGSYNVAHISYELNVL  200

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M C +++
Sbjct  201  GTRGPRRMQCTLHA  214


 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  558  FVTFTALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            F+  T  L ENGKFLL+A+++RR T T+YIIS++ +++SR S++ +GKLRS  LGT
Sbjct  94   FLGLTPTLTENGKFLLAARKSRRATSTDYIISIDPEDMSRGSSSCVGKLRSNFLGT  149



>ref|XP_006307685.1| hypothetical protein CARUB_v10009311mg [Capsella rubella]
 gb|EOA40583.1| hypothetical protein CARUB_v10009311mg [Capsella rubella]
Length=409

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 53/74 (72%), Gaps = 10/74 (14%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFIIYDT   YNS   S P          KVSPKVP+GSYNI QVTYELNV 
Sbjct  186  MRSNFLGTKFIIYDTALAYNSPRTSSP----------KVSPKVPSGSYNIGQVTYELNVF  235

Query  44   GTRGPRKMHCAMYS  3
            GTRGPRKMHC M+S
Sbjct  236  GTRGPRKMHCIMHS  249


 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALL E GKFLLSAKR RRT++TEY+ISM+A+NISRSS+TYIGK+RS  LGT
Sbjct  142  PALLGETGKFLLSAKRTRRTSYTEYVISMDANNISRSSSTYIGKMRSNFLGT  193



>dbj|BAA82866.1| tubby-like protein [Lemna paucicostata]
Length=428

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 57/75 (76%), Gaps = 2/75 (3%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHIS-DPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNV  48
             RSNFLGTKFI++DTQPP      +   G  SRRFY  KVSPKVP+G+Y IAQVTYELNV
Sbjct  197  LRSNFLGTKFIMFDTQPPTRHCRPAPSSGRVSRRFY-SKVSPKVPSGNYAIAQVTYELNV  255

Query  47   LGTRGPRKMHCAMYS  3
            LG RGPR+MHC M S
Sbjct  256  LGKRGPRRMHCTMNS  270


 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -3

Query  540  LLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            L  ENGKFLLS   +R           NAD+ISRSS+TYIGKLRS  LGT
Sbjct  155  LPAENGKFLLSQSASRALPARNTSSPWNADDISRSSSTYIGKLRSNFLGT  204



>ref|XP_009786613.1| PREDICTED: tubby-like F-box protein 5 [Nicotiana sylvestris]
 ref|XP_009786614.1| PREDICTED: tubby-like F-box protein 5 [Nicotiana sylvestris]
Length=412

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF IYD+QPP ++  I   G  SRRF+ K+VSP+VP  +Y +A ++YELNVL
Sbjct  189  LRSNFLGTKFSIYDSQPPSDAA-IQQRGRLSRRFHAKQVSPRVPACNYRVATISYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
             TRGPR+MHCAM+S
Sbjct  248  RTRGPRRMHCAMHS  261


 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  531  ENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            E  K LL+AK+ RR T T+++IS+ AD+ SR+SNTY GKLRS  LGT
Sbjct  150  ERDKLLLAAKKIRRATSTDFVISLVADDFSRASNTYAGKLRSNFLGT  196



>ref|XP_002989529.1| hypothetical protein SELMODRAFT_160180 [Selaginella moellendorffii]
 gb|EFJ09405.1| hypothetical protein SELMODRAFT_160180 [Selaginella moellendorffii]
Length=437

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF IYDTQPP+ S  I+      RR   K+VSPKVP GSYN+A ++YELNVL
Sbjct  203  LRSNFLGTKFAIYDTQPPH-SGAIASTNRAGRRVAAKQVSPKVPAGSYNVAHISYELNVL  261

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M C +++
Sbjct  262  GTRGPRRMQCTLHA  275


 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  558  FVTFTALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            F+  T  L ENGKFLL+A+++RR T T+YIIS++ +++SR S++ +GKLRS  LGT
Sbjct  155  FLGLTPTLTENGKFLLAARKSRRATSTDYIISIDPEDMSRGSSSCVGKLRSNFLGT  210



>ref|XP_004232417.1| PREDICTED: tubby-like F-box protein 5 [Solanum lycopersicum]
 ref|XP_010316378.1| PREDICTED: tubby-like F-box protein 5 [Solanum lycopersicum]
Length=411

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF I+D+QPP ++  I  PG  SRRF+ K+VSP+VP  +Y +A ++YELNVL
Sbjct  188  LRSNFLGTKFSIHDSQPPSDAA-IQQPGRLSRRFHAKQVSPRVPACNYRVATISYELNVL  246

Query  44   GTRGPRKMHCAMYS  3
             TRGPR+MH AM+S
Sbjct  247  RTRGPRRMHSAMHS  260


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -3

Query  531  ENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            E  K LLSAK+ RR T+T+++IS  AD+ SR+SN Y GKLRS  LGT
Sbjct  149  ERDKLLLSAKKIRRATNTDFVISFVADDFSRASNMYAGKLRSNFLGT  195



>gb|ABK24436.1| unknown [Picea sitchensis]
Length=418

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF IYD+QPP+ S  I+      RR   K+VSP+VP GSYNIA + YELNVL
Sbjct  195  LRSNFLGTKFTIYDSQPPH-SGAIASTSRAGRRVGAKQVSPRVPAGSYNIAHIGYELNVL  253

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M C M+S
Sbjct  254  GTRGPRRMQCIMHS  267


 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -3

Query  558  FVTFTALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            +++ T  L +NGKFLL+A++ RR T TEYIIS++A+++SR SNTY+GKLRS  LGT
Sbjct  147  YLSLTPTLSDNGKFLLAARKFRRATSTEYIISLDAEDMSRGSNTYVGKLRSNFLGT  202



>gb|EYU17436.1| hypothetical protein MIMGU_mgv1a007105mg [Erythranthe guttata]
Length=419

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 59/75 (79%), Gaps = 5/75 (7%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISD---PGCTSRRFYPKKVSPKVPTGSYNIAQVTYEL  54
             RSNFLGTKF+IYDT PP+N++  S    PG  +   + KKVS KVP+G+++IAQV+YEL
Sbjct  181  LRSNFLGTKFVIYDTHPPHNTSSSSTLPPPGVATS--HSKKVSSKVPSGTHSIAQVSYEL  238

Query  53   NVLGTRGPRKMHCAM  9
            NVLGTRGPRKMHC M
Sbjct  239  NVLGTRGPRKMHCVM  253


 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVE GKFLLSAKRNRRTTHTEYIISM++DNISRS+NTYIGKLRS  LGT
Sbjct  137  PALLVETGKFLLSAKRNRRTTHTEYIISMDSDNISRSNNTYIGKLRSNFLGT  188



>ref|XP_009610594.1| PREDICTED: tubby-like F-box protein 5 [Nicotiana tomentosiformis]
 ref|XP_009610595.1| PREDICTED: tubby-like F-box protein 5 [Nicotiana tomentosiformis]
 ref|XP_009610596.1| PREDICTED: tubby-like F-box protein 5 [Nicotiana tomentosiformis]
 ref|XP_009610597.1| PREDICTED: tubby-like F-box protein 5 [Nicotiana tomentosiformis]
 ref|XP_009610598.1| PREDICTED: tubby-like F-box protein 5 [Nicotiana tomentosiformis]
 ref|XP_009610599.1| PREDICTED: tubby-like F-box protein 5 [Nicotiana tomentosiformis]
Length=411

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFI+YD+QPP ++  I   G  SRRF  K+VSP VP  +Y++A + YELNVL
Sbjct  188  LRSNFLGTKFIVYDSQPPSDAA-IQHCGQLSRRFSVKQVSPTVPACNYSVATINYELNVL  246

Query  44   GTRGPRKMHCAMYS  3
             TRGPR+MHCAM+S
Sbjct  247  RTRGPRRMHCAMHS  260


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  531  ENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            E+ K LL+AKR RR T TE++IS+  D+ SR+S+TY+GKLRS  LGT
Sbjct  149  ESDKLLLAAKRTRRATSTEFVISLVGDDFSRASSTYVGKLRSNFLGT  195



>ref|XP_009603271.1| PREDICTED: tubby-like F-box protein 5 [Nicotiana tomentosiformis]
 ref|XP_009603272.1| PREDICTED: tubby-like F-box protein 5 [Nicotiana tomentosiformis]
Length=412

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF IYD+QPP ++  I   G  SRRF+ K+VSP+VP  +Y +A ++YELNVL
Sbjct  189  LRSNFLGTKFSIYDSQPPSDAA-IQRHGRLSRRFHAKQVSPRVPACNYKVATISYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
             TRGPR+MHC M+S
Sbjct  248  RTRGPRRMHCPMHS  261


 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  531  ENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            E  K LL+AK+ RR T T+++IS+ AD+ SR+SNTY GKLRS  LGT
Sbjct  150  ERDKLLLAAKKIRRATSTDFVISLVADDFSRASNTYAGKLRSNFLGT  196



>ref|XP_002449042.1| hypothetical protein SORBIDRAFT_05g003900 [Sorghum bicolor]
 gb|EES08030.1| hypothetical protein SORBIDRAFT_05g003900 [Sorghum bicolor]
Length=456

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKK-VSPKVPTGSYNIAQVTYELNV  48
             RSNFLGTKF+IYDTQPPYN+T  +  G T++RFY KK  S K     Y+I QV+YELNV
Sbjct  191  LRSNFLGTKFVIYDTQPPYNATSPTVAGKTNQRFYSKKGGSTKGSCSRYSIGQVSYELNV  250

Query  47   LGTRGPRKMHCAMYS  3
            LGTRGPR+M+C M+S
Sbjct  251  LGTRGPRRMNCVMHS  265


 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSS--NTYIGKLRSVCLGT  391
            +A+  E+GKFLLSAKRN R T+TEY IS+N+ +ISRS+  NTYIGKLRS  LGT
Sbjct  145  SAVPAEDGKFLLSAKRNCRPTYTEYTISINSGDISRSTSNNTYIGKLRSNFLGT  198



>emb|CDP02006.1| unnamed protein product [Coffea canephora]
Length=412

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF IYD+QPP  +  +   G +SRRF+ K+VSP+VP  +Y +A ++YELNVL
Sbjct  188  LRSNFLGTKFTIYDSQPPIVAP-VHQNGRSSRRFHAKQVSPRVPACNYGVAAISYELNVL  246

Query  44   GTRGPRKMHCAMYS  3
             TRGPR+MHC M+S
Sbjct  247  RTRGPRRMHCVMHS  260


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -3

Query  531  ENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            EN K LL+AK+ RR T T++IIS+ AD+ SR+SNTY+GKLRS  LGT
Sbjct  149  ENDKLLLAAKKIRRATSTDFIISLVADDFSRASNTYVGKLRSNFLGT  195



>emb|CBI17501.3| unnamed protein product [Vitis vinifera]
Length=342

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF IYD+QPPY+ T +     +SRRF+ K+VSP+VP  +Y++A ++YELNVL
Sbjct  189  LRSNFLGTKFTIYDSQPPYD-TAVQPNSRSSRRFHSKQVSPRVPACNYSVATISYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
             TRGPR+M C M+S
Sbjct  248  RTRGPRRMQCTMHS  261


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -3

Query  531  ENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            ++ K LL+A+R RR T T+++IS+ AD+ SR+SNTY+GKLRS  LGT
Sbjct  150  QSDKLLLAARRIRRPTSTDFVISLVADDFSRASNTYVGKLRSNFLGT  196



>ref|XP_004972405.1| PREDICTED: tubby-like F-box protein 12-like [Setaria italica]
Length=449

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF++YDTQPPYN+  +   G +SRR   ++VSPKVPT SY IAQV YELNVL
Sbjct  194  MRSNFLGTKFVVYDTQPPYNAGSLVSCGRSSRRISSRRVSPKVPTASYPIAQVNYELNVL  253

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M+C M+S
Sbjct  254  GTRGPRRMNCTMHS  267


 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             A+L ENGKFLL+AKRNRRTT+TEYIISM+  NISRSSN Y+GK+RS  LGT
Sbjct  150  PAVLSENGKFLLAAKRNRRTTYTEYIISMDPKNISRSSNGYVGKMRSNFLGT  201



>ref|XP_010926002.1| PREDICTED: tubby-like F-box protein 5 [Elaeis guineensis]
Length=422

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF IYD+QPP ++T +     +SRR + K+VSP+VP G+YN+A +TYELNV 
Sbjct  198  LRSNFLGTKFTIYDSQPPCDAT-VRLNSSSSRRIHSKQVSPRVPAGNYNVATITYELNVF  256

Query  44   GTRGPRKMHCAMYS  3
             TRGPR+MH  M+S
Sbjct  257  RTRGPRRMHVMMHS  270


 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  531  ENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            ENGK LLSA++ R  T TEY+IS+  D+ SR+S+TYIGKLRS  LGT
Sbjct  159  ENGKLLLSARKIRHATSTEYVISLVLDDYSRASSTYIGKLRSNFLGT  205



>ref|XP_006340635.1| PREDICTED: tubby-like F-box protein 5-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006340636.1| PREDICTED: tubby-like F-box protein 5-like isoform X2 [Solanum 
tuberosum]
Length=407

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF I+D QPP ++  I  PG  SRRF+ K+VSP+VP  +Y +A ++YELNVL
Sbjct  188  LRSNFLGTKFSIHDCQPPSDAA-IQQPGRLSRRFHAKQVSPRVPACNYRVATISYELNVL  246

Query  44   GTRGPRKMHCAMYS  3
              RGPR+MH AM+S
Sbjct  247  RARGPRRMHSAMHS  260


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -3

Query  531  ENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            E  K LLSAK+ RR T T+++IS  AD+ SR+SN Y GKLRS  LGT
Sbjct  149  ERDKLLLSAKKIRRATSTDFVISFVADDFSRASNMYAGKLRSNFLGT  195



>ref|XP_002265804.1| PREDICTED: tubby-like F-box protein 5 [Vitis vinifera]
Length=413

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF IYD+QPPY+ T +     +SRRF+ K+VSP+VP  +Y++A ++YELNVL
Sbjct  189  LRSNFLGTKFTIYDSQPPYD-TAVQPNSRSSRRFHSKQVSPRVPACNYSVATISYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
             TRGPR+M C M+S
Sbjct  248  RTRGPRRMQCTMHS  261


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -3

Query  531  ENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            ++ K LL+A+R RR T T+++IS+ AD+ SR+SNTY+GKLRS  LGT
Sbjct  150  QSDKLLLAARRIRRPTSTDFVISLVADDFSRASNTYVGKLRSNFLGT  196



>ref|XP_009803929.1| PREDICTED: tubby-like F-box protein 5 [Nicotiana sylvestris]
 ref|XP_009803935.1| PREDICTED: tubby-like F-box protein 5 [Nicotiana sylvestris]
Length=411

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF +YD+QPP ++  I   G  SRRF  K+VSP VP  +Y++A + YELNVL
Sbjct  188  LRSNFLGTKFTVYDSQPPSDAA-IQHRGRLSRRFNVKQVSPTVPACNYSVAAINYELNVL  246

Query  44   GTRGPRKMHCAMYS  3
             TRGPR+MHCAM+S
Sbjct  247  RTRGPRRMHCAMHS  260


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  531  ENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            E+ K LL+AKR RR T T+++IS+ AD+ SR+S+T +GKLRS  LGT
Sbjct  149  ESDKLLLAAKRTRRATSTDFVISLVADDFSRASSTCVGKLRSNFLGT  195



>gb|KJB23182.1| hypothetical protein B456_004G085800 [Gossypium raimondii]
Length=397

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF IYD+QPP     ++   C++R  Y K++SP+VPTG+Y IA ++YELNVL
Sbjct  179  LRSNFLGTKFEIYDSQPPNVGAKVTK-SCSTRLMYAKQISPRVPTGNYPIAHISYELNVL  237

Query  44   GTRGPRKMHCAM  9
            G+RGPR+M C M
Sbjct  238  GSRGPRRMQCIM  249


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -3

Query  531  ENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            E+GKFLL+A++ RR T T+YIIS+NAD++S+ SNTYIGKLRS  LGT
Sbjct  140  EDGKFLLAARKCRRPTCTDYIISLNADDVSKGSNTYIGKLRSNFLGT  186



>ref|XP_011099633.1| PREDICTED: tubby-like F-box protein 5 [Sesamum indicum]
Length=412

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 57/76 (75%), Gaps = 5/76 (7%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYN--STHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELN  51
             RSNFLGTKF IYD+QPP +  S HIS     SRRF  K+VSPK+P  +Y +A ++YELN
Sbjct  188  LRSNFLGTKFTIYDSQPPNDTCSQHISR---QSRRFNAKQVSPKLPAFNYTVATISYELN  244

Query  50   VLGTRGPRKMHCAMYS  3
            VL TRGPR+MHC M+S
Sbjct  245  VLRTRGPRRMHCVMHS  260


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -3

Query  531  ENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            EN K LL+AK+ RR T T+++IS+ AD+ SR+SNTY+GKLRS  LGT
Sbjct  149  ENDKLLLAAKKIRRATSTDFVISLVADDFSRASNTYVGKLRSNFLGT  195



>ref|XP_004237815.1| PREDICTED: tubby-like F-box protein 5 [Solanum lycopersicum]
 ref|XP_010320110.1| PREDICTED: tubby-like F-box protein 5 [Solanum lycopersicum]
Length=400

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF IYD+QPP ++  I   G  SRRF  K+VSP V   +Y+IA ++YELNVL
Sbjct  188  LRSNFLGTKFTIYDSQPPSDAA-IQHRGRLSRRFSAKQVSPTVSACNYSIATISYELNVL  246

Query  44   GTRGPRKMHCAMYS  3
             TRGPR+MHCAM+S
Sbjct  247  RTRGPRRMHCAMHS  260


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  522  KFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            K LL+AKR RR T T+++IS+ +D+ SR+S+TY+GKLRS  LGT
Sbjct  152  KLLLAAKRIRRATSTDFVISLVSDDFSRASSTYVGKLRSNFLGT  195



>ref|XP_007156059.1| hypothetical protein PHAVU_003G254900g [Phaseolus vulgaris]
 ref|XP_007156060.1| hypothetical protein PHAVU_003G254900g [Phaseolus vulgaris]
 gb|ESW28053.1| hypothetical protein PHAVU_003G254900g [Phaseolus vulgaris]
 gb|ESW28054.1| hypothetical protein PHAVU_003G254900g [Phaseolus vulgaris]
Length=413

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 56/75 (75%), Gaps = 3/75 (4%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTS-RRFYPKKVSPKVPTGSYNIAQVTYELNV  48
             RSNFLGTKF IYD+QPP ++     P C S RRF+ K+VSP+VP  SY ++ V+YELNV
Sbjct  189  LRSNFLGTKFTIYDSQPPRDAAI--QPNCQSNRRFHSKQVSPRVPACSYLVSTVSYELNV  246

Query  47   LGTRGPRKMHCAMYS  3
            L TRGPR+MHC M S
Sbjct  247  LCTRGPRRMHCVMNS  261


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  531  ENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGTYI------PPR  376
            +N K LL+AKR RR T T+++IS+  D+ SR+SN Y+GKLRS  LGT        PPR
Sbjct  150  DNNKLLLAAKRIRRATGTDFVISLATDDFSRASNKYVGKLRSNFLGTKFTIYDSQPPR  207



>emb|CBI18204.3| unnamed protein product [Vitis vinifera]
Length=284

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQV  66
             RSNFLGTKFIIYDTQPPYN + +S PG TSRRFY KKVSPKVPTGSYNIAQ+
Sbjct  125  LRSNFLGTKFIIYDTQPPYNGSQLSPPGRTSRRFYSKKVSPKVPTGSYNIAQL  177


 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             ALLVENGKFLLSAKRNRRTT TEY+ISM+ADNISRSS+TYIGKLRS  LGT
Sbjct  81   PALLVENGKFLLSAKRNRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGT  132



>ref|XP_007147863.1| hypothetical protein PHAVU_006G161100g [Phaseolus vulgaris]
 gb|ESW19857.1| hypothetical protein PHAVU_006G161100g [Phaseolus vulgaris]
Length=383

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF IYD+QPP++   I     T R    K+VSPKVPTG+Y +A ++YELNVL
Sbjct  166  LRSNFLGTKFTIYDSQPPHSGARIMKSRST-RLVNLKQVSPKVPTGNYPVAHISYELNVL  224

Query  44   GTRGPRKMHCAMYS  3
            G+RGPR+MHC M S
Sbjct  225  GSRGPRRMHCVMDS  238


 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -3

Query  558  FVTFTALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            F++    L E+GKFLL+A++ RR T T+YIIS++AD++S+ SN+Y+GKLRS  LGT
Sbjct  118  FLSLANTLAEDGKFLLAARKCRRPTCTDYIISLDADDMSKGSNSYVGKLRSNFLGT  173



>ref|XP_006363440.1| PREDICTED: tubby-like F-box protein 5-like [Solanum tuberosum]
Length=401

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF IYD+QPP +   I   G  SRRF  K+VSP V   +Y+IA V+YELNVL
Sbjct  189  LRSNFLGTKFTIYDSQPPSD-VAIQHRGRLSRRFSAKQVSPTVSACNYSIATVSYELNVL  247

Query  44   GTRGPRKMHCAMYS  3
             TRGPR+MHCAM+S
Sbjct  248  RTRGPRRMHCAMHS  261


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  522  KFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            K LL+AKR RR T T+++IS+ +D+ SR+S+TY+GKLRS  LGT
Sbjct  153  KLLLAAKRIRRATSTDFVISLVSDDFSRASSTYVGKLRSNFLGT  196



>gb|EPS60718.1| hypothetical protein M569_14084, partial [Genlisea aurea]
Length=279

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 57/72 (79%), Gaps = 3/72 (4%)
 Frame = -1

Query  218  SNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVLGT  39
            SNFLGT+F IYD+QPP+++  +      SRRF PK+VSPK+P+ +Y++A V+YELNVL T
Sbjct  82   SNFLGTRFTIYDSQPPHDAATVKH---VSRRFNPKQVSPKLPSCNYSVASVSYELNVLRT  138

Query  38   RGPRKMHCAMYS  3
            RGPR+M C M+S
Sbjct  139  RGPRRMRCVMHS  150


 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  531  ENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLR  409
            EN K LL+AKR RR T T++IIS+ AD+ SR+SNTY+GKLR
Sbjct  34   ENDKLLLAAKRIRRATSTDFIISLVADDFSRASNTYVGKLR  74



>ref|XP_009590675.1| PREDICTED: tubby-like F-box protein 5 [Nicotiana tomentosiformis]
Length=411

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = -1

Query  236  FLMCFRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYE  57
            +L   RSNFLGTKF IYD++PP +++ I +    SRRF  K+VSP VP  +Y+IA ++YE
Sbjct  184  YLGKLRSNFLGTKFTIYDSKPPTDAS-IQEHCRHSRRFRAKQVSPTVPACNYSIATISYE  242

Query  56   LNVLGTRGPRKMHCAMYS  3
            LNVL TRGPR+MHCAM+S
Sbjct  243  LNVLRTRGPRRMHCAMHS  260


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -3

Query  531  ENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            E+ K LL+A+R RR T T+++IS+ AD+ SR+SNTY+GKLRS  LGT
Sbjct  149  ESDKLLLAARRIRRATSTDFVISLVADDFSRASNTYLGKLRSNFLGT  195



>gb|EMT26643.1| hypothetical protein F775_07511 [Aegilops tauschii]
Length=458

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFI+YDTQPPYN+  +      SRR   ++VSPKVPTGSY IAQV YELNVL
Sbjct  196  MRSNFLGTKFIVYDTQPPYNAGSLVPCQRGSRRISSRRVSPKVPTGSYPIAQVNYELNVL  255

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M C M+S
Sbjct  256  GTRGPRRMQCTMHS  269


 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             A+L ENGKFLL+AKRNRRTT+TEY+IS+++ NISRSSN Y+GK+RS  LGT
Sbjct  152  PAVLSENGKFLLAAKRNRRTTYTEYVISVDSKNISRSSNGYVGKMRSNFLGT  203



>gb|EMS66196.1| Tubby-like F-box protein 12 [Triticum urartu]
Length=456

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKFI+YDTQPPYN+  +      SRR   ++VSPKVPTGSY IAQV YELNVL
Sbjct  196  MRSNFLGTKFIVYDTQPPYNAGSLIPCQRGSRRISSRRVSPKVPTGSYPIAQVNYELNVL  255

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M C M+S
Sbjct  256  GTRGPRRMQCTMHS  269


 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
             A+L ENGKFLL+AKRNRRTT+TEY+IS+++ NISRSSN Y+GK+RS  LGT
Sbjct  152  PAVLSENGKFLLAAKRNRRTTYTEYVISVDSKNISRSSNGYVGKMRSNFLGT  203



>ref|XP_009390170.1| PREDICTED: tubby-like F-box protein 5 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009390171.1| PREDICTED: tubby-like F-box protein 5 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009390172.1| PREDICTED: tubby-like F-box protein 5 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009390173.1| PREDICTED: tubby-like F-box protein 5 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009390175.1| PREDICTED: tubby-like F-box protein 5 [Musa acuminata subsp. 
malaccensis]
Length=412

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 67/98 (68%), Gaps = 2/98 (2%)
 Frame = -1

Query  296  SINLLEGINHSLFSHRTL*PFLMCFRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYP  117
            S N +  +N   FS R    ++   RSNFL TKF +YD++PPY +  +S    ++RR + 
Sbjct  165  STNFVISLNPEDFS-RASSTYIGKARSNFLATKFTVYDSEPPYEAA-VSSSNRSNRRIHS  222

Query  116  KKVSPKVPTGSYNIAQVTYELNVLGTRGPRKMHCAMYS  3
            ++VSP+VP G+YNIA ++YELN+L TRGPR+M C M+S
Sbjct  223  RQVSPRVPAGNYNIATISYELNILRTRGPRRMQCMMHS  260


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = -3

Query  564  C*FVTFTALLV-ENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            C ++  T  L  ++ K LL+A + RR T T ++IS+N ++ SR+S+TYIGK RS  L T
Sbjct  137  CLYLGLTPSLQGQSDKLLLAAHKIRRATSTNFVISLNPEDFSRASSTYIGKARSNFLAT  195



>ref|XP_002982271.1| hypothetical protein SELMODRAFT_116378 [Selaginella moellendorffii]
 gb|EFJ16516.1| hypothetical protein SELMODRAFT_116378 [Selaginella moellendorffii]
Length=432

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNF+GTKF +YD+ PP++   ++      RR   K+VSP+VP GSYNIA + YELNVL
Sbjct  201  LRSNFMGTKFTLYDSNPPHDGA-VASTNRAGRRILSKQVSPRVPAGSYNIAHIAYELNVL  259

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M C ++S
Sbjct  260  GTRGPRRMECTIHS  273


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -3

Query  531  ENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            +NGKFLL+A++ RR + T+YIIS + D+ SR SNTY+GKLRS  +GT
Sbjct  162  KNGKFLLAARKFRRASGTDYIISTDTDDFSRGSNTYVGKLRSNFMGT  208



>ref|XP_002966201.1| hypothetical protein SELMODRAFT_85745 [Selaginella moellendorffii]
 gb|EFJ32228.1| hypothetical protein SELMODRAFT_85745 [Selaginella moellendorffii]
Length=432

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNF+GTKF +YD+ PP++   ++      RR   K+VSP+VP GSYNIA + YELNVL
Sbjct  201  LRSNFMGTKFTLYDSNPPHDGA-VASTNRAGRRILSKQVSPRVPAGSYNIAHIAYELNVL  259

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M C ++S
Sbjct  260  GTRGPRRMECTIHS  273


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -3

Query  531  ENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            +NGKFLL+A++ RR + T+YIIS + D+ SR SNTY+GKLRS  +GT
Sbjct  162  KNGKFLLAARKFRRASGTDYIISTDTDDFSRGSNTYVGKLRSNFMGT  208



>gb|KJB41991.1| hypothetical protein B456_007G131500 [Gossypium raimondii]
Length=375

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF +YD QPP   T ++   C++R    K+VSP+VP G+Y +A ++YELNVL
Sbjct  188  LRSNFLGTKFTVYDAQPPNAGTKVTK-SCSTRLINMKQVSPRVPAGNYPVAHISYELNVL  246

Query  44   GTRGPRKMHCAM  9
            G+RGPR+MHC M
Sbjct  247  GSRGPRRMHCIM  258


 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -3

Query  531  ENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            ++GKFLL+A++ RR T T+YIIS+N +++S+ S+TYIGKLRS  LGT
Sbjct  149  DDGKFLLAARKCRRPTCTDYIISLNCNDVSKGSSTYIGKLRSNFLGT  195



>ref|XP_009380364.1| PREDICTED: tubby-like F-box protein 5 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380365.1| PREDICTED: tubby-like F-box protein 5 [Musa acuminata subsp. 
malaccensis]
Length=425

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = -1

Query  221  RSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVLG  42
            RSNFLGTKF +YD+QPP ++  +S    ++RR + K+VSP+VP G+YNIA + YELNVL 
Sbjct  202  RSNFLGTKFTVYDSQPPCDAA-VSSGSRSTRRIHSKQVSPRVPAGNYNIATIAYELNVLR  260

Query  41   TRGPRKMHCAMYS  3
            TRGPR++ C M+S
Sbjct  261  TRGPRRIQCTMHS  273


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -3

Query  531  ENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            +N K LL+A++ RR T T+++IS+ AD+ SR+S++Y+GK+RS  LGT
Sbjct  162  QNDKLLLAARKIRRATSTDFVISLTADDFSRASSSYVGKVRSNFLGT  208



>ref|NP_001065832.2| Os11g0163600 [Oryza sativa Japonica Group]
 gb|AAX95105.1| Tub family, putative [Oryza sativa Japonica Group]
 gb|ABA91674.1| Tubby protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAG91791.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF27677.2| Os11g0163600 [Oryza sativa Japonica Group]
Length=317

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = -1

Query  224  FRSNFLGTKFIIYDTQPPYNSTHISDPGCTSRRFYPKKVSPKVPTGSYNIAQVTYELNVL  45
             RSNFLGTKF+IYDT  PYN+T  S  G TSRRF   K + K P  +Y+IA ++YELNV 
Sbjct  66   LRSNFLGTKFVIYDTHTPYNATSDSQSGKTSRRF-SNKGTAKHPCSTYSIANISYELNVF  124

Query  44   GTRGPRKMHCAMYS  3
            GTRGPR+M C M+S
Sbjct  125  GTRGPRRMCCLMHS  138


 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  546  TALLVENGKFLLSAKRNRRTTHTEYIISMNADNISRSSNTYIGKLRSVCLGT  391
            +A+LV+NGKFLLSAKRN   T TEY+ISMNA+N+SRS+NT IGKLRS  LGT
Sbjct  22   SAVLVDNGKFLLSAKRNWHATCTEYVISMNANNLSRSTNTNIGKLRSNFLGT  73



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660