BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP010E09 658 bp,

Length=622
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP06201.1|  unnamed protein product                                332   2e-111   Coffea canephora [robusta coffee]
ref|XP_009588398.1|  PREDICTED: carbonyl reductase [NADPH] 2-like       317   2e-105   Nicotiana tomentosiformis
ref|XP_002517315.1|  2,4-dienoyl-CoA reductase, putative                311   2e-103   Ricinus communis
ref|XP_004294537.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    308   8e-102   Fragaria vesca subsp. vesca
gb|KDP23890.1|  hypothetical protein JCGZ_26632                         308   1e-101   Jatropha curcas
ref|XP_006482063.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    306   2e-101   Citrus sinensis [Valencia orange]
ref|XP_011075453.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    308   3e-101   Sesamum indicum [beniseed]
ref|XP_010055797.1|  PREDICTED: carbonyl reductase [NADPH] 2-like       306   3e-101   Eucalyptus grandis [rose gum]
gb|KDO53625.1|  hypothetical protein CISIN_1g023885mg                   305   5e-101   Citrus sinensis [Valencia orange]
ref|XP_003518977.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    305   1e-100   Glycine max [soybeans]
gb|EYU20812.1|  hypothetical protein MIMGU_mgv1a011359mg                303   7e-100   Erythranthe guttata [common monkey flower]
gb|EYU18609.1|  hypothetical protein MIMGU_mgv1a011131mg                303   9e-100   Erythranthe guttata [common monkey flower]
emb|CAN64848.1|  hypothetical protein VITISV_036158                     302   2e-99    Vitis vinifera
gb|ABK93994.1|  unknown                                                 302   2e-99    Populus trichocarpa [western balsam poplar]
gb|KDO53624.1|  hypothetical protein CISIN_1g023555mg                   301   2e-99    Citrus sinensis [Valencia orange]
pir||S39508  alcohol dehydrogenase homolog, ripening-related - to...    300   2e-99 
ref|XP_002323240.1|  short-chain dehydrogenase/reductase family p...    301   3e-99    Populus trichocarpa [western balsam poplar]
ref|XP_006430534.1|  hypothetical protein CICLE_v10012432mg             301   3e-99    Citrus clementina
ref|XP_010653621.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    301   3e-99    Vitis vinifera
ref|XP_004249319.1|  PREDICTED: carbonyl reductase [NADPH] 2-like       300   2e-98    Solanum lycopersicum
emb|CDP20582.1|  unnamed protein product                                299   3e-98    Coffea canephora [robusta coffee]
ref|XP_006482064.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    299   4e-98    
ref|XP_009371362.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    299   4e-98    Pyrus x bretschneideri [bai li]
ref|XP_006430535.1|  hypothetical protein CICLE_v10012421mg             298   4e-98    Citrus clementina
ref|XP_010943529.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    298   4e-98    Elaeis guineensis
ref|XP_008808086.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    298   5e-98    Phoenix dactylifera
ref|NP_001274762.1|  putative short-chain type alcohol dehydrogenase    298   6e-98    Solanum tuberosum [potatoes]
ref|XP_009417296.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    298   6e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003518969.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    298   7e-98    Glycine max [soybeans]
ref|XP_006482062.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    297   9e-98    Citrus sinensis [Valencia orange]
ref|XP_007145484.1|  hypothetical protein PHAVU_007G242900g             297   1e-97    Phaseolus vulgaris [French bean]
ref|XP_006430531.1|  hypothetical protein CICLE_v10012408mg             296   2e-97    Citrus clementina
ref|XP_006339259.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    297   2e-97    Solanum tuberosum [potatoes]
ref|XP_007028287.1|  2,4-dienoyl-CoA reductase isoform 2                296   2e-97    Theobroma cacao [chocolate]
ref|XP_010112844.1|  3-oxoacyl-[acyl-carrier-protein] reductase FabG    296   3e-97    Morus notabilis
ref|XP_008805478.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    296   3e-97    Phoenix dactylifera
gb|AFK48641.1|  unknown                                                 296   3e-97    Medicago truncatula
ref|XP_008386836.1|  PREDICTED: probable L-xylulose reductase           296   7e-97    Malus domestica [apple tree]
ref|XP_011000407.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    295   7e-97    Populus euphratica
gb|AAN32641.1|AF416732_1  putative short-chain type alcohol dehyd...    295   8e-97    Solanum tuberosum [potatoes]
ref|XP_011075452.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    296   9e-97    Sesamum indicum [beniseed]
gb|KJB54601.1|  hypothetical protein B456_009G041000                    295   1e-96    Gossypium raimondii
gb|KHN24253.1|  3-oxoacyl-[acyl-carrier-protein] reductase 1            291   1e-96    Glycine soja [wild soybean]
ref|XP_010913911.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    294   2e-96    Elaeis guineensis
ref|XP_011079077.1|  PREDICTED: carbonyl reductase [NADPH] 2-like       293   4e-96    Sesamum indicum [beniseed]
ref|XP_009383217.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    293   5e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004249318.1|  PREDICTED: D-erythrulose reductase-like            293   7e-96    Solanum lycopersicum
gb|EPS63859.1|  hypothetical protein M569_10924                         292   1e-95    Genlisea aurea
gb|KEH30024.1|  enoyl-(acyl carrier) reductase                          292   1e-95    Medicago truncatula
gb|KHG26617.1|  3-oxoacyl-[acyl-carrier-protein] reductase FabG         291   3e-95    Gossypium arboreum [tree cotton]
ref|XP_010673042.1|  PREDICTED: L-xylulose reductase-like               290   1e-94    Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_008340560.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    290   1e-94    Malus domestica [apple tree]
ref|XP_007145483.1|  hypothetical protein PHAVU_007G242800g             288   4e-94    Phaseolus vulgaris [French bean]
ref|XP_007202394.1|  hypothetical protein PRUPE_ppa009414mg             288   5e-94    Prunus persica
ref|XP_009631508.1|  PREDICTED: probable L-xylulose reductase           286   3e-93    Nicotiana tomentosiformis
ref|XP_008339342.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    285   7e-93    Malus domestica [apple tree]
ref|XP_004515513.1|  PREDICTED: glucose 1-dehydrogenase-like            284   2e-92    Cicer arietinum [garbanzo]
ref|XP_002282735.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    284   2e-92    Vitis vinifera
ref|XP_008340561.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    283   9e-92    Malus domestica [apple tree]
ref|XP_009394521.1|  PREDICTED: hydroxysteroid dehydrogenase-like...    290   2e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010257447.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    281   2e-91    Nelumbo nucifera [Indian lotus]
ref|XP_010529958.1|  PREDICTED: carbonyl reductase [NADPH] 2-like...    278   2e-90    Tarenaya hassleriana [spider flower]
ref|XP_010530115.1|  PREDICTED: carbonyl reductase [NADPH] 2-like...    278   2e-90    Tarenaya hassleriana [spider flower]
ref|XP_009390649.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    278   2e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010530193.1|  PREDICTED: carbonyl reductase [NADPH] 2-like...    278   2e-90    Tarenaya hassleriana [spider flower]
ref|XP_010530038.1|  PREDICTED: carbonyl reductase [NADPH] 2-like...    278   2e-90    Tarenaya hassleriana [spider flower]
ref|XP_010529885.1|  PREDICTED: carbonyl reductase [NADPH] 2-like...    278   4e-90    Tarenaya hassleriana [spider flower]
ref|XP_011079072.1|  PREDICTED: estradiol 17-beta-dehydrogenase 8...    277   1e-89    Sesamum indicum [beniseed]
ref|XP_008455729.1|  PREDICTED: uncharacterized oxidoreductase C9...    276   2e-89    Cucumis melo [Oriental melon]
ref|XP_009607267.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    276   3e-89    Nicotiana tomentosiformis
ref|XP_004144326.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    275   6e-89    Cucumis sativus [cucumbers]
ref|XP_010473483.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    273   2e-88    Camelina sativa [gold-of-pleasure]
ref|XP_002876294.1|  short-chain dehydrogenase/reductase family p...    273   3e-88    Arabidopsis lyrata subsp. lyrata
ref|XP_006365803.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    273   3e-88    Solanum tuberosum [potatoes]
gb|KEH41456.1|  NAD(P)-binding rossmann-fold protein                    273   3e-88    Medicago truncatula
ref|XP_004170137.1|  PREDICTED: LOW QUALITY PROTEIN: 3-oxoacyl-[a...    273   3e-88    
emb|CDP06198.1|  unnamed protein product                                273   5e-88    Coffea canephora [robusta coffee]
ref|XP_010265875.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    272   7e-88    Nelumbo nucifera [Indian lotus]
ref|XP_009778773.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    272   8e-88    Nicotiana sylvestris
ref|XP_004973876.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    272   8e-88    Setaria italica
ref|XP_010112832.1|  3-oxoacyl-[acyl-carrier-protein] reductase FabG    278   1e-87    Morus notabilis
emb|CDP06199.1|  unnamed protein product                                271   2e-87    Coffea canephora [robusta coffee]
ref|NP_567019.1|  Rossmann-fold NAD(P)-binding domain-containing ...    271   3e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009773767.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    271   3e-87    Nicotiana sylvestris
ref|NP_974441.1|  Rossmann-fold NAD(P)-binding domain-containing ...    270   3e-87    Arabidopsis thaliana [mouse-ear cress]
emb|CAB75763.1|  oxidoreductase-like protein                            270   3e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006301634.1|  hypothetical protein CARUB_v10022077mg             270   3e-87    Capsella rubella
ref|XP_009596119.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    271   3e-87    Nicotiana tomentosiformis
gb|EAZ43296.1|  hypothetical protein OsJ_27892                          270   5e-87    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009391879.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    270   6e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010516096.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    269   8e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010516097.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    269   8e-87    Camelina sativa [gold-of-pleasure]
ref|NP_001062206.1|  Os08g0510400                                       270   9e-87    
ref|XP_010427297.1|  PREDICTED: probable L-xylulose reductase iso...    269   1e-86    Camelina sativa [gold-of-pleasure]
ref|XP_010427295.1|  PREDICTED: probable L-xylulose reductase iso...    269   1e-86    Camelina sativa [gold-of-pleasure]
ref|XP_004172090.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    269   2e-86    
ref|XP_009593495.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    268   2e-86    Nicotiana tomentosiformis
ref|XP_009371244.1|  PREDICTED: LOW QUALITY PROTEIN: estradiol 17...    269   2e-86    Pyrus x bretschneideri [bai li]
ref|XP_010418256.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    268   4e-86    Camelina sativa [gold-of-pleasure]
ref|XP_006660269.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    266   5e-86    Oryza brachyantha
ref|XP_002444769.1|  hypothetical protein SORBIDRAFT_07g027700          267   6e-86    Sorghum bicolor [broomcorn]
ref|XP_008443382.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    267   6e-86    Cucumis melo [Oriental melon]
ref|XP_009631506.1|  PREDICTED: probable L-xylulose reductase iso...    267   6e-86    Nicotiana tomentosiformis
ref|XP_006403473.1|  hypothetical protein EUTSA_v10010610mg             267   7e-86    Eutrema salsugineum
emb|CDP21456.1|  unnamed protein product                                267   9e-86    Coffea canephora [robusta coffee]
ref|XP_006291426.1|  hypothetical protein CARUB_v10017563mg             269   1e-85    Capsella rubella
ref|XP_004136692.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    266   1e-85    Cucumis sativus [cucumbers]
ref|XP_006291425.1|  hypothetical protein CARUB_v10017563mg             268   2e-85    Capsella rubella
ref|XP_004249129.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    266   2e-85    Solanum lycopersicum
ref|XP_004144361.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    266   2e-85    
gb|KFK34763.1|  hypothetical protein AALP_AA5G190600                    266   3e-85    Arabis alpina [alpine rockcress]
gb|KFK34764.1|  hypothetical protein AALP_AA5G190600                    265   3e-85    Arabis alpina [alpine rockcress]
emb|CDY48725.1|  BnaA09g10000D                                          266   3e-85    Brassica napus [oilseed rape]
gb|KFK40341.1|  hypothetical protein AALP_AA3G361500                    265   4e-85    Arabis alpina [alpine rockcress]
gb|KGN54692.1|  hypothetical protein Csa_4G427280                       266   4e-85    Cucumis sativus [cucumbers]
ref|XP_006361353.1|  PREDICTED: probable L-xylulose reductase-like      265   6e-85    
gb|EMT14873.1|  3-oxoacyl-(acyl-carrier-protein) reductase              264   1e-84    Aegilops tauschii
ref|NP_565425.1|  Rossmann-fold NAD(P)-binding domain-containing ...    265   1e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010504384.1|  PREDICTED: probable L-xylulose reductase iso...    263   2e-84    Camelina sativa [gold-of-pleasure]
ref|XP_009139176.1|  PREDICTED: probable L-xylulose reductase iso...    263   2e-84    Brassica rapa
ref|XP_010504386.1|  PREDICTED: probable L-xylulose reductase iso...    263   2e-84    Camelina sativa [gold-of-pleasure]
ref|XP_009139177.1|  PREDICTED: probable L-xylulose reductase iso...    263   2e-84    Brassica rapa
ref|XP_009139180.1|  PREDICTED: probable L-xylulose reductase iso...    263   3e-84    Brassica rapa
ref|XP_009139179.1|  PREDICTED: probable L-xylulose reductase iso...    263   3e-84    Brassica rapa
dbj|BAK03236.1|  predicted protein                                      263   3e-84    Hordeum vulgare subsp. vulgare [barley]
emb|CDX76107.1|  BnaA04g03710D                                          263   3e-84    Brassica napus [oilseed rape]
ref|NP_001152499.1|  LOC100286139                                       263   3e-84    Zea mays [maize]
emb|CDY65313.1|  BnaCnng46610D                                          263   3e-84    Brassica napus [oilseed rape]
ref|XP_009112627.1|  PREDICTED: probable L-xylulose reductase           263   3e-84    Brassica rapa
tpg|DAA47976.1|  TPA: 3-oxoacyl-reductase                               263   3e-84    Zea mays [maize]
ref|XP_006403474.1|  hypothetical protein EUTSA_v10010605mg             262   8e-84    Eutrema salsugineum
gb|EMS50889.1|  Gluconate 5-dehydrogenase                               259   2e-83    Triticum urartu
ref|XP_004157996.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    261   2e-83    
emb|CDY03343.1|  BnaC09g10050D                                          260   4e-83    Brassica napus [oilseed rape]
ref|XP_011079074.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    260   4e-83    Sesamum indicum [beniseed]
ref|NP_191091.2|  Rossmann-fold NAD(P)-binding domain-containing ...    259   5e-83    Arabidopsis thaliana [mouse-ear cress]
gb|AAF19703.1|AC008047_10  F2K11.24                                     260   5e-83    Arabidopsis thaliana [mouse-ear cress]
ref|NP_190203.1|  NAD(P)-binding Rossmann-fold superfamily protein      260   5e-83    Arabidopsis thaliana [mouse-ear cress]
ref|NP_176527.4|  Rossmann-fold NAD(P)-binding domain-containing ...    259   5e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006361361.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    260   6e-83    
ref|XP_004144362.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    260   6e-83    
ref|NP_001031220.1|  putative ketoacyl-ACP reductase                    259   8e-83    Arabidopsis thaliana [mouse-ear cress]
emb|CAB75765.1|  beta-ketoacyl-ACP reductase-like protein               260   8e-83    Arabidopsis thaliana [mouse-ear cress]
ref|NP_176449.2|  putative ketoacyl-ACP reductase                       259   8e-83    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185294.1|  putative ketoacyl-ACP reductase                    259   9e-83    Arabidopsis thaliana [mouse-ear cress]
ref|NP_974072.1|  putative ketoacyl-ACP reductase                       259   9e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004252844.1|  PREDICTED: probable L-xylulose reductase           258   2e-82    Solanum lycopersicum
ref|XP_010314314.1|  PREDICTED: probable L-xylulose reductase           258   2e-82    Solanum lycopersicum
ref|XP_002886464.1|  predicted protein                                  258   3e-82    Arabidopsis lyrata subsp. lyrata
gb|AAD43618.1|AC005698_17  T3P18.17                                     258   3e-82    Arabidopsis thaliana [mouse-ear cress]
gb|EYU20810.1|  hypothetical protein MIMGU_mgv1a011271mg                257   6e-82    Erythranthe guttata [common monkey flower]
emb|CDY29203.1|  BnaA06g25540D                                          256   8e-82    Brassica napus [oilseed rape]
ref|XP_006365797.1|  PREDICTED: probable L-xylulose reductase-like      256   1e-81    Solanum tuberosum [potatoes]
ref|XP_009139357.1|  PREDICTED: probable L-xylulose reductase           256   1e-81    Brassica rapa
ref|XP_009124575.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    256   2e-81    Brassica rapa
gb|ACS12983.1|  2,4-dienoyl-CoA reductase                               256   2e-81    Jatropha curcas
ref|XP_006850022.1|  hypothetical protein AMTR_s00022p00187970          256   3e-81    Amborella trichopoda
emb|CDY07814.1|  BnaC03g48080D                                          255   3e-81    Brassica napus [oilseed rape]
gb|KHN19831.1|  3-oxoacyl-[acyl-carrier-protein] reductase FabG         251   4e-81    Glycine soja [wild soybean]
ref|XP_009139356.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    253   5e-81    Brassica rapa
ref|XP_008455802.1|  PREDICTED: probable L-xylulose reductase           255   6e-81    
emb|CDX73333.1|  BnaC05g27730D                                          254   7e-81    Brassica napus [oilseed rape]
ref|XP_011079076.1|  PREDICTED: L-rhamnose-1-dehydrogenase-like         254   7e-81    Sesamum indicum [beniseed]
ref|XP_004248275.1|  PREDICTED: carbonyl reductase [NADPH] 2-like       254   9e-81    Solanum lycopersicum
emb|CDY44938.1|  BnaA02g04430D                                          254   9e-81    Brassica napus [oilseed rape]
ref|XP_009594209.1|  PREDICTED: probable L-xylulose reductase           253   1e-80    Nicotiana tomentosiformis
ref|XP_004172089.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    254   3e-80    
ref|XP_006366156.1|  PREDICTED: probable L-xylulose reductase-like      253   3e-80    
ref|XP_009631507.1|  PREDICTED: probable L-xylulose reductase iso...    251   4e-80    Nicotiana tomentosiformis
ref|XP_004252379.1|  PREDICTED: probable L-xylulose reductase           251   7e-80    Solanum lycopersicum
gb|EMS67034.1|  3-oxoacyl-[acyl-carrier-protein] reductase FabG         250   1e-79    Triticum urartu
ref|XP_009116225.1|  PREDICTED: probable L-xylulose reductase iso...    251   1e-79    Brassica rapa
ref|XP_004136691.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    252   1e-79    
ref|XP_009116226.1|  PREDICTED: probable L-xylulose reductase iso...    250   2e-79    Brassica rapa
ref|XP_010431696.1|  PREDICTED: estradiol 17-beta-dehydrogenase 8...    248   4e-79    Camelina sativa [gold-of-pleasure]
ref|XP_009599584.1|  PREDICTED: probable L-xylulose reductase           249   7e-79    Nicotiana tomentosiformis
emb|CAN59905.1|  hypothetical protein VITISV_033145                     250   9e-79    Vitis vinifera
ref|XP_003574753.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    249   9e-79    Brachypodium distachyon [annual false brome]
ref|XP_009763303.1|  PREDICTED: probable L-xylulose reductase iso...    246   4e-78    Nicotiana sylvestris
ref|XP_008240678.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    245   1e-77    Prunus mume [ume]
ref|XP_009763295.1|  PREDICTED: probable L-xylulose reductase iso...    245   2e-77    Nicotiana sylvestris
ref|XP_011079073.1|  PREDICTED: estradiol 17-beta-dehydrogenase 8...    245   2e-77    Sesamum indicum [beniseed]
emb|CDY40209.1|  BnaA09g34910D                                          246   2e-77    Brassica napus [oilseed rape]
dbj|BAK02348.1|  predicted protein                                      245   2e-77    Hordeum vulgare subsp. vulgare [barley]
ref|XP_006367949.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    244   5e-77    
ref|XP_009150759.1|  PREDICTED: probable L-xylulose reductase iso...    243   1e-76    Brassica rapa
ref|XP_009150760.1|  PREDICTED: probable L-xylulose reductase iso...    243   2e-76    Brassica rapa
emb|CDX73391.1|  BnaC08g26120D                                          249   2e-76    Brassica napus [oilseed rape]
ref|XP_008680945.1|  PREDICTED: LOC100286139 isoform X4                 240   2e-75    Zea mays [maize]
ref|XP_009781380.1|  PREDICTED: L-xylulose reductase-like               239   3e-75    Nicotiana sylvestris
ref|XP_008680943.1|  PREDICTED: LOC100286139 isoform X3                 240   4e-75    Zea mays [maize]
ref|XP_008680941.1|  PREDICTED: LOC100286139 isoform X2                 240   6e-75    Zea mays [maize]
tpg|DAA47977.1|  TPA: hypothetical protein ZEAMMB73_585385              240   8e-75    Zea mays [maize]
ref|XP_006362944.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    237   3e-74    Solanum tuberosum [potatoes]
ref|XP_008680935.1|  PREDICTED: LOC100286139 isoform X1                 240   3e-74    Zea mays [maize]
ref|XP_009121071.1|  PREDICTED: probable L-xylulose reductase iso...    237   4e-74    Brassica rapa
ref|XP_009121072.1|  PREDICTED: probable L-xylulose reductase iso...    237   5e-74    Brassica rapa
gb|KEH30026.1|  enoyl-(acyl carrier) reductase                          234   7e-74    Medicago truncatula
gb|KDO53626.1|  hypothetical protein CISIN_1g031340mg                   231   2e-73    Citrus sinensis [Valencia orange]
ref|XP_006362943.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    233   9e-73    Solanum tuberosum [potatoes]
gb|ADE77298.1|  unknown                                                 231   1e-71    Picea sitchensis
ref|XP_008787372.1|  PREDICTED: LOW QUALITY PROTEIN: estradiol 17...    225   1e-70    Phoenix dactylifera
ref|XP_001760079.1|  predicted protein                                  228   2e-70    Physcomitrella patens
ref|XP_002884088.1|  short-chain dehydrogenase/reductase family p...    226   7e-70    Arabidopsis lyrata subsp. lyrata
ref|XP_011075456.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    226   7e-70    Sesamum indicum [beniseed]
emb|CBI32789.3|  unnamed protein product                                225   2e-69    Vitis vinifera
ref|XP_004170138.1|  PREDICTED: uncharacterized oxidoreductase Rv...    221   4e-69    
ref|XP_007028286.1|  2,4-dienoyl-CoA reductase, putative isoform 1      224   5e-68    Theobroma cacao [chocolate]
ref|XP_011075454.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    221   1e-67    Sesamum indicum [beniseed]
ref|XP_009786105.1|  PREDICTED: D-erythrulose reductase-like            215   5e-66    Nicotiana sylvestris
ref|XP_006367340.1|  PREDICTED: probable L-xylulose reductase-like      215   1e-65    Solanum tuberosum [potatoes]
ref|XP_003632638.2|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    213   2e-64    Vitis vinifera
ref|XP_009394522.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    210   6e-64    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006362945.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    209   2e-63    
ref|XP_006408894.1|  hypothetical protein EUTSA_v10002227mg             208   7e-63    Eutrema salsugineum
gb|EMS63120.1|  3-oxoacyl-[acyl-carrier-protein] reductase FabG         202   2e-61    Triticum urartu
ref|XP_010314672.1|  PREDICTED: omega-6 fatty acid desaturase, en...    211   8e-61    Solanum lycopersicum
ref|XP_004252861.2|  PREDICTED: omega-6 fatty acid desaturase, en...    211   8e-61    Solanum lycopersicum
gb|EYU20809.1|  hypothetical protein MIMGU_mgv11b016674mg               202   9e-61    Erythranthe guttata [common monkey flower]
ref|XP_009769812.1|  PREDICTED: carbonyl reductase [NADPH] 2-like       194   2e-59    Nicotiana sylvestris
ref|XP_002963314.1|  hypothetical protein SELMODRAFT_80357              196   3e-58    Selaginella moellendorffii
ref|XP_002963719.1|  hypothetical protein SELMODRAFT_80710              193   6e-58    Selaginella moellendorffii
gb|ABK21106.1|  unknown                                                 196   8e-58    Picea sitchensis
ref|XP_002974604.1|  hypothetical protein SELMODRAFT_101607             194   2e-57    Selaginella moellendorffii
ref|XP_006299633.1|  hypothetical protein CARUB_v10015813mg             189   1e-56    Capsella rubella
emb|CBI32788.3|  unnamed protein product                                192   1e-56    Vitis vinifera
gb|KGN54695.1|  hypothetical protein Csa_4G429290                       175   6e-52    Cucumis sativus [cucumbers]
emb|CDY07809.1|  BnaC03g48130D                                          171   2e-50    Brassica napus [oilseed rape]
emb|CDY29207.1|  BnaA06g25500D                                          169   1e-49    Brassica napus [oilseed rape]
gb|ABE65821.1|  short-chain dehydrogenase/reductase family protein      169   2e-49    Arabidopsis thaliana [mouse-ear cress]
dbj|BAE99083.1|  putative reductase                                     165   5e-48    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185300.1|  Rossmann-fold NAD(P)-binding domain-containi...    155   5e-43    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010265876.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    149   2e-42    Nelumbo nucifera [Indian lotus]
ref|XP_006430532.1|  hypothetical protein CICLE_v10012408mg             150   2e-41    Citrus clementina
emb|CDY02920.1|  BnaC04g25660D                                          151   3e-41    Brassica napus [oilseed rape]
gb|KJB54602.1|  hypothetical protein B456_009G041000                    149   8e-41    Gossypium raimondii
ref|XP_006430533.1|  hypothetical protein CICLE_v10012432mg             147   2e-40    Citrus clementina
ref|XP_006302904.1|  hypothetical protein CARUB_v10021033mg             140   1e-37    Capsella rubella
emb|CBI32790.3|  unnamed protein product                                134   1e-35    Vitis vinifera
ref|XP_006374241.1|  hypothetical protein POPTR_0015s05345g             131   2e-35    Populus trichocarpa [western balsam poplar]
ref|XP_002308881.1|  hypothetical protein POPTR_0006s03530g             117   9e-30    Populus trichocarpa [western balsam poplar]
gb|EYU20811.1|  hypothetical protein MIMGU_mgv11b022665mg               119   1e-29    Erythranthe guttata [common monkey flower]
ref|XP_009599581.1|  PREDICTED: glucose and ribitol dehydrogenase...    118   3e-29    Nicotiana tomentosiformis
gb|ACJ85419.1|  unknown                                                 118   6e-29    Medicago truncatula
ref|XP_009599582.1|  PREDICTED: carbonyl reductase [NADPH] 2-like...    116   1e-28    Nicotiana tomentosiformis
ref|XP_006850023.1|  hypothetical protein AMTR_s00022p00188500          112   8e-28    
ref|XP_006298324.1|  hypothetical protein CARUB_v10014388mg             115   3e-27    Capsella rubella
emb|CAN59906.1|  hypothetical protein VITISV_033146                     111   3e-27    Vitis vinifera
ref|XP_010482176.1|  PREDICTED: L-xylulose reductase-like               112   2e-26    Camelina sativa [gold-of-pleasure]
dbj|BAH19676.1|  AT3G01980                                              110   1e-25    Arabidopsis thaliana [mouse-ear cress]
ref|NP_186847.1|  Rossmann-fold NAD(P)-binding domain-containing ...    110   1e-25    Arabidopsis thaliana [mouse-ear cress]
gb|AAM65725.1|  putative dehydrogenase                                  110   2e-25    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882153.1|  short-chain dehydrogenase/reductase family p...    108   5e-25    Arabidopsis lyrata subsp. lyrata
dbj|BAH19962.1|  AT3G01980                                              108   5e-25    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010439895.1|  PREDICTED: carbonyl reductase [NADPH] 2-like       108   8e-25    Camelina sativa [gold-of-pleasure]
gb|KHG07824.1|  Levodione reductase                                     107   2e-24    Gossypium arboreum [tree cotton]
ref|XP_006408559.1|  hypothetical protein EUTSA_v10021329mg             107   2e-24    Eutrema salsugineum
ref|WP_035340522.1|  3-oxoacyl-ACP reductase                            106   2e-24    Bacillus hemicellulosilyticus
gb|KJB11704.1|  hypothetical protein B456_001G273200                    106   4e-24    Gossypium raimondii
gb|KCZ60467.1|  hypothetical protein HY36_05665                         105   5e-24    Hyphomonas atlantica
gb|KJB78351.1|  hypothetical protein B456_012G085000                    104   6e-24    Gossypium raimondii
ref|XP_009618143.1|  PREDICTED: peroxisomal 2,4-dienoyl-CoA reduc...    105   7e-24    Nicotiana tomentosiformis
ref|WP_035552356.1|  2-deoxy-D-gluconate 3-dehydrogenase                105   7e-24    Hyphomonas atlantica
ref|XP_010913025.1|  PREDICTED: estradiol 17-beta-dehydrogenase 8...    105   1e-23    Elaeis guineensis
ref|XP_008450121.1|  PREDICTED: carbonyl reductase [NADPH] 2            105   1e-23    
ref|WP_034129857.1|  hypothetical protein                               105   1e-23    
ref|WP_027836295.1|  2-deoxy-D-gluconate 3-dehydrogenase                105   1e-23    
ref|XP_008808111.1|  PREDICTED: carbonyl reductase [NADPH] 2            105   1e-23    Phoenix dactylifera
gb|KJB78349.1|  hypothetical protein B456_012G085000                    104   1e-23    Gossypium raimondii
ref|WP_036151163.1|  3-oxoacyl-ACP reductase                            104   1e-23    Lysinibacillus odysseyi
ref|XP_010442348.1|  PREDICTED: L-xylulose reductase-like               105   1e-23    Camelina sativa [gold-of-pleasure]
ref|WP_016481639.1|  3-oxoacyl-[acyl-carrier-protein] reductase         104   2e-23    Chthonomonas calidirosea
gb|KFK37653.1|  hypothetical protein AALP_AA3G011000                    104   2e-23    Arabis alpina [alpine rockcress]
gb|KJB78350.1|  hypothetical protein B456_012G085000                    104   2e-23    Gossypium raimondii
ref|XP_007031916.1|  NAD(P)-binding Rossmann-fold superfamily pro...    104   2e-23    Theobroma cacao [chocolate]
gb|KCZ63815.1|  hypothetical protein L53_04790                          103   2e-23    Hyphomonas sp. L-53-1-40
ref|WP_034813394.1|  2-deoxy-D-gluconate 3-dehydrogenase                103   3e-23    Hyphomonas sp. L-53-1-40
ref|WP_021509639.1|  short-chain dehydrogenase                          103   4e-23    Pantoea dispersa
ref|WP_003758645.1|  3-ketoacyl-ACP reductase                           103   4e-23    Listeria grayi
ref|WP_041328299.1|  3-oxoacyl-ACP reductase                            103   4e-23    
ref|XP_004169927.1|  PREDICTED: LOW QUALITY PROTEIN: 3-oxoacyl-[a...    103   5e-23    
ref|XP_004148011.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    103   5e-23    
gb|ABG05322.1|  short-chain dehydrogenase/reductase SDR                 103   6e-23    
ref|WP_011334166.1|  2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase      102   1e-22    
gb|KDP46262.1|  hypothetical protein JCGZ_10102                         102   1e-22    
ref|WP_039768484.1|  2-deoxy-D-gluconate 3-dehydrogenase                102   1e-22    
ref|XP_001771628.1|  predicted protein                                  102   2e-22    
gb|KJB34002.1|  hypothetical protein B456_006G042900                    100   2e-22    
ref|WP_007537040.1|  alcohol dehydrogenase                              102   2e-22    
emb|CEG22649.1|  Gluconate 5-dehydrogenase                              101   2e-22    
gb|AIZ49783.1|  putative short-chain dehydrogenase/reductase            102   2e-22    
ref|WP_019649717.1|  2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase      102   2e-22    
ref|WP_036632045.1|  2-deoxy-D-gluconate 3-dehydrogenase                101   2e-22    
ref|WP_000998686.1|  gluconate 5-dehydrogenase                          101   2e-22    
gb|KCZ99863.1|  short chain dehydrogenase/reductase family oxidor...    101   2e-22    
ref|XP_009798974.1|  PREDICTED: peroxisomal 2,4-dienoyl-CoA reduc...    102   2e-22    
gb|KJB33999.1|  hypothetical protein B456_006G042900                    101   2e-22    
gb|EHC55855.1|  5-keto-D-gluconate 5-reductase                          100   3e-22    
ref|WP_035594398.1|  2-deoxy-D-gluconate 3-dehydrogenase                101   3e-22    
gb|AHS47113.1|  gluconate 5-dehydrogenase                               101   3e-22    
ref|XP_006363009.1|  PREDICTED: peroxisomal 2,4-dienoyl-CoA reduc...    101   3e-22    
ref|WP_038392156.1|  gluconate 5-dehydrogenase                          101   3e-22    
gb|EHC76865.1|  5-keto-D-gluconate 5-reductase                          100   3e-22    
gb|AIZ49782.1|  putative short-chain dehydrogenase/reductase            101   3e-22    
ref|WP_020292543.1|  putative 3-oxoacyl-(acyl-carrier-protein) re...    101   3e-22    
ref|WP_000998685.1|  gluconate 5-dehydrogenase                          101   3e-22    
ref|XP_008813480.1|  PREDICTED: carbonyl reductase [NADPH] 2-like       101   3e-22    
ref|WP_019578905.1|  2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase      101   3e-22    
ref|WP_028683983.1|  2-deoxy-D-gluconate 3-dehydrogenase                101   4e-22    
ref|WP_039052368.1|  gluconate 5-dehydrogenase                          100   4e-22    
gb|KJB34003.1|  hypothetical protein B456_006G042900                    100   4e-22    
ref|WP_023234363.1|  gluconate 5-dehydrogenase                          100   4e-22    
gb|EHC96582.1|  5-keto-D-gluconate 5-reductase                          100   4e-22    
ref|WP_038407538.1|  3-oxoacyl-ACP reductase                            100   4e-22    
ref|WP_003720122.1|  3-oxoacyl-(acyl-carrier-protein) reductase         100   4e-22    
ref|WP_010683557.1|  Short-chain dehydrogenase/reductase SDR            100   4e-22    
ref|WP_023225531.1|  gluconate 5-dehydrogenase                          100   4e-22    
ref|WP_014093155.1|  3-ketoacyl-ACP reductase                           100   4e-22    
ref|NP_001284466.1|  carbonyl reductase [NADPH] 2                       100   4e-22    
ref|WP_001651385.1|  5-keto-D-gluconate 5-reductase                     100   4e-22    
gb|KJB34000.1|  hypothetical protein B456_006G042900                    100   4e-22    
gb|EFR87358.1|  3-oxoacyl-(acyl-carrier-protein) reductase              100   5e-22    
ref|WP_039176252.1|  sugar dehydrogenase                                100   5e-22    
ref|WP_033843501.1|  3-oxoacyl-ACP reductase                            100   5e-22    
ref|WP_009049041.1|  2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase      100   5e-22    
gb|KJB34004.1|  hypothetical protein B456_006G042900                    100   5e-22    
ref|WP_008458735.1|  gluconate 5-dehydrogenase                          100   5e-22    
ref|WP_000998688.1|  MULTISPECIES: gluconate 5-dehydrogenase            100   5e-22    
ref|WP_000998684.1|  gluconate 5-dehydrogenase                          100   5e-22    
ref|WP_001523606.1|  gluconate 5-dehydrogenase                          100   5e-22    
ref|WP_023207008.1|  gluconate 5-dehydrogenase                          100   6e-22    
ref|WP_000998680.1|  gluconate 5-dehydrogenase                          100   6e-22    
ref|WP_023218527.1|  gluconate 5-dehydrogenase                          100   6e-22    
ref|WP_000998692.1|  gluconate 5-dehydrogenase                          100   6e-22    
ref|WP_033543136.1|  2-deoxy-D-gluconate 3-dehydrogenase                100   6e-22    
ref|WP_001061034.1|  gluconate 5-dehydrogenase                          100   6e-22    
ref|WP_020959316.1|  3-ketoacyl-ACP reductase                           100   6e-22    
ref|WP_010453095.1|  short-chain dehydrogenase                          100   6e-22    
ref|WP_000998689.1|  gluconate 5-dehydrogenase                          100   6e-22    
ref|WP_041851306.1|  gluconate 5-dehydrogenase                          100   6e-22    
ref|WP_000998690.1|  gluconate 5-dehydrogenase                          100   6e-22    
ref|WP_001627667.1|  5-keto-D-gluconate 5-reductase                     100   6e-22    
ref|WP_023220418.1|  gluconate 5-dehydrogenase                          100   6e-22    
ref|WP_003181868.1|  short-chain dehydrogenase                          100   6e-22    
ref|WP_023993567.1|  gluconate 5-dehydrogenase                          100   6e-22    
ref|WP_038680613.1|  3-oxoacyl-ACP reductase                            100   7e-22    
ref|WP_033099763.1|  3-oxoacyl-ACP reductase                            100   7e-22    
ref|WP_041122664.1|  2-deoxy-D-gluconate 3-dehydrogenase                100   7e-22    
ref|WP_000998691.1|  gluconate 5-dehydrogenase                          100   7e-22    
gb|KHG08201.1|  2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase           100   8e-22    
ref|WP_023249722.1|  gluconate 5-dehydrogenase                          100   8e-22    
ref|WP_001581703.1|  5-keto-D-gluconate 5-reductase                     100   8e-22    
ref|WP_010153679.1|  2-deoxy-D-gluconate 3-dehydrogenase                100   8e-22    
ref|WP_019874056.1|  hypothetical protein                             99.8    8e-22    
gb|KIL11680.1|  Glucose 1-dehydrogenase                                 100   9e-22    
ref|WP_000998683.1|  gluconate 5-dehydrogenase                          100   9e-22    
ref|WP_041088915.1|  sugar dehydrogenase                                100   9e-22    
ref|WP_042286074.1|  gluconate 5-dehydrogenase                        99.8    9e-22    
ref|WP_008878621.1|  MULTISPECIES: 3-ketoacyl-ACP reductase           99.8    1e-21    
ref|WP_043348661.1|  2-deoxy-D-gluconate 3-dehydrogenase              99.8    1e-21    
gb|EAZ29313.1|  hypothetical protein OsJ_13374                          100   1e-21    
ref|WP_036053216.1|  gluconate 5-dehydrogenase                        99.8    1e-21    
ref|NP_001051902.1|  Os03g0850000                                       100   1e-21    
ref|WP_027564025.1|  MULTISPECIES: short-chain dehydrogenase          99.8    1e-21    
ref|WP_003769287.1|  3-ketoacyl-ACP reductase                         99.8    1e-21    
ref|WP_029194250.1|  2-deoxy-D-gluconate 3-dehydrogenase              99.8    1e-21    
ref|WP_012317089.1|  2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase    99.8    1e-21    
dbj|BAC78573.1|  hypothetical protein                                   100   1e-21    
ref|WP_034283207.1|  MULTISPECIES: sugar dehydrogenase                99.8    1e-21    
ref|WP_011196426.1|  2-deoxy-D-gluconate 3-dehydrogenase              99.4    1e-21    
ref|WP_033773617.1|  short-chain dehydrogenase                        99.4    1e-21    
ref|WP_024030208.1|  3-ketoacyl-(acyl-carrier-protein) reductase      99.4    1e-21    
ref|WP_000998687.1|  gluconate 5-dehydrogenase                        99.4    1e-21    
ref|WP_042838234.1|  gluconate 5-dehydrogenase                        99.4    2e-21    
ref|XP_010926846.1|  PREDICTED: dehydrogenase/reductase SDR famil...  99.0    2e-21    
ref|WP_026694874.1|  2-deoxy-D-gluconate 3-dehydrogenase              99.4    2e-21    
ref|WP_008006358.1|  short-chain dehydrogenase                        99.4    2e-21    
ref|WP_043380387.1|  MULTISPECIES: 2-deoxy-D-gluconate 3-dehydrog...  99.4    2e-21    
ref|WP_000998704.1|  gluconate 5-dehydrogenase                        99.4    2e-21    
ref|WP_003332632.1|  3-ketoacyl-(acyl-carrier-protein) reductase      99.0    2e-21    
gb|EFI87014.1|  oxidoreductase, short chain dehydrogenase/reducta...  99.4    2e-21    
ref|WP_040263450.1|  short-chain dehydrogenase                        99.4    2e-21    
emb|CDP06200.1|  unnamed protein product                              95.5    2e-21    
dbj|GAN48841.1|  short-chain dehydrogenase/reductase SDR              99.4    2e-21    
ref|WP_000998681.1|  gluconate 5-dehydrogenase                        99.0    2e-21    
ref|WP_025092777.1|  sugar dehydrogenase                              99.4    2e-21    
ref|WP_035193567.1|  3-oxoacyl-ACP reductase                          99.0    2e-21    
ref|WP_028748212.1|  alcohol dehydrogenase                            99.0    2e-21    
dbj|BAI96705.1|  gluconate 5-dehydrogenase                            99.0    2e-21    
ref|WP_043560423.1|  short-chain dehydrogenase                        99.0    2e-21    
ref|WP_014970354.1|  2-deoxy-D-gluconate 3-dehydrogenase              99.0    2e-21    
ref|WP_028251851.1|  gluconate 5-dehydrogenase                        99.0    2e-21    
ref|WP_033022939.1|  3-oxoacyl-ACP reductase                          99.0    2e-21    
ref|WP_024691730.1|  short-chain dehydrogenase                        99.0    2e-21    
ref|WP_041386398.1|  2-deoxy-D-gluconate 3-dehydrogenase              99.0    2e-21    
ref|WP_020717882.1|  hypothetical protein                             99.0    2e-21    
ref|WP_011702598.1|  3-ketoacyl-ACP reductase                         99.0    2e-21    
ref|WP_003748392.1|  3-ketoacyl-ACP reductase                         98.6    2e-21    
ref|WP_005457037.1|  3-oxoacyl-ACP reductase                          98.6    2e-21    
gb|EYU34819.1|  hypothetical protein MIMGU_mgv1a011896mg              99.0    2e-21    
ref|WP_012985954.1|  3-ketoacyl-ACP reductase                         98.6    2e-21    
ref|WP_017437118.1|  3-ketoacyl-ACP reductase                         98.6    3e-21    
ref|WP_013196494.1|  MULTISPECIES: short-chain dehydrogenase          98.6    3e-21    
ref|WP_003327998.1|  MULTISPECIES: glucose-1-dehydrogenase            98.6    3e-21    
ref|WP_024647326.1|  short-chain dehydrogenase                        98.6    3e-21    
ref|WP_041048423.1|  2-deoxy-D-gluconate 3-dehydrogenase              98.6    3e-21    
ref|WP_032270890.1|  gluconate 5-dehydrogenase                        98.2    3e-21    
ref|WP_024424360.1|  sugar dehydrogenase                              98.6    3e-21    
ref|WP_003448266.1|  3-oxoacyl-acyl-carrier protein reductase         98.6    3e-21    
ref|WP_027605723.1|  short-chain dehydrogenase                        98.6    3e-21    
ref|WP_033787211.1|  short-chain dehydrogenase                        98.6    3e-21    
gb|KCZ95903.1|  short chain dehydrogenase/reductase family oxidor...  97.8    3e-21    
gb|KIL17547.1|  Glucose 1-dehydrogenase                               98.6    3e-21    
ref|XP_010926845.1|  PREDICTED: carbonyl reductase [NADPH] 2-like...  98.6    3e-21    
gb|KGZ29295.1|  gluconate 5-dehydrogenase                             98.6    3e-21    
ref|WP_035047109.1|  3-oxoacyl-ACP reductase                          98.2    3e-21    
ref|WP_038636797.1|  gluconate 5-dehydrogenase                        98.6    3e-21    
ref|WP_042961878.1|  gluconate 5-dehydrogenase                        98.6    3e-21    
ref|WP_021525016.1|  gluconate 5-dehydrogenase                        98.6    3e-21    
ref|WP_035062987.1|  3-oxoacyl-ACP reductase                          98.2    3e-21    
dbj|BAP45623.1|  short-chain dehydrogenase/reductase SDR              98.2    3e-21    
ref|WP_027612762.1|  short-chain dehydrogenase                        98.2    3e-21    
ref|WP_033011164.1|  MULTISPECIES: 3-oxoacyl-ACP reductase            98.2    3e-21    
ref|WP_034664255.1|  sugar dehydrogenase                              98.6    3e-21    
ref|WP_000627842.1|  gluconate 5-dehydrogenase                        98.2    3e-21    
ref|XP_004243555.1|  PREDICTED: short-chain dehydrogenase reducta...  98.6    3e-21    
ref|XP_002976924.1|  hypothetical protein SELMODRAFT_106011           97.4    3e-21    
gb|AAP43529.1|  IdnO                                                  98.2    3e-21    
ref|WP_005138457.1|  gluconate 5-dehydrogenase                        98.2    3e-21    
ref|WP_024427225.1|  MULTISPECIES: sugar dehydrogenase                98.6    3e-21    
gb|EPZ39275.1|  3-ketoacyl-ACP reductase                              98.2    4e-21    
gb|EHC42956.1|  5-keto-D-gluconate 5-reductase                        98.2    4e-21    
ref|WP_029208415.1|  gluconate 5-dehydrogenase                        98.2    4e-21    
ref|WP_036008395.1|  short-chain dehydrogenase                        98.2    4e-21    
ref|WP_028620280.1|  short-chain dehydrogenase                        98.2    4e-21    
ref|WP_031376959.1|  short-chain dehydrogenase                        98.2    4e-21    
ref|WP_038340788.1|  gluconate 5-dehydrogenase                        98.2    4e-21    
ref|WP_013084812.1|  3-ketoacyl-ACP reductase                         98.2    4e-21    
ref|WP_005891534.1|  short-chain dehydrogenase                        98.2    4e-21    
ref|WP_006323105.1|  3-ketoacyl-ACP reductase                         98.2    4e-21    
ref|WP_032295593.1|  hypothetical protein                             98.2    4e-21    
ref|WP_042091301.1|  gluconate 5-dehydrogenase                        98.2    4e-21    
ref|WP_024694287.1|  short-chain dehydrogenase                        98.2    4e-21    
ref|WP_000998703.1|  MULTISPECIES: gluconate 5-dehydrogenase          98.2    4e-21    
ref|WP_001552303.1|  gluconate 5-dehydrogenase                        98.2    4e-21    
ref|WP_000998699.1|  gluconate 5-dehydrogenase                        98.2    4e-21    
ref|WP_025388988.1|  short-chain dehydrogenase                        98.2    4e-21    
ref|WP_031410459.1|  3-oxoacyl-ACP reductase                          98.2    4e-21    
ref|WP_032230425.1|  gluconate 5-dehydrogenase                        98.2    4e-21    
ref|WP_000998702.1|  gluconate 5-dehydrogenase                        98.2    4e-21    
ref|WP_021523336.1|  gluconate 5-dehydrogenase                        98.2    4e-21    
ref|WP_042064593.1|  gluconate 5-dehydrogenase                        98.2    4e-21    
ref|WP_024240877.1|  gluconate 5-dehydrogenase                        98.2    4e-21    
ref|WP_021574893.1|  gluconate 5-dehydrogenase                        98.2    4e-21    
ref|WP_021529940.1|  gluconate 5-dehydrogenase                        98.2    4e-21    
ref|WP_033808557.1|  gluconate 5-dehydrogenase                        98.2    4e-21    
ref|WP_042321751.1|  gluconate 5-dehydrogenase                        98.2    4e-21    
ref|WP_021529186.1|  gluconate 5-dehydrogenase                        98.2    4e-21    
ref|WP_000998695.1|  MULTISPECIES: 5-keto-D-gluconate-5-reductase     98.2    4e-21    
ref|WP_001523839.1|  MULTISPECIES: gluconate 5-dehydrogenase          98.2    4e-21    
ref|WP_003739222.1|  3-ketoacyl-ACP reductase                         97.8    4e-21    
ref|WP_031621669.1|  gluconate 5-dehydrogenase                        96.7    4e-21    
ref|WP_000998698.1|  gluconate 5-dehydrogenase                        98.2    5e-21    
ref|WP_001600925.1|  gluconate 5-dehydrogenase                        97.8    5e-21    
gb|EJY56944.1|  short-chain dehydrogenase/reductase SDR               97.8    5e-21    
ref|WP_033779971.1|  short-chain dehydrogenase                        97.8    5e-21    
ref|XP_004981042.1|  PREDICTED: L-xylulose reductase-like             98.2    5e-21    
ref|WP_015094660.1|  short-chain dehydrogenase/reductase SDR          97.8    5e-21    
ref|WP_009732857.1|  MULTISPECIES: 3-ketoacyl-ACP reductase           97.8    5e-21    
ref|WP_007476457.1|  3-ketoacyl-ACP reductase                         97.8    5e-21    
ref|WP_012008830.1|  glucose-1-dehydrogenase                          97.8    5e-21    
ref|WP_040288440.1|  3-oxoacyl-ACP reductase                          97.8    5e-21    
ref|WP_038157360.1|  gluconate 5-dehydrogenase                        97.8    5e-21    
ref|WP_042894079.1|  3-oxoacyl-ACP reductase                          97.8    5e-21    
ref|WP_010787553.1|  Glucose 1-dehydrogenase                          97.8    5e-21    
ref|WP_026675905.1|  3-oxoacyl-ACP reductase                          97.8    5e-21    
ref|WP_005070678.1|  hypothetical protein                             97.8    5e-21    
ref|WP_029421226.1|  3-oxoacyl-ACP reductase                          97.8    5e-21    
ref|WP_011646160.1|  MULTISPECIES: 2-dehydro-3-deoxy-D-gluconate ...  97.8    5e-21    
ref|WP_000998696.1|  gluconate 5-dehydrogenase                        97.8    5e-21    
ref|WP_016234056.1|  gluconate 5-dehydrogenase                        97.8    5e-21    
ref|WP_001596443.1|  gluconate 5-dehydrogenase                        97.8    5e-21    
ref|WP_037010453.1|  short-chain dehydrogenase                        97.8    5e-21    
ref|WP_019842230.1|  oxidoreductase                                   97.8    5e-21    
ref|XP_002980667.1|  hypothetical protein SELMODRAFT_112748           97.1    6e-21    
ref|WP_001395231.1|  gluconate 5-dehydrogenase                        97.8    6e-21    
ref|WP_044424919.1|  short-chain dehydrogenase                        97.8    6e-21    
ref|WP_019649740.1|  short-chain dehydrogenase                        97.8    6e-21    
ref|WP_000998693.1|  gluconate 5-dehydrogenase                        97.8    6e-21    
emb|CEA12535.1|  hypothetical protein DSM1535_0170                    97.8    6e-21    
ref|WP_003258380.1|  short-chain dehydrogenase                        97.4    6e-21    
ref|WP_018705172.1|  3-ketoacyl-ACP reductase                         97.4    6e-21    
ref|WP_041508196.1|  sugar dehydrogenase                              97.8    6e-21    
ref|WP_010246831.1|  short-chain dehydrogenase                        97.4    6e-21    
ref|WP_037617075.1|  3-oxoacyl-ACP reductase                          97.4    6e-21    
ref|WP_024217823.1|  gluconate 5-dehydrogenase                        97.8    6e-21    
ref|WP_013973349.1|  MULTISPECIES: short-chain dehydrogenase          97.4    6e-21    
ref|WP_042999262.1|  MULTISPECIES: gluconate 5-dehydrogenase          97.4    6e-21    
ref|WP_017987774.1|  short-chain dehydrogenase                        97.4    6e-21    
ref|WP_001476107.1|  gluconate 5-dehydrogenase                        97.4    7e-21    



>emb|CDP06201.1| unnamed protein product [Coffea canephora]
Length=285

 Score =   332 bits (852),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS++GPAIEAAVQ+AWDAFGRIDAL+NNAGVRGR+HTPLDL+EEEWN++ KTNLTGT
Sbjct  82   ELDVSSNGPAIEAAVQKAWDAFGRIDALVNNAGVRGRLHTPLDLSEEEWNNIIKTNLTGT  141

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+RM +AK GG +++ISSISGLNRGQLPGGLAY ++K A+N +T+VMA+ELG 
Sbjct  142  WLVSKYVCIRMRDAKQGGCVINISSISGLNRGQLPGGLAYASAKVAINTMTKVMAMELGE  201

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSISPGLFKSEIT+GLMQKDWL  VAL+TVPLRT+GT++PALTS++RYLIHDSSE
Sbjct  202  HKIRVNSISPGLFKSEITEGLMQKDWLKNVALKTVPLRTYGTADPALTSVIRYLIHDSSE  261

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVDAG TLPG+PIFSSL
Sbjct  262  YVSGNNFIVDAGTTLPGLPIFSSL  285



>ref|XP_009588398.1| PREDICTED: carbonyl reductase [NADPH] 2-like [Nicotiana tomentosiformis]
Length=288

 Score =   317 bits (812),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSA+GP IEAAVQ+AWDAFGRIDAL+NNAGVRG VH+PLDL+EEEW+++ +TNL G 
Sbjct  85   ELDVSANGPIIEAAVQKAWDAFGRIDALVNNAGVRGSVHSPLDLSEEEWDNIYRTNLKGA  144

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+RM +A  GGS+++ISSI+GLNRGQLPGGLAY +SKTA+N + ++MALELG 
Sbjct  145  WLVSKYVCIRMRDANQGGSVINISSIAGLNRGQLPGGLAYASSKTALNTVMKMMALELGP  204

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSISPGLF+SEIT+GLMQKDWL+ +ALRT+PLRT GTS+PALTS+VRYLIHDSSE
Sbjct  205  YKIRVNSISPGLFRSEITEGLMQKDWLHNIALRTIPLRTHGTSDPALTSVVRYLIHDSSE  264

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IV+AG TLPGVPIFSSL
Sbjct  265  YVSGNIFIVEAGATLPGVPIFSSL  288



>ref|XP_002517315.1| 2,4-dienoyl-CoA reductase, putative [Ricinus communis]
 gb|EEF45108.1| 2,4-dienoyl-CoA reductase, putative [Ricinus communis]
Length=285

 Score =   311 bits (798),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV ADGP I+ +VQ AWDAFGRIDAL+NNAGVRG V TPLDL+EEEW  + KTNL G+
Sbjct  82   ELDVCADGPTIDKSVQIAWDAFGRIDALVNNAGVRGNVKTPLDLSEEEWELVVKTNLKGS  141

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            W+VSKYVC+RM +AK GGSIV+ISSI+GLNRGQLPG +AY +SK  +NALT+VMALELG 
Sbjct  142  WIVSKYVCIRMRDAKLGGSIVNISSIAGLNRGQLPGAVAYASSKAGLNALTKVMALELGV  201

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            + IRVNSISPGLFKSEIT+GLMQKDWL  +ALRTVPLR +GTS+PALTSLVRYLIHDSSE
Sbjct  202  HNIRVNSISPGLFKSEITEGLMQKDWLRNIALRTVPLREYGTSDPALTSLVRYLIHDSSE  261

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN ++VDAG TLPGVPIFSSL
Sbjct  262  YVSGNIFVVDAGATLPGVPIFSSL  285



>ref|XP_004294537.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=282

 Score =   308 bits (788),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSADG AI+ +VQ+AWDAFGRIDALINNAGVRG V + L+L+EEEWN+  KTNLTGT
Sbjct  79   ELDVSADGSAIQKSVQKAWDAFGRIDALINNAGVRGTVASALELSEEEWNNTLKTNLTGT  138

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYV L M NA  GGSI++ISSI+GLNRG LPGG AY  SK AVN L++VMALELG 
Sbjct  139  WLVSKYVSLCMRNADKGGSIINISSIAGLNRGYLPGGPAYNCSKGAVNTLSKVMALELGA  198

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVN+ISPGLF+SEIT+GLMQKDWL+ VA+RTVPLRTFGTS+PALTSLVRYLIHDSSE
Sbjct  199  HKIRVNAISPGLFRSEITEGLMQKDWLHNVAMRTVPLRTFGTSDPALTSLVRYLIHDSSE  258

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN YIVDAG TLPGVPIFSSL
Sbjct  259  YVSGNIYIVDAGATLPGVPIFSSL  282



>gb|KDP23890.1| hypothetical protein JCGZ_26632 [Jatropha curcas]
Length=285

 Score =   308 bits (788),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELD+SADG  I+ +VQ AWDAFGRIDAL+NNAGVRG V TPLDL+EEEWN + +TNLTGT
Sbjct  82   ELDISADGVTIDKSVQTAWDAFGRIDALVNNAGVRGTVKTPLDLSEEEWNQVHRTNLTGT  141

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK VC RM + K GGSI++ISSI+GL+RGQLPGGLAYTTSKT +NA+T+VMALELG 
Sbjct  142  WLVSKSVCKRMRDGKQGGSIINISSIAGLDRGQLPGGLAYTTSKTGINAMTKVMALELGV  201

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSISPGLFKSEIT+ LMQKDWL  VA + VPLRT G S+PALTSLVRYLIHDSSE
Sbjct  202  HKIRVNSISPGLFKSEITEHLMQKDWLTNVAKKIVPLRTHGASDPALTSLVRYLIHDSSE  261

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +I+DAG TLPGVPIFSSL
Sbjct  262  YVSGNIFIIDAGATLPGVPIFSSL  285



>ref|XP_006482063.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Citrus sinensis]
Length=276

 Score =   306 bits (785),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELD+ ADG AIE++VQ+AW+AFGRID LINNAGVRG V +PLD TEEEW+   KTNLTG+
Sbjct  73   ELDICADGAAIESSVQKAWEAFGRIDVLINNAGVRGSVKSPLDWTEEEWDHNIKTNLTGS  132

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+RM +A  GGSI++ISSI+G+NRGQLPGG+AY +SK  +N++T+VMALELG 
Sbjct  133  WLVSKYVCIRMRDANLGGSIINISSIAGINRGQLPGGVAYASSKAGLNSMTKVMALELGV  192

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            + IRVNSISPGLF+SEIT+GLMQK WLN VAL+TVPLR FGTS+PALTSLVRYLIHDSS+
Sbjct  193  HNIRVNSISPGLFRSEITEGLMQKKWLNNVALKTVPLREFGTSDPALTSLVRYLIHDSSK  252

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVDAG TLPGVPIFSSL
Sbjct  253  YVSGNMFIVDAGATLPGVPIFSSL  276



>ref|XP_011075453.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
isoform X2 [Sesamum indicum]
Length=312

 Score =   308 bits (788),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+A GP IEA+VQ+AWDAFGRIDALINNAGVRG VHTPLDLTE+EWND+ +TNLTGT
Sbjct  109  ELDVTASGPIIEASVQKAWDAFGRIDALINNAGVRGSVHTPLDLTEDEWNDIIRTNLTGT  168

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK+VC  M +AK GGS+++ISSI+GL+RGQLPG L Y  SK AVN +T+VMA+ELG 
Sbjct  169  WLVSKHVCRLMRDAKRGGSVINISSIAGLDRGQLPGSLVYAASKAAVNTMTKVMAMELGV  228

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSI+PGLF+SEIT GLMQKDWL  VA +TVPLRT+G S+PALTSL RYLIHDSSE
Sbjct  229  YKIRVNSIAPGLFQSEITQGLMQKDWLKIVAAKTVPLRTYGESDPALTSLARYLIHDSSE  288

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IV+AG TLPG+PI+SSL
Sbjct  289  YVSGNVFIVEAGATLPGIPIYSSL  312



>ref|XP_010055797.1| PREDICTED: carbonyl reductase [NADPH] 2-like [Eucalyptus grandis]
 gb|KCW90025.1| hypothetical protein EUGRSUZ_A02228 [Eucalyptus grandis]
Length=282

 Score =   306 bits (785),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELD++A G AIE +V  AWDAFGRIDALINNAGVRG V +PL+L+EEEWN   KTNLTG+
Sbjct  79   ELDIAAGGAAIERSVGSAWDAFGRIDALINNAGVRGSVKSPLELSEEEWNHTFKTNLTGS  138

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+RM +A  GGSIV+ISSI+GLNRGQLPGG+AYT+SK A+N +T+VMALELG 
Sbjct  139  WLVSKYVCIRMRDAHQGGSIVNISSIAGLNRGQLPGGVAYTSSKAALNTMTKVMALELGE  198

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSISPGLFKSEIT GLMQ+DWLN VA +TVPLRT+GTS+PALT+L+RYLIHDSSE
Sbjct  199  YKIRVNSISPGLFKSEITQGLMQRDWLNNVAEKTVPLRTYGTSDPALTTLIRYLIHDSSE  258

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            YI+GN +IVDAG TLPGVPIFSSL
Sbjct  259  YITGNIFIVDAGATLPGVPIFSSL  282



>gb|KDO53625.1| hypothetical protein CISIN_1g023885mg [Citrus sinensis]
Length=276

 Score =   305 bits (782),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV ADG AIE++VQ+AW+AFGRID LINNAGVRG V +PLD TEEEW+   KTNLTG+
Sbjct  73   ELDVCADGAAIESSVQKAWEAFGRIDVLINNAGVRGSVKSPLDWTEEEWDHNIKTNLTGS  132

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+RM +A  GGSI++ISSI+G+NRGQLPGG+AY +SK  +N++T+VMALELG 
Sbjct  133  WLVSKYVCIRMRDANLGGSIINISSIAGINRGQLPGGVAYASSKAGLNSMTKVMALELGV  192

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            + IRVNSISPGLF SEIT+GLMQK WLN VAL+TVPLR FGTS+PALTSLVRYLIHDSS+
Sbjct  193  HNIRVNSISPGLFISEITEGLMQKKWLNNVALKTVPLREFGTSDPALTSLVRYLIHDSSK  252

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVDAG TLPGVPIFSSL
Sbjct  253  YVSGNMFIVDAGATLPGVPIFSSL  276



>ref|XP_003518977.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic 
isoform X1 [Glycine max]
 ref|XP_006575129.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic 
isoform X2 [Glycine max]
Length=282

 Score =   305 bits (780),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+AD PA++  VQ+AW+AFG IDALINNAGVRG V +PL+L+EEEWN   +TNLTGT
Sbjct  79   ELDVAADDPAVDKYVQKAWEAFGHIDALINNAGVRGNVKSPLELSEEEWNHAFRTNLTGT  138

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC RM +A+  GSI++I+SI+GLNRGQLPGG AY++SK  VN LTRVMALELG 
Sbjct  139  WLVSKYVCKRMRDAQRKGSIINIASIAGLNRGQLPGGAAYSSSKAGVNMLTRVMALELGA  198

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSISPGLFKSEIT+ LM+K+WLN VA++TVPLR FGTS+PALTSL RYLIHDSSE
Sbjct  199  HKIRVNSISPGLFKSEITEKLMEKNWLNNVAMKTVPLRKFGTSDPALTSLARYLIHDSSE  258

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN ++VDAG TLPGVPI+SSL
Sbjct  259  YVSGNNFVVDAGATLPGVPIYSSL  282



>gb|EYU20812.1| hypothetical protein MIMGU_mgv1a011359mg [Erythranthe guttata]
Length=284

 Score =   303 bits (775),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSA GP IEA+VQ+AW AFGRIDALINNAG+RG++HTPLDLTEEEW+   +TNLTGT
Sbjct  81   ELDVSASGPTIEASVQKAWAAFGRIDALINNAGIRGKIHTPLDLTEEEWDITMRTNLTGT  140

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC RM +AK  GS+VSISSI+GL RGQLPGGLAY  SKTA+N +T+VMALELG 
Sbjct  141  WLVSKYVCTRMRDAKISGSLVSISSIAGLERGQLPGGLAYACSKTAINTMTKVMALELGI  200

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVNSISPGLFKSEIT GL++K WL  V  RTVPLR++GT +PALTSL+RYLIHDSS+
Sbjct  201  YGIRVNSISPGLFKSEITQGLVEKHWLKNVERRTVPLRSYGTLDPALTSLLRYLIHDSSK  260

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
             ++GN +IVDAG TLPGVPIFSSL
Sbjct  261  QVTGNLFIVDAGTTLPGVPIFSSL  284



>gb|EYU18609.1| hypothetical protein MIMGU_mgv1a011131mg [Erythranthe guttata]
Length=291

 Score =   303 bits (775),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSA G  IEA+VQ+AWDAFGRIDALINNAGVRG VHTPL+L E+EWN++ +TN TG 
Sbjct  88   ELDVSAGGATIEASVQKAWDAFGRIDALINNAGVRGSVHTPLNLREDEWNEIVRTNQTGA  147

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC  M +AK GGS+V+ISSI+GLNRGQLPG LAY  SKTAVN +T++MA+ELG 
Sbjct  148  WLVSKYVCSHMRDAKQGGSVVNISSIAGLNRGQLPGSLAYAASKTAVNTMTKMMAIELGV  207

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVNSISPGLFKSEIT+ LM+KDWL  VA +TVPLRT+G S+PALTSLVRYLIH+SSE
Sbjct  208  YGIRVNSISPGLFKSEITENLMEKDWLKNVATKTVPLRTYGESDPALTSLVRYLIHESSE  267

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN Y+V+AG TLPGVPIFSSL
Sbjct  268  YVSGNVYVVEAGATLPGVPIFSSL  291



>emb|CAN64848.1| hypothetical protein VITISV_036158 [Vitis vinifera]
Length=286

 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV++DG +I A+VQ+AW+AFGRIDAL+NNAG+RG V++PLD++EEEWN+  KTNLTG+
Sbjct  83   ELDVTSDGSSIGASVQKAWEAFGRIDALLNNAGIRGNVNSPLDISEEEWNNTLKTNLTGS  142

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYV LRM +AK GGSI++ISSI+ LNRGQLPGG+AY +SK+ ++A+T+VMALELG 
Sbjct  143  WLVSKYVGLRMRDAKNGGSIINISSIAALNRGQLPGGVAYVSSKSGLSAMTKVMALELGA  202

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IR N+I+PGLFKSEIT GLMQKDWLN VA RT P+RTFGTS+PALTSLVRYLIHDSS 
Sbjct  203  YNIRANAIAPGLFKSEITSGLMQKDWLNTVAQRTCPMRTFGTSDPALTSLVRYLIHDSSR  262

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            YISGN +IVDAG TLPGVPIFSSL
Sbjct  263  YISGNIFIVDAGATLPGVPIFSSL  286



>gb|ABK93994.1| unknown [Populus trichocarpa]
Length=290

 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSADG  I+  VQ+AWDAFG IDAL+NNAGVRG V  PL+L+EEEWN + +TN TGT
Sbjct  87   ELDVSADGNTIDKCVQKAWDAFGGIDALVNNAGVRGTVRDPLELSEEEWNHVIRTNTTGT  146

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK VC+RM ++K GGS+++I+SI+GLNRGQLPGG+ Y  SKT VNA+++VMA+ELG 
Sbjct  147  WLVSKAVCIRMRDSKRGGSVINIASIAGLNRGQLPGGIHYVASKTGVNAISKVMAMELGA  206

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSISPGLFKSEIT GLMQKDWL+ VAL+TVPLRTFGT++PALTSL RYLIHDSSE
Sbjct  207  YKIRVNSISPGLFKSEITQGLMQKDWLSNVALKTVPLRTFGTADPALTSLARYLIHDSSE  266

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GN +IVDAG TLPGVP+FSSL
Sbjct  267  YVTGNNFIVDAGATLPGVPLFSSL  290



>gb|KDO53624.1| hypothetical protein CISIN_1g023555mg [Citrus sinensis]
Length=280

 Score =   301 bits (772),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSA+G AIE +VQ+AW+AFGRIDAL+NNAGV G V +PLDLTEEEWN + KTNLTG+
Sbjct  77   ELDVSANGAAIENSVQKAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGS  136

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+RM +A   GS+++ISSI+  +RGQLPGG+AY +SK  +NA+T+ ++LELG 
Sbjct  137  WLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGV  196

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSI PGLFKSEIT+GLM+KDWLN VA RT PLR FGT++PALTSLVRYL+HDSSE
Sbjct  197  HKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSE  256

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVD+G TLPG+PIFSSL
Sbjct  257  YVSGNIFIVDSGATLPGLPIFSSL  280



>pir||S39508 alcohol dehydrogenase homolog, ripening-related - tomato  (fragment)
Length=242

 Score =   300 bits (768),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSA+G AIEAAVQ+AWDAFGRID L+NNAG RG V +PL+L+EEEW  + KTNL G 
Sbjct  39   ELDVSANGSAIEAAVQKAWDAFGRIDGLVNNAGFRGSVLSPLELSEEEWEKIHKTNLRGA  98

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLV+KYVC+ M  A  GGSI++ISSI+G+NRGQLPG LAYT+SK A+N++T+V+ALELG 
Sbjct  99   WLVTKYVCMHMRAANQGGSIINISSIAGINRGQLPGSLAYTSSKEALNSITKVLALELGP  158

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSISPGLFKSEIT+GL+QKDW+  + LRT+PLRT GTS+PALTS+VRYLIHDSSE
Sbjct  159  YKIRVNSISPGLFKSEITEGLIQKDWIKNIELRTIPLRTHGTSHPALTSVVRYLIHDSSE  218

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVDAG TLPGVPIFSSL
Sbjct  219  YVSGNMFIVDAGATLPGVPIFSSL  242



>ref|XP_002323240.1| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
 gb|EEF05001.1| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
Length=290

 Score =   301 bits (772),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSADG  I+  VQ+AWDAFG IDAL+NNAGVRG V  PL+L+EEEWN + +TN TGT
Sbjct  87   ELDVSADGNTIDKCVQKAWDAFGGIDALVNNAGVRGTVRDPLELSEEEWNHVIRTNTTGT  146

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK VC+RM ++K GGS+++I+SI+GLNRGQLPGG+ Y  SKT VNA+++VMA+ELG 
Sbjct  147  WLVSKAVCIRMRDSKRGGSVINIASIAGLNRGQLPGGIHYVASKTGVNAISKVMAMELGA  206

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSISPGLFKSEIT GLMQKDWL+ VAL+TVPLRTFGT++PALTSL RYLIHDSSE
Sbjct  207  YKIRVNSISPGLFKSEITQGLMQKDWLSNVALKTVPLRTFGTADPALTSLARYLIHDSSE  266

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GN +IVDAG TLPGVP+FSSL
Sbjct  267  YVTGNNFIVDAGATLPGVPLFSSL  290



>ref|XP_006430534.1| hypothetical protein CICLE_v10012432mg [Citrus clementina]
 gb|ESR43774.1| hypothetical protein CICLE_v10012432mg [Citrus clementina]
Length=276

 Score =   301 bits (771),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV ADG AIE++VQ+AW+AF RID LINNAGVRG V +PLD TEEEW+   KTNLTG+
Sbjct  73   ELDVCADGAAIESSVQKAWEAFWRIDVLINNAGVRGSVKSPLDWTEEEWDHNIKTNLTGS  132

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+RM +A  GGSI++ISSI+G+NRGQLPGG+AY +SK  +N++T+VMALELG 
Sbjct  133  WLVSKYVCIRMRDANLGGSIINISSIAGINRGQLPGGVAYASSKAGLNSMTKVMALELGV  192

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            + IRVNSISPGLF SEIT+GLMQK WLN VAL+TVPLR FGTS+PALTSLVRYLIHDSS+
Sbjct  193  HNIRVNSISPGLFISEITEGLMQKKWLNNVALKTVPLREFGTSDPALTSLVRYLIHDSSK  252

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVDAG TLPGVPIFSSL
Sbjct  253  YVSGNMFIVDAGATLPGVPIFSSL  276



>ref|XP_010653621.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic 
[Vitis vinifera]
Length=286

 Score =   301 bits (771),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV++DG +I A+VQ+AW+AFGRIDAL+NNAG+RG V++PLD++EEEWN+  KTNLTG+
Sbjct  83   ELDVTSDGSSIGASVQKAWEAFGRIDALLNNAGIRGNVNSPLDISEEEWNNTLKTNLTGS  142

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYV +RM +AK GGSI++ISSI+ LNRGQLPGG+AY +SK+ ++A+T+VMALELG 
Sbjct  143  WLVSKYVGMRMRDAKNGGSIINISSIAALNRGQLPGGVAYVSSKSGLSAMTKVMALELGA  202

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IR N+I+PGLFKSEIT GLMQKDWLN VA RT P+RTFGTS+PALTSLVRYLIHDSS 
Sbjct  203  YNIRANAIAPGLFKSEITSGLMQKDWLNTVAQRTCPMRTFGTSDPALTSLVRYLIHDSSR  262

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            YISGN +IVDAG TLPGVPIFSSL
Sbjct  263  YISGNIFIVDAGATLPGVPIFSSL  286



>ref|XP_004249319.1| PREDICTED: carbonyl reductase [NADPH] 2-like [Solanum lycopersicum]
Length=287

 Score =   300 bits (767),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSA+G AIEAAVQ+AWDAFGRID L+NNAG RG V +PL+L+EEEW  + KTNL G 
Sbjct  84   ELDVSANGSAIEAAVQKAWDAFGRIDGLVNNAGFRGSVLSPLELSEEEWEKIHKTNLRGA  143

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLV+KYVC+ M  A  GGSI++ISSI+G+NRGQLPG LAYT+SK A+N++T+V+ALELG 
Sbjct  144  WLVTKYVCMHMRAANQGGSIINISSIAGINRGQLPGSLAYTSSKEALNSITKVLALELGP  203

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSISPGLFKSEIT+GL+QKDW+  + LRT+PLRT GTS+PALTS+VRYLIHDSSE
Sbjct  204  YKIRVNSISPGLFKSEITEGLIQKDWIKNIELRTIPLRTHGTSHPALTSVVRYLIHDSSE  263

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVDAG TLPGVPIFSSL
Sbjct  264  YVSGNMFIVDAGATLPGVPIFSSL  287



>emb|CDP20582.1| unnamed protein product [Coffea canephora]
Length=285

 Score =   299 bits (765),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            +LDVSADGPAIEA VQ+AWDAFGRIDAL+NNAGVRGRVHTPLDL+EEEWN++ KT+LTGT
Sbjct  82   KLDVSADGPAIEADVQKAWDAFGRIDALVNNAGVRGRVHTPLDLSEEEWNNIIKTDLTGT  141

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+ M +AK GG +++ISSI+GL+RGQLPG LAY ++K A+N +T+VMA+ELG 
Sbjct  142  WLVSKYVCIHMRDAKQGGCVINISSIAGLDRGQLPGALAYASAKAAINTMTKVMAMELGK  201

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSI+PG+FKSEIT+GLM+KDWL  V L+TVPL TFGT +PALTSL+RYLI DSSE
Sbjct  202  HKIRVNSIAPGIFKSEITEGLMEKDWLKNVTLKTVPLGTFGTIDPALTSLIRYLILDSSE  261

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVDAG TLPG PIFSSL
Sbjct  262  YVSGNIFIVDAGATLPGFPIFSSL  285



>ref|XP_006482064.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Citrus sinensis]
Length=296

 Score =   299 bits (765),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSA+G AIE +VQ AW+AFGRIDAL+NNAGV G V +PLDLTEEEWN + KTNLTG+
Sbjct  93   ELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGS  152

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+RM +A   GS+++ISSI+  +RGQLPGG+AY +SK  +NA+T+ ++LELG 
Sbjct  153  WLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGV  212

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSI PGLFKSEIT+GLM+KDWLN VA RT PLR FGT++PALTSLVRYL+HDSSE
Sbjct  213  HKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSE  272

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVD+G TLPG+PIFSSL
Sbjct  273  YVSGNIFIVDSGATLPGLPIFSSL  296



>ref|XP_009371362.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Pyrus x bretschneideri]
Length=295

 Score =   299 bits (765),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSADGPAIE +V +AWDAFG IDAL+NNAG+RG V + L+L+EEEWN + +TNLTGT
Sbjct  92   ELDVSADGPAIEKSVNKAWDAFGHIDALVNNAGIRGNVSSALELSEEEWNHVFRTNLTGT  151

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK+V +RM +A  GGSIV+ISSI+GLNRG LPG  AY  SK  VN LT+ MA+ELG 
Sbjct  152  WLVSKFVAIRMRDADQGGSIVNISSIAGLNRGYLPGATAYNCSKAGVNTLTKTMAMELGV  211

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVN+ISPGLF+SEIT+GLMQKDWL+ VA++TVPLRTFG S+PALTSLVRYL+HDSSE
Sbjct  212  HKIRVNAISPGLFRSEITEGLMQKDWLHNVAMKTVPLRTFGASDPALTSLVRYLVHDSSE  271

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN YIVDAG TLPGVPIFSSL
Sbjct  272  YVSGNIYIVDAGATLPGVPIFSSL  295



>ref|XP_006430535.1| hypothetical protein CICLE_v10012421mg [Citrus clementina]
 gb|ESR43775.1| hypothetical protein CICLE_v10012421mg [Citrus clementina]
Length=280

 Score =   298 bits (764),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSA+G AI  +VQ+AW+AFGRIDAL+NNAGV G V +PLDLTEEEWN + KTNLTG+
Sbjct  77   ELDVSANGAAIGNSVQKAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGS  136

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+RM +A   GS+++ISSI+  +RGQLPGG+AY +SK  +NA+T+ ++LELG 
Sbjct  137  WLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGV  196

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSI PGLFKSEIT+GLM+KDWLN VA RT PLR FGT++PALTSLVRYL+HDSSE
Sbjct  197  HKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSE  256

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVD+G TLPG+PIFSSL
Sbjct  257  YVSGNIFIVDSGATLPGLPIFSSL  280



>ref|XP_010943529.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Elaeis guineensis]
Length=295

 Score =   298 bits (764),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSA   AIEA+VQ+AW+AFGRIDAL+NNAGVRG V++PLD +EEEWN +  TNLTG 
Sbjct  92   ELDVSAGSAAIEASVQKAWEAFGRIDALVNNAGVRGGVYSPLDWSEEEWNHIITTNLTGL  151

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC +M +AK  GS+++ISSI G+NRGQLPGG+AYT SK  VNA+T+VMALELG 
Sbjct  152  WLVSKYVCRQMRDAKQKGSVINISSIGGINRGQLPGGIAYTASKAGVNAITKVMALELGV  211

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            + IRVNSI+PGLF SEIT GLMQ+ WLN VA +TVPL+T+GTS+PALTSLVRYLIHDSSE
Sbjct  212  HNIRVNSIAPGLFSSEITAGLMQRKWLNDVAKKTVPLQTYGTSDPALTSLVRYLIHDSSE  271

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GN +IVDAG TLPG+PIFSSL
Sbjct  272  YVTGNIFIVDAGVTLPGIPIFSSL  295



>ref|XP_008808086.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Phoenix dactylifera]
Length=294

 Score =   298 bits (764),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSA G AIEA+VQRAW+AFGRIDAL+NNAG+RG V++PLD +EEEWN +  TNLTG 
Sbjct  91   ELDVSAGGAAIEASVQRAWEAFGRIDALVNNAGIRGGVYSPLDWSEEEWNHVITTNLTGL  150

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC +M +AK  GS+++ISSI G+NRGQLPGG+AYT SK  VNA+T+VMALELG 
Sbjct  151  WLVSKYVCRQMRDAKQKGSVINISSIGGINRGQLPGGIAYTASKAGVNAITKVMALELGA  210

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVNSI+PGLF SEIT GLMQ+ WL+ VA +TVPL+T+GTS+PALTSLVRYLIHDSSE
Sbjct  211  YNIRVNSIAPGLFSSEITAGLMQRKWLDNVAKKTVPLQTYGTSDPALTSLVRYLIHDSSE  270

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GN +IVDAG TLPG+PIFSSL
Sbjct  271  YVTGNIFIVDAGVTLPGIPIFSSL  294



>ref|NP_001274762.1| putative short-chain type alcohol dehydrogenase [Solanum tuberosum]
 gb|AAK29646.1|AF349916_1 putative short-chain type alcohol dehydrogenase [Solanum tuberosum]
Length=283

 Score =   298 bits (763),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSA+G AIEAAVQ+AWD FGRID L+NNAG+RG VH+PLDL+EEEW    KTNL G 
Sbjct  80   ELDVSANGSAIEAAVQKAWDVFGRIDGLVNNAGIRGSVHSPLDLSEEEWEKTYKTNLRGA  139

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLV+K+VC  M  A   GS+++ISSI+GLN GQLPG LAY +SK A+N++T+V+ALELG 
Sbjct  140  WLVTKFVCKHMRAANQEGSVINISSIAGLNPGQLPGCLAYASSKEALNSITKVLALELGP  199

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSISPGLFKSEIT+GL+QKDWL  + LRT+PLRT GTSNPALTS+VRYLIHDSSE
Sbjct  200  YKIRVNSISPGLFKSEITEGLIQKDWLQNIELRTIPLRTHGTSNPALTSVVRYLIHDSSE  259

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVDAG TLPGVPIFSSL
Sbjct  260  YVSGNMFIVDAGATLPGVPIFSSL  283



>ref|XP_009417296.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=287

 Score =   298 bits (763),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSAD PAI A+VQRAWDAFGRID L+NNAGVRG VH+PLD +EEEW+   +TNLTG 
Sbjct  84   ELDVSADEPAIAASVQRAWDAFGRIDGLVNNAGVRGDVHSPLDWSEEEWSSNIRTNLTGL  143

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK+VC  M +AK  GS+++ISSI G+ RGQLPGGLAY  SKT VNA+T+VMALELG 
Sbjct  144  WLVSKHVCKHMRDAKQKGSVINISSIGGIERGQLPGGLAYVASKTGVNAVTKVMALELGA  203

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVNSI+PGLFKSEITDGLM+++WLNKVA RTVPLRT+GT +PALTS+VR+L+HDSS 
Sbjct  204  FNIRVNSIAPGLFKSEITDGLMKREWLNKVAERTVPLRTYGTLDPALTSIVRFLMHDSSA  263

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN ++VDAG TLPG+P+FSSL
Sbjct  264  YVSGNIFVVDAGVTLPGIPLFSSL  287



>ref|XP_003518969.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic 
[Glycine max]
Length=282

 Score =   298 bits (762),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+ADGPAI+ AVQ+AWDAFGR+D+LINNAGVRG V +PL L+EEEW+ + KTNLTG 
Sbjct  79   ELDVAADGPAIDRAVQKAWDAFGRVDSLINNAGVRGSVKSPLKLSEEEWDHVFKTNLTGC  138

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC RMC+ +  GSI++ISS+SGLNRGQLPG  AY +SK  VN LT+VMA+ELG 
Sbjct  139  WLVSKYVCKRMCDIQLKGSIINISSVSGLNRGQLPGAAAYASSKAGVNMLTKVMAMELGM  198

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSISPG+FKSEIT+ L+QKDWLN V  + +PLR  GTS+PALTSL RYLIHDSSE
Sbjct  199  HKIRVNSISPGIFKSEITENLLQKDWLNDVVRKIMPLRRLGTSDPALTSLARYLIHDSSE  258

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GN +IVD G TLPGVPI+SSL
Sbjct  259  YVTGNNFIVDYGGTLPGVPIYSSL  282



>ref|XP_006482062.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Citrus sinensis]
Length=282

 Score =   297 bits (761),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV ADG  IE +VQ+AW+AFGR+DAL+NNAG+RG V +PL+++EEEWN + KTNLTG 
Sbjct  79   ELDVCADGATIEISVQKAWEAFGRVDALVNNAGIRGNVKSPLEMSEEEWNRVVKTNLTGC  138

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLV+KYVC+RM +AK GGS+++ISS  GLNRG LPGG+AY +SK  +NA+T+VMALELG 
Sbjct  139  WLVAKYVCIRMRDAKQGGSVINISSTGGLNRGHLPGGVAYASSKAGLNAMTKVMALELGA  198

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVN ISPG+F+SEIT  LM+KDWL  VA++TVPLR  GT+ PALTSL+RYL+HDSSE
Sbjct  199  HKIRVNCISPGIFRSEITKALMEKDWLTNVAMKTVPLREHGTTAPALTSLIRYLVHDSSE  258

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVDAG TLPGVPIFSSL
Sbjct  259  YVSGNIFIVDAGTTLPGVPIFSSL  282



>ref|XP_007145484.1| hypothetical protein PHAVU_007G242900g [Phaseolus vulgaris]
 gb|ESW17478.1| hypothetical protein PHAVU_007G242900g [Phaseolus vulgaris]
Length=286

 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELD++ADGP +++ VQ+AWDAFG +DALINNAG+RG V +PL+L+EEEWN   +TNLTGT
Sbjct  83   ELDIAADGPVVDSYVQKAWDAFGHVDALINNAGIRGTVKSPLELSEEEWNHSFRTNLTGT  142

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK VC RM +A+  GSI++I+SI+GLNRGQLPG  AY++SK  VN LT+VMALELG 
Sbjct  143  WLVSKSVCKRMRDAQRKGSIINIASIAGLNRGQLPGSAAYSSSKAGVNILTKVMALELGA  202

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSISPGLFKSEIT+ LM+KDWLNKVA++TVPLR +GT++PALTSL RYLIHDSSE
Sbjct  203  HKIRVNSISPGLFKSEITEKLMEKDWLNKVAMKTVPLRRYGTADPALTSLARYLIHDSSE  262

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GN +IVDAG TLPG+PI+SSL
Sbjct  263  YVTGNNFIVDAGATLPGLPIYSSL  286



>ref|XP_006430531.1| hypothetical protein CICLE_v10012408mg [Citrus clementina]
 gb|ESR43771.1| hypothetical protein CICLE_v10012408mg [Citrus clementina]
Length=282

 Score =   296 bits (759),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV AD   IE +VQ+AW+AFGR+DAL+NNAG+RG V +PL+++EEEWN + KTNLTG 
Sbjct  79   ELDVCADAATIEISVQKAWEAFGRVDALVNNAGIRGSVKSPLEMSEEEWNRVMKTNLTGC  138

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLV+KYVC+RM +AK GGS+++ISS  GLNRG LPGG+AY +SK  +NA+T+VMALELG 
Sbjct  139  WLVAKYVCIRMRDAKQGGSVINISSTGGLNRGHLPGGVAYASSKAGLNAMTKVMALELGA  198

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVN ISPG+F+SEIT  LM+KDWL  VA++TVPLR  GT++PALTSL+RYL+HDSSE
Sbjct  199  HKIRVNCISPGIFRSEITKALMEKDWLTNVAMKTVPLREHGTTDPALTSLIRYLVHDSSE  258

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVDAG TLPGVPIFSSL
Sbjct  259  YVSGNIFIVDAGTTLPGVPIFSSL  282



>ref|XP_006339259.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Solanum tuberosum]
Length=290

 Score =   297 bits (760),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSA+G AIEAAVQ+AW+AFGRID L+NNAG+RG VH+PL+L+EEEW  +  TNL G 
Sbjct  87   ELDVSANGAAIEAAVQKAWNAFGRIDVLVNNAGIRGSVHSPLNLSEEEWEKIYNTNLRGA  146

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLV+KYVC+ M  A  GGS+++ISS +GLNRG+LPG LAY +SK A+N++T+VMA+ELG 
Sbjct  147  WLVTKYVCIHMRAANQGGSVINISSTAGLNRGKLPGSLAYASSKDALNSITKVMAIELGP  206

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSISPG+FKSEIT+ L+QKDW   VAL+T+PLRT GTSNPALTS+VRYLIHDSSE
Sbjct  207  YKIRVNSISPGVFKSEITERLIQKDWFKNVALKTIPLRTHGTSNPALTSVVRYLIHDSSE  266

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVDAG TLPGVPIFSSL
Sbjct  267  YVSGNIFIVDAGATLPGVPIFSSL  290



>ref|XP_007028287.1| 2,4-dienoyl-CoA reductase isoform 2 [Theobroma cacao]
 gb|EOY08789.1| 2,4-dienoyl-CoA reductase isoform 2 [Theobroma cacao]
Length=282

 Score =   296 bits (759),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV A G  I+++V+ AWDAFGRID+LINNAG+RG V  P++L+EEEWN   KTNLTG+
Sbjct  79   ELDVCAKGATIQSSVKTAWDAFGRIDSLINNAGIRGNVKNPMELSEEEWNQTIKTNLTGS  138

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+ M +A  GGSI++ISSI+GLNRGQLPGG+AY  SK  + A+T+ MALELG 
Sbjct  139  WLVSKYVCMHMLDANQGGSIINISSIAGLNRGQLPGGVAYAASKAGLIAMTKSMALELGA  198

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSISPGLFKSEIT GLM+KDWL  VA RT PLRTFGTS+PALTSLVRYLIHDSSE
Sbjct  199  HKIRVNSISPGLFKSEITQGLMKKDWLTNVATRTAPLRTFGTSDPALTSLVRYLIHDSSE  258

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVDAG TLPG+PIFSSL
Sbjct  259  YVSGNMFIVDAGVTLPGIPIFSSL  282



>ref|XP_010112844.1| 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Morus notabilis]
 gb|EXC34967.1| 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Morus notabilis]
Length=283

 Score =   296 bits (758),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV ADGP IE +VQ+AW+AFGRIDALINNAG RG V +PLDL+E+EW+ +  TNL GT
Sbjct  80   ELDVCADGPTIEKSVQKAWEAFGRIDALINNAGFRGNVKSPLDLSEDEWDTVFNTNLKGT  139

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC  M +A  GGS+++ISSISGLNRGQLPGGLAY+ SK  VN L++VMALELG 
Sbjct  140  WLVSKYVCRLMRDAGRGGSVINISSISGLNRGQLPGGLAYSASKAGVNTLSKVMALELGP  199

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSISPGLFKSEIT+GL++KDWL+ V  R VPLRTFGTS+PALTSLVRYLIHDSSE
Sbjct  200  YKIRVNSISPGLFKSEITEGLIKKDWLSIVGERIVPLRTFGTSDPALTSLVRYLIHDSSE  259

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN Y+VDAG+ LP VPIFSSL
Sbjct  260  YVSGNVYVVDAGSILPAVPIFSSL  283



>ref|XP_008805478.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Phoenix dactylifera]
Length=286

 Score =   296 bits (758),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSA   AIEA+VQ+AWDAFGRIDALINNAG+RG +++PL+  EEEWNDL  TNLTG 
Sbjct  83   ELDVSARSSAIEASVQKAWDAFGRIDALINNAGIRGGIYSPLEWPEEEWNDLMATNLTGL  142

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK+VC RM + K  GS++++SSI+GL RGQLPG LAY+ SKT VNALTRVMALELG 
Sbjct  143  WLVSKHVCKRMRDTKQKGSVINVSSINGLERGQLPGNLAYSVSKTGVNALTRVMALELGV  202

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            + IRVNSISPG+FKSEIT GLM K+WL++V  +TVPL+T GTS+PALTSLVRYLIHDS+E
Sbjct  203  HNIRVNSISPGIFKSEITKGLMVKEWLDRVTKKTVPLQTLGTSDPALTSLVRYLIHDSTE  262

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN ++VDAG TLPGVP+FSSL
Sbjct  263  YVSGNVFVVDAGATLPGVPLFSSL  286



>gb|AFK48641.1| unknown [Medicago truncatula]
 gb|KEH30025.1| enoyl-(acyl carrier) reductase [Medicago truncatula]
 gb|KEH30027.1| enoyl-(acyl carrier) reductase [Medicago truncatula]
Length=273

 Score =   296 bits (757),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+ADG AIE  VQ+AW+AFG IDALINNAGVRG V +PL+LTEEEWN++ KTN+TGT
Sbjct  70   ELDVAADGGAIEKYVQKAWEAFGHIDALINNAGVRGNVSSPLELTEEEWNNVFKTNITGT  129

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC  M ++K  GSI++ISSI+GL RGQLPGG AY  SK  VN LT+VMALELG 
Sbjct  130  WLVSKYVCKLMRDSKRKGSIINISSIAGLERGQLPGGTAYACSKAGVNMLTKVMALELGA  189

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSISPGLFKSEIT+ LM+KDWLN VA+RTVPLR +GTSNPALTS+ RYLIHDSSE
Sbjct  190  YKIRVNSISPGLFKSEITESLMKKDWLNNVAIRTVPLREWGTSNPALTSIARYLIHDSSE  249

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GN +I DAG TLPG PI+SSL
Sbjct  250  YVTGNIFIADAGATLPGFPIYSSL  273



>ref|XP_008386836.1| PREDICTED: probable L-xylulose reductase [Malus domestica]
Length=296

 Score =   296 bits (757),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 148/204 (73%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSADGPAIE +V +AWDAFGRIDAL+NNAG+RG V++ L+L+EEEWN + +TNLTG+
Sbjct  93   ELDVSADGPAIEKSVNKAWDAFGRIDALVNNAGIRGNVNSALELSEEEWNHVFRTNLTGS  152

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK+V +RM +A  GGSIV+ISSI+G+NRG LPGG AY  SK  VN LT+ MA+ELG 
Sbjct  153  WLVSKFVAIRMRDADQGGSIVNISSIAGINRGHLPGGTAYICSKAGVNTLTKTMAMELGV  212

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVN+ISPGLF+SEIT+GLMQK W+  VA++ VPLRT+GTS+PALTSL+RYL+HDSSE
Sbjct  213  HKIRVNAISPGLFRSEITEGLMQKKWIPNVAMKIVPLRTYGTSDPALTSLLRYLVHDSSE  272

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN YIVDAG TLPGVPIFSSL
Sbjct  273  YVSGNIYIVDAGTTLPGVPIFSSL  296



>ref|XP_011000407.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Populus euphratica]
 ref|XP_011015779.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Populus euphratica]
Length=290

 Score =   295 bits (756),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSAD   I+  VQ+AWDAFG IDAL+NNAGVRG V  PL+L+EEEWN + +TN TGT
Sbjct  87   ELDVSADENTIDKCVQKAWDAFGGIDALVNNAGVRGTVRDPLELSEEEWNHVIRTNTTGT  146

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK VC+RM ++K GGS+++I+SI+GLNRGQLPGG+ Y  SKT VNA+++VMA+ELG 
Sbjct  147  WLVSKAVCIRMRDSKRGGSVINIASIAGLNRGQLPGGVHYVASKTGVNAISKVMAMELGA  206

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVNSISPGLFKSEIT GLMQKDWL+ VAL+TVPLRTFGT++PALTSL RYLIHDSSE
Sbjct  207  YNIRVNSISPGLFKSEITQGLMQKDWLSNVALKTVPLRTFGTADPALTSLARYLIHDSSE  266

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GN +IVDAG TLPGVP+FSSL
Sbjct  267  YVTGNNFIVDAGATLPGVPLFSSL  290



>gb|AAN32641.1|AF416732_1 putative short-chain type alcohol dehydrogenase [Solanum tuberosum]
Length=290

 Score =   295 bits (756),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSA+G +IEAAVQ+AW+AFGRID L+NNAG+RG VH+PL+L+EEEW  +  TNL G 
Sbjct  87   ELDVSANGASIEAAVQKAWNAFGRIDVLVNNAGIRGSVHSPLNLSEEEWEKIYNTNLRGA  146

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLV+KYVC+ M  A  GG++++ISS +GLNRG+LPG LAY +SK A+N++T+VMA+ELG 
Sbjct  147  WLVTKYVCIHMRAANQGGTVINISSTAGLNRGKLPGSLAYASSKDALNSITKVMAIELGP  206

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSISPG+FKSEIT+ L+QKDW   VAL+T+PLRT GTSNPALTS+VRYLIHDSSE
Sbjct  207  YKIRVNSISPGVFKSEITERLIQKDWFKNVALKTIPLRTHGTSNPALTSVVRYLIHDSSE  266

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVDAG TLPGVPIFSSL
Sbjct  267  YVSGNIFIVDAGATLPGVPIFSSL  290



>ref|XP_011075452.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
isoform X1 [Sesamum indicum]
Length=313

 Score =   296 bits (758),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 175/201 (87%), Gaps = 0/201 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+A GP IEA+VQ+AWDAFGRIDALINNAGVRG VHTPLDLTE+EWND+ +TNLTGT
Sbjct  109  ELDVTASGPIIEASVQKAWDAFGRIDALINNAGVRGSVHTPLDLTEDEWNDIIRTNLTGT  168

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK+VC  M +AK GGS+++ISSI+GL+RGQLPG L Y  SK AVN +T+VMA+ELG 
Sbjct  169  WLVSKHVCRLMRDAKRGGSVINISSIAGLDRGQLPGSLVYAASKAAVNTMTKVMAMELGV  228

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSI+PGLF+SEIT GLMQKDWL  VA +TVPLRT+G S+PALTSL RYLIHDSSE
Sbjct  229  YKIRVNSIAPGLFQSEITQGLMQKDWLKIVAAKTVPLRTYGESDPALTSLARYLIHDSSE  288

Query  541  YISGNTYIVDAGNTLPGVPIF  603
            Y+SGN +IV+AG TLPG+  +
Sbjct  289  YVSGNVFIVEAGATLPGLRAY  309



>gb|KJB54601.1| hypothetical protein B456_009G041000 [Gossypium raimondii]
Length=283

 Score =   295 bits (754),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV ADG  I+++V+ AWDAFGRIDALINNAGVRG V  PL+LTEEEWN   +TNLTG+
Sbjct  80   ELDVCADGSTIQSSVKAAWDAFGRIDALINNAGVRGNVKDPLELTEEEWNQNIRTNLTGS  139

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+ M +AK GGS+++ISSI+GLNRGQLPGGLAY +SK  +N +T+ MA+ELG 
Sbjct  140  WLVSKYVCMLMRDAKQGGSVINISSIAGLNRGQLPGGLAYASSKAGLNTMTKTMAMELGM  199

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSISPGLFKSEIT+GL++K WL +VA +  PLRTFGT++PALTSLVRYLIHDSSE
Sbjct  200  HKIRVNSISPGLFKSEITEGLLKKAWLQEVATKINPLRTFGTADPALTSLVRYLIHDSSE  259

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GN +IVDAG+TLPGVPIFSSL
Sbjct  260  YVTGNIFIVDAGSTLPGVPIFSSL  283



>gb|KHN24253.1| 3-oxoacyl-[acyl-carrier-protein] reductase 1 [Glycine soja]
Length=202

 Score =   291 bits (746),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 172/201 (86%), Gaps = 0/201 (0%)
 Frame = +1

Query  10   VSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGTWLV  189
            V+ADGPAI+ AVQ+AWDAFGR+D+LINNAGVRG V +PL L+EEEW+ + KTNLTG WLV
Sbjct  2    VAADGPAIDRAVQKAWDAFGRVDSLINNAGVRGSVKSPLKLSEEEWDHVFKTNLTGCWLV  61

Query  190  SKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGTNKI  369
            SKYVC RMC+ +  GSI++ISS+SGLNRGQLPG  AY +SK  VN LT+VMA+ELG +KI
Sbjct  62   SKYVCKRMCDIQLKGSIINISSVSGLNRGQLPGAAAYASSKAGVNMLTKVMAMELGMHKI  121

Query  370  RVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSEYIS  549
            RVNSISPG+FKSEIT+ L+QKDWLN V  + +PLR  GTS+PALTSL RYLIHDSSEY++
Sbjct  122  RVNSISPGIFKSEITENLLQKDWLNDVVRKIMPLRRLGTSDPALTSLARYLIHDSSEYVT  181

Query  550  GNTYIVDAGNTLPGVPIFSSL  612
            GN +IVD G TLPGVPI+SSL
Sbjct  182  GNNFIVDYGGTLPGVPIYSSL  202



>ref|XP_010913911.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Elaeis guineensis]
Length=281

 Score =   294 bits (753),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            +LDVSA    IEA+VQ+AWDAFGRIDAL+NNAG+RG +++PL+  EEEWN L  TNLTG 
Sbjct  78   QLDVSAQSSVIEASVQKAWDAFGRIDALVNNAGIRGGIYSPLEWPEEEWNALMATNLTGL  137

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK+VC RM + K  GS+++ISSI+GL RGQLPG LAY+ SKTAVNALTRVMALELG 
Sbjct  138  WLVSKHVCKRMRDTKQKGSVINISSINGLERGQLPGNLAYSVSKTAVNALTRVMALELGV  197

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            + IRVNSISPG+FKSEIT GLM KDWL++V  +TVPL+T GTS+PALTSLVRYLIHDSSE
Sbjct  198  HNIRVNSISPGIFKSEITKGLMVKDWLDRVTKKTVPLKTTGTSDPALTSLVRYLIHDSSE  257

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVDAG TLPGVP+FSSL
Sbjct  258  YVSGNVFIVDAGATLPGVPLFSSL  281



>ref|XP_011079077.1| PREDICTED: carbonyl reductase [NADPH] 2-like [Sesamum indicum]
Length=285

 Score =   293 bits (751),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSA   +IEA+VQ+AW AFGRIDALINNAG+RGRVH+PLDL+EEEWND  KTNLTGT
Sbjct  82   ELDVSASAASIEASVQKAWAAFGRIDALINNAGIRGRVHSPLDLSEEEWNDNIKTNLTGT  141

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+RM + + GGS+V+ISSI+GL RG LPGGLAY  +KTA+NA+T+VMALELG 
Sbjct  142  WLVSKYVCMRMRDGRHGGSVVNISSIAGLERGHLPGGLAYACAKTAINAMTKVMALELGA  201

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             +IRVNSISPGLFKSEIT GL++KDWL  V  RTVPLRTFGT +PALTSL+RYLIHDSS+
Sbjct  202  FEIRVNSISPGLFKSEITQGLVRKDWLKNVERRTVPLRTFGTLDPALTSLLRYLIHDSSK  261

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            +ISGN +IVDAG TLPG+PIFSSL
Sbjct  262  HISGNLFIVDAGVTLPGIPIFSSL  285



>ref|XP_009383217.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=280

 Score =   293 bits (750),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSA    I AAVQ AWDAFGRIDAL+NNAG+RG V++PLD +EEEW++  +TNLTGT
Sbjct  77   ELDVSAQEAVIAAAVQTAWDAFGRIDALVNNAGIRGAVNSPLDWSEEEWSNNIRTNLTGT  136

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK+VC RMC+AK  G +++ISSI G++RG LPGG+AY+ SKT  NA+T+VMALELG 
Sbjct  137  WLVSKHVCKRMCDAKQKGCVINISSIGGIDRGHLPGGIAYSASKTGANAITKVMALELGA  196

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVNSI+PGLF+SEIT GLM+++WLN+VA RTVPLRT+G S+PALTSL+RYLIHDSS 
Sbjct  197  FNIRVNSIAPGLFRSEITAGLMEREWLNRVAERTVPLRTYGKSDPALTSLIRYLIHDSSA  256

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVDAG TLPG+P+FSSL
Sbjct  257  YVSGNIFIVDAGVTLPGIPLFSSL  280



>ref|XP_004249318.1| PREDICTED: D-erythrulose reductase-like [Solanum lycopersicum]
Length=290

 Score =   293 bits (750),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSA+  AIEAAVQ+AW+AFGRID L+NNAG+RG VH+PL+L+EEEW  +  TNL G 
Sbjct  87   ELDVSANDAAIEAAVQKAWNAFGRIDVLVNNAGIRGSVHSPLNLSEEEWEKIYNTNLRGA  146

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLV+KYVC+ M  A  GGS+++ISS +GLNRG+LPG LAY +SK A+N++T++MA+ELG 
Sbjct  147  WLVTKYVCIHMRAANQGGSVINISSTAGLNRGKLPGSLAYASSKEALNSITKLMAIELGP  206

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNS+SPG+FKSEIT+ L+QKDW   VAL+T+PLRT GTSNPALTS+VRYLIHDSSE
Sbjct  207  YKIRVNSVSPGVFKSEITERLIQKDWFKTVALKTIPLRTHGTSNPALTSMVRYLIHDSSE  266

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVDAG TLPGVPIFSSL
Sbjct  267  YVSGNIFIVDAGATLPGVPIFSSL  290



>gb|EPS63859.1| hypothetical protein M569_10924, partial [Genlisea aurea]
Length=269

 Score =   292 bits (747),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 170/205 (83%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELD+SA GPAIEAAV++AW AFGRIDALINNAG+RG VHTPLDL+E+EWN +  TN+ GT
Sbjct  65   ELDISAAGPAIEAAVEKAWAAFGRIDALINNAGIRGSVHTPLDLSEDEWNQIVTTNMKGT  124

Query  181  WLVSKYVCLRMCNAKFggsivsissisg-LNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSK+VC RM +AK GG  V   S    L+RGQLPG LAY  SKTAVN +T++MA+ELG
Sbjct  125  WLVSKHVCTRMRDAKQGGGSVINISSIAGLDRGQLPGSLAYAASKTAVNNMTKMMAVELG  184

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
               IRVNSISPGLFKSEIT+ L +K+WL  V LRT+PLRT G+S+PALTSLVRYLIHDSS
Sbjct  185  IYNIRVNSISPGLFKSEITESLFRKEWLETVNLRTIPLRTVGSSDPALTSLVRYLIHDSS  244

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
             Y++GN +IVDAG TLPG+PIFSSL
Sbjct  245  SYVTGNMFIVDAGATLPGIPIFSSL  269



>gb|KEH30024.1| enoyl-(acyl carrier) reductase [Medicago truncatula]
Length=273

 Score =   292 bits (747),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+ADG AIE  VQ+AW+AFG IDALINNAGVRG V +PL+LTEEEWN++ +TN+TG 
Sbjct  70   ELDVAADGGAIEKYVQKAWEAFGHIDALINNAGVRGNVSSPLELTEEEWNNVFRTNITGA  129

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC  M ++K  GSI++ISSI+GL RGQ+PGG AY  SK  VN LT+VMALELG 
Sbjct  130  WLVSKYVCKLMRDSKRKGSIINISSIAGLERGQVPGGTAYACSKAGVNMLTKVMALELGA  189

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSISPGLFKSEIT+ LM+KDWLN VA RTVPLR +GTSNPALT +VRYLIHDSSE
Sbjct  190  HKIRVNSISPGLFKSEITESLMKKDWLNNVAKRTVPLREWGTSNPALTKIVRYLIHDSSE  249

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GN +I DAG TLPG PI+SSL
Sbjct  250  YVTGNIFIADAGATLPGFPIYSSL  273



>gb|KHG26617.1| 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Gossypium arboreum]
Length=283

 Score =   291 bits (745),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELD+ ADG  I+++V+ AWDAFGRIDALINNAGVRG V  PL+LTEEEW+   +TNLTG+
Sbjct  80   ELDICADGSTIQSSVKAAWDAFGRIDALINNAGVRGNVKDPLELTEEEWDQNIRTNLTGS  139

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+ M +AK GGS+++ISSI+GLNRGQLPGGLAY +SK  +N +T+ MA+ELG 
Sbjct  140  WLVSKYVCMLMRDAKQGGSVINISSIAGLNRGQLPGGLAYASSKAGLNTMTKTMAMELGM  199

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSISPGLFKSEIT+GL++K WL +VA +  PLRTFGT++PALTSLVRYLIHDSS+
Sbjct  200  HKIRVNSISPGLFKSEITEGLLKKAWLQEVATKINPLRTFGTADPALTSLVRYLIHDSSK  259

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GN +IVDAG+TLPG+PIFSSL
Sbjct  260  YVTGNIFIVDAGSTLPGIPIFSSL  283



>ref|XP_010673042.1| PREDICTED: L-xylulose reductase-like [Beta vulgaris subsp. vulgaris]
Length=296

 Score =   290 bits (742),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSADG  I+A+V +AW+AFG I AL+NNAG+RG V + LD+TEEEW++  KTNLTG 
Sbjct  93   ELDVSADGKTIDASVNKAWNAFGCIHALVNNAGIRGNVKSALDITEEEWDNTFKTNLTGA  152

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK VC+RM +AK GGSIV+ISSI+GLNRGQLPG  AY+ SK  +N LT++MALELG 
Sbjct  153  WLVSKSVCIRMRDAKIGGSIVNISSIAGLNRGQLPGSAAYSASKAGLNTLTKMMALELGV  212

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIR+NSISPGLFKSEIT+ LM+KDWLNKVA++TVPL+TFGTS+PALTSLVRYLI D+SE
Sbjct  213  YKIRINSISPGLFKSEITENLMEKDWLNKVAVKTVPLQTFGTSDPALTSLVRYLILDASE  272

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GN +IVDAG TLPGVPIFSSL
Sbjct  273  YVTGNIFIVDAGATLPGVPIFSSL  296



>ref|XP_008340560.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Malus domestica]
Length=295

 Score =   290 bits (742),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSADGPAIE +V +AWDAFG IDAL+NNAG+RG V + LDL+EEEWN + +TNLTG+
Sbjct  92   ELDVSADGPAIEKSVNKAWDAFGLIDALVNNAGIRGNVSSALDLSEEEWNHVFRTNLTGS  151

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK+V +RM +A  GGSIV+ISSI+GLNRG LPG  AY  SK  VN LT+ MA+ELG 
Sbjct  152  WLVSKFVAIRMRDADQGGSIVNISSIAGLNRGYLPGATAYNCSKAGVNTLTKTMAMELGV  211

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVN+IS GLF+SEIT+ LMQKDWL+ VA++ VPLRTFGTS+PALTSLVRYL+HDSSE
Sbjct  212  HKIRVNAISLGLFRSEITERLMQKDWLHNVAMKIVPLRTFGTSDPALTSLVRYLVHDSSE  271

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN YIVDAG +LPGVPIFSSL
Sbjct  272  YVSGNIYIVDAGTSLPGVPIFSSL  295



>ref|XP_007145483.1| hypothetical protein PHAVU_007G242800g [Phaseolus vulgaris]
 gb|ESW17477.1| hypothetical protein PHAVU_007G242800g [Phaseolus vulgaris]
Length=282

 Score =   288 bits (737),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+ADG  I+ AVQ+AWDAFGRID+LINNAGVRG V +PL+L+EEEW+ + KTN+ G 
Sbjct  79   ELDVAADGSTIDKAVQKAWDAFGRIDSLINNAGVRGSVKSPLNLSEEEWDQVFKTNVRGC  138

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC RMC+A   GSI++ISS++GLNRGQLPG +AY +SK  VN LT+VMA ELG 
Sbjct  139  WLVSKYVCKRMCDAPMKGSIINISSVAGLNRGQLPGAVAYASSKAGVNMLTKVMASELGV  198

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSISPG+FKSEIT+ LMQK WL  V  + +PLR  GTS+PALTSL RYLIHDSSE
Sbjct  199  HKIRVNSISPGIFKSEITESLMQKKWLEDVVRKIMPLRRLGTSDPALTSLARYLIHDSSE  258

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GN +IVD G TLPGVPI+SSL
Sbjct  259  YVTGNNFIVDFGATLPGVPIYSSL  282



>ref|XP_007202394.1| hypothetical protein PRUPE_ppa009414mg [Prunus persica]
 gb|EMJ03593.1| hypothetical protein PRUPE_ppa009414mg [Prunus persica]
Length=293

 Score =   288 bits (738),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELD+SADGPAIE +V +AWDAFGRIDAL+NNAGVRG V + L+L+EEEWN++ KTNLTG+
Sbjct  90   ELDISADGPAIEKSVNKAWDAFGRIDALVNNAGVRGNVSSSLELSEEEWNNVFKTNLTGS  149

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYV +RM +A  GGSI+++SSI+GL+RG LPGG+AY  SK  VN L +VMA+ELG 
Sbjct  150  WLVSKYVSIRMRDADQGGSIINVSSIAGLHRGYLPGGVAYNCSKAGVNTLAKVMAMELGV  209

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVN+ISPGLF+SEIT+GLM+KDWL+ VA++TVPLRTFGTS+PALTSLVRYL+HDSSE
Sbjct  210  HKIRVNAISPGLFRSEITEGLMKKDWLHNVAMKTVPLRTFGTSDPALTSLVRYLVHDSSE  269

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN YIVDAG TLPGVPIFS+L
Sbjct  270  YVSGNVYIVDAGATLPGVPIFSAL  293



>ref|XP_009631508.1| PREDICTED: probable L-xylulose reductase [Nicotiana tomentosiformis]
Length=275

 Score =   286 bits (731),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 168/205 (82%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            +LDV+ADG  IEAAVQRAWDAFGRIDAL+NNAG+RG VH+ L L EEEWN   KTNL G 
Sbjct  71   QLDVTADGSTIEAAVQRAWDAFGRIDALVNNAGLRGNVHSSLKLPEEEWNHTFKTNLRGA  130

Query  181  WLVSKYVCLRMCNAKFggsivsissisg-LNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSKY+C RM +AK GG  V   S +  LNR  +PGG+AY +SK A++  T++MALELG
Sbjct  131  WLVSKYICRRMRDAKQGGGSVINISSTAGLNRVLIPGGVAYASSKMALDMFTKMMALELG  190

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
             +KIRVNS+SPG+FKSEIT+ LMQK+W N V LRT+PL+T GT++PALTS+VRYLIHDSS
Sbjct  191  VDKIRVNSVSPGIFKSEITESLMQKEWFNNVTLRTIPLKTLGTTDPALTSVVRYLIHDSS  250

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
            EY+SGN +IVDAG TL GVPIFSSL
Sbjct  251  EYVSGNVFIVDAGTTLVGVPIFSSL  275



>ref|XP_008339342.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Malus domestica]
 ref|XP_008352851.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Malus domestica]
Length=295

 Score =   285 bits (730),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSADG AIE +V +AWDAFG IDAL+NNAG+RG V +PL+L+EEEWN++ +TNLTG+
Sbjct  92   ELDVSADGXAIEKSVNKAWDAFGLIDALVNNAGIRGNVSSPLELSEEEWNNVFRTNLTGS  151

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK+V +RM +A  GGSIV+ISSI+GLNRG  PG  AY  SK  VN LT+ MA+ELG 
Sbjct  152  WLVSKFVAIRMRDADQGGSIVNISSITGLNRGFAPGATAYNCSKAGVNTLTKTMAMELGV  211

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVN+IS GLF+SEIT+ LMQKDWL+ VA++ VPLRTFGTS+PALTSLVRYL+HDSSE
Sbjct  212  HKIRVNAISLGLFRSEITERLMQKDWLHNVAMKIVPLRTFGTSDPALTSLVRYLVHDSSE  271

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN YIVDAG +LPGVPIFSSL
Sbjct  272  YVSGNIYIVDAGTSLPGVPIFSSL  295



>ref|XP_004515513.1| PREDICTED: glucose 1-dehydrogenase-like [Cicer arietinum]
Length=284

 Score =   284 bits (726),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            E+DV+ADG  IE  V++AW+ FG ID +INNAG RG V +PL+L+EEEWN + +TN+TGT
Sbjct  81   EIDVAADGSVIENYVKKAWEVFGHIDVVINNAGFRGNVSSPLELSEEEWNKVFRTNITGT  140

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC  M +AK  GSI++ISSI+GL+RGQLPG  AY  SK AVN LT+VMALELG 
Sbjct  141  WLVSKYVCKLMRDAKIKGSIINISSIAGLDRGQLPGATAYACSKGAVNMLTKVMALELGA  200

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSISPGLFKSEIT  LM+K WL  VA +TVPLR+FGTSNPALTS+VRYLIHDSSE
Sbjct  201  HKIRVNSISPGLFKSEITADLMEKHWLLNVAKKTVPLRSFGTSNPALTSIVRYLIHDSSE  260

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GN +IVDAG T+PGVPI+SSL
Sbjct  261  YVTGNIFIVDAGATIPGVPIYSSL  284



>ref|XP_002282735.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic 
[Vitis vinifera]
Length=286

 Score =   284 bits (726),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV++ G +I A+VQ+AW+AFGRID L+NNAG+RG V++PLD++EEEWN+  KTNLTG+
Sbjct  83   ELDVTSGGSSISASVQKAWEAFGRIDVLLNNAGIRGNVNSPLDISEEEWNNTLKTNLTGS  142

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYV +RM +AK GGSI++ISSI  LNRGQ PG +AY +SK+ ++A+T+VMALELG 
Sbjct  143  WLVSKYVGMRMRDAKNGGSIINISSIVSLNRGQSPGAVAYVSSKSGLSAMTKVMALELGA  202

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IR N+I+PG+FKSEIT GLMQKDWLN V  RT PLR +GTS+PALTSLVRYLIHDSS 
Sbjct  203  YNIRANAIAPGIFKSEITAGLMQKDWLNTVVQRTCPLRAYGTSDPALTSLVRYLIHDSSR  262

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            YISGN + VDAG TLPGVPIFSSL
Sbjct  263  YISGNVFNVDAGATLPGVPIFSSL  286



>ref|XP_008340561.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Malus domestica]
Length=295

 Score =   283 bits (723),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSADG AIE +V +AWDAFG IDAL+NNAG+RG V +PL+L+EEEWN++ +TNLTG+
Sbjct  92   ELDVSADGXAIEKSVNKAWDAFGLIDALVNNAGIRGNVSSPLELSEEEWNNVFRTNLTGS  151

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK+V +RM +A  GGSIV+ISSI+GLNRG  PG  AY  SK  VN LT+ MA+ELG 
Sbjct  152  WLVSKFVAIRMRDADQGGSIVNISSITGLNRGFAPGATAYNCSKAGVNTLTKTMAMELGV  211

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVN+IS GLF+SEIT+ LM+KDWL+ VA++  PLRTFGTS+PALTSLVRYL+HDSSE
Sbjct  212  HKIRVNAISXGLFRSEITERLMZKDWLHNVAMKXXPLRTFGTSDPALTSLVRYLVHDSSE  271

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN YIVDAG  LPGVPIFSSL
Sbjct  272  YVSGNIYIVDAGXXLPGVPIFSSL  295



>ref|XP_009394521.1| PREDICTED: hydroxysteroid dehydrogenase-like protein 2 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=549

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSA G  IEAAVQRAWDAFGRIDALINNAGVRG V++PLD  EE+WN    TNLTG 
Sbjct  81   ELDVSAGGSVIEAAVQRAWDAFGRIDALINNAGVRGGVYSPLDWPEEDWNATFATNLTGL  140

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC +M NAK  G++++ISSISGLNRG+LPG +AY  SK  VNA+T+VMALE+G 
Sbjct  141  WLVSKYVCKQMVNAKLKGTVINISSISGLNRGKLPGAIAYAVSKEGVNAITKVMALEMGV  200

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            + IRVNSISPG+FKSEIT+ LM+K W+NKVA + +PLRTFGTS+PA+TS+VRYLIHDSSE
Sbjct  201  HNIRVNSISPGIFKSEITESLMRKKWINKVATKIIPLRTFGTSDPAITSVVRYLIHDSSE  260

Query  541  YISGNTYIVDAGNTLPGVPIFS  606
            Y++GN +IVDAG TLPG P+ S
Sbjct  261  YVTGNIFIVDAGATLPGFPVTS  282



>ref|XP_010257447.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Nelumbo nucifera]
Length=290

 Score =   281 bits (720),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 175/205 (85%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRG-RVHTPLDLTEEEWNDLTKTNLTG  177
            +LD++A GP IEA+VQ+AWDAFGRIDALINNAGVRG  V + LD  E+EWN++  TNLTG
Sbjct  86   DLDLNAKGPVIEASVQKAWDAFGRIDALINNAGVRGGAVTSLLDFPEDEWNNIVTTNLTG  145

Query  178  TWLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            TWLVSKY+   M N    GSI++++SI+GLNRGQLPGG+AY  SK  +NALT+VMALELG
Sbjct  146  TWLVSKYIGRCMSNTNQKGSIINVTSIAGLNRGQLPGGVAYVASKAGLNALTKVMALELG  205

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
             + IRVN+I+PGLFKSEIT GL+QK+W+N+VA +TVPLRTFGT++PALTSL+RYLIHDSS
Sbjct  206  QHNIRVNAIAPGLFKSEITQGLLQKEWINEVARKTVPLRTFGTTDPALTSLIRYLIHDSS  265

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
             Y++GN +I DAG TLPGVPIFSSL
Sbjct  266  YYVTGNIFIADAGATLPGVPIFSSL  290



>ref|XP_010529958.1| PREDICTED: carbonyl reductase [NADPH] 2-like isoform X2 [Tarenaya 
hassleriana]
Length=280

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV AD   I+A+V++AWD FGRID LINNAG+RG V T LDL+EEEW+ + +TNLTG 
Sbjct  77   ELDVCADAATIKASVKKAWDMFGRIDVLINNAGIRGTVKTSLDLSEEEWDRVFRTNLTGP  136

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC  +  AK GGS+++ISSI+G+ RG LPGG+AY +SK AVN +TR+MALELG 
Sbjct  137  WLVSKYVCRLIREAKRGGSVINISSIAGIQRGMLPGGVAYNSSKGAVNIMTRMMALELGE  196

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSI+PGLF+SEIT  LM+K WL KVA RTVPL+ +GT +PALTSL+RYLIHDSSE
Sbjct  197  HKIRVNSIAPGLFRSEITGTLMEKGWLKKVAERTVPLKEYGTVDPALTSLLRYLIHDSSE  256

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GNT+IVDAG TLPGVPIFSSL
Sbjct  257  YVTGNTFIVDAGATLPGVPIFSSL  280



>ref|XP_010530115.1| PREDICTED: carbonyl reductase [NADPH] 2-like isoform X4 [Tarenaya 
hassleriana]
Length=279

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV AD   I+A+V++AWD FGRID LINNAG+RG V T LDL+EEEW+ + +TNLTG 
Sbjct  76   ELDVCADAATIKASVKKAWDMFGRIDVLINNAGIRGTVKTSLDLSEEEWDRVFRTNLTGP  135

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC  +  AK GGS+++ISSI+G+ RG LPGG+AY +SK AVN +TR+MALELG 
Sbjct  136  WLVSKYVCRLIREAKRGGSVINISSIAGIQRGMLPGGVAYNSSKGAVNIMTRMMALELGE  195

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSI+PGLF+SEIT  LM+K WL KVA RTVPL+ +GT +PALTSL+RYLIHDSSE
Sbjct  196  HKIRVNSIAPGLFRSEITGTLMEKGWLKKVAERTVPLKEYGTVDPALTSLLRYLIHDSSE  255

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GNT+IVDAG TLPGVPIFSSL
Sbjct  256  YVTGNTFIVDAGATLPGVPIFSSL  279



>ref|XP_009390649.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=283

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 172/203 (85%), Gaps = 0/203 (0%)
 Frame = +1

Query  4    LDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGTW  183
            LDVSAD P+I A+VQRA DAFGRID L+NNAGVRG VH+PLD +EE+W+   +TNLTG W
Sbjct  81   LDVSADEPSIAASVQRACDAFGRIDGLVNNAGVRGSVHSPLDWSEEDWSSNIRTNLTGLW  140

Query  184  LVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGTN  363
            LVSK+VC  M +AK  GS+++ISSI G  RG LPGG+AY  SKT VNA+T+VMALELG  
Sbjct  141  LVSKHVCKHMRDAKQKGSVINISSIGGTERGHLPGGVAYVASKTGVNAVTKVMALELGGF  200

Query  364  KIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSEY  543
             IRVN+I+PGLF+SEIT GLM+++WLNKVA +TVPLRT+GT +PALTS+VR+LIHDSS Y
Sbjct  201  NIRVNAIAPGLFRSEITAGLMEREWLNKVAEKTVPLRTYGTLDPALTSVVRFLIHDSSSY  260

Query  544  ISGNTYIVDAGNTLPGVPIFSSL  612
            +SGN +IVDAG TLPG+P+FSSL
Sbjct  261  VSGNIFIVDAGVTLPGIPLFSSL  283



>ref|XP_010530193.1| PREDICTED: carbonyl reductase [NADPH] 2-like isoform X5 [Tarenaya 
hassleriana]
Length=278

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV AD   I+A+V++AWD FGRID LINNAG+RG V T LDL+EEEW+ + +TNLTG 
Sbjct  75   ELDVCADAATIKASVKKAWDMFGRIDVLINNAGIRGTVKTSLDLSEEEWDRVFRTNLTGP  134

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC  +  AK GGS+++ISSI+G+ RG LPGG+AY +SK AVN +TR+MALELG 
Sbjct  135  WLVSKYVCRLIREAKRGGSVINISSIAGIQRGMLPGGVAYNSSKGAVNIMTRMMALELGE  194

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSI+PGLF+SEIT  LM+K WL KVA RTVPL+ +GT +PALTSL+RYLIHDSSE
Sbjct  195  HKIRVNSIAPGLFRSEITGTLMEKGWLKKVAERTVPLKEYGTVDPALTSLLRYLIHDSSE  254

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GNT+IVDAG TLPGVPIFSSL
Sbjct  255  YVTGNTFIVDAGATLPGVPIFSSL  278



>ref|XP_010530038.1| PREDICTED: carbonyl reductase [NADPH] 2-like isoform X3 [Tarenaya 
hassleriana]
Length=279

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV AD   I+A+V++AWD FGRID LINNAG+RG V T LDL+EEEW+ + +TNLTG 
Sbjct  76   ELDVCADAATIKASVKKAWDMFGRIDVLINNAGIRGTVKTSLDLSEEEWDRVFRTNLTGP  135

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC  +  AK GGS+++ISSI+G+ RG LPGG+AY +SK AVN +TR+MALELG 
Sbjct  136  WLVSKYVCRLIREAKRGGSVINISSIAGIQRGMLPGGVAYNSSKGAVNIMTRMMALELGE  195

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSI+PGLF+SEIT  LM+K WL KVA RTVPL+ +GT +PALTSL+RYLIHDSSE
Sbjct  196  HKIRVNSIAPGLFRSEITGTLMEKGWLKKVAERTVPLKEYGTVDPALTSLLRYLIHDSSE  255

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GNT+IVDAG TLPGVPIFSSL
Sbjct  256  YVTGNTFIVDAGATLPGVPIFSSL  279



>ref|XP_010529885.1| PREDICTED: carbonyl reductase [NADPH] 2-like isoform X1 [Tarenaya 
hassleriana]
Length=284

 Score =   278 bits (711),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV AD   I+A+V++AWD FGRID LINNAG+RG V T LDL+EEEW+ + +TNLTG 
Sbjct  81   ELDVCADAATIKASVKKAWDMFGRIDVLINNAGIRGTVKTSLDLSEEEWDRVFRTNLTGP  140

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC  +  AK GGS+++ISSI+G+ RG LPGG+AY +SK AVN +TR+MALELG 
Sbjct  141  WLVSKYVCRLIREAKRGGSVINISSIAGIQRGMLPGGVAYNSSKGAVNIMTRMMALELGE  200

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSI+PGLF+SEIT  LM+K WL KVA RTVPL+ +GT +PALTSL+RYLIHDSSE
Sbjct  201  HKIRVNSIAPGLFRSEITGTLMEKGWLKKVAERTVPLKEYGTVDPALTSLLRYLIHDSSE  260

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GNT+IVDAG TLPGVPIFSSL
Sbjct  261  YVTGNTFIVDAGATLPGVPIFSSL  284



>ref|XP_011079072.1| PREDICTED: estradiol 17-beta-dehydrogenase 8-like isoform X1 
[Sesamum indicum]
Length=299

 Score =   277 bits (709),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+A GP I AAV++AW AFGRIDALINNAGVRG VH+PLDL+E+EWND+ +TNLTGT
Sbjct  84   ELDVNASGPIINAAVEKAWGAFGRIDALINNAGVRGSVHSPLDLSEDEWNDIIRTNLTGT  143

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC RM  A+ GGS+++ISS +GLNRGQLPG L Y  SK AVN +T+ MALELG 
Sbjct  144  WLVSKYVCSRMRYAQQGGSVINISSTAGLNRGQLPGSLVYAASKAAVNTITKGMALELGM  203

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSISPG+FKSEIT GL+QKDWL  VA +T+PLRT GT++PALTSLVRYL+HD SE
Sbjct  204  YKIRVNSISPGIFKSEITQGLLQKDWLKTVAFKTIPLRTHGTTDPALTSLVRYLVHDCSE  263

Query  541  YISGNTYIVDA  573
            Y++GN +IV+A
Sbjct  264  YVTGNVFIVEA  274



>ref|XP_008455729.1| PREDICTED: uncharacterized oxidoreductase C922.06-like [Cucumis 
melo]
Length=284

 Score =   276 bits (707),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELD+SADG +IE +V+ AW++FG IDAL+NNAG RG V T L+L+EEEW+ +  TNL G+
Sbjct  81   ELDISADGKSIEKSVKNAWESFGFIDALVNNAGFRGTVKTCLELSEEEWDQVMGTNLKGS  140

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC  M ++K GGS++SISSISG+ RGQLPGGLAY  SK  +N LT+VMALELG 
Sbjct  141  WLVSKYVCGHMRDSKRGGSVISISSISGIERGQLPGGLAYAASKAGINTLTKVMALELGP  200

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVNSI+PGLFKSEIT+GLMQKDWLN VA +T PLRTFGTS+PALT+L+RYLI DSS 
Sbjct  201  YNIRVNSIAPGLFKSEITEGLMQKDWLNTVAYKTTPLRTFGTSDPALTTLIRYLIDDSSR  260

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN YIVD G TLPG PIFSSL
Sbjct  261  YVSGNIYIVDTGATLPGFPIFSSL  284



>ref|XP_009607267.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=285

 Score =   276 bits (705),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+ADGP IEA+V++AWDAFG IDALINNAGVRG + + +DL+EEEW +  +TNLTG+
Sbjct  82   ELDVTADGPTIEASVKKAWDAFGYIDALINNAGVRGGIKSAVDLSEEEWRNTLQTNLTGS  141

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYV   M  AK GGSI++ISSISGLNR  + GG+AY++SK A++++T++MALELG 
Sbjct  142  WLVSKYVGRHMKAAKRGGSIINISSISGLNRALMRGGIAYSSSKAAMDSMTKIMALELGE  201

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            + IRVN+I+PGLFKSEIT+ L+++DWL  VA RTVPL+TFGT++PALTSLVRYL+HDSS 
Sbjct  202  HNIRVNAIAPGLFKSEITEKLVEQDWLKNVATRTVPLKTFGTTDPALTSLVRYLVHDSSN  261

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVDAG TLPG+PIFSSL
Sbjct  262  YVSGNIFIVDAGYTLPGLPIFSSL  285



>ref|XP_004144326.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
[Cucumis sativus]
 gb|KGN54691.1| hypothetical protein Csa_4G427270 [Cucumis sativus]
Length=286

 Score =   275 bits (703),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELD+SADG +IE +V+ AW++FG IDAL+NNAG RG V T L+L+EEEW+ +  TNL G+
Sbjct  83   ELDISADGKSIEKSVKNAWESFGFIDALVNNAGFRGNVKTCLELSEEEWDQVMGTNLKGS  142

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC  M ++K GGS++SISSISG+ RGQLPGGLAY  SK  +N LT+VMALELG 
Sbjct  143  WLVSKYVCSHMRDSKRGGSVISISSISGIERGQLPGGLAYAASKAGINILTKVMALELGP  202

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IR NSI+PGLFKSEIT+GLMQKDWLN VA +T PLRTFGTS+PALT+L+RYLI DSS 
Sbjct  203  YNIRANSIAPGLFKSEITEGLMQKDWLNTVAYKTSPLRTFGTSDPALTTLIRYLIDDSSR  262

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN YIVD G TLPG PIFSSL
Sbjct  263  YVSGNIYIVDTGATLPGFPIFSSL  286



>ref|XP_010473483.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase 4-like 
[Camelina sativa]
Length=280

 Score =   273 bits (699),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+DG  I+ AV+ AW+ FG ID LINNAG+RG V + LD +EEEW+ + +TNLTG+
Sbjct  77   ELDVSSDGATIQKAVKEAWEIFGNIDVLINNAGIRGNVKSSLDWSEEEWDKVFRTNLTGS  136

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVCL M  AK GGS+++ISSISGL+RG LPGGLAY  SK  V+ +TR+MA+EL  
Sbjct  137  WLVSKYVCLLMREAKRGGSVINISSISGLHRGLLPGGLAYACSKGGVDTMTRMMAIELAA  196

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            NKIRVNSI+PGLF+SEIT GLMQK+WL KV  RTVPL+   T +P LTSL+RYLIHDSS+
Sbjct  197  NKIRVNSIAPGLFRSEITQGLMQKEWLKKVTERTVPLKMQQTVDPGLTSLMRYLIHDSSQ  256

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GNTYIVD+G TLPGVPIFSSL
Sbjct  257  YVTGNTYIVDSGTTLPGVPIFSSL  280



>ref|XP_002876294.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH52553.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=280

 Score =   273 bits (698),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 170/204 (83%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV+ AWD FG+IDALINNAG+RG V + LDL+E+EWN + KTNLTG 
Sbjct  78   ELDVSSDAATIQKAVREAWDIFGKIDALINNAGIRGNVKSSLDLSEDEWNKVFKTNLTGP  137

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+ M +AK GGS+++ISSI+G+ RG LPGGLAY  SK  V+ ++R+MA+ELG 
Sbjct  138  WLVSKYVCVLMRDAKRGGSVINISSIAGI-RGILPGGLAYACSKGGVDTMSRMMAIELGV  196

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSI+PGLFKSEIT GLMQK+WL  V  RTVPL+   T +P LTSLVRYLIHDSS+
Sbjct  197  HKIRVNSIAPGLFKSEITQGLMQKEWLKNVTERTVPLKVQQTVDPGLTSLVRYLIHDSSQ  256

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            YISGNTYIVD+G TLPGVPIFSSL
Sbjct  257  YISGNTYIVDSGATLPGVPIFSSL  280



>ref|XP_006365803.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Solanum tuberosum]
Length=272

 Score =   273 bits (697),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 161/205 (79%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            +LD++AD   IEAAVQ AWDAFGRID LINNAG+RG V+  LDL EEEW  + KTNL GT
Sbjct  68   QLDITADSATIEAAVQIAWDAFGRIDVLINNAGLRGNVYNSLDLPEEEWEHIYKTNLRGT  127

Query  181  WLVSKYVCLRMCNAKFggsivsissisg-LNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSKYVC  M ++K  G  V   S    LNR  +PGGLAY +SK A++ +T++MALELG
Sbjct  128  WLVSKYVCRHMRDSKQDGGSVINISSISGLNRVLIPGGLAYASSKMALDMVTKMMALELG  187

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
             + IRVNSISPG+FKSEIT  LM+K+W N V +RT+PLRT GT++PALTS VRYLIHDSS
Sbjct  188  VDNIRVNSISPGIFKSEITKSLMEKEWFNNVTVRTIPLRTLGTTDPALTSTVRYLIHDSS  247

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
            EYISGN +IVDAG TL GVPIFSSL
Sbjct  248  EYISGNVFIVDAGTTLTGVPIFSSL  272



>gb|KEH41456.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=281

 Score =   273 bits (698),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSADG +I+ +V +AWDAFG ID LINNAGVRG V +PLDL+E+EWN + KTNLTG+
Sbjct  78   ELDVSADGASIDKSVHKAWDAFGHIDTLINNAGVRGSVKSPLDLSEDEWNHVFKTNLTGS  137

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC R+C+A   GSI++ISS SGLNRG L G +AY +SK  +N LT+VMALELG 
Sbjct  138  WLVSKYVCKRICDAHRKGSIINISSTSGLNRGNLSGAVAYASSKAGLNMLTKVMALELGA  197

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSISPG+FKSEIT+ L++K WLN V  +  PLR+   S+P LTSL RYLIHD+SE
Sbjct  198  HKIRVNSISPGIFKSEITEKLVEKAWLNNVITKINPLRSLVASDPGLTSLARYLIHDASE  257

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GN +IVD G TLPGVPI+SSL
Sbjct  258  YVTGNNFIVDCGVTLPGVPIYSSL  281



>ref|XP_004170137.1| PREDICTED: LOW QUALITY PROTEIN: 3-oxoacyl-[acyl-carrier-protein] 
reductase FabG-like [Cucumis sativus]
Length=286

 Score =   273 bits (698),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELD+SADG +IE +V+ AW++FG IDAL+NNAG RG V T L+L+EEEW+ +  TNL G+
Sbjct  83   ELDISADGKSIEKSVKNAWESFGFIDALVNNAGFRGNVKTCLELSEEEWDQVMGTNLKGS  142

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC  M ++K GGS++SISSISG+ RGQLPGGLAY  SK  +N LT+VMALELG 
Sbjct  143  WLVSKYVCSHMRDSKRGGSVISISSISGIERGQLPGGLAYAASKAGINILTKVMALELGP  202

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IR NSI+PG FKSEIT+GLMQKDWLN VA +T PLRTFGTS+PALT+L+RYLI DSS 
Sbjct  203  YNIRANSIAPGXFKSEITEGLMQKDWLNTVAYKTSPLRTFGTSDPALTTLIRYLIDDSSR  262

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN YIVD G TLPG PIFSSL
Sbjct  263  YVSGNIYIVDTGATLPGFPIFSSL  286



>emb|CDP06198.1| unnamed protein product [Coffea canephora]
Length=288

 Score =   273 bits (697),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+AD   IE +VQRAW+AFG IDAL+NNAGVRG + + LDLTE EWN   +TNLTG 
Sbjct  85   ELDVTADASTIETSVQRAWNAFGHIDALVNNAGVRGSISSSLDLTENEWNSTVRTNLTGA  144

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYV   M  A   G IV++SS+SGLNR QL G +AY++SK  ++++TR+MALELG 
Sbjct  145  WLVSKYVGRHMREACRCGCIVNVSSVSGLNRAQLRGAVAYSSSKAGMDSMTRIMALELGE  204

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSISPGLF SE+T+GL++K W+N VA RTVPLRTFGTS+PALTSLVR+LIHDSS 
Sbjct  205  YKIRVNSISPGLFSSELTEGLVKKPWINNVAERTVPLRTFGTSDPALTSLVRFLIHDSSS  264

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVDAG +LPGVPIFSSL
Sbjct  265  YVSGNHFIVDAGYSLPGVPIFSSL  288



>ref|XP_010265875.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Nelumbo nucifera]
Length=290

 Score =   272 bits (696),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            +LD++A GP IEA+V++AWDAFGRIDAL+NNAGVRG V TPLD  E+EW+++  TNLTG+
Sbjct  87   DLDLNAKGPVIEASVRKAWDAFGRIDALVNNAGVRGGVSTPLDFPEDEWSNIVNTNLTGS  146

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLV+KYV   M      GSIV+I+SI+G  RGQLPGG  YT SK  +NAL +V A+ELG 
Sbjct  147  WLVTKYVGREMSKHNLKGSIVNITSIAGTERGQLPGGCPYTASKAGLNALAKVSAVELGV  206

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVN+I+PG+FKSEIT+ LMQK WL  V  +TVPL TFGTS+PALTSLVRYLIHDSS 
Sbjct  207  HKIRVNAIAPGIFKSEITEKLMQKQWLTNVMKKTVPLGTFGTSDPALTSLVRYLIHDSSG  266

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVDAG TLPGVPIFSSL
Sbjct  267  YVSGNVFIVDAGATLPGVPIFSSL  290



>ref|XP_009778773.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Nicotiana sylvestris]
Length=285

 Score =   272 bits (696),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            EL+V+ADGP IEA++Q+AWDAFG ID LINNAGVRG + + +D++EEEW++  +TNLTG+
Sbjct  82   ELNVTADGPLIEASIQKAWDAFGHIDVLINNAGVRGGLKSAVDISEEEWHNTLRTNLTGS  141

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYV   M  AK GGSI++ISSI GLNR  + GG+AY++SK AV+ +T+VMA ELG 
Sbjct  142  WLVSKYVGKHMQAAKRGGSIINISSIGGLNRISMRGGIAYSSSKAAVDTMTKVMAYELGE  201

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            + IRVN+I+PG+FKSEIT+ L+QKDWL  VA R+VPL+TFGT+NP LTSLVRYL+HDSS 
Sbjct  202  HNIRVNAIAPGIFKSEITEKLLQKDWLKNVATRSVPLKTFGTTNPGLTSLVRYLVHDSSN  261

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVD+G TLPG+PIFSSL
Sbjct  262  YVSGNIFIVDSGYTLPGIPIFSSL  285



>ref|XP_004973876.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Setaria italica]
Length=277

 Score =   272 bits (695),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+A G A+EAAVQRAWDAFGRID LINNAG+RG VH+PLD  E+EW+ L KTNLTG 
Sbjct  74   ELDVAAGGSALEAAVQRAWDAFGRIDVLINNAGIRGAVHSPLDWPEDEWDKLIKTNLTGL  133

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLV+K+VC RM +AK  GS+++ISSI+GLNRG LPG + Y +SK+AV+  T++MALELG 
Sbjct  134  WLVAKHVCRRMRDAKLKGSVINISSIAGLNRGHLPGSIGYASSKSAVHYATKLMALELGA  193

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVN+I+PGLFKSEIT  L+QK WLN VA + VPL+  GT++PALTSLVR+LIH++S 
Sbjct  194  YGIRVNAIAPGLFKSEITAPLLQKRWLNTVASKIVPLKEHGTTDPALTSLVRFLIHEASS  253

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GN ++VD+G ++PGVPIFSSL
Sbjct  254  YVTGNIFVVDSGVSIPGVPIFSSL  277



>ref|XP_010112832.1| 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Morus notabilis]
 gb|EXC34955.1| 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Morus notabilis]
Length=488

 Score =   278 bits (712),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 169/206 (82%), Gaps = 0/206 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV  DGP IE +V +AWDAFGRIDAL+NNAG+RG V +PLDL+EEEWN + +TNLTGT
Sbjct  95   ELDVCGDGPTIEKSVHKAWDAFGRIDALVNNAGIRGNVRSPLDLSEEEWNRVLRTNLTGT  154

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK+VC RM +A  GGS+++ISSI+G+NRG LPGG AY +SK  +N LT+VMA+ELG 
Sbjct  155  WLVSKFVCKRMRDAGRGGSVINISSIAGVNRGHLPGGAAYASSKAGLNTLTKVMAIELGE  214

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVN ISPGLFKSEIT+ LMQK WL+ VA RTVPL+  GTS+PALTSLVRYLIHDSS 
Sbjct  215  YKIRVNVISPGLFKSEITENLMQKAWLSNVAARTVPLKEHGTSDPALTSLVRYLIHDSSA  274

Query  541  YISGNTYIVDAGNTLPGVPIFSSL*N  618
            Y+SGN +IVDAG TL G  + S L N
Sbjct  275  YVSGNAFIVDAGVTLSGFEVLSVLGN  300


 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +1

Query  100  VRGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivsissisgLNRGQ  279
            V G V +PLDL+EEEWN + +TNLTGTWLVSK+VC RM +A  GGS+++ISSI+G+NRG 
Sbjct  297  VLGNVRSPLDLSEEEWNRVLRTNLTGTWLVSKFVCKRMRDAGRGGSVINISSIAGVNRGH  356

Query  280  LPGGLAYTTSKTAVNALTRVMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALR  459
            LPGG AY +SK  +  LT+VMA+ELG  KIRVN ISPGLFKSEIT+ LMQK WL+ VA R
Sbjct  357  LPGGAAYASSKAGLKTLTKVMAIELGEYKIRVNVISPGLFKSEITENLMQKAWLSNVAAR  416

Query  460  TVPLRTFGTSNPALTSLVRYLIHDSSEYISGNTYIVDAGNTLPG  591
            TVPL+  GTS+PALTSLVRYLIHDSS Y+SGN +IVDAG TL G
Sbjct  417  TVPLKEHGTSDPALTSLVRYLIHDSSAYVSGNAFIVDAGVTLSG  460



>emb|CDP06199.1| unnamed protein product [Coffea canephora]
Length=288

 Score =   271 bits (694),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+AD   IE +VQRAW+AFG IDAL+NNAGVRG + + LDLTE EWN   +TNLTG 
Sbjct  85   ELDVTADASTIETSVQRAWNAFGHIDALVNNAGVRGSISSSLDLTENEWNSTVRTNLTGA  144

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYV   M  A  GG IV++SSISGLNR Q+ G +AY++SK  ++++TR+MALELG 
Sbjct  145  WLVSKYVGRHMREAGRGGCIVNVSSISGLNRAQMRGSVAYSSSKAGMDSMTRIMALELGE  204

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             K+RVNSISPGLF+S+IT+ L++K W+N VA RTVPLRTFGTS+PALTSLVR+LIHDSS 
Sbjct  205  YKVRVNSISPGLFRSQITEELVKKRWINNVAERTVPLRTFGTSDPALTSLVRFLIHDSSS  264

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVDAG TLPGVPIFSSL
Sbjct  265  YVSGNHFIVDAGYTLPGVPIFSSL  288



>ref|NP_567019.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AAK76629.1| putative oxidoreductase [Arabidopsis thaliana]
 gb|AAL85073.1| putative oxidoreductase [Arabidopsis thaliana]
 gb|AEE79365.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=280

 Score =   271 bits (692),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 170/204 (83%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV+ AWD FG+IDALINNAG+RG V + LDL+E+EW+++ KTNL G 
Sbjct  78   ELDVSSDAATIQKAVREAWDIFGKIDALINNAGIRGNVKSSLDLSEDEWDNVFKTNLKGP  137

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK+VC+ M +AK GGS+++ISSI+G+ RG LPGGLAY  SK  V+ ++R+MALELG 
Sbjct  138  WLVSKHVCMLMRDAKRGGSVINISSIAGI-RGMLPGGLAYACSKGGVDTMSRMMALELGV  196

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSI+PGLFKSEIT GLMQK+WL  V  RTVPL+   T +P LTSLVRYLIHDSS+
Sbjct  197  HKIRVNSIAPGLFKSEITQGLMQKEWLKNVTERTVPLKVQQTVDPGLTSLVRYLIHDSSQ  256

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            YISGNTYIVD+G TLPGVPIFSSL
Sbjct  257  YISGNTYIVDSGATLPGVPIFSSL  280



>ref|XP_009773767.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Nicotiana sylvestris]
Length=285

 Score =   271 bits (692),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+ADGP IEA+V++AWDAFG IDALINNAGVRG + + +D++EEEW    +TNLTG+
Sbjct  82   ELDVTADGPTIEASVKKAWDAFGYIDALINNAGVRGGIKSAVDISEEEWRSTLETNLTGS  141

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYV  RM  AK GGSI++ISSISGLNR    GG+AY++SK A++++T++MALELG 
Sbjct  142  WLVSKYVGRRMKAAKRGGSIINISSISGLNRVLTRGGIAYSSSKAAMDSMTKIMALELGE  201

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVN+I+PG+FKSEIT+ L+++DWL  VA RT+PL+TFGT++PALTSLVRYL+HDSS 
Sbjct  202  GNIRVNAIAPGIFKSEITEKLVEQDWLKNVATRTIPLKTFGTTDPALTSLVRYLVHDSSN  261

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVDAG TLPG PIFSSL
Sbjct  262  YVSGNIFIVDAGYTLPGFPIFSSL  285



>ref|NP_974441.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE79366.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=279

 Score =   270 bits (691),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 170/204 (83%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV+ AWD FG+IDALINNAG+RG V + LDL+E+EW+++ KTNL G 
Sbjct  77   ELDVSSDAATIQKAVREAWDIFGKIDALINNAGIRGNVKSSLDLSEDEWDNVFKTNLKGP  136

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK+VC+ M +AK GGS+++ISSI+G+ RG LPGGLAY  SK  V+ ++R+MALELG 
Sbjct  137  WLVSKHVCMLMRDAKRGGSVINISSIAGI-RGMLPGGLAYACSKGGVDTMSRMMALELGV  195

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSI+PGLFKSEIT GLMQK+WL  V  RTVPL+   T +P LTSLVRYLIHDSS+
Sbjct  196  HKIRVNSIAPGLFKSEITQGLMQKEWLKNVTERTVPLKVQQTVDPGLTSLVRYLIHDSSQ  255

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            YISGNTYIVD+G TLPGVPIFSSL
Sbjct  256  YISGNTYIVDSGATLPGVPIFSSL  279



>emb|CAB75763.1| oxidoreductase-like protein [Arabidopsis thaliana]
Length=273

 Score =   270 bits (691),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 170/204 (83%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV+ AWD FG+IDALINNAG+RG V + LDL+E+EW+++ KTNL G 
Sbjct  71   ELDVSSDAATIQKAVREAWDIFGKIDALINNAGIRGNVKSSLDLSEDEWDNVFKTNLKGP  130

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK+VC+ M +AK GGS+++ISSI+G+ RG LPGGLAY  SK  V+ ++R+MALELG 
Sbjct  131  WLVSKHVCMLMRDAKRGGSVINISSIAGI-RGMLPGGLAYACSKGGVDTMSRMMALELGV  189

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSI+PGLFKSEIT GLMQK+WL  V  RTVPL+   T +P LTSLVRYLIHDSS+
Sbjct  190  HKIRVNSIAPGLFKSEITQGLMQKEWLKNVTERTVPLKVQQTVDPGLTSLVRYLIHDSSQ  249

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            YISGNTYIVD+G TLPGVPIFSSL
Sbjct  250  YISGNTYIVDSGATLPGVPIFSSL  273



>ref|XP_006301634.1| hypothetical protein CARUB_v10022077mg, partial [Capsella rubella]
 gb|EOA34532.1| hypothetical protein CARUB_v10022077mg, partial [Capsella rubella]
Length=274

 Score =   270 bits (691),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+DG  I+ AVQ AW+ FG ID LINNAG+RG V + LD +EEEW+ + +TNLTG+
Sbjct  71   ELDVSSDGATIKRAVQEAWEIFGNIDVLINNAGIRGNVKSSLDWSEEEWDKVFRTNLTGS  130

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+ M +AK GGS+++ISSISGL+RG LPGGLAY  SK  V+ +TR+MA+ELG 
Sbjct  131  WLVSKYVCVLMRDAKRGGSVINISSISGLHRGLLPGGLAYACSKGGVDTMTRMMAIELGV  190

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSI+PGLF+SEIT  LMQK+WL KV  RTVPL+   T +P LTSLVRYLIHDSS 
Sbjct  191  YKIRVNSIAPGLFRSEITQALMQKEWLKKVTERTVPLKMQQTVDPGLTSLVRYLIHDSSR  250

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GNTYIVD+G TLPGVPIFSSL
Sbjct  251  YVTGNTYIVDSGTTLPGVPIFSSL  274



>ref|XP_009596119.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=298

 Score =   271 bits (693),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 173/200 (87%), Gaps = 0/200 (0%)
 Frame = +1

Query  13   SADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGTWLVS  192
            +ADGP I+A+VQ+AWDAFG ID LINNAGVRG + + +D++EEEW++  +TNLTG+WLVS
Sbjct  99   TADGPLIKASVQKAWDAFGHIDVLINNAGVRGEIKSAVDISEEEWHNTLRTNLTGSWLVS  158

Query  193  KYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGTNKIR  372
            KYV   M  AK GGSI++ISSI+GLNR  + GG+AY++SK A++++T+VMALELG + +R
Sbjct  159  KYVGKHMQAAKRGGSIINISSIAGLNRISVRGGIAYSSSKAAMDSMTKVMALELGEHNVR  218

Query  373  VNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSEYISG  552
            VN+I+PG+FKSEIT+ L+QKDWL  VA R+VPL+TFGT+NPALTSLVRYL+HDSS YISG
Sbjct  219  VNAIAPGIFKSEITEKLLQKDWLKNVATRSVPLKTFGTTNPALTSLVRYLVHDSSNYISG  278

Query  553  NTYIVDAGNTLPGVPIFSSL  612
            N +IVD+G TLPG+PIFSSL
Sbjct  279  NIFIVDSGYTLPGIPIFSSL  298



>gb|EAZ43296.1| hypothetical protein OsJ_27892 [Oryza sativa Japonica Group]
Length=274

 Score =   270 bits (689),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV++ GPA+EAAVQ AWDAFGRID LINNAG+RG VH+PLD  E+EW  L KTNLTG+
Sbjct  71   ELDVASGGPALEAAVQSAWDAFGRIDVLINNAGLRGGVHSPLDWPEDEWETLIKTNLTGS  130

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLV+K+VC RM +AK  GS+++ISS+SGLNRG LPG   Y  SK+A++  T++MALELG 
Sbjct  131  WLVAKHVCRRMRDAKLKGSVINISSVSGLNRGHLPGSTGYAASKSAMHYATKLMALELGA  190

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVNSI+PG+FKSEIT  L+QK WL+ V  + VPL+T GT++PALTSLVR+LIH++S 
Sbjct  191  YGIRVNSIAPGIFKSEITAPLLQKKWLSTVVSKIVPLKTHGTTDPALTSLVRFLIHETSS  250

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GN +IVD+G TLPGVPIFSSL
Sbjct  251  YVTGNIFIVDSGATLPGVPIFSSL  274



>ref|XP_009391879.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   270 bits (689),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS   PAIEAAV  AW+AFGRIDAL+NNAGVRG V++ +D +EEEW+ +  TNLTG 
Sbjct  72   ELDVSRKSPAIEAAVHDAWNAFGRIDALVNNAGVRGGVYSAVDWSEEEWHRIMTTNLTGL  131

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK+VC+RM +A   G++++ISSI+G+ RGQLPG LAYT SKT VN++T VMALE+G 
Sbjct  132  WLVSKHVCIRMRDATQKGAVINISSIAGVARGQLPGSLAYTASKTGVNSITWVMALEMGR  191

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IR NS+ PG+FKSEIT+ LM+K+W+ KVA RTVPL TFGT+NP++ SL+RYL+ D+SE
Sbjct  192  YGIRTNSVCPGIFKSEITERLMEKEWIGKVARRTVPLGTFGTANPSVISLIRYLVDDASE  251

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GN +IVDAG TLPGVP+FSSL
Sbjct  252  YVNGNVFIVDAGATLPGVPLFSSL  275



>ref|XP_010516096.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase 4-like 
isoform X1 [Camelina sativa]
Length=281

 Score =   269 bits (688),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV+ AW+ FG+ID LINNAG+RG V T LD++E+EW  + +TNLTG 
Sbjct  78   ELDVSSDALTIQKAVKEAWEIFGKIDVLINNAGIRGEVKTSLDVSEDEWEKVFRTNLTGP  137

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVCL M +AK GGS+++ISSI+GL+RG LPGGLAY  SK  V+ ++R+MALELG 
Sbjct  138  WLVSKYVCLLMRDAKRGGSVINISSIAGLHRGLLPGGLAYACSKGGVDTMSRMMALELGV  197

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSI+PGLFKSEIT+ L+QK+W+  V  R VPL+   T +P LTSLVRYLIHD+S+
Sbjct  198  HKIRVNSIAPGLFKSEITESLLQKEWMKNVTERVVPLKVQQTVDPGLTSLVRYLIHDASQ  257

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGNTYIVD+GNTLPGVPIFSSL
Sbjct  258  YVSGNTYIVDSGNTLPGVPIFSSL  281



>ref|XP_010516097.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase 4-like 
isoform X2 [Camelina sativa]
Length=280

 Score =   269 bits (688),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV+ AW+ FG+ID LINNAG+RG V T LD++E+EW  + +TNLTG 
Sbjct  77   ELDVSSDALTIQKAVKEAWEIFGKIDVLINNAGIRGEVKTSLDVSEDEWEKVFRTNLTGP  136

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVCL M +AK GGS+++ISSI+GL+RG LPGGLAY  SK  V+ ++R+MALELG 
Sbjct  137  WLVSKYVCLLMRDAKRGGSVINISSIAGLHRGLLPGGLAYACSKGGVDTMSRMMALELGV  196

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSI+PGLFKSEIT+ L+QK+W+  V  R VPL+   T +P LTSLVRYLIHD+S+
Sbjct  197  HKIRVNSIAPGLFKSEITESLLQKEWMKNVTERVVPLKVQQTVDPGLTSLVRYLIHDASQ  256

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGNTYIVD+GNTLPGVPIFSSL
Sbjct  257  YVSGNTYIVDSGNTLPGVPIFSSL  280



>ref|NP_001062206.1| Os08g0510400 [Oryza sativa Japonica Group]
 dbj|BAC57400.1| putative alcohol dehydrogenase homolog [Oryza sativa Japonica 
Group]
 dbj|BAF24120.1| Os08g0510400 [Oryza sativa Japonica Group]
 gb|EAZ07584.1| hypothetical protein OsI_29835 [Oryza sativa Indica Group]
 dbj|BAG91409.1| unnamed protein product [Oryza sativa Japonica Group]
Length=284

 Score =   270 bits (689),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV++ GPA+EAAVQ AWDAFGRID LINNAG+RG VH+PLD  E+EW  L KTNLTG+
Sbjct  81   ELDVASGGPALEAAVQSAWDAFGRIDVLINNAGLRGGVHSPLDWPEDEWETLIKTNLTGS  140

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLV+K+VC RM +AK  GS+++ISS+SGLNRG LPG   Y  SK+A++  T++MALELG 
Sbjct  141  WLVAKHVCRRMRDAKLKGSVINISSVSGLNRGHLPGSTGYAASKSAMHYATKLMALELGA  200

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVNSI+PG+FKSEIT  L+QK WL+ V  + VPL+T GT++PALTSLVR+LIH++S 
Sbjct  201  YGIRVNSIAPGIFKSEITAPLLQKKWLSTVVSKIVPLKTHGTTDPALTSLVRFLIHETSS  260

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GN +IVD+G TLPGVPIFSSL
Sbjct  261  YVTGNIFIVDSGATLPGVPIFSSL  284



>ref|XP_010427297.1| PREDICTED: probable L-xylulose reductase isoform X2 [Camelina 
sativa]
Length=280

 Score =   269 bits (688),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV+ AW+ FG+ID LINNAG+RG V T LD++E+EW  + +TNLTG 
Sbjct  77   ELDVSSDAATIQKAVKEAWEIFGKIDVLINNAGIRGEVKTSLDVSEDEWEKVFRTNLTGP  136

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVCL M +AK GGS+++ISSI+GL+RG LPGGLAY  SK  V+ ++R+MALELG 
Sbjct  137  WLVSKYVCLMMRDAKRGGSVINISSIAGLHRGLLPGGLAYACSKGGVDTMSRMMALELGV  196

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSI+PGLFKSEIT+ L+QK+W+  V  R VPL+   T +P LTSLVRYLIHD+S+
Sbjct  197  HKIRVNSIAPGLFKSEITESLLQKEWMKNVTERIVPLKVQQTVDPGLTSLVRYLIHDASQ  256

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            ++SGNTYIVD+GNTLPGVPIFSSL
Sbjct  257  HVSGNTYIVDSGNTLPGVPIFSSL  280



>ref|XP_010427295.1| PREDICTED: probable L-xylulose reductase isoform X1 [Camelina 
sativa]
 ref|XP_010427296.1| PREDICTED: probable L-xylulose reductase isoform X1 [Camelina 
sativa]
Length=281

 Score =   269 bits (688),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV+ AW+ FG+ID LINNAG+RG V T LD++E+EW  + +TNLTG 
Sbjct  78   ELDVSSDAATIQKAVKEAWEIFGKIDVLINNAGIRGEVKTSLDVSEDEWEKVFRTNLTGP  137

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVCL M +AK GGS+++ISSI+GL+RG LPGGLAY  SK  V+ ++R+MALELG 
Sbjct  138  WLVSKYVCLMMRDAKRGGSVINISSIAGLHRGLLPGGLAYACSKGGVDTMSRMMALELGV  197

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSI+PGLFKSEIT+ L+QK+W+  V  R VPL+   T +P LTSLVRYLIHD+S+
Sbjct  198  HKIRVNSIAPGLFKSEITESLLQKEWMKNVTERIVPLKVQQTVDPGLTSLVRYLIHDASQ  257

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            ++SGNTYIVD+GNTLPGVPIFSSL
Sbjct  258  HVSGNTYIVDSGNTLPGVPIFSSL  281



>ref|XP_004172090.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
isoform 2 [Cucumis sativus]
Length=286

 Score =   269 bits (687),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELD+ AD   I+ AV++AWD+FG IDAL+NN G+RG V + LDL+EEEW+D+  TNL G+
Sbjct  83   ELDLKADSTIIKDAVRKAWDSFGFIDALVNNGGLRGTVKSSLDLSEEEWDDVMGTNLKGS  142

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+ M +    GS+++ISSI GLNRG +PGG  Y  SK  +N LT++MALELG 
Sbjct  143  WLVSKYVCIHMRDTNRSGSLINISSIGGLNRGHIPGGSVYGASKAGLNTLTKIMALELGA  202

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVNSI PG+FKSEIT  LMQKDWL  VAL+TVPL+T+GTSNPALT+L+RYL+HDSS 
Sbjct  203  YNIRVNSICPGIFKSEITKVLMQKDWLKNVALKTVPLQTYGTSNPALTTLIRYLVHDSSR  262

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GN +IVDAG TLPGVPIFSSL
Sbjct  263  YVTGNIFIVDAGATLPGVPIFSSL  286



>ref|XP_009593495.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=285

 Score =   268 bits (686),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            EL+V+ADGP IEA+VQ+AWDAFG ID LINNAGVRG + + +D++E+EW++  +TNLTG+
Sbjct  82   ELNVTADGPLIEASVQKAWDAFGHIDVLINNAGVRGGLKSAVDISEKEWHNTLRTNLTGS  141

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYV   M  AK GGSI++ISSI G+NR  + GG+AY++SK AV+ +T+VMA ELG 
Sbjct  142  WLVSKYVGKHMQAAKRGGSIINISSIGGINRISMRGGIAYSSSKAAVDTMTKVMAYELGE  201

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            + IRVN+I+PG+FKSEIT+ L+QKDWL  VA R+VPL+TFGT+NPALTSLVRYL+HDSS 
Sbjct  202  HNIRVNAIAPGIFKSEITEKLLQKDWLKNVATRSVPLKTFGTTNPALTSLVRYLVHDSSN  261

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVD+G TLPG+PIFSSL
Sbjct  262  YVSGNIFIVDSGYTLPGIPIFSSL  285



>ref|XP_009371244.1| PREDICTED: LOW QUALITY PROTEIN: estradiol 17-beta-dehydrogenase 
8-like [Pyrus x bretschneideri]
Length=295

 Score =   269 bits (687),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 166/195 (85%), Gaps = 0/195 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSADGPAIE +V +AWDAFGRIDAL+NNAG+RG V + L L+EEEWN++ +TNLTG+
Sbjct  93   ELDVSADGPAIEKSVNKAWDAFGRIDALVNNAGIRGNVKSALXLSEEEWNNVFRTNLTGS  152

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK+V +RM +A  GGSIV ISS++G+N G LPG  AY  SK  VN LT+ MA+ELG 
Sbjct  153  WLVSKFVAIRMRDADQGGSIVKISSVAGINGGYLPGATAYNCSKAGVNTLTKTMAMELGV  212

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVN+ SPGLF+SEIT+GLMQK+WL+ VA++TVPLRTFGTS+ ALTSLVRYL+HDSSE
Sbjct  213  HKIRVNATSPGLFRSEITEGLMQKEWLHNVAMKTVPLRTFGTSDTALTSLVRYLLHDSSE  272

Query  541  YISGNTYIVDAGNTL  585
            Y+SGN YI DAG TL
Sbjct  273  YMSGNIYIADAGTTL  287



>ref|XP_010418256.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase 4-like 
[Camelina sativa]
Length=280

 Score =   268 bits (684),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+DG  I+ AV+ AW+ FG ID LINNAG+RG V + LD +EEEW+ + +TNLTG+
Sbjct  77   ELDVSSDGATIQKAVKEAWEIFGNIDVLINNAGIRGNVKSSLDWSEEEWDKVFRTNLTGS  136

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK+VC+ M +AK GGS ++ISSISGL+RG LPGGLAY  SK  V+ +TR+MA+EL  
Sbjct  137  WLVSKHVCVLMRDAKRGGSEINISSISGLHRGLLPGGLAYACSKGGVDTMTRMMAIELAV  196

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSI+PGLF+SEIT GLMQK+WL KV  RTVPL+   T +P LTSL+RYLIHDSS+
Sbjct  197  YKIRVNSIAPGLFRSEITQGLMQKEWLKKVTERTVPLKMQQTVDPGLTSLMRYLIHDSSQ  256

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GNTYIVD+G TLPGVPIFSSL
Sbjct  257  YVTGNTYIVDSGTTLPGVPIFSSL  280



>ref|XP_006660269.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Oryza brachyantha]
Length=246

 Score =   266 bits (680),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 168/203 (83%), Gaps = 0/203 (0%)
 Frame = +1

Query  4    LDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGTW  183
            LDV++ G A+EAAVQRAWDAFGRID LINNAG+RG VH+PLD  E++WN L KTNLTG+W
Sbjct  44   LDVASGGAALEAAVQRAWDAFGRIDVLINNAGLRGGVHSPLDWPEDDWNTLIKTNLTGSW  103

Query  184  LVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGTN  363
            LVSK+VC RM +AK  GS+++ISS+SGLNRG LPG   Y  SK+A++ +T++MALELG  
Sbjct  104  LVSKHVCRRMHDAKIKGSVINISSVSGLNRGHLPGSTGYAASKSAMHYVTKLMALELGAY  163

Query  364  KIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSEY  543
             IRVNSI+PG+F+SEIT  L+QK WL  V  + VPL+T GT++PALTSLVR+LIH +S Y
Sbjct  164  GIRVNSIAPGIFQSEITAPLLQKKWLKTVVSKIVPLKTHGTTDPALTSLVRFLIHGTSSY  223

Query  544  ISGNTYIVDAGNTLPGVPIFSSL  612
            ++GN +IVD+G T+PGVPIFSSL
Sbjct  224  VTGNIFIVDSGATIPGVPIFSSL  246



>ref|XP_002444769.1| hypothetical protein SORBIDRAFT_07g027700 [Sorghum bicolor]
 gb|EES14264.1| hypothetical protein SORBIDRAFT_07g027700 [Sorghum bicolor]
Length=279

 Score =   267 bits (683),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+A G  +EAAVQRAWDAFGRIDALINNAG+RG VH+PLD  E+EW+ + KTNLTG+
Sbjct  76   ELDVAAGGSVLEAAVQRAWDAFGRIDALINNAGIRGGVHSPLDWPEDEWDRIIKTNLTGS  135

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLV+K+VC RM +AK  GS+V+I+SI+GLNRG LPG   Y +SK AV+  T++MALELG 
Sbjct  136  WLVAKHVCRRMRDAKLYGSVVNITSIAGLNRGHLPGSTGYASSKAAVHYATKIMALELGA  195

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVNSI+PGLFKSEIT  L+QK WL+ V  + VPL+  GT++PALTSLVR+LIH++S 
Sbjct  196  YGIRVNSIAPGLFKSEITAPLLQKRWLSTVTSKIVPLKEHGTTDPALTSLVRFLIHEASS  255

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GN ++VD+G  +PGVPIFSSL
Sbjct  256  YVTGNIFVVDSGAAIPGVPIFSSL  279



>ref|XP_008443382.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase 4-like 
[Cucumis melo]
Length=286

 Score =   267 bits (683),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELD+ AD   I+ AV++AWD+FG IDAL+NNAG+RG V + L+L+EEEW+++  TNL G+
Sbjct  83   ELDLKADSTIIKDAVRKAWDSFGFIDALVNNAGLRGTVKSSLELSEEEWDEVMGTNLKGS  142

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+ M +    GS+++ISSI GLNRG +PGG AY+ SK  +N LT++MA ELG 
Sbjct  143  WLVSKYVCIHMRDTNRSGSVINISSIGGLNRGHIPGGPAYSASKAGLNTLTKIMAHELGA  202

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVNSI PG+FKSEIT GLMQKDWL  VAL+TVPL+T+GTS+PALT+LVRYL+H+SS 
Sbjct  203  YNIRVNSICPGIFKSEITKGLMQKDWLKNVALKTVPLQTYGTSDPALTTLVRYLVHESST  262

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GN +IVDAG TLPGVPIFSSL
Sbjct  263  YVTGNIFIVDAGATLPGVPIFSSL  286



>ref|XP_009631506.1| PREDICTED: probable L-xylulose reductase isoform X1 [Nicotiana 
tomentosiformis]
Length=269

 Score =   267 bits (682),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 168/205 (82%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELD++A+G  IEAAVQRAWDAFGRIDAL+NNAG+RG + + L L+E+EWN    TNL G 
Sbjct  65   ELDINANGATIEAAVQRAWDAFGRIDALVNNAGIRGSISSSLKLSEDEWNHTFNTNLRGA  124

Query  181  WLVSKYVCLRMCNAKFgg-sivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSKYVC RM +AK GG S+++ISS + LNR  LPG LAY +SK A++ +T++MALELG
Sbjct  125  WLVSKYVCRRMPDAKQGGGSVINISSAAALNRALLPGSLAYASSKIALDMVTKIMALELG  184

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
             +KIRVNSI+PG+FKSEIT+ L+Q+   +    + VPLRTFGT++PALTS+VRYLIH+SS
Sbjct  185  VDKIRVNSIAPGVFKSEITENLVQQKRFHNAVFKAVPLRTFGTTDPALTSVVRYLIHNSS  244

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
            +Y+SGN +IVD G TLPGVPIFSSL
Sbjct  245  QYVSGNVFIVDGGGTLPGVPIFSSL  269



>ref|XP_006403473.1| hypothetical protein EUTSA_v10010610mg [Eutrema salsugineum]
 gb|ESQ44926.1| hypothetical protein EUTSA_v10010610mg [Eutrema salsugineum]
Length=281

 Score =   267 bits (682),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV+ AW  FG+IDALINNAG RG V + L+L+EEEWN + +TNLTG 
Sbjct  78   ELDVSSDAATIQKAVKEAWQVFGKIDALINNAGFRGNVKSSLELSEEEWNKVFRTNLTGP  137

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVCL M +A  GGS+++ISSISGL+RG+ PGG+AY  SK  V+ +TR+MA+ELG 
Sbjct  138  WLVSKYVCLLMKDANIGGSVINISSISGLHRGKKPGGVAYACSKGGVDTMTRMMAIELGV  197

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSI+PGLF+SEIT GL++K+WL KV  RTVPL    T +P L+SLVRYLIHDSS+
Sbjct  198  YKIRVNSIAPGLFRSEITQGLLEKEWLKKVTDRTVPLTVEQTVDPGLSSLVRYLIHDSSQ  257

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGNTYIVD+G TLPGVPIFSSL
Sbjct  258  YVSGNTYIVDSGATLPGVPIFSSL  281



>emb|CDP21456.1| unnamed protein product [Coffea canephora]
Length=288

 Score =   267 bits (682),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+AD   IE +VQRAW+AFG IDA++NNAGVRG + + LDLTE EWN   +TNLTG 
Sbjct  85   ELDVTADASTIETSVQRAWNAFGHIDAVVNNAGVRGSISSSLDLTENEWNSTMRTNLTGA  144

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYV  +M  A  GG IV++SSISGLNR Q+ G +AY++SK  ++++TR+MALELG 
Sbjct  145  WLVSKYVGRQMREACTGGCIVNVSSISGLNRAQMRGSVAYSSSKAGMDSMTRIMALELGE  204

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             K+RVNSISPGLF+S+IT+ L++K W+N VA RTVPLR FGT++PALTSLVR+LIHDSS 
Sbjct  205  YKVRVNSISPGLFRSQITEELVKKRWINNVAERTVPLRAFGTTDPALTSLVRFLIHDSSS  264

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVDAG TLPGVPIFSSL
Sbjct  265  YVSGNHFIVDAGYTLPGVPIFSSL  288



>ref|XP_006291426.1| hypothetical protein CARUB_v10017563mg, partial [Capsella rubella]
 gb|EOA24324.1| hypothetical protein CARUB_v10017563mg, partial [Capsella rubella]
Length=345

 Score =   269 bits (687),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV+ AW+ FG+ID LINNAG+RG V + LD++E+EW+ + +TNLTG 
Sbjct  142  ELDVSSDAATIQKAVKVAWEIFGKIDVLINNAGIRGEVKSSLDVSEDEWDKVFRTNLTGP  201

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+ M +AK GGS+++ISSI+GL+RG LPGGLAY  SK  V+ ++R+MALELG 
Sbjct  202  WLVSKYVCILMRDAKRGGSVINISSIAGLHRGLLPGGLAYACSKGGVDTMSRMMALELGV  261

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSI+PGLFKSEIT+ L+QK W+  V  RTVPL+   T +P LTSLVRYLIHDSS+
Sbjct  262  HKIRVNSIAPGLFKSEITESLLQKKWMKNVTERTVPLKEQQTVDPGLTSLVRYLIHDSSQ  321

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGNTYIVD+GNTLPGVPIFSSL
Sbjct  322  YVSGNTYIVDSGNTLPGVPIFSSL  345



>ref|XP_004136692.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
isoform 2 [Cucumis sativus]
 gb|KGN59543.1| hypothetical protein Csa_3G824880 [Cucumis sativus]
Length=286

 Score =   266 bits (681),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELD+ AD   I+ AV++AWD+FG IDAL+NN G+RG V + LDL+EEEW+D+  TNL G+
Sbjct  83   ELDLKADSTIIKDAVRKAWDSFGFIDALVNNGGLRGTVKSSLDLSEEEWDDVMGTNLKGS  142

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+ M +    GS+++ISSI GLNRG +PGG  Y  SK  +N LT++MALELG 
Sbjct  143  WLVSKYVCIHMRDTNRSGSLINISSIGGLNRGHIPGGSVYGASKAGLNTLTKIMALELGA  202

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVNSI PG+FKSEIT  LMQKDWL  VAL+TVPL+T+GTS+PALT+L+RYL+HDSS 
Sbjct  203  YNIRVNSICPGIFKSEITKVLMQKDWLKNVALKTVPLQTYGTSDPALTTLIRYLVHDSSR  262

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GN +IVDAG TLPGVPIFSSL
Sbjct  263  YVTGNIFIVDAGATLPGVPIFSSL  286



>ref|XP_006291425.1| hypothetical protein CARUB_v10017563mg, partial [Capsella rubella]
 gb|EOA24323.1| hypothetical protein CARUB_v10017563mg, partial [Capsella rubella]
Length=344

 Score =   268 bits (686),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV+ AW+ FG+ID LINNAG+RG V + LD++E+EW+ + +TNLTG 
Sbjct  141  ELDVSSDAATIQKAVKVAWEIFGKIDVLINNAGIRGEVKSSLDVSEDEWDKVFRTNLTGP  200

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+ M +AK GGS+++ISSI+GL+RG LPGGLAY  SK  V+ ++R+MALELG 
Sbjct  201  WLVSKYVCILMRDAKRGGSVINISSIAGLHRGLLPGGLAYACSKGGVDTMSRMMALELGV  260

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSI+PGLFKSEIT+ L+QK W+  V  RTVPL+   T +P LTSLVRYLIHDSS+
Sbjct  261  HKIRVNSIAPGLFKSEITESLLQKKWMKNVTERTVPLKEQQTVDPGLTSLVRYLIHDSSQ  320

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGNTYIVD+GNTLPGVPIFSSL
Sbjct  321  YVSGNTYIVDSGNTLPGVPIFSSL  344



>ref|XP_004249129.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Solanum lycopersicum]
Length=291

 Score =   266 bits (681),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+ADG  IEA+V++AWDAFG IDALINNAGVRG + + +D++ EEW +  +TNLTG+
Sbjct  88   ELDVTADGTTIEASVKKAWDAFGHIDALINNAGVRGGIKSSVDISWEEWENTLRTNLTGS  147

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYV  +M  +K GGSI++ISSISGLNR  + GG+AY++SK A++++T++MALELG 
Sbjct  148  WLVSKYVGRQMQASKKGGSIINISSISGLNRALMRGGIAYSSSKAAMDSMTKIMALELGE  207

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            + IRVN+I+PGLFKSEIT+ L++KDW+  VA R++PL+TFGT++PALTSL+RYL+HDSS 
Sbjct  208  HNIRVNAIAPGLFKSEITENLVKKDWIQNVAKRSIPLKTFGTTDPALTSLLRYLVHDSSN  267

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVDAG TLPGVPIFSSL
Sbjct  268  YVSGNIFIVDAGYTLPGVPIFSSL  291



>ref|XP_004144361.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
[Cucumis sativus]
Length=297

 Score =   266 bits (680),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV  +G +IE +V +AWD FG ID L+NNAG+RG V +PL+L+E+EW+D   TNL G 
Sbjct  94   ELDVCGNGKSIEESVTKAWDYFGFIDTLVNNAGLRGSVKSPLELSEKEWDDTMDTNLKGQ  153

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+ M  A  GGSI++ISSISGLNR    G +AY TSK A+N  T+VMA+ELG 
Sbjct  154  WLVSKYVCILMNKANRGGSIINISSISGLNRPLEMGAVAYITSKAALNTFTKVMAMELGA  213

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSI PGLFKSEIT  LM+KDW+  VA R VPLRTFGTSNPALT++VRYL+HDSS+
Sbjct  214  HKIRVNSICPGLFKSEITKDLMKKDWIKNVARRMVPLRTFGTSNPALTTIVRYLVHDSSK  273

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVDAG+TLPGVPIFSSL
Sbjct  274  YVSGNIFIVDAGSTLPGVPIFSSL  297



>gb|KFK34763.1| hypothetical protein AALP_AA5G190600 [Arabis alpina]
Length=282

 Score =   266 bits (679),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV+ AW  FGRID LINNAG+RG V + LDL+E+EW+++ +TNLTG 
Sbjct  79   ELDVSSDAATIQKAVKEAWAVFGRIDVLINNAGIRGNVKSSLDLSEDEWDNVFRTNLTGP  138

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+ M +AK GGS++++SSI+GL+RG LPGGLAY TSK  V+ +TR+MA+ELG 
Sbjct  139  WLVSKYVCILMRDAKRGGSVINVSSIAGLHRGMLPGGLAYATSKGGVDTMTRMMAIELGA  198

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIR+N+I+PGLFKSEIT GLMQK+WL  V  + VPL+   T +P LTSLVRYLIHDSS+
Sbjct  199  YKIRLNTIAPGLFKSEITQGLMQKEWLKHVNEKIVPLKEEQTVDPGLTSLVRYLIHDSSQ  258

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGNTYIVD+G TL G+PIFSSL
Sbjct  259  YVSGNTYIVDSGTTLSGLPIFSSL  282



>gb|KFK34764.1| hypothetical protein AALP_AA5G190600 [Arabis alpina]
Length=281

 Score =   265 bits (678),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV+ AW  FGRID LINNAG+RG V + LDL+E+EW+++ +TNLTG 
Sbjct  78   ELDVSSDAATIQKAVKEAWAVFGRIDVLINNAGIRGNVKSSLDLSEDEWDNVFRTNLTGP  137

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+ M +AK GGS++++SSI+GL+RG LPGGLAY TSK  V+ +TR+MA+ELG 
Sbjct  138  WLVSKYVCILMRDAKRGGSVINVSSIAGLHRGMLPGGLAYATSKGGVDTMTRMMAIELGA  197

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIR+N+I+PGLFKSEIT GLMQK+WL  V  + VPL+   T +P LTSLVRYLIHDSS+
Sbjct  198  YKIRLNTIAPGLFKSEITQGLMQKEWLKHVNEKIVPLKEEQTVDPGLTSLVRYLIHDSSQ  257

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGNTYIVD+G TL G+PIFSSL
Sbjct  258  YVSGNTYIVDSGTTLSGLPIFSSL  281



>emb|CDY48725.1| BnaA09g10000D [Brassica napus]
Length=287

 Score =   266 bits (679),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV++D   I  AV +AW+ FG+ID LINNAG+RG V + LDL+E+EW+ + +TNLTG 
Sbjct  84   ELDVASDAATIRKAVNKAWEVFGKIDVLINNAGIRGNVKSSLDLSEDEWDKVFRTNLTGP  143

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+ M +AK GGS+++ISS++G++RG LPG +AY  SK  V+ +TR+MA+ELG 
Sbjct  144  WLVSKYVCILMRDAKQGGSVINISSMAGVHRGMLPGAVAYACSKGGVDIMTRMMAIELGV  203

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIR+NSI+PGLFKSEIT GLMQK+WL KV  RTVPL+   T +P LTSLVRYLIHDSSE
Sbjct  204  YKIRMNSIAPGLFKSEITQGLMQKEWLKKVNERTVPLKMQQTVDPGLTSLVRYLIHDSSE  263

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGNTYIVD+G +LPG+PIFSSL
Sbjct  264  YVSGNTYIVDSGASLPGLPIFSSL  287



>gb|KFK40341.1| hypothetical protein AALP_AA3G361500 [Arabis alpina]
Length=284

 Score =   265 bits (678),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV++D   I+ AV+ AW+ FG+ID LINNAG+RG V + LDL++EEW+ + +TNLTG 
Sbjct  81   ELDVTSDAATIQNAVKEAWEIFGKIDVLINNAGIRGTVKSSLDLSKEEWDKVFRTNLTGP  140

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYV + MC+AK GGS+++ISS++GL RG+LPGGLAY  SK  V  +T +MALELG 
Sbjct  141  WLVSKYVGVLMCDAKRGGSVINISSVAGLRRGELPGGLAYACSKGGVETMTMMMALELGD  200

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSI+PGLFKSEIT GLMQK+WL  VA R VPL+   T +P LTSLVRYLIH+SS+
Sbjct  201  YKIRVNSIAPGLFKSEITQGLMQKEWLKNVAERIVPLKMQQTVDPGLTSLVRYLIHNSSQ  260

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            YISGNTYIVD+G TLPG+PIFSSL
Sbjct  261  YISGNTYIVDSGYTLPGLPIFSSL  284



>gb|KGN54692.1| hypothetical protein Csa_4G427280 [Cucumis sativus]
Length=297

 Score =   266 bits (679),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV   G +IE +V +AWD FG ID L+NNAG+RG V +PL+L+E+EW+D   TNL G 
Sbjct  94   ELDVCGHGKSIEESVTKAWDYFGFIDTLVNNAGLRGSVKSPLELSEKEWDDTMDTNLKGQ  153

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+ M  A  GGSI++ISSISGLNR    G +AY TSK A+N  T+VMA+ELG 
Sbjct  154  WLVSKYVCILMNKANRGGSIINISSISGLNRPLEMGAVAYITSKAALNTFTKVMAMELGA  213

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSI PGLFKSEIT  LM+KDW+  VA R VPLRTFGTSNPALT++VRYL+HDSS+
Sbjct  214  HKIRVNSICPGLFKSEITKDLMKKDWIKNVARRMVPLRTFGTSNPALTTIVRYLVHDSSK  273

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVDAG+TLPGVPIFSSL
Sbjct  274  YVSGNIFIVDAGSTLPGVPIFSSL  297



>ref|XP_006361353.1| PREDICTED: probable L-xylulose reductase-like, partial [Solanum 
tuberosum]
Length=276

 Score =   265 bits (676),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 160/205 (78%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            +LDV++DG  IE+AVQ AWDAFG IDAL+NNAG+ G VH+ L+L E+EW+++  TNL G 
Sbjct  72   QLDVTSDGATIESAVQIAWDAFGHIDALVNNAGITGNVHSSLELPEKEWDNVFNTNLKGA  131

Query  181  WLVSKYVCLRMCNAKFggsivsissisg-LNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSKYVC RM +AK GG  V   S    LNRG   G LAY TSK A++ LT++MA+ELG
Sbjct  132  WLVSKYVCRRMRDAKQGGGSVINISSLAGLNRGVFTGSLAYATSKMALDMLTKIMAVELG  191

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
             +KIRVNSI+PG FKSEIT  LMQK W +    RTVPLRT GT +PALTS+VRYLIHDSS
Sbjct  192  VDKIRVNSIAPGYFKSEITGSLMQKKWFDNYTRRTVPLRTLGTIDPALTSMVRYLIHDSS  251

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
            +Y+SGN +IVDAG +LPGVPIFSSL
Sbjct  252  KYVSGNVFIVDAGTSLPGVPIFSSL  276



>gb|EMT14873.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Aegilops tauschii]
Length=283

 Score =   264 bits (675),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+A G A+EAAVQRAWDAFGRID LINNAG+RG VH+ LD  E+EW+ L KTNLTG 
Sbjct  80   ELDVAAGGSAVEAAVQRAWDAFGRIDVLINNAGLRGGVHSSLDWPEDEWDKLIKTNLTGL  139

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLV+K+VC  M +AK  GS+++ISS++GLNRG LPG + Y +SK+AV+++T++MALELG 
Sbjct  140  WLVAKHVCRHMRDAKIKGSVINISSVAGLNRGNLPGSIGYASSKSAVHSVTKIMALELGA  199

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVN+I+PG+F+SEIT  L+QK WL+ V  + VPL+T GT++PALTSLVR+LIH+ + 
Sbjct  200  YGIRVNAIAPGIFQSEITAPLLQKRWLSTVVSKIVPLKTNGTTDPALTSLVRFLIHEKAS  259

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            YI+GN +IVD+G T+PGVPIFSSL
Sbjct  260  YITGNIFIVDSGVTVPGVPIFSSL  283



>ref|NP_565425.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AEC06694.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=312

 Score =   265 bits (677),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 162/205 (79%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   ++ AV++AW+ FG+IDALINNAG RG V + LDL+E+EW+ + KTNLTGT
Sbjct  108  ELDVSSDAATVQKAVKKAWEIFGKIDALINNAGFRGNVKSSLDLSEDEWDKVFKTNLTGT  167

Query  181  WLVSKYVCLRMCNAKFggsivsissisg-LNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSKYVC+ M +AK GG  V   S    L+RGQ+PGG+AY  SK  V+ +TR+MALELG
Sbjct  168  WLVSKYVCILMRDAKRGGGSVINISSVSWLHRGQVPGGVAYACSKGGVDTMTRMMALELG  227

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
              KIRVNSI+PGL KSEIT GLMQK+WL  V  RTVPL+   T +P LTSL+RYL+HDSS
Sbjct  228  VYKIRVNSIAPGLLKSEITQGLMQKEWLKTVIERTVPLKVQQTVDPGLTSLLRYLVHDSS  287

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
            +YISGNTYIVDAG +L G+PIFSSL
Sbjct  288  KYISGNTYIVDAGASLVGLPIFSSL  312



>ref|XP_010504384.1| PREDICTED: probable L-xylulose reductase isoform X1 [Camelina 
sativa]
 ref|XP_010504385.1| PREDICTED: probable L-xylulose reductase isoform X1 [Camelina 
sativa]
Length=281

 Score =   263 bits (673),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV+ AW+ F +ID LINNAG+RG V T LD++E+EW  + +TNLTG 
Sbjct  78   ELDVSSDAATIQKAVKEAWEIFEKIDVLINNAGIRGEVKTSLDVSEDEWEKVFRTNLTGP  137

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVCL M +AK GGS+++ISSI+GL+RG LPGGLA   SK  V+ ++R+M LELG 
Sbjct  138  WLVSKYVCLMMRDAKRGGSVINISSIAGLHRGLLPGGLACACSKGGVDTMSRMMTLELGV  197

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSI+PGLFKSEIT+ L+QK+W+  V  R VPL+   T +P LTSLVRYLIHDSS+
Sbjct  198  HKIRVNSIAPGLFKSEITESLLQKEWMKNVTGRVVPLKVQQTVDPGLTSLVRYLIHDSSQ  257

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGNTYIVD+GNTLPGVPIFSSL
Sbjct  258  YVSGNTYIVDSGNTLPGVPIFSSL  281



>ref|XP_009139176.1| PREDICTED: probable L-xylulose reductase isoform X1 [Brassica 
rapa]
Length=283

 Score =   263 bits (673),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV++AWD FG+ID LINNAG+RG V T LDLTE+EWN + +TNL+G 
Sbjct  80   ELDVSSDAATIQKAVKQAWDIFGKIDVLINNAGIRGNVKTSLDLTEDEWNTVFRTNLSGP  139

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC  M +AK GGS++++SSI+GL+RG LPGG+AY  SK  V+ +TR+MA+ELG 
Sbjct  140  WLVSKYVCSLMRDAKRGGSVINVSSIAGLHRGLLPGGVAYACSKGGVDTMTRMMAIELGV  199

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVNSI+PGL KSEIT GLMQK+WL  V  R++PL+   T +P LTSLVRYLIHDSS 
Sbjct  200  YNIRVNSIAPGLLKSEITQGLMQKEWLKNVTERSIPLKVQQTVDPGLTSLVRYLIHDSSR  259

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGNTYI+D+G T+PG+PIFSSL
Sbjct  260  YVSGNTYILDSGATIPGLPIFSSL  283



>ref|XP_010504386.1| PREDICTED: probable L-xylulose reductase isoform X2 [Camelina 
sativa]
Length=280

 Score =   263 bits (672),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV+ AW+ F +ID LINNAG+RG V T LD++E+EW  + +TNLTG 
Sbjct  77   ELDVSSDAATIQKAVKEAWEIFEKIDVLINNAGIRGEVKTSLDVSEDEWEKVFRTNLTGP  136

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVCL M +AK GGS+++ISSI+GL+RG LPGGLA   SK  V+ ++R+M LELG 
Sbjct  137  WLVSKYVCLMMRDAKRGGSVINISSIAGLHRGLLPGGLACACSKGGVDTMSRMMTLELGV  196

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSI+PGLFKSEIT+ L+QK+W+  V  R VPL+   T +P LTSLVRYLIHDSS+
Sbjct  197  HKIRVNSIAPGLFKSEITESLLQKEWMKNVTGRVVPLKVQQTVDPGLTSLVRYLIHDSSQ  256

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGNTYIVD+GNTLPGVPIFSSL
Sbjct  257  YVSGNTYIVDSGNTLPGVPIFSSL  280



>ref|XP_009139177.1| PREDICTED: probable L-xylulose reductase isoform X2 [Brassica 
rapa]
Length=282

 Score =   263 bits (672),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV++AWD FG+ID LINNAG+RG V T LDLTE+EWN + +TNL+G 
Sbjct  79   ELDVSSDAATIQKAVKQAWDIFGKIDVLINNAGIRGNVKTSLDLTEDEWNTVFRTNLSGP  138

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC  M +AK GGS++++SSI+GL+RG LPGG+AY  SK  V+ +TR+MA+ELG 
Sbjct  139  WLVSKYVCSLMRDAKRGGSVINVSSIAGLHRGLLPGGVAYACSKGGVDTMTRMMAIELGV  198

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVNSI+PGL KSEIT GLMQK+WL  V  R++PL+   T +P LTSLVRYLIHDSS 
Sbjct  199  YNIRVNSIAPGLLKSEITQGLMQKEWLKNVTERSIPLKVQQTVDPGLTSLVRYLIHDSSR  258

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGNTYI+D+G T+PG+PIFSSL
Sbjct  259  YVSGNTYILDSGATIPGLPIFSSL  282



>ref|XP_009139180.1| PREDICTED: probable L-xylulose reductase isoform X4 [Brassica 
rapa]
Length=275

 Score =   263 bits (672),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV++AWD FG+ID LINNAG+RG V T LDLTE+EWN + +TNL+G 
Sbjct  72   ELDVSSDAATIQKAVKQAWDIFGKIDVLINNAGIRGNVKTSLDLTEDEWNTVFRTNLSGP  131

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC  M +AK GGS++++SSI+GL+RG LPGG+AY  SK  V+ +TR+MA+ELG 
Sbjct  132  WLVSKYVCSLMRDAKRGGSVINVSSIAGLHRGLLPGGVAYACSKGGVDTMTRMMAIELGV  191

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVNSI+PGL KSEIT GLMQK+WL  V  R++PL+   T +P LTSLVRYLIHDSS 
Sbjct  192  YNIRVNSIAPGLLKSEITQGLMQKEWLKNVTERSIPLKVQQTVDPGLTSLVRYLIHDSSR  251

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGNTYI+D+G T+PG+PIFSSL
Sbjct  252  YVSGNTYILDSGATIPGLPIFSSL  275



>ref|XP_009139179.1| PREDICTED: probable L-xylulose reductase isoform X3 [Brassica 
rapa]
Length=279

 Score =   263 bits (672),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV++AWD FG+ID LINNAG+RG V T LDLTE+EWN + +TNL+G 
Sbjct  76   ELDVSSDAATIQKAVKQAWDIFGKIDVLINNAGIRGNVKTSLDLTEDEWNTVFRTNLSGP  135

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC  M +AK GGS++++SSI+GL+RG LPGG+AY  SK  V+ +TR+MA+ELG 
Sbjct  136  WLVSKYVCSLMRDAKRGGSVINVSSIAGLHRGLLPGGVAYACSKGGVDTMTRMMAIELGV  195

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVNSI+PGL KSEIT GLMQK+WL  V  R++PL+   T +P LTSLVRYLIHDSS 
Sbjct  196  YNIRVNSIAPGLLKSEITQGLMQKEWLKNVTERSIPLKVQQTVDPGLTSLVRYLIHDSSR  255

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGNTYI+D+G T+PG+PIFSSL
Sbjct  256  YVSGNTYILDSGATIPGLPIFSSL  279



>dbj|BAK03236.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=283

 Score =   263 bits (672),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+A G A+EAAVQRAWDAFGRID LINNAG+RG VH+ LD  E+EW+ L KTNLTG 
Sbjct  80   ELDVAAGGSAVEAAVQRAWDAFGRIDVLINNAGLRGGVHSSLDWPEDEWDKLIKTNLTGL  139

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLV+K+VC  M +AK  GS+++ISS++GLNRG LPG + Y +SK+AV+++T++MALELG 
Sbjct  140  WLVAKHVCRHMRDAKIKGSVINISSVAGLNRGNLPGSIGYASSKSAVHSVTKLMALELGA  199

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVN+I+PG+F+SEIT  L+QK WL+ V  + VPL+T GT++PALTSLVR+LIH+ + 
Sbjct  200  YGIRVNAIAPGIFQSEITAPLLQKRWLSTVVSKIVPLKTNGTTDPALTSLVRFLIHEKAS  259

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            YI+GN +IVD+G T+PGVPIFSSL
Sbjct  260  YITGNIFIVDSGVTVPGVPIFSSL  283



>emb|CDX76107.1| BnaA04g03710D [Brassica napus]
Length=280

 Score =   263 bits (672),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV++AWD FG+ID LINNAG+RG V T LDLTE+EWN + +TNL+G 
Sbjct  77   ELDVSSDAATIQKAVKQAWDIFGKIDVLINNAGIRGNVKTSLDLTEDEWNTVFRTNLSGP  136

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC  M +AK GGS++++SSI+GL+RG LPGG+AY  SK  V+ +TR+MA+ELG 
Sbjct  137  WLVSKYVCSLMRDAKRGGSVINVSSIAGLHRGLLPGGVAYACSKGGVDTMTRMMAIELGV  196

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVNSI+PGL KSEIT GLMQK+WL  V  R++PL+   T +P LTSLVRYLIHDSS 
Sbjct  197  YNIRVNSIAPGLLKSEITQGLMQKEWLKNVTERSIPLKVQQTVDPGLTSLVRYLIHDSSR  256

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGNTYI+D+G T+PG+PIFSSL
Sbjct  257  YVSGNTYILDSGATIPGLPIFSSL  280



>ref|NP_001152499.1| LOC100286139 [Zea mays]
 gb|ACG47903.1| 3-oxoacyl-reductase [Zea mays]
Length=280

 Score =   263 bits (672),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 165/197 (84%), Gaps = 0/197 (0%)
 Frame = +1

Query  22   GPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYV  201
            G A+EAAVQ+AWDAFGRIDAL+NNAG+RG VH+PLD  E+EW+ + KTNLTG+WLV+K+V
Sbjct  84   GSALEAAVQKAWDAFGRIDALVNNAGIRGAVHSPLDWPEDEWDRIIKTNLTGSWLVAKHV  143

Query  202  CLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGTNKIRVNS  381
            C RM +AK  GS+V+I+SI+GLNRG LPG   Y +SK AV+  T++MALELG ++IRVNS
Sbjct  144  CRRMRDAKLKGSVVNITSIAGLNRGHLPGSTGYASSKAAVHYATKIMALELGADRIRVNS  203

Query  382  ISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSEYISGNTY  561
            I+PGLFKSEIT  L QK WL+ VA + VPL+  G ++PALTSLVR+LIH++S Y++GN +
Sbjct  204  IAPGLFKSEITAPLFQKRWLSTVASKIVPLKEHGATDPALTSLVRFLIHEASSYVTGNIF  263

Query  562  IVDAGNTLPGVPIFSSL  612
            IVD+G T+PGVPIFSSL
Sbjct  264  IVDSGATIPGVPIFSSL  280



>emb|CDY65313.1| BnaCnng46610D [Brassica napus]
Length=282

 Score =   263 bits (672),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV++AWD +G+ID LINNAG+RG V T LDLTE+EWN + +TNLTG 
Sbjct  79   ELDVSSDAATIQKAVKQAWDIYGKIDVLINNAGIRGNVKTSLDLTEDEWNTVFRTNLTGP  138

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC  M +AK GGS++++SSI+GL+RG LPGG+AY  SK  V+ +TR+MA+ELG 
Sbjct  139  WLVSKYVCSLMRDAKGGGSVINVSSIAGLHRGLLPGGVAYACSKGGVDTMTRMMAIELGV  198

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVNSI+PGL KSEIT GLMQK+WL  V  R++PL+   T +P LTSLVRYLIHDSS 
Sbjct  199  YNIRVNSIAPGLLKSEITQGLMQKEWLKNVTERSIPLKVQQTVDPGLTSLVRYLIHDSSR  258

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGNTYI+D+G T+PG+PIFSSL
Sbjct  259  YVSGNTYILDSGATIPGLPIFSSL  282



>ref|XP_009112627.1| PREDICTED: probable L-xylulose reductase [Brassica rapa]
Length=287

 Score =   263 bits (672),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            E DV++D   I  AV+ AW+ FG+ID LINNAG+RG V + LDL+E+EW+ + +TNLTG 
Sbjct  84   EFDVASDAATIRKAVKEAWEVFGKIDVLINNAGIRGNVKSSLDLSEDEWDKVFRTNLTGP  143

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+ M +AK GGS+++ISS++G++RG LPG +AY  SK  V+ +TR+MA+ELG 
Sbjct  144  WLVSKYVCILMRDAKQGGSVINISSMAGVHRGMLPGAVAYACSKGGVDIMTRMMAIELGV  203

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSI+PGLFKSEIT GLMQK+WL KV  RTVPL+   T +P +TSLVRYLIHDS+E
Sbjct  204  YKIRVNSIAPGLFKSEITQGLMQKEWLKKVNERTVPLKMQQTVDPGVTSLVRYLIHDSAE  263

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGNTYIVD+G +LPG+PIFSSL
Sbjct  264  YVSGNTYIVDSGASLPGLPIFSSL  287



>tpg|DAA47976.1| TPA: 3-oxoacyl-reductase [Zea mays]
Length=280

 Score =   263 bits (671),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 165/197 (84%), Gaps = 0/197 (0%)
 Frame = +1

Query  22   GPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYV  201
            G A+EAAVQ+AWDAFGRIDAL+NNAG+RG VH+PLD  E+EW+ + KTNLTG+WLV+K+V
Sbjct  84   GSALEAAVQKAWDAFGRIDALVNNAGIRGAVHSPLDWPEDEWDRIIKTNLTGSWLVAKHV  143

Query  202  CLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGTNKIRVNS  381
            C RM +AK  GS+V+I+SI+GLNRG LPG   Y +SK AV+  T++MALELG ++IRVNS
Sbjct  144  CRRMRDAKLKGSVVNITSIAGLNRGHLPGSTGYASSKAAVHYATKIMALELGADRIRVNS  203

Query  382  ISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSEYISGNTY  561
            I+PGLFKSEIT  L QK WL+ VA + VPL+  G ++PALTSLVR+LIH++S Y++GN +
Sbjct  204  IAPGLFKSEITAPLFQKRWLSTVASKIVPLKEHGATDPALTSLVRFLIHEASSYVTGNIF  263

Query  562  IVDAGNTLPGVPIFSSL  612
            IVD+G T+PGVPIFSSL
Sbjct  264  IVDSGATIPGVPIFSSL  280



>ref|XP_006403474.1| hypothetical protein EUTSA_v10010605mg [Eutrema salsugineum]
 gb|ESQ44927.1| hypothetical protein EUTSA_v10010605mg [Eutrema salsugineum]
Length=285

 Score =   262 bits (669),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 167/206 (81%), Gaps = 2/206 (1%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV++AW  FG+IDALINNAG+RG V T L+L+E+EW+ + +TNLTG 
Sbjct  80   ELDVSSDAATIQKAVKKAWQVFGKIDALINNAGIRGNVKTSLELSEQEWDKVLRTNLTGP  139

Query  181  WLVSKYVCLRM--CNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALEL  354
            WLVSKYVC+ M   N   GGS+++ISSISGL+RG LPGG+AY  SK  V+ +TR+MA+EL
Sbjct  140  WLVSKYVCILMRDANNHGGGSVINISSISGLHRGMLPGGVAYACSKGGVDTMTRMMAIEL  199

Query  355  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  534
            G  KIRVNSI+PGL KSEIT GLM+K+WL  V  RT+PL+   T +P LTSLVRYLIHDS
Sbjct  200  GVYKIRVNSIAPGLLKSEITQGLMEKEWLKNVTERTIPLKVQQTVDPGLTSLVRYLIHDS  259

Query  535  SEYISGNTYIVDAGNTLPGVPIFSSL  612
            S+Y+SGNTYIVD+G TLPG+PIFSSL
Sbjct  260  SQYVSGNTYIVDSGATLPGLPIFSSL  285



>gb|EMS50889.1| Gluconate 5-dehydrogenase [Triticum urartu]
Length=226

 Score =   259 bits (661),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+A G  +EAAVQRAWDAFGRID LINNAG+RG +H+ LD  E++W+ L KTNLTG+
Sbjct  23   ELDVAAGGSTVEAAVQRAWDAFGRIDVLINNAGLRGGIHSSLDWPEDDWDKLHKTNLTGS  82

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLV+K+VC  M +AK  GS+++ISS++GL+RG + G   Y +SK AV+A+T+VMALELG 
Sbjct  83   WLVAKHVCRHMRDAKIKGSVINISSVAGLHRGDVHGSTGYASSKAAVHAVTKVMALELGP  142

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVNSI+PG+F+SEIT  L+QK W N V  + VPL+T+GT++PALTSLVR+LIH++S 
Sbjct  143  YGIRVNSIAPGIFQSEITAALLQKRWWNTVTSKIVPLKTYGTTDPALTSLVRFLIHETSL  202

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GN +IVDAG TLPGVP+FSSL
Sbjct  203  YLTGNIFIVDAGLTLPGVPLFSSL  226



>ref|XP_004157996.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
[Cucumis sativus]
Length=297

 Score =   261 bits (667),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 164/204 (80%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV  +G +IE +V++AWD FG ID L+NNAG RG V +P++L+EEEW+    TNL G 
Sbjct  94   ELDVCGNGKSIEESVRKAWDYFGFIDTLVNNAGFRGSVKSPVELSEEEWDYTMGTNLKGQ  153

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+ M  A  GGSI++ISSISGLNR    G LAY TSK A+N LT+VMA+ELG 
Sbjct  154  WLVSKYVCILMNKANRGGSIINISSISGLNRALQRGALAYITSKAALNTLTKVMAMELGA  213

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSI PGLFKSEIT  LM+KDW+  VA R +PLRTFGTSNPALT+ VRYL+H+SS+
Sbjct  214  HKIRVNSICPGLFKSEITKDLMEKDWIKNVAKRMIPLRTFGTSNPALTTTVRYLVHESSK  273

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVDAGN+L GVPIFSSL
Sbjct  274  YVSGNIFIVDAGNSLLGVPIFSSL  297



>emb|CDY03343.1| BnaC09g10050D [Brassica napus]
Length=280

 Score =   260 bits (664),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            +LDV++D   I  AV+ AW  FG+ID LINNAG+RG V + LDL+E+EW+ + +TNLTG 
Sbjct  77   KLDVASDAATIRKAVKGAWGIFGKIDVLINNAGIRGNVKSSLDLSEDEWDKVFRTNLTGP  136

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+ M +AK GGS+++ISS++G++RG LPG +AY  SK  V+ +TR+MA+ELG 
Sbjct  137  WLVSKYVCILMRDAKQGGSVINISSMAGVHRGMLPGAVAYACSKGGVDIMTRMMAIELGV  196

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSI+PGLFKSEIT GLMQK+WL KV  RTVPL+   + +P LTSLVRYLIHDSS+
Sbjct  197  YKIRVNSIAPGLFKSEITQGLMQKEWLKKVNERTVPLKMQQSVDPGLTSLVRYLIHDSSQ  256

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGNTYIVD+G +LPG+PIFSSL
Sbjct  257  YVSGNTYIVDSGASLPGLPIFSSL  280



>ref|XP_011079074.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Sesamum indicum]
Length=291

 Score =   260 bits (665),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 169/205 (82%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+A G AIEA VQ+AW AFGRIDALINNAG+RG   + ++L+EEEW  + +TNLTG+
Sbjct  87   ELDVTAVGAAIEACVQKAWAAFGRIDALINNAGIRGHTRSSIELSEEEWEQVLQTNLTGS  146

Query  181  WLVSKYVCLRMCNA-KFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            W V+K V  RM  A   GGSI++ISS+SGLNR Q   G+AY++SK  ++A+T++MAL+LG
Sbjct  147  WFVAKSVARRMREAGNRGGSIINISSVSGLNRTQYRDGIAYSSSKAGLDAMTKIMALDLG  206

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
              KIRVNSI+PGLFKSEIT+GL+QK+WL  VA RTVPL TFGTS+P LTSLVRYL+HDSS
Sbjct  207  EFKIRVNSIAPGLFKSEITEGLVQKNWLKNVAKRTVPLGTFGTSDPGLTSLVRYLVHDSS  266

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
             YISGN +IVD+G +LPGVPIFSSL
Sbjct  267  SYISGNIFIVDSGYSLPGVPIFSSL  291



>ref|NP_191091.2| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
 dbj|BAD44022.1| beta-ketoacyl-ACP reductase - like protein [Arabidopsis thaliana]
 gb|AEE79367.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=279

 Score =   259 bits (663),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 167/204 (82%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV+ AWD FG+IDALINNAG+RG V   LDL+E+EW+++  TNL G 
Sbjct  77   ELDVSSDAATIQKAVREAWDIFGKIDALINNAGIRGNVKLSLDLSEDEWDNVFNTNLKGP  136

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLV+KYVC+ M +AK GGS+++ISS++G+ R  +PGGLAY+ SK  V+ ++R+MA+ELG 
Sbjct  137  WLVAKYVCVLMRDAKRGGSVINISSVAGV-RSIVPGGLAYSCSKGGVDTMSRMMAIELGV  195

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSI+PGLFKSEIT  LMQK+WL  V  RTVPL+   T +P LTSLVRYLIHDSS+
Sbjct  196  HKIRVNSIAPGLFKSEITQALMQKEWLKNVTERTVPLKVQQTIDPGLTSLVRYLIHDSSQ  255

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            YISGNTYIVD+G TLPGVPIFSSL
Sbjct  256  YISGNTYIVDSGATLPGVPIFSSL  279



>gb|AAF19703.1|AC008047_10 F2K11.24 [Arabidopsis thaliana]
Length=287

 Score =   260 bits (664),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS++   I  AV+ AW+ FG+ID LINNAG+RG V + LDL+EEEW+ + +TNLTG+
Sbjct  82   ELDVSSEADTIRKAVKEAWETFGKIDVLINNAGIRGNVKSSLDLSEEEWDKVFRTNLTGS  141

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WL+SKYVCL M +A+ GGS++++SSISGL+RG L GGLAY  SK  V+ +TR+MA+EL  
Sbjct  142  WLISKYVCLLMRDAERGGSVINVSSISGLHRGLLRGGLAYACSKGGVDTMTRMMAIELAV  201

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSI+PG+F+SEIT GL QK+WL KV  + VPL+   T +P LTSLVRYLIHDSS+
Sbjct  202  YKIRVNSIAPGIFRSEITQGLFQKEWLKKVTEKVVPLKMQQTVDPGLTSLVRYLIHDSSQ  261

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GNTYIVD+G TLPGVPIFSSL
Sbjct  262  YVTGNTYIVDSGTTLPGVPIFSSL  285



>ref|NP_190203.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
 emb|CAB90944.1| dehydrogenase-like protein [Arabidopsis thaliana]
 gb|AAY78761.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
thaliana]
 gb|AEE78124.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
Length=288

 Score =   260 bits (664),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 167/204 (82%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            +LDV++D   I+  VQ AW  FG+IDALINNAG+RG V + LDL++EEW+++ KTNLTG 
Sbjct  86   KLDVTSDAATIQKVVQGAWGIFGKIDALINNAGIRGNVKSSLDLSKEEWDNVFKTNLTGP  145

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+ M +AK GGS+++ISSI+G+ RG LPG LAY  SK  V+ ++++MA+ELG 
Sbjct  146  WLVSKYVCVLMRDAKLGGSVINISSIAGI-RGILPGALAYACSKIGVDTMSKMMAVELGV  204

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSI+PG+FKSEIT GLMQK+W   V  RTVPL+   T +P +TSLVRYLIHDSS+
Sbjct  205  HKIRVNSIAPGIFKSEITQGLMQKEWFKNVTERTVPLKLQQTVDPGITSLVRYLIHDSSQ  264

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            YISGNTYIVD+G TLPGVPIFSSL
Sbjct  265  YISGNTYIVDSGATLPGVPIFSSL  288



>ref|NP_176527.4| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE34092.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=282

 Score =   259 bits (663),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS++   I  AV+ AW+ FG+ID LINNAG+RG V + LDL+EEEW+ + +TNLTG+
Sbjct  77   ELDVSSEADTIRKAVKEAWETFGKIDVLINNAGIRGNVKSSLDLSEEEWDKVFRTNLTGS  136

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WL+SKYVCL M +A+ GGS++++SSISGL+RG L GGLAY  SK  V+ +TR+MA+EL  
Sbjct  137  WLISKYVCLLMRDAERGGSVINVSSISGLHRGLLRGGLAYACSKGGVDTMTRMMAIELAV  196

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSI+PG+F+SEIT GL QK+WL KV  + VPL+   T +P LTSLVRYLIHDSS+
Sbjct  197  YKIRVNSIAPGIFRSEITQGLFQKEWLKKVTEKVVPLKMQQTVDPGLTSLVRYLIHDSSQ  256

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GNTYIVD+G TLPGVPIFSSL
Sbjct  257  YVTGNTYIVDSGTTLPGVPIFSSL  280



>ref|XP_006361361.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Solanum tuberosum]
Length=297

 Score =   260 bits (664),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 158/205 (77%), Gaps = 2/205 (1%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            +LDV+ADG  IE+AVQ AWD FGRID L+NNAGV G+ H+ L+L+EEEW+++  TNL G 
Sbjct  94   QLDVTADGATIESAVQIAWDTFGRIDVLVNNAGVTGK-HSSLELSEEEWDNMFNTNLKGA  152

Query  181  WLVSKYVCLRMCNAKFggsivsissisg-LNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSKYVC RM +AK GG  V   S    LNR    G   Y +SK A++ +T+ MA+ELG
Sbjct  153  WLVSKYVCRRMRDAKQGGGSVINISSMAGLNRVVYIGTFGYASSKMALDMVTKNMAMELG  212

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
             +KIRVNSI+PG FKSEIT+GLMQ  W N V  RT+PLRT GT NPALTS+VRYLIHDSS
Sbjct  213  VDKIRVNSIAPGYFKSEITEGLMQNKWFNNVTRRTIPLRTSGTINPALTSVVRYLIHDSS  272

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
            EYISGN +IVDAG TLPGVPIFSSL
Sbjct  273  EYISGNVFIVDAGTTLPGVPIFSSL  297



>ref|XP_004144362.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
[Cucumis sativus]
Length=297

 Score =   260 bits (664),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 163/204 (80%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV  +G +IE +V +AWD FG ID L+NNAG RG V +P++L+EEEW+    TNL G 
Sbjct  94   ELDVCGNGKSIEESVTKAWDYFGFIDTLVNNAGFRGSVKSPVELSEEEWDYTMGTNLKGQ  153

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+ M  A  GGSI++ISSISGLNR    G LAY TSK A+N LT+VMA+ELG 
Sbjct  154  WLVSKYVCILMNKANRGGSIINISSISGLNRALQRGALAYITSKAALNTLTKVMAMELGA  213

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSI PGLFKSEIT  LM+KDW+  VA R +PLRTFGTSNPALT+ VRYL+H+SS+
Sbjct  214  HKIRVNSICPGLFKSEITKDLMKKDWIKNVAKRMIPLRTFGTSNPALTTTVRYLVHESSK  273

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVDAGN+L GVPIFSSL
Sbjct  274  YVSGNIFIVDAGNSLLGVPIFSSL  297



>ref|NP_001031220.1| putative ketoacyl-ACP reductase [Arabidopsis thaliana]
 gb|AAV74220.1| At1g62610 [Arabidopsis thaliana]
 gb|AAW78588.1| At1g62610 [Arabidopsis thaliana]
 gb|AEE33985.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=278

 Score =   259 bits (662),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I  AV+ AW+ FG ID LINNAG+RG V + LDL++EEW+ + +TNLTG+
Sbjct  75   ELDVSSDADTIRKAVKEAWEIFGTIDVLINNAGIRGNVKSSLDLSKEEWDKVFRTNLTGS  134

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WL+SKYVCL M +AK GGS++++SSISGL+RG L GGLAY  SK  V+ +TR+MA+EL  
Sbjct  135  WLISKYVCLLMRDAKRGGSVINVSSISGLHRGLLRGGLAYACSKGGVDTMTRMMAIELAV  194

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSI+PG+F+SEIT GL QK+WL KV  + VPL+   T +P LTSLVRYLIHDSS+
Sbjct  195  YKIRVNSIAPGIFRSEITQGLFQKEWLEKVTEKIVPLKMQQTVDPGLTSLVRYLIHDSSQ  254

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GNTYIVD+G TLPGVPIFSSL
Sbjct  255  YVTGNTYIVDSGATLPGVPIFSSL  278



>emb|CAB75765.1| beta-ketoacyl-ACP reductase-like protein [Arabidopsis thaliana]
Length=298

 Score =   260 bits (664),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 167/204 (82%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV+ AWD FG+IDALINNAG+RG V   LDL+E+EW+++  TNL G 
Sbjct  96   ELDVSSDAATIQKAVREAWDIFGKIDALINNAGIRGNVKLSLDLSEDEWDNVFNTNLKGP  155

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLV+KYVC+ M +AK GGS+++ISS++G+ R  +PGGLAY+ SK  V+ ++R+MA+ELG 
Sbjct  156  WLVAKYVCVLMRDAKRGGSVINISSVAGV-RSIVPGGLAYSCSKGGVDTMSRMMAIELGV  214

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVNSI+PGLFKSEIT  LMQK+WL  V  RTVPL+   T +P LTSLVRYLIHDSS+
Sbjct  215  HKIRVNSIAPGLFKSEITQALMQKEWLKNVTERTVPLKVQQTIDPGLTSLVRYLIHDSSQ  274

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            YISGNTYIVD+G TLPGVPIFSSL
Sbjct  275  YISGNTYIVDSGATLPGVPIFSSL  298



>ref|NP_176449.2| putative ketoacyl-ACP reductase [Arabidopsis thaliana]
 gb|AEE33983.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=277

 Score =   259 bits (662),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I  AV+ AW+ FG ID LINNAG+RG V + LDL++EEW+ + +TNLTG+
Sbjct  74   ELDVSSDADTIRKAVKEAWEIFGTIDVLINNAGIRGNVKSSLDLSKEEWDKVFRTNLTGS  133

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WL+SKYVCL M +AK GGS++++SSISGL+RG L GGLAY  SK  V+ +TR+MA+EL  
Sbjct  134  WLISKYVCLLMRDAKRGGSVINVSSISGLHRGLLRGGLAYACSKGGVDTMTRMMAIELAV  193

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSI+PG+F+SEIT GL QK+WL KV  + VPL+   T +P LTSLVRYLIHDSS+
Sbjct  194  YKIRVNSIAPGIFRSEITQGLFQKEWLEKVTEKIVPLKMQQTVDPGLTSLVRYLIHDSSQ  253

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GNTYIVD+G TLPGVPIFSSL
Sbjct  254  YVTGNTYIVDSGATLPGVPIFSSL  277



>ref|NP_001185294.1| putative ketoacyl-ACP reductase [Arabidopsis thaliana]
 gb|AEE33986.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=282

 Score =   259 bits (662),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I  AV+ AW+ FG ID LINNAG+RG V + LDL++EEW+ + +TNLTG+
Sbjct  79   ELDVSSDADTIRKAVKEAWEIFGTIDVLINNAGIRGNVKSSLDLSKEEWDKVFRTNLTGS  138

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WL+SKYVCL M +AK GGS++++SSISGL+RG L GGLAY  SK  V+ +TR+MA+EL  
Sbjct  139  WLISKYVCLLMRDAKRGGSVINVSSISGLHRGLLRGGLAYACSKGGVDTMTRMMAIELAV  198

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSI+PG+F+SEIT GL QK+WL KV  + VPL+   T +P LTSLVRYLIHDSS+
Sbjct  199  YKIRVNSIAPGIFRSEITQGLFQKEWLEKVTEKIVPLKMQQTVDPGLTSLVRYLIHDSSQ  258

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GNTYIVD+G TLPGVPIFSSL
Sbjct  259  YVTGNTYIVDSGATLPGVPIFSSL  282



>ref|NP_974072.1| putative ketoacyl-ACP reductase [Arabidopsis thaliana]
 gb|AEE33984.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=276

 Score =   259 bits (661),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I  AV+ AW+ FG ID LINNAG+RG V + LDL++EEW+ + +TNLTG+
Sbjct  73   ELDVSSDADTIRKAVKEAWEIFGTIDVLINNAGIRGNVKSSLDLSKEEWDKVFRTNLTGS  132

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WL+SKYVCL M +AK GGS++++SSISGL+RG L GGLAY  SK  V+ +TR+MA+EL  
Sbjct  133  WLISKYVCLLMRDAKRGGSVINVSSISGLHRGLLRGGLAYACSKGGVDTMTRMMAIELAV  192

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSI+PG+F+SEIT GL QK+WL KV  + VPL+   T +P LTSLVRYLIHDSS+
Sbjct  193  YKIRVNSIAPGIFRSEITQGLFQKEWLEKVTEKIVPLKMQQTVDPGLTSLVRYLIHDSSQ  252

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GNTYIVD+G TLPGVPIFSSL
Sbjct  253  YVTGNTYIVDSGATLPGVPIFSSL  276



>ref|XP_004252844.1| PREDICTED: probable L-xylulose reductase [Solanum lycopersicum]
Length=270

 Score =   258 bits (659),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 167/206 (81%), Gaps = 2/206 (1%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            +LDV ++G  +EAAV+RAWDAFG I+ LINNAG+RG V +PL+L+EEEW     TNL G 
Sbjct  65   KLDVMSNGATMEAAVERAWDAFGHINVLINNAGIRGPVSSPLELSEEEWEHTFNTNLRGA  124

Query  181  WLVSKYVCLRMCNAKFgg--sivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALEL  354
            WL+SKYVC RM +AK  G  S+++ISS+SGLNR  +PGGLAY  SK A++ LTR+MALEL
Sbjct  125  WLLSKYVCRRMRDAKLQGGGSVINISSVSGLNRVLVPGGLAYACSKMALDMLTRMMALEL  184

Query  355  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  534
            G + IRVNS++PG+FKS+IT+ LMQK+  N V L+TVPLR  G ++PALTSLV+YLIHDS
Sbjct  185  GVHNIRVNSVAPGVFKSQITESLMQKEGFNNVILQTVPLRYLGMTDPALTSLVKYLIHDS  244

Query  535  SEYISGNTYIVDAGNTLPGVPIFSSL  612
            SEY+SGN +IVD+G TL GVPIFSSL
Sbjct  245  SEYVSGNIFIVDSGGTLTGVPIFSSL  270



>ref|XP_010314314.1| PREDICTED: probable L-xylulose reductase [Solanum lycopersicum]
Length=271

 Score =   258 bits (658),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 160/205 (78%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSAD   I++AVQ AWDAFGRID LINNAGVRG V + +++TEEEWN+   TNL G 
Sbjct  67   ELDVSADSTTIDSAVQIAWDAFGRIDVLINNAGVRGSVSSSVEITEEEWNNTYNTNLRGA  126

Query  181  WLVSKYVCLRMCNAKFggsivsissisg-LNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            W+VSKYVC RM +AK GG  V   +    LNR  +PG +AY TSK A++ +T++MA+ELG
Sbjct  127  WMVSKYVCKRMIDAKQGGGSVINITSMAGLNRTAVPGTIAYGTSKMALDMVTKIMAIELG  186

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
               IRVNSISPG+ KSEIT+ L++  W +K  LRT+PL+  GT++PALTSL+RYL+HDSS
Sbjct  187  GENIRVNSISPGVVKSEITEDLVKNKWFHKFLLRTLPLKYLGTTDPALTSLIRYLMHDSS  246

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
            EY++GN +IVDAG TLPGVPIFSSL
Sbjct  247  EYVTGNVFIVDAGATLPGVPIFSSL  271



>ref|XP_002886464.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62723.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=290

 Score =   258 bits (659),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I   V+ AW+ FG+ID LINNAG+RG V + LDL+EEEW+ + +TNLTG+
Sbjct  87   ELDVSSDADTIRKVVKEAWEIFGKIDVLINNAGIRGNVKSSLDLSEEEWDKVFRTNLTGS  146

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK+V + M +AK GGS+++ISSISGL+RG  PG LAY  SK  V+ +TR+MA+ELG 
Sbjct  147  WLVSKFVGVLMRDAKRGGSVINISSISGLHRGLRPGCLAYACSKGGVDTMTRMMAIELGV  206

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSI+PGLF+S+IT GLMQK+WL KV  RTVPL+   T +P LTSLVRYLIHDSS+
Sbjct  207  YKIRVNSIAPGLFRSDITQGLMQKEWLKKVTERTVPLKMQQTVDPGLTSLVRYLIHDSSQ  266

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GNTYIVD+G TLPGVPIFSSL
Sbjct  267  YVTGNTYIVDSGATLPGVPIFSSL  290



>gb|AAD43618.1|AC005698_17 T3P18.17 [Arabidopsis thaliana]
Length=307

 Score =   258 bits (660),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I  AV+ AW+ FG ID LINNAG+RG V + LDL++EEW+ + +TNLTG+
Sbjct  104  ELDVSSDADTIRKAVKEAWEIFGTIDVLINNAGIRGNVKSSLDLSKEEWDKVFRTNLTGS  163

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WL+SKYVCL M +AK GGS++++SSISGL+RG L GGLAY  SK  V+ +TR+MA+EL  
Sbjct  164  WLISKYVCLLMRDAKRGGSVINVSSISGLHRGLLRGGLAYACSKGGVDTMTRMMAIELAV  223

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSI+PG+F+SEIT GL QK+WL KV  + VPL+   T +P LTSLVRYLIHDSS+
Sbjct  224  YKIRVNSIAPGIFRSEITQGLFQKEWLEKVTEKIVPLKMQQTVDPGLTSLVRYLIHDSSQ  283

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GNTYIVD+G TLPGVPIFSSL
Sbjct  284  YVTGNTYIVDSGATLPGVPIFSSL  307



>gb|EYU20810.1| hypothetical protein MIMGU_mgv1a011271mg [Erythranthe guttata]
Length=287

 Score =   257 bits (657),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELD++AD  AIEA+V++AWDAFG IDALINNAGVRG + + L+L+++EWN + KTNLTG+
Sbjct  84   ELDLTADSTAIEASVRKAWDAFGHIDALINNAGVRGSIKSSLNLSDDEWNHVVKTNLTGS  143

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLV+K V  RM +A  GGSI++ISS+SGLNR Q+PG +AY++SK  ++  T VMALELG 
Sbjct  144  WLVAKCVGKRMRDAARGGSIINISSVSGLNRMQVPGAVAYSSSKAGLHLTTMVMALELGN  203

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVN+I+PGLFKSEIT  L++K W+  V  RTVPLR  GT++PALTSLVRYL+HDSS 
Sbjct  204  YKIRVNAIAPGLFKSEITGDLLEKKWMKNVTERTVPLRVLGTTDPALTSLVRYLVHDSSN  263

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVD+G TLPG PIFSSL
Sbjct  264  YVSGNIFIVDSGYTLPGFPIFSSL  287



>emb|CDY29203.1| BnaA06g25540D [Brassica napus]
Length=278

 Score =   256 bits (655),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 167/205 (81%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV+ AW+AFG+IDAL+NNAG+RG V + LDL+E EW+ + KTNLTG 
Sbjct  74   ELDVSSDAATIQQAVKEAWEAFGKIDALVNNAGIRGTVKSSLDLSENEWDKVFKTNLTGA  133

Query  181  WLVSKYVCLRMCNAK-FggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSKYVC+ M +AK  GGS+++ISSISGL+RG +PGG+AY TSK  V+ +TRVMA+ELG
Sbjct  134  WLVSKYVCILMRDAKDRGGSVINISSISGLHRGVVPGGIAYATSKGGVDTMTRVMAIELG  193

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
               IRVNSI+PGL +SE+T GLM+K WL  V  RT+PL+   T +P +TSLVRYLIHDSS
Sbjct  194  VYNIRVNSIAPGLLESEMTQGLMKKKWLKNVTERTIPLKVQQTVDPGITSLVRYLIHDSS  253

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
            +Y+SGN YI+D+G T+PG+PIFSSL
Sbjct  254  QYVSGNIYILDSGATVPGLPIFSSL  278



>ref|XP_006365797.1| PREDICTED: probable L-xylulose reductase-like [Solanum tuberosum]
Length=270

 Score =   256 bits (654),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 164/205 (80%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV A+G  IEAAV+ AWDAFGRID L+NNAGVRG V + L L+EEEW    +TNL G 
Sbjct  66   ELDVMANGATIEAAVKIAWDAFGRIDVLVNNAGVRGSVSSSLKLSEEEWEHTFRTNLRGA  125

Query  181  WLVSKYVCLRMCNAKFgg-sivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSKYVC  M +AK GG S+++I+SI+ LNR   PG LAY +SK A++ +T++MALELG
Sbjct  126  WLVSKYVCRHMRDAKQGGGSVINITSIAALNRVITPGTLAYASSKMALDMVTKIMALELG  185

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
             +KIRVNSISPG+FKSEIT+ L Q+ WL+K   +T+P R  GT++PALTS++RYLIHDSS
Sbjct  186  VDKIRVNSISPGIFKSEITESLFQQKWLHKFLYKTLPQRYIGTTDPALTSVIRYLIHDSS  245

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
            EY++GN +IVD G TLPGVPIFSSL
Sbjct  246  EYVTGNIFIVDGGGTLPGVPIFSSL  270



>ref|XP_009139357.1| PREDICTED: probable L-xylulose reductase [Brassica rapa]
Length=280

 Score =   256 bits (654),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV++AWD FG+ID LINNAG+RG V T L L+E+EW+ + +TNLTG 
Sbjct  77   ELDVSSDAATIQKAVKQAWDIFGKIDVLINNAGIRGNVKTCLHLSEDEWDRVFRTNLTGA  136

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC  M +AK GGS+++ISSI+GL+RG LPGG+AY+ SK+ V+ +T++MA+ELG 
Sbjct  137  WLVSKYVCSLMRDAKSGGSVINISSIAGLHRGMLPGGVAYSCSKSGVDIMTKMMAIELGV  196

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVNSI+PG+ KSEIT GL+QK+WL KV  RT PL+   T +P +TSLVRYLIHDSS 
Sbjct  197  YNIRVNSIAPGILKSEITQGLLQKEWLKKVTERTTPLKVQQTVDPGITSLVRYLIHDSSR  256

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN YI+D+G T+PG+PIFS L
Sbjct  257  YVSGNIYILDSGGTIPGLPIFSCL  280



>ref|XP_009124575.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase 4-like 
[Brassica rapa]
Length=296

 Score =   256 bits (655),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 167/205 (81%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV+ AW+AFG+IDAL+NNAG+RG V + LDL+E EW+ + KTNLTG 
Sbjct  92   ELDVSSDAATIQQAVKEAWEAFGKIDALVNNAGIRGTVKSSLDLSENEWDKVFKTNLTGA  151

Query  181  WLVSKYVCLRMCNAK-FggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSKYVC+ M +AK  GGS+++ISSISGL+RG +PGG+AY TSK  V+ +TRVMA+ELG
Sbjct  152  WLVSKYVCILMRDAKDRGGSVINISSISGLHRGVVPGGIAYATSKGGVDTMTRVMAIELG  211

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
               IRVNSI+PGL +SE+T GLM+K WL  V  RT+PL+   T +P +TSLVRYLIHDSS
Sbjct  212  VYNIRVNSIAPGLLESEMTQGLMKKKWLKNVTERTIPLKVQQTVDPGITSLVRYLIHDSS  271

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
            +Y+SGN YI+D+G T+PG+PIFSSL
Sbjct  272  QYVSGNIYILDSGATVPGLPIFSSL  296



>gb|ACS12983.1| 2,4-dienoyl-CoA reductase [Jatropha curcas]
Length=308

 Score =   256 bits (655),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 143/227 (63%), Positives = 168/227 (74%), Gaps = 23/227 (10%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGR--------------IDALINN---------AGVRGR  111
            ELDV  DG  I+ +VQ AW+A G               I  L +            V G 
Sbjct  82   ELDVCVDGVTIDKSVQSAWEALGESMLWLIMLVLEVFYIFCLDDEKFPIFEKIYGVVSGS  141

Query  112  VHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGG  291
            V TPLDL+EEEWN + +TNLTG+WLVSK VCLRM +AK GGSI++ISSI+GL+RGQLPG 
Sbjct  142  VKTPLDLSEEEWNHVIRTNLTGSWLVSKSVCLRMRDAKQGGSIINISSIAGLDRGQLPGA  201

Query  292  LAYTTSKTAVNALTRVMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPL  471
            +AY +SK  +NA+T+VMALELG +KIRVNSISPGLFKSEIT+ LMQKDWL  VA + VPL
Sbjct  202  VAYASSKAGLNAMTKVMALELGVHKIRVNSISPGLFKSEITEHLMQKDWLTNVAKKIVPL  261

Query  472  RTFGTSNPALTSLVRYLIHDSSEYISGNTYIVDAGNTLPGVPIFSSL  612
            RT G S+PALTSLVRYLIHDSSEY+SGN +I+DAG TLPGVPIFSSL
Sbjct  262  RTHGASDPALTSLVRYLIHDSSEYVSGNIFIIDAGATLPGVPIFSSL  308



>ref|XP_006850022.1| hypothetical protein AMTR_s00022p00187970 [Amborella trichopoda]
 gb|ERN11603.1| hypothetical protein AMTR_s00022p00187970 [Amborella trichopoda]
Length=289

 Score =   256 bits (653),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 164/204 (80%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ++DVS +G AI+ AVQ AW+ +GRIDALINNAG+RG V +PLDL EEEWN +  TNL GT
Sbjct  86   KVDVSQNGKAIDEAVQLAWNIYGRIDALINNAGIRGHVASPLDLDEEEWNSVMATNLRGT  145

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLV++ VC RMC+A   GS+++ISSI GL RG LPGG+AY  SK  V+ +T+VMALELG 
Sbjct  146  WLVARSVCRRMCDANQKGSVINISSIGGLPRGLLPGGIAYAISKAGVDVMTKVMALELGK  205

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVNSI+PGLFKS+IT  L+QKDW++KVA R +PLRT GT +PALTSL+ +LI DSS 
Sbjct  206  YNIRVNSIAPGLFKSDITARLVQKDWIDKVAERIIPLRTHGTIDPALTSLLDHLIDDSSG  265

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            +++GN +IVD G TLPGVP++SSL
Sbjct  266  FVTGNVFIVDCGATLPGVPLYSSL  289



>emb|CDY07814.1| BnaC03g48080D [Brassica napus]
Length=278

 Score =   255 bits (651),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 167/205 (81%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV+ AW+ FG+IDAL+NNAG+RG V + LDL+E+EW+ + KTNLTG 
Sbjct  74   ELDVSSDAATIQKAVKEAWEVFGKIDALVNNAGIRGTVKSSLDLSEKEWDKVFKTNLTGA  133

Query  181  WLVSKYVCLRMCNAK-FggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSKYVC+ M +AK  GGS+++ISSISGL+RG +PGG+AY TSK  V+ +TRVMA+ELG
Sbjct  134  WLVSKYVCILMRDAKDRGGSVINISSISGLHRGVVPGGIAYATSKGGVDTMTRVMAIELG  193

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
               IRVNSI+PGL +SE+T GLM+K WL  V  RT+PL+   T +P +TSLVRYLIHDSS
Sbjct  194  VYNIRVNSIAPGLLESEMTQGLMKKKWLKNVTERTIPLKVQQTVDPGITSLVRYLIHDSS  253

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
            +Y+SGN YI+D+G T+PG+PIFSSL
Sbjct  254  KYVSGNIYILDSGATVPGLPIFSSL  278



>gb|KHN19831.1| 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Glycine soja]
Length=177

 Score =   251 bits (641),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = +1

Query  82   LINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivsissis  261
            +  N  ++G V +PL+L+EEEWN   +TNLTGTWLVSKYVC RM +A+  GSI++I+SI+
Sbjct  1    MFYNVRLQGNVKSPLELSEEEWNHAFRTNLTGTWLVSKYVCKRMRDAQRKGSIINIASIA  60

Query  262  gLNRGQLPGGLAYTTSKTAVNALTRVMALELGTNKIRVNSISPGLFKSEITDGLMQKDWL  441
            GLNRGQLPGG AY++SK  VN LTRVMALELG +KIRVNSISPGLFKSEIT+ LM+K+WL
Sbjct  61   GLNRGQLPGGAAYSSSKAGVNMLTRVMALELGAHKIRVNSISPGLFKSEITEKLMEKNWL  120

Query  442  NKVALRTVPLRTFGTSNPALTSLVRYLIHDSSEYISGNTYIVDAGNTLPGVPIFSSL  612
            N VA++TVPLR FGTS+PALTSL RYLIHDSSEY+SGN ++VDAG TLPGVPI+SSL
Sbjct  121  NNVAMKTVPLRKFGTSDPALTSLARYLIHDSSEYVSGNNFVVDAGATLPGVPIYSSL  177



>ref|XP_009139356.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Brassica rapa]
Length=247

 Score =   253 bits (647),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV++AWD FG+ID LINNAG+RG V T LDLTE+EWN + +TNLTG 
Sbjct  44   ELDVSSDAATIQKAVKQAWDIFGKIDVLINNAGIRGNVKTSLDLTEDEWNTVFRTNLTGP  103

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC  M ++K GGS++++SSISGL+RG   GG+AY  SK  V+ +TR+MA+ELG 
Sbjct  104  WLVSKYVCSLMRDSKRGGSVINVSSISGLHRGLFFGGVAYACSKGGVDTMTRMMAIELGV  163

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVNSI+PGL KSEIT GLMQK+WL  V  R +PL+   T +P +TSLVRYLIHDSS 
Sbjct  164  YNIRVNSIAPGLLKSEITQGLMQKEWLKNVTDRIIPLKVQQTVDPGITSLVRYLIHDSSR  223

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN YI+D+G TLPG+PIFSSL
Sbjct  224  YVSGNIYILDSGTTLPGLPIFSSL  247



>ref|XP_008455802.1| PREDICTED: probable L-xylulose reductase [Cucumis melo]
Length=294

 Score =   255 bits (651),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV A+G +IE +V +AWD FG ID L+NNAG+RG V +PL+L+E+EW+D   TNL G 
Sbjct  91   ELDVCANGKSIEESVTKAWDYFGFIDTLVNNAGIRGNVKSPLELSEKEWDDTMATNLKGQ  150

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+ M  A  GGSI++ISSISGL+R    G LAY TSK A+N LT+VMA+ELG 
Sbjct  151  WLVSKYVCILMNKANRGGSIINISSISGLDRALQRGALAYITSKAALNTLTKVMAMELGE  210

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            + IRVN I PGLFKSEIT  LM+KDW+  VA R  PL TFGTSNPALT+ +RYL+HDSS+
Sbjct  211  HNIRVNCICPGLFKSEITKDLMEKDWIKNVARRMNPLGTFGTSNPALTTTIRYLVHDSSK  270

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN +IVD+GN+L GVPIFSSL
Sbjct  271  YVSGNIFIVDSGNSLLGVPIFSSL  294



>emb|CDX73333.1| BnaC05g27730D [Brassica napus]
Length=280

 Score =   254 bits (649),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV++AWD FG+ID LINNAG+RG V T LDL+E+EW+ + +TNLTG 
Sbjct  77   ELDVSSDAATIQKAVKQAWDIFGKIDVLINNAGIRGNVKTCLDLSEDEWDRVFRTNLTGV  136

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC  M +AK GGS++++SSI+GLNR    GG+AY  SK  V+ +TR+MA+ELG 
Sbjct  137  WLVSKYVCSLMRDAKRGGSVINVSSIAGLNRVMFFGGVAYACSKGGVDTMTRMMAIELGV  196

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVNSI+PGL +SEIT GLMQK+WL  VA R +PL+   T +P LTSLVRYLIHDSS 
Sbjct  197  YNIRVNSIAPGLLQSEITQGLMQKEWLKNVADRIIPLKVQQTVDPGLTSLVRYLIHDSSR  256

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN YI+D+G TLPG+PIFSSL
Sbjct  257  YVSGNIYILDSGTTLPGLPIFSSL  280



>ref|XP_011079076.1| PREDICTED: L-rhamnose-1-dehydrogenase-like [Sesamum indicum]
Length=290

 Score =   254 bits (650),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+A G  IEA VQ+AW AFGRIDALINNAG+RG   + ++L+EEEW  + +TNLTG+
Sbjct  87   ELDVTAAGVTIEACVQKAWAAFGRIDALINNAGIRGHAMSSIELSEEEWKQVVQTNLTGS  146

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLV+K V  RM  A  GGSI++ISS +GLNR Q   G+AY  SK  ++A+T++MAL+LG 
Sbjct  147  WLVAKSVARRMREAGQGGSIINISSAAGLNRTQFRDGVAYGPSKAGLHAMTKIMALDLGE  206

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSI+PG+FKSEIT+ L++K+WL  VA R+VPL TFGT++P LTSLVRYL+HDSS 
Sbjct  207  FKIRVNSIAPGIFKSEITEELVKKNWLKNVAKRSVPLGTFGTTDPGLTSLVRYLLHDSSN  266

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            YISGN +IVDAG +LPGVPIFSSL
Sbjct  267  YISGNIFIVDAGYSLPGVPIFSSL  290



>ref|XP_004248275.1| PREDICTED: carbonyl reductase [NADPH] 2-like [Solanum lycopersicum]
Length=276

 Score =   254 bits (648),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 156/205 (76%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+A+G  IEAAVQ AWDAFG ID LINNAGVRG V + L+L EEEW     TNL G 
Sbjct  72   ELDVTANGGNIEAAVQIAWDAFGHIDVLINNAGVRGCVSSSLELPEEEWEHTFTTNLRGA  131

Query  181  WLVSKYVCLRMCNAKFggsivsissisg-LNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSKYVC  M + K GG  +   S    LNR  +PGG+AY +SK A++ LT +MALELG
Sbjct  132  WLVSKYVCRHMIDVKQGGGSIINVSSVAGLNRVLVPGGVAYASSKMALDKLTEMMALELG  191

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
             +KIRVNSI+PG+FKSE+T+ L+Q+ W + V  RT PLRT GT++PALTSLVRYLIH SS
Sbjct  192  VHKIRVNSIAPGIFKSEMTESLIQQKWFHGVISRTAPLRTIGTTDPALTSLVRYLIHASS  251

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
            EY+SGN +IVD+G TL GVPIFSSL
Sbjct  252  EYVSGNVFIVDSGATLIGVPIFSSL  276



>emb|CDY44938.1| BnaA02g04430D [Brassica napus]
Length=284

 Score =   254 bits (649),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV++AWD FG+ID LINNAG+RG V T LDL+E+EW+ + +TNLTG 
Sbjct  81   ELDVSSDAATIQKAVKQAWDIFGKIDVLINNAGIRGNVKTCLDLSEDEWDRVFRTNLTGV  140

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC  M +AK GGS++++SSI+GLNR    GG+AY  SK  V+ +TR+MA+ELG 
Sbjct  141  WLVSKYVCSLMRDAKRGGSVINVSSIAGLNRVMFFGGVAYACSKGGVDTMTRMMAIELGV  200

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVNSI+PGL +SEIT GLMQK+WL  VA R +PL+   T +P LTSLVRYLIHDSS 
Sbjct  201  YNIRVNSIAPGLLQSEITQGLMQKEWLKNVADRIIPLKVQQTVDPGLTSLVRYLIHDSSR  260

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGN YI+D+G TLPG+PIFSSL
Sbjct  261  YVSGNIYILDSGTTLPGLPIFSSL  284



>ref|XP_009594209.1| PREDICTED: probable L-xylulose reductase [Nicotiana tomentosiformis]
Length=269

 Score =   253 bits (647),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 166/205 (81%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            EL+++A+G  IEAAVQ+AWDAFGRID L++NAG+RG + + L L+E+EWN    TNL G 
Sbjct  65   ELEINANGATIEAAVQKAWDAFGRIDVLVSNAGIRGSISSSLKLSEDEWNHTFNTNLRGA  124

Query  181  WLVSKYVCLRMCNAKFgg-sivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSK+VC RM +AK GG S+++ISS + LNR  LPG LAY +SK A++ +T++MALELG
Sbjct  125  WLVSKHVCRRMRDAKQGGGSVINISSAAALNRALLPGSLAYASSKIALDMVTKIMALELG  184

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
             +KIRVNSI+PG+FKSEIT+ L+Q+   +    + VPLRTFGT++PALTS+VRYLIH+SS
Sbjct  185  VDKIRVNSIAPGVFKSEITENLVQQKRFHNAVFKAVPLRTFGTTDPALTSVVRYLIHNSS  244

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
            +Y+SG+ +IVD G TLPGVPIFS L
Sbjct  245  QYVSGSVFIVDGGGTLPGVPIFSLL  269



>ref|XP_004172089.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
isoform 1 [Cucumis sativus]
Length=314

 Score =   254 bits (648),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 134/232 (58%), Positives = 165/232 (71%), Gaps = 28/232 (12%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELD+ AD   I+ AV++AWD+FG IDAL+NN G+RG V + LDL+EEEW+D+  TNL G+
Sbjct  83   ELDLKADSTIIKDAVRKAWDSFGFIDALVNNGGLRGTVKSSLDLSEEEWDDVMGTNLKGS  142

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTR--------  336
            WLVSKYVC+ M +    GS+++ISSI GLNRG +PGG  Y  SK  +N LT+        
Sbjct  143  WLVSKYVCIHMRDTNRSGSLINISSIGGLNRGHIPGGSVYGASKAGLNTLTKSGKAYARF  202

Query  337  --------------------VMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVAL  456
                                +MALELG   IRVNSI PG+FKSEIT  LMQKDWL  VAL
Sbjct  203  YVATKGEFILYARNKCLVKEIMALELGAYNIRVNSICPGIFKSEITKVLMQKDWLKNVAL  262

Query  457  RTVPLRTFGTSNPALTSLVRYLIHDSSEYISGNTYIVDAGNTLPGVPIFSSL  612
            +TVPL+T+GTSNPALT+L+RYL+HDSS Y++GN +IVDAG TLPGVPIFSSL
Sbjct  263  KTVPLQTYGTSNPALTTLIRYLVHDSSRYVTGNIFIVDAGATLPGVPIFSSL  314



>ref|XP_006366156.1| PREDICTED: probable L-xylulose reductase-like, partial [Solanum 
tuberosum]
Length=300

 Score =   253 bits (647),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 158/205 (77%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+ADG  IE++VQ AW+AFGRIDAL+NNAGVRG V + ++LTEEEWN+   TNL G 
Sbjct  96   ELDVAADGATIESSVQIAWNAFGRIDALVNNAGVRGSVSSSVELTEEEWNNTYNTNLRGA  155

Query  181  WLVSKYVCLRMCNAKFggsivsissisg-LNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            W+VSKYVC  M +AK GG  V   +    LNR  +PG +AY TSK A++ +T++MA+ELG
Sbjct  156  WMVSKYVCKHMIDAKQGGGSVINITSMAGLNRVAVPGTIAYATSKMALDMVTKIMAIELG  215

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
               IR+NSISPG+FKSEIT  L+++ W +K   +T+P R  GT++P LTSL+RYLIHDSS
Sbjct  216  GENIRLNSISPGVFKSEITQSLVEQKWFHKFLYKTLPTRYLGTTDPGLTSLIRYLIHDSS  275

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
            EY++GN +IVD G +LPGVPIFSSL
Sbjct  276  EYVTGNVFIVDGGASLPGVPIFSSL  300



>ref|XP_009631507.1| PREDICTED: probable L-xylulose reductase isoform X2 [Nicotiana 
tomentosiformis]
Length=259

 Score =   251 bits (642),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 162/205 (79%), Gaps = 11/205 (5%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELD++A+G  IEAAVQRAWDAFGRIDAL+NNAG+R          E+EWN    TNL G 
Sbjct  65   ELDINANGATIEAAVQRAWDAFGRIDALVNNAGIR----------EDEWNHTFNTNLRGA  114

Query  181  WLVSKYVCLRMCNAKFgg-sivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSKYVC RM +AK GG S+++ISS + LNR  LPG LAY +SK A++ +T++MALELG
Sbjct  115  WLVSKYVCRRMPDAKQGGGSVINISSAAALNRALLPGSLAYASSKIALDMVTKIMALELG  174

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
             +KIRVNSI+PG+FKSEIT+ L+Q+   +    + VPLRTFGT++PALTS+VRYLIH+SS
Sbjct  175  VDKIRVNSIAPGVFKSEITENLVQQKRFHNAVFKAVPLRTFGTTDPALTSVVRYLIHNSS  234

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
            +Y+SGN +IVD G TLPGVPIFSSL
Sbjct  235  QYVSGNVFIVDGGGTLPGVPIFSSL  259



>ref|XP_004252379.1| PREDICTED: probable L-xylulose reductase [Solanum lycopersicum]
Length=271

 Score =   251 bits (642),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 158/205 (77%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+AD   IE+AV+ AW+AFGRIDAL+NNAGVRG V + ++LTEEEWN+   TNL G 
Sbjct  67   ELDVAADSATIESAVKIAWEAFGRIDALVNNAGVRGSVSSSVELTEEEWNNTYNTNLRGA  126

Query  181  WLVSKYVCLRMCNAKFggsivsissisg-LNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            W+VSKYVC RM +AK GG  V   +    LNR  +PG  AY TSK A++ +T++MA+ELG
Sbjct  127  WMVSKYVCKRMIDAKQGGGSVINITSMAGLNRIAVPGTTAYATSKMALDMVTKIMAIELG  186

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
               IR+NSISPG+FKSEIT+ L+++ W +K   +T+P R  GT++P LTSL+RYLIHDSS
Sbjct  187  GENIRLNSISPGVFKSEITESLVEQKWFHKFLYKTLPTRYLGTTDPGLTSLIRYLIHDSS  246

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
            EY++GN +IVD G +LPGVPIFSSL
Sbjct  247  EYVTGNVFIVDGGASLPGVPIFSSL  271



>gb|EMS67034.1| 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Triticum urartu]
Length=248

 Score =   250 bits (638),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 163/204 (80%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
             LDV+A    +EAAVQ+AWDAFGR+D LINNAGVRG VH+ LD  E+EW+ L KTNL G 
Sbjct  45   RLDVAAGESFVEAAVQKAWDAFGRVDVLINNAGVRGGVHSALDWPEDEWDKLMKTNLRGV  104

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLV+K+VC RM +AK  GS+++ISS SGL+ G   G LAY+ SK+AV+++T++MALELG 
Sbjct  105  WLVAKHVCRRMRDAKLKGSVINISSTSGLDGGITHGSLAYSASKSAVHSVTKLMALELGA  164

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            + IRVN+I+PG+FKSEIT  L+QK WLN V  + VPL+  GT +PALTSLVR+LIH++S 
Sbjct  165  HGIRVNTIAPGIFKSEITAPLLQKRWLNDVLSKIVPLKKIGTPDPALTSLVRFLIHETSS  224

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            YISGN ++VD+G  LPGVPIFSSL
Sbjct  225  YISGNIFVVDSGLVLPGVPIFSSL  248



>ref|XP_009116225.1| PREDICTED: probable L-xylulose reductase isoform X1 [Brassica 
rapa]
Length=283

 Score =   251 bits (641),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 157/205 (77%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV++AWD FG ID LINNAG+RG V + LDL+EEEW  + +TNLTG 
Sbjct  79   ELDVSSDSSTIQNAVKQAWDIFGHIDVLINNAGIRGNVRSSLDLSEEEWERVFRTNLTGP  138

Query  181  WLVSKYVCLRMCNAKFggsivsissisg-LNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSK+VC+ M +AK GG  V   S    L RG+LPG LAY  SK  ++ +T++MA+E+G
Sbjct  139  WLVSKHVCVLMRDAKRGGGSVINVSSIAGLQRGKLPGALAYACSKGGLDIMTKMMAVEMG  198

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
               IRVNSI+PGLFKSEIT+GLM+K+W+  V  RTVPL+   + +P LTSLVRYLIHDSS
Sbjct  199  EYGIRVNSIAPGLFKSEITEGLMRKEWMKNVRERTVPLKVQQSVDPGLTSLVRYLIHDSS  258

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
             Y+SGN YIVDAG+TL G+PIFSSL
Sbjct  259  RYVSGNVYIVDAGSTLSGLPIFSSL  283



>ref|XP_004136691.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
isoform 1 [Cucumis sativus]
Length=314

 Score =   252 bits (643),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/232 (57%), Positives = 165/232 (71%), Gaps = 28/232 (12%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELD+ AD   I+ AV++AWD+FG IDAL+NN G+RG V + LDL+EEEW+D+  TNL G+
Sbjct  83   ELDLKADSTIIKDAVRKAWDSFGFIDALVNNGGLRGTVKSSLDLSEEEWDDVMGTNLKGS  142

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTR--------  336
            WLVSKYVC+ M +    GS+++ISSI GLNRG +PGG  Y  SK  +N LT+        
Sbjct  143  WLVSKYVCIHMRDTNRSGSLINISSIGGLNRGHIPGGSVYGASKAGLNTLTKSGKAYARF  202

Query  337  --------------------VMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVAL  456
                                +MALELG   IRVNSI PG+FKSEIT  LMQKDWL  VAL
Sbjct  203  YVATKGEFILYARNKCLVKEIMALELGAYNIRVNSICPGIFKSEITKVLMQKDWLKNVAL  262

Query  457  RTVPLRTFGTSNPALTSLVRYLIHDSSEYISGNTYIVDAGNTLPGVPIFSSL  612
            +TVPL+T+GTS+PALT+L+RYL+HDSS Y++GN +IVDAG TLPGVPIFSSL
Sbjct  263  KTVPLQTYGTSDPALTTLIRYLVHDSSRYVTGNIFIVDAGATLPGVPIFSSL  314



>ref|XP_009116226.1| PREDICTED: probable L-xylulose reductase isoform X2 [Brassica 
rapa]
Length=282

 Score =   250 bits (639),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 157/205 (77%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV++AWD FG ID LINNAG+RG V + LDL+EEEW  + +TNLTG 
Sbjct  78   ELDVSSDSSTIQNAVKQAWDIFGHIDVLINNAGIRGNVRSSLDLSEEEWERVFRTNLTGP  137

Query  181  WLVSKYVCLRMCNAKFggsivsissisg-LNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSK+VC+ M +AK GG  V   S    L RG+LPG LAY  SK  ++ +T++MA+E+G
Sbjct  138  WLVSKHVCVLMRDAKRGGGSVINVSSIAGLQRGKLPGALAYACSKGGLDIMTKMMAVEMG  197

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
               IRVNSI+PGLFKSEIT+GLM+K+W+  V  RTVPL+   + +P LTSLVRYLIHDSS
Sbjct  198  EYGIRVNSIAPGLFKSEITEGLMRKEWMKNVRERTVPLKVQQSVDPGLTSLVRYLIHDSS  257

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
             Y+SGN YIVDAG+TL G+PIFSSL
Sbjct  258  RYVSGNVYIVDAGSTLSGLPIFSSL  282



>ref|XP_010431696.1| PREDICTED: estradiol 17-beta-dehydrogenase 8-like [Camelina sativa]
Length=231

 Score =   248 bits (633),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 162/200 (81%), Gaps = 2/200 (1%)
 Frame = +1

Query  19   DGPAIEA--AVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGTWLVS  192
            +G  +EA    + AW+ FG ID LINNAG+RG V + LD +EEEW+ + +TNLTG+WLVS
Sbjct  32   EGYLLEAWRLYKEAWEIFGNIDVLINNAGIRGNVKSSLDWSEEEWDKVFRTNLTGSWLVS  91

Query  193  KYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGTNKIR  372
            K+VCL M +AK GGS+++ISSISGL+RG LPGGLAY  SK  V+ +TR+MA+ELG  KIR
Sbjct  92   KHVCLLMRDAKRGGSVINISSISGLHRGLLPGGLAYACSKGGVDTMTRMMAIELGVYKIR  151

Query  373  VNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSEYISG  552
            VNSI+PGLF+SEIT GLMQK+WL  V  RTVPL+   T +P LTSL+RYLIHDSS+Y++G
Sbjct  152  VNSIAPGLFRSEITQGLMQKEWLKNVTERTVPLKMQQTVDPGLTSLMRYLIHDSSQYVTG  211

Query  553  NTYIVDAGNTLPGVPIFSSL  612
            NTYIVD+G TLPGVPIFSSL
Sbjct  212  NTYIVDSGTTLPGVPIFSSL  231



>ref|XP_009599584.1| PREDICTED: probable L-xylulose reductase [Nicotiana tomentosiformis]
Length=269

 Score =   249 bits (635),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 162/205 (79%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELD++A+G  IEA VQRAWDA G IDAL+NNAG+RG + + L L+E+EWN    TNL G 
Sbjct  65   ELDINANGATIEAIVQRAWDASGLIDALVNNAGIRGSISSSLKLSEDEWNHTFNTNLRGA  124

Query  181  WLVSKYVCLRMCNAKFgg-sivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSKYVC  M +AK GG S+++ISS + LNR  LPG LAY +SK A++ +T++MALELG
Sbjct  125  WLVSKYVCRCMPDAKQGGGSVINISSAAALNRALLPGSLAYASSKIALDMVTKIMALELG  184

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
             +KIRVNSI+PG+FKSEIT+ L+ +   +    + VPLRTFGT++P LTS+VRYLIH+SS
Sbjct  185  VDKIRVNSIAPGVFKSEITENLVPQKRFHNAVFKAVPLRTFGTTDPTLTSVVRYLIHNSS  244

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
            +Y+SGN +IVD G TLPGVPIFSSL
Sbjct  245  QYVSGNVFIVDGGGTLPGVPIFSSL  269



>emb|CAN59905.1| hypothetical protein VITISV_033145 [Vitis vinifera]
Length=316

 Score =   250 bits (638),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 156/183 (85%), Gaps = 0/183 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV++ G +I A+VQ+AW+AFGRID L+NNAG+RG V++PLD++EEEWN+  KTNLTG+
Sbjct  83   ELDVTSGGSSISASVQKAWEAFGRIDVLLNNAGIRGNVNSPLDISEEEWNNTLKTNLTGS  142

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYV +RM +AK GGSI++ISSI  LNRGQ PG +AY +SK+ ++A+T+VMALELG 
Sbjct  143  WLVSKYVGMRMRDAKNGGSIINISSIVSLNRGQSPGAVAYVSSKSGLSAMTKVMALELGA  202

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IR N+I+PG+FKSEIT GLMQKDWLN V  RT PLR +GTS+PALTSLVRYLIHDSS 
Sbjct  203  YNIRANAIAPGIFKSEITAGLMQKDWLNTVVQRTCPLRAYGTSDPALTSLVRYLIHDSSR  262

Query  541  YIS  549
            YIS
Sbjct  263  YIS  265



>ref|XP_003574753.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Brachypodium distachyon]
Length=281

 Score =   249 bits (635),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            E+DV+A G A EAAVQRAWDAFGRID LINNAG+RG V++ LD  E+EW+ L KTNLTG 
Sbjct  78   EIDVAAGGSAAEAAVQRAWDAFGRIDVLINNAGIRGGVYSALDWPEDEWDKLMKTNLTGL  137

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLV+K++C RM  +K  GS+++ISS++GLNRG LPG + YT+SK+AV+  T+++ALELG 
Sbjct  138  WLVAKHICRRMHESKIKGSVINISSVAGLNRGHLPGSIGYTSSKSAVHYATKLLALELGA  197

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVNSI+PG+F+SEIT  L+QK WL  V  + VPL+T GT++PALTSLVR+LIH++S 
Sbjct  198  YGIRVNSIAPGIFQSEITAPLLQKKWLKTVVSKIVPLKTHGTTDPALTSLVRFLIHETSS  257

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y++GN +IVD+G TLPGVPIFSSL
Sbjct  258  YVTGNIFIVDSGVTLPGVPIFSSL  281



>ref|XP_009763303.1| PREDICTED: probable L-xylulose reductase isoform X2 [Nicotiana 
sylvestris]
Length=259

 Score =   246 bits (629),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 159/205 (78%), Gaps = 11/205 (5%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELD++A+G  IE AVQ AW+ FGRIDAL+NNAGVR          EEEWN    TNL G 
Sbjct  65   ELDITANGATIEVAVQIAWNTFGRIDALVNNAGVR----------EEEWNHTFNTNLRGA  114

Query  181  WLVSKYVCLRMCNAKFgg-sivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSKYVC RM +AK  G S+++ISS + LNR  LPG LAY +SKTA++ +T++MALELG
Sbjct  115  WLVSKYVCRRMHDAKQSGGSVINISSAAALNRAPLPGSLAYASSKTALDMITKIMALELG  174

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
             +KIR+NSI+PG++KSEIT+ L+Q+   +    + VPLRTFGT++PALTS+VRYLIHDSS
Sbjct  175  VDKIRLNSIAPGVYKSEITEMLVQQKRFHNAVFKAVPLRTFGTTDPALTSVVRYLIHDSS  234

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
            EY+SGN +IVDAG TL GVPIFSSL
Sbjct  235  EYVSGNVFIVDAGTTLVGVPIFSSL  259



>ref|XP_008240678.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Prunus mume]
Length=264

 Score =   245 bits (626),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELD+SADGPAIE +V +AWDAFGRIDAL+NNAGVRG V + L+L+EEEWN++ KTNLTG+
Sbjct  87   ELDISADGPAIEKSVNKAWDAFGRIDALVNNAGVRGNVSSVLELSEEEWNNVFKTNLTGS  146

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYV +RM +A  GGSI+++SSI+GL+RG LPG +AY  SK  VN L +VMA+ELG 
Sbjct  147  WLVSKYVSIRMRDADQGGSIINVSSIAGLHRGYLPGAVAYNCSKAGVNTLAKVMAMELGV  206

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYL  522
            +KIRVN+ISPGLF+SEIT+GLM+KDWL+ VA++TVPLRT+GTS+PALTSLVRYL
Sbjct  207  HKIRVNAISPGLFRSEITEGLMKKDWLHNVAMKTVPLRTYGTSDPALTSLVRYL  260



>ref|XP_009763295.1| PREDICTED: probable L-xylulose reductase isoform X1 [Nicotiana 
sylvestris]
Length=269

 Score =   245 bits (626),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 165/205 (80%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELD++A+G  IE AVQ AW+ FGRIDAL+NNAGVRG + + L L+EEEWN    TNL G 
Sbjct  65   ELDITANGATIEVAVQIAWNTFGRIDALVNNAGVRGSLSSSLKLSEEEWNHTFNTNLRGA  124

Query  181  WLVSKYVCLRMCNAKFgg-sivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSKYVC RM +AK  G S+++ISS + LNR  LPG LAY +SKTA++ +T++MALELG
Sbjct  125  WLVSKYVCRRMHDAKQSGGSVINISSAAALNRAPLPGSLAYASSKTALDMITKIMALELG  184

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
             +KIR+NSI+PG++KSEIT+ L+Q+   +    + VPLRTFGT++PALTS+VRYLIHDSS
Sbjct  185  VDKIRLNSIAPGVYKSEITEMLVQQKRFHNAVFKAVPLRTFGTTDPALTSVVRYLIHDSS  244

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
            EY+SGN +IVDAG TL GVPIFSSL
Sbjct  245  EYVSGNVFIVDAGTTLVGVPIFSSL  269



>ref|XP_011079073.1| PREDICTED: estradiol 17-beta-dehydrogenase 8-like isoform X2 
[Sesamum indicum]
Length=284

 Score =   245 bits (626),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 149/177 (84%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+A GP I AAV++AW AFGRIDALINNAGVRG VH+PLDL+E+EWND+ +TNLTGT
Sbjct  84   ELDVNASGPIINAAVEKAWGAFGRIDALINNAGVRGSVHSPLDLSEDEWNDIIRTNLTGT  143

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC RM  A+ GGS+++ISS +GLNRGQLPG L Y  SK AVN +T+ MALELG 
Sbjct  144  WLVSKYVCSRMRYAQQGGSVINISSTAGLNRGQLPGSLVYAASKAAVNTITKGMALELGM  203

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  531
             KIRVNSISPG+FKSEIT GL+QKDWL  VA +T+PLRT GT++PALTSLVR   +D
Sbjct  204  YKIRVNSISPGIFKSEITQGLLQKDWLKTVAFKTIPLRTHGTTDPALTSLVRRRQND  260



>emb|CDY40209.1| BnaA09g34910D [Brassica napus]
Length=312

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 155/205 (76%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I  AV++AWD FG ID LINNAG+RG V + LDL+EEEW  + +TNLTG 
Sbjct  108  ELDVSSDTSTIRNAVKQAWDIFGHIDVLINNAGIRGNVKSSLDLSEEEWERVFRTNLTGP  167

Query  181  WLVSKYVCLRMCNAKFggsivsissisg-LNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSK+VC+ M +AK GG  V   S    L RG+LPG LAY  SK  ++ +T++MA+E+G
Sbjct  168  WLVSKHVCVLMRDAKRGGGSVINVSSIAGLQRGKLPGALAYACSKGGLDIMTKMMAVEMG  227

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
               IRVNSI+PGLFKSEIT+GLM+K+W+  V  R VPL+   + +P LTSLVRYLIHDSS
Sbjct  228  EYGIRVNSIAPGLFKSEITEGLMRKEWMKNVRERIVPLKVQQSVDPGLTSLVRYLIHDSS  287

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
             Y+SGN YIVDAG+TL G+PIFSSL
Sbjct  288  RYVSGNVYIVDAGSTLSGLPIFSSL  312



>dbj|BAK02348.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=281

 Score =   245 bits (626),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+A    +E AVQRAWDAFGR+D LINNAGVRG VH+ LD  E+EW+ L KTNL G 
Sbjct  78   ELDVAAGESLVEDAVQRAWDAFGRVDVLINNAGVRGGVHSALDWPEDEWDKLMKTNLRGV  137

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLV+K+VC RM +A+  GS+++ISS SGL+ G   G LAY+ SK+AV+++T++MALELG 
Sbjct  138  WLVAKHVCRRMRDAELKGSVINISSTSGLDGGITHGSLAYSASKSAVHSVTKLMALELGA  197

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            + IRVN+I+PG+FKSEIT  L +K W+N VA + +PL+  GT +PALTSLVR+L H++S 
Sbjct  198  HGIRVNTIAPGIFKSEITAPLFEKRWMNDVASKILPLKKIGTPDPALTSLVRFLTHETSS  257

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            YISGN ++VD+G  LPGVPIFSSL
Sbjct  258  YISGNIFVVDSGLVLPGVPIFSSL  281



>ref|XP_006367949.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like, 
partial [Solanum tuberosum]
Length=261

 Score =   244 bits (622),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 154/205 (75%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+ADG  IE+AVQ AWDAFG ID LINNAG+RG V + L+LTEEEW     TNL GT
Sbjct  57   ELDVAADGATIESAVQIAWDAFGHIDVLINNAGIRGSVSSSLELTEEEWEHTFNTNLKGT  116

Query  181  WLVSKYVCLRMCNAKFggsivs-issisgLNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSK VC RM +AK  G  V  ISS + LNR    G LAY +SK A++ +T++MA+ELG
Sbjct  117  WLVSKCVCRRMRDAKQSGGSVINISSAAALNRVVYKGSLAYASSKMALDMITKIMAIELG  176

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
             +KIRVNSI+PG FKSEIT+GL +     K  L+ VPLR  GT++  LTSLVRYLIHDSS
Sbjct  177  VDKIRVNSITPGFFKSEITEGLFKLKGFPKFLLKIVPLRFIGTTDLGLTSLVRYLIHDSS  236

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
            +Y++GN +IVD G+T+ GVPIFSSL
Sbjct  237  KYVTGNVFIVDGGSTIVGVPIFSSL  261



>ref|XP_009150759.1| PREDICTED: probable L-xylulose reductase isoform X1 [Brassica 
rapa]
Length=279

 Score =   243 bits (620),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 148/205 (72%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV+ AW  FG+IDAL+NNAG+RG V + LDL+E EW+ + KTNL G 
Sbjct  75   ELDVSSDAATIQQAVKEAWKVFGKIDALVNNAGIRGTVKSSLDLSENEWDKVFKTNLMGA  134

Query  181  WLVSKYVCLRMCNAKFggsivsissisg-LNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSKYVC+ MC+AK GG  V   S    L+R    G +AY +SK+ V+ +TR MA+ELG
Sbjct  135  WLVSKYVCILMCDAKQGGGSVINISSVSGLHRSLSYGAVAYASSKSGVDTMTRAMAIELG  194

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
               IRVNSI+PGLFKSEIT  L+QK W   V  R  PL    T +P LTSLVRYLIHDSS
Sbjct  195  VYNIRVNSIAPGLFKSEITQALIQKKWFKNVTDRIFPLTAEQTVDPGLTSLVRYLIHDSS  254

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
             Y+SGN +IVDAG TLPG+PIFSSL
Sbjct  255  IYVSGNVFIVDAGATLPGLPIFSSL  279



>ref|XP_009150760.1| PREDICTED: probable L-xylulose reductase isoform X2 [Brassica 
rapa]
Length=278

 Score =   243 bits (620),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 148/205 (72%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV+ AW  FG+IDAL+NNAG+RG V + LDL+E EW+ + KTNL G 
Sbjct  74   ELDVSSDAATIQQAVKEAWKVFGKIDALVNNAGIRGTVKSSLDLSENEWDKVFKTNLMGA  133

Query  181  WLVSKYVCLRMCNAKFggsivsissisg-LNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSKYVC+ MC+AK GG  V   S    L+R    G +AY +SK+ V+ +TR MA+ELG
Sbjct  134  WLVSKYVCILMCDAKQGGGSVINISSVSGLHRSLSYGAVAYASSKSGVDTMTRAMAIELG  193

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
               IRVNSI+PGLFKSEIT  L+QK W   V  R  PL    T +P LTSLVRYLIHDSS
Sbjct  194  VYNIRVNSIAPGLFKSEITQALIQKKWFKNVTDRIFPLTAEQTVDPGLTSLVRYLIHDSS  253

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
             Y+SGN +IVDAG TLPG+PIFSSL
Sbjct  254  IYVSGNVFIVDAGATLPGLPIFSSL  278



>emb|CDX73391.1| BnaC08g26120D [Brassica napus]
Length=469

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 163/206 (79%), Gaps = 2/206 (1%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV++AWD FG ID LINNAG+RG V + LDL+EEEW  + +TNLTG 
Sbjct  264  ELDVSSDSSTIQNAVKQAWDIFGNIDVLINNAGIRGSVKSSLDLSEEEWERVFRTNLTGP  323

Query  181  WLVSKYVCLRMCNAKFgg--sivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALEL  354
            WLVSK+VC+ M +AK  G  S++++SSI+GL RG+LPGGLAY  SK  ++ +T++MA+EL
Sbjct  324  WLVSKHVCVLMRDAKRRGGGSVINVSSIAGLQRGKLPGGLAYACSKGGLDIMTKMMAVEL  383

Query  355  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  534
            G   IRVNSI+PGLFKSEIT+GLM+K+W+  V  R VPL+   + +P LTSLVRYLIHDS
Sbjct  384  GEYGIRVNSIAPGLFKSEITEGLMRKEWMKNVRERIVPLKVQQSVDPGLTSLVRYLIHDS  443

Query  535  SEYISGNTYIVDAGNTLPGVPIFSSL  612
            S Y+SGN YIVDAG TL G+PIFSSL
Sbjct  444  SRYVSGNVYIVDAGATLSGLPIFSSL  469



>ref|XP_008680945.1| PREDICTED: LOC100286139 isoform X4 [Zea mays]
Length=275

 Score =   240 bits (612),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = +1

Query  22   GPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYV  201
            G A+EAAVQ+AWDAFGRIDAL+NNAG+RG VH+PLD  E+EW+ + KTNLTG+WLV+K+V
Sbjct  84   GSALEAAVQKAWDAFGRIDALVNNAGIRGAVHSPLDWPEDEWDRIIKTNLTGSWLVAKHV  143

Query  202  CLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGTNKIRVNS  381
            C RM +AK  GS+V+I+SI+GLNRG LPG   Y +SK AV+  T++MALELG ++IRVNS
Sbjct  144  CRRMRDAKLKGSVVNITSIAGLNRGHLPGSTGYASSKAAVHYATKIMALELGADRIRVNS  203

Query  382  ISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSEYISGNTY  561
            I+PGLFKSEIT  L QK WL+ VA + VPL+  G ++PALTSLVR+LIH++S Y++GN +
Sbjct  204  IAPGLFKSEITAPLFQKRWLSTVASKIVPLKEHGATDPALTSLVRFLIHEASSYVTGNIF  263

Query  562  IVDA  573
            IVD+
Sbjct  264  IVDS  267



>ref|XP_009781380.1| PREDICTED: L-xylulose reductase-like [Nicotiana sylvestris]
Length=269

 Score =   239 bits (610),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 166/205 (81%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELD++A+G  IEAA Q AWD FGRIDAL+NNAGVRG + + L+L+E+EW     TNL G 
Sbjct  65   ELDITANGATIEAAGQIAWDTFGRIDALVNNAGVRGSISSSLELSEDEWKHTFNTNLRGA  124

Query  181  WLVSKYVCLRMCNAKFgg-sivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSKYVC  M +AK GG S+++ISS++ LNR  LPG LAY +SK A++ +T++MALELG
Sbjct  125  WLVSKYVCRCMRDAKHGGGSVINISSVAALNRTLLPGSLAYASSKAALDMVTKIMALELG  184

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
             +KIRVNSI+PG+FKSEIT+ L+++   + V  +TVPL+TF T++PALTS+VRYLIHDSS
Sbjct  185  VHKIRVNSIAPGVFKSEITENLVRQKRFHNVVFKTVPLKTFVTTDPALTSVVRYLIHDSS  244

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
            +Y+SGN +IVD G+TL GVPIFSSL
Sbjct  245  QYVSGNVFIVDGGSTLTGVPIFSSL  269



>ref|XP_008680943.1| PREDICTED: LOC100286139 isoform X3 [Zea mays]
Length=292

 Score =   240 bits (612),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = +1

Query  22   GPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYV  201
            G A+EAAVQ+AWDAFGRIDAL+NNAG+RG VH+PLD  E+EW+ + KTNLTG+WLV+K+V
Sbjct  84   GSALEAAVQKAWDAFGRIDALVNNAGIRGAVHSPLDWPEDEWDRIIKTNLTGSWLVAKHV  143

Query  202  CLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGTNKIRVNS  381
            C RM +AK  GS+V+I+SI+GLNRG LPG   Y +SK AV+  T++MALELG ++IRVNS
Sbjct  144  CRRMRDAKLKGSVVNITSIAGLNRGHLPGSTGYASSKAAVHYATKIMALELGADRIRVNS  203

Query  382  ISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSEYISGNTY  561
            I+PGLFKSEIT  L QK WL+ VA + VPL+  G ++PALTSLVR+LIH++S Y++GN +
Sbjct  204  IAPGLFKSEITAPLFQKRWLSTVASKIVPLKEHGATDPALTSLVRFLIHEASSYVTGNIF  263

Query  562  IVDA  573
            IVD+
Sbjct  264  IVDS  267



>ref|XP_008680941.1| PREDICTED: LOC100286139 isoform X2 [Zea mays]
 gb|ACN26914.1| unknown [Zea mays]
Length=315

 Score =   240 bits (613),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = +1

Query  22   GPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYV  201
            G A+EAAVQ+AWDAFGRIDAL+NNAG+RG VH+PLD  E+EW+ + KTNLTG+WLV+K+V
Sbjct  84   GSALEAAVQKAWDAFGRIDALVNNAGIRGAVHSPLDWPEDEWDRIIKTNLTGSWLVAKHV  143

Query  202  CLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGTNKIRVNS  381
            C RM +AK  GS+V+I+SI+GLNRG LPG   Y +SK AV+  T++MALELG ++IRVNS
Sbjct  144  CRRMRDAKLKGSVVNITSIAGLNRGHLPGSTGYASSKAAVHYATKIMALELGADRIRVNS  203

Query  382  ISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSEYISGNTY  561
            I+PGLFKSEIT  L QK WL+ VA + VPL+  G ++PALTSLVR+LIH++S Y++GN +
Sbjct  204  IAPGLFKSEITAPLFQKRWLSTVASKIVPLKEHGATDPALTSLVRFLIHEASSYVTGNIF  263

Query  562  IVDA  573
            IVD+
Sbjct  264  IVDS  267



>tpg|DAA47977.1| TPA: hypothetical protein ZEAMMB73_585385 [Zea mays]
Length=319

 Score =   240 bits (612),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = +1

Query  22   GPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYV  201
            G A+EAAVQ+AWDAFGRIDAL+NNAG+RG VH+PLD  E+EW+ + KTNLTG+WLV+K+V
Sbjct  84   GSALEAAVQKAWDAFGRIDALVNNAGIRGAVHSPLDWPEDEWDRIIKTNLTGSWLVAKHV  143

Query  202  CLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGTNKIRVNS  381
            C RM +AK  GS+V+I+SI+GLNRG LPG   Y +SK AV+  T++MALELG ++IRVNS
Sbjct  144  CRRMRDAKLKGSVVNITSIAGLNRGHLPGSTGYASSKAAVHYATKIMALELGADRIRVNS  203

Query  382  ISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSEYISGNTY  561
            I+PGLFKSEIT  L QK WL+ VA + VPL+  G ++PALTSLVR+LIH++S Y++GN +
Sbjct  204  IAPGLFKSEITAPLFQKRWLSTVASKIVPLKEHGATDPALTSLVRFLIHEASSYVTGNIF  263

Query  562  IVDA  573
            IVD+
Sbjct  264  IVDS  267



>ref|XP_006362944.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=275

 Score =   237 bits (605),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 160/205 (78%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+A+G  IEAAVQ AWDAFGRIDAL+NNAGVRG V + L+L+EEEW     TNL G 
Sbjct  71   ELDVTANGGNIEAAVQIAWDAFGRIDALVNNAGVRGSVSSSLELSEEEWEHTFTTNLRGA  130

Query  181  WLVSKYVCLRMCNAKFggsivsissisg-LNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSK+VC  M +AK GG  +   S    LNR  +PGGLAY +SK A++ LT +MALELG
Sbjct  131  WLVSKFVCRHMIDAKQGGGSIINVSSIAGLNRVLVPGGLAYASSKMALDRLTEMMALELG  190

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
             +KIRVNSI+PG+FKSE+T+ L+Q+ W + V  RT PLRT GT++PALTSLVRYLIH +S
Sbjct  191  VHKIRVNSIAPGIFKSEMTESLIQQKWFHGVISRTTPLRTIGTTDPALTSLVRYLIHAAS  250

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
            EY+SGN +IVD+G TL GVPIFSSL
Sbjct  251  EYVSGNVFIVDSGATLIGVPIFSSL  275



>ref|XP_008680935.1| PREDICTED: LOC100286139 isoform X1 [Zea mays]
Length=366

 Score =   240 bits (612),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = +1

Query  22   GPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYV  201
            G A+EAAVQ+AWDAFGRIDAL+NNAG+RG VH+PLD  E+EW+ + KTNLTG+WLV+K+V
Sbjct  84   GSALEAAVQKAWDAFGRIDALVNNAGIRGAVHSPLDWPEDEWDRIIKTNLTGSWLVAKHV  143

Query  202  CLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGTNKIRVNS  381
            C RM +AK  GS+V+I+SI+GLNRG LPG   Y +SK AV+  T++MALELG ++IRVNS
Sbjct  144  CRRMRDAKLKGSVVNITSIAGLNRGHLPGSTGYASSKAAVHYATKIMALELGADRIRVNS  203

Query  382  ISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSEYISGNTY  561
            I+PGLFKSEIT  L QK WL+ VA + VPL+  G ++PALTSLVR+LIH++S Y++GN +
Sbjct  204  IAPGLFKSEITAPLFQKRWLSTVASKIVPLKEHGATDPALTSLVRFLIHEASSYVTGNIF  263

Query  562  IVDA  573
            IVD+
Sbjct  264  IVDS  267



>ref|XP_009121071.1| PREDICTED: probable L-xylulose reductase isoform X1 [Brassica 
rapa]
Length=279

 Score =   237 bits (604),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 150/205 (73%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS++   I+ AV+ AWD FG+I ALINNAG+RG V + LDL+E EW+++  TNL G 
Sbjct  75   ELDVSSNAATIQKAVKEAWDIFGKIHALINNAGIRGNVKSCLDLSENEWDNVLTTNLKGA  134

Query  181  WLVSKYVCLRMCNAKFggsivsissisg-LNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLV+KYVC+ M +AK GG  V   S     +R   PG LAY  SK+ V+ +TR+MA+ELG
Sbjct  135  WLVAKYVCVLMRDAKTGGGSVINISSIAGFHRSLAPGALAYACSKSGVDTMTRMMAIELG  194

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
               IRVNSI+PGL  S+IT  LMQK WL  VA R +PL+   T +P LTSLVRYL+HDSS
Sbjct  195  AYNIRVNSIAPGLLNSDITKDLMQKKWLKVVAERILPLKVNQTVDPGLTSLVRYLLHDSS  254

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
            +Y+SGN YIVD+G TLPG+PIFSSL
Sbjct  255  QYVSGNIYIVDSGTTLPGLPIFSSL  279



>ref|XP_009121072.1| PREDICTED: probable L-xylulose reductase isoform X2 [Brassica 
rapa]
Length=278

 Score =   237 bits (604),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 150/205 (73%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS++   I+ AV+ AWD FG+I ALINNAG+RG V + LDL+E EW+++  TNL G 
Sbjct  74   ELDVSSNAATIQKAVKEAWDIFGKIHALINNAGIRGNVKSCLDLSENEWDNVLTTNLKGA  133

Query  181  WLVSKYVCLRMCNAKFggsivsissisg-LNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLV+KYVC+ M +AK GG  V   S     +R   PG LAY  SK+ V+ +TR+MA+ELG
Sbjct  134  WLVAKYVCVLMRDAKTGGGSVINISSIAGFHRSLAPGALAYACSKSGVDTMTRMMAIELG  193

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
               IRVNSI+PGL  S+IT  LMQK WL  VA R +PL+   T +P LTSLVRYL+HDSS
Sbjct  194  AYNIRVNSIAPGLLNSDITKDLMQKKWLKVVAERILPLKVNQTVDPGLTSLVRYLLHDSS  253

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
            +Y+SGN YIVD+G TLPG+PIFSSL
Sbjct  254  QYVSGNIYIVDSGTTLPGLPIFSSL  278



>gb|KEH30026.1| enoyl-(acyl carrier) reductase [Medicago truncatula]
Length=219

 Score =   234 bits (597),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 146/181 (81%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   RIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivsi  249
            R D  +      G V +PL+LTEEEWN++ +TN+TG WLVSKYVC  M ++K  GSI++I
Sbjct  39   RHDDFLLTTDDHGNVSSPLELTEEEWNNVFRTNITGAWLVSKYVCKLMRDSKRKGSIINI  98

Query  250  ssisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGTNKIRVNSISPGLFKSEITDGLMQ  429
            SSI+GL RGQ+PGG AY  SK  VN LT+VMALELG +KIRVNSISPGLFKSEIT+ LM+
Sbjct  99   SSIAGLERGQVPGGTAYACSKAGVNMLTKVMALELGAHKIRVNSISPGLFKSEITESLMK  158

Query  430  KDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSEYISGNTYIVDAGNTLPGVPIFSS  609
            KDWLN VA RTVPLR +GTSNPALT +VRYLIHDSSEY++GN +I DAG TLPG PI+SS
Sbjct  159  KDWLNNVAKRTVPLREWGTSNPALTKIVRYLIHDSSEYVTGNIFIADAGATLPGFPIYSS  218

Query  610  L  612
            L
Sbjct  219  L  219



>gb|KDO53626.1| hypothetical protein CISIN_1g031340mg [Citrus sinensis]
Length=161

 Score =   231 bits (588),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +1

Query  130  LTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTS  309
            ++EEEWN + KTNLTG WLV+KYVC+RM +AK GGS+++ISS  GLNRG LPGG+AY +S
Sbjct  1    MSEEEWNRVMKTNLTGCWLVAKYVCIRMRDAKQGGSVINISSTGGLNRGHLPGGVAYASS  60

Query  310  KTAVNALTRVMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTS  489
            K  +NA+T+VMALELG +KIRVN ISPG+F+SEIT  LM+KDWL  VA++TVPLR  GT+
Sbjct  61   KAGLNAMTKVMALELGAHKIRVNCISPGIFRSEITKALMEKDWLTNVAMKTVPLREHGTT  120

Query  490  NPALTSLVRYLIHDSSEYISGNTYIVDAGNTLPGVPIFSSL  612
             PALTSL+RYL+HDSSEY+SGN +IVDAG TLPGVPIFSSL
Sbjct  121  APALTSLIRYLVHDSSEYVSGNIFIVDAGTTLPGVPIFSSL  161



>ref|XP_006362943.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
isoform X1 [Solanum tuberosum]
Length=276

 Score =   233 bits (595),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 161/206 (78%), Gaps = 2/206 (1%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+A+G  IEAAVQ AWDAFGRIDAL+NNAGVRG V + L+L+EEEW     TNL G 
Sbjct  71   ELDVTANGGNIEAAVQIAWDAFGRIDALVNNAGVRGSVSSSLELSEEEWEHTFTTNLRGA  130

Query  181  WLVSKYVCLRMCNAKFggsivsissisg-LNRGQLPGGLAYTTSKTAVNALT-RVMALEL  354
            WLVSK+VC  M +AK GG  +   S    LNR  +PGGLAY +SK A++ LT ++MALEL
Sbjct  131  WLVSKFVCRHMIDAKQGGGSIINVSSIAGLNRVLVPGGLAYASSKMALDRLTEQMMALEL  190

Query  355  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  534
            G +KIRVNSI+PG+FKSE+T+ L+Q+ W + V  RT PLRT GT++PALTSLVRYLIH +
Sbjct  191  GVHKIRVNSIAPGIFKSEMTESLIQQKWFHGVISRTTPLRTIGTTDPALTSLVRYLIHAA  250

Query  535  SEYISGNTYIVDAGNTLPGVPIFSSL  612
            SEY+SGN +IVD+G TL GVPIFSSL
Sbjct  251  SEYVSGNVFIVDSGATLIGVPIFSSL  276



>gb|ADE77298.1| unknown [Picea sitchensis]
Length=289

 Score =   231 bits (588),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 153/204 (75%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            +LDVS     ++AAV  AW  FGRID LINNAG RG V++ LDL E+EWN +  TNL GT
Sbjct  86   KLDVSQSDAVVDAAVGIAWQCFGRIDVLINNAGFRGNVNSSLDLKEDEWNKVITTNLRGT  145

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK V  RM  AK GGSI++ISSI GL RG+LPGG+AY+ SK  +NA+T++MALELG 
Sbjct  146  WLVSKAVGKRMREAKRGGSIINISSIGGLPRGELPGGIAYSASKAGINAMTKIMALELGM  205

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVN+++PGLF+SEIT GLM+KDWLN VA + VPL+T+G   P LTS +  L  D+S 
Sbjct  206  YNIRVNAVAPGLFRSEITAGLMEKDWLNTVARKIVPLQTWGEIEPTLTSTLHLLASDTSA  265

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y +GN  I+D G +LPGVP++SSL
Sbjct  266  YTTGNIVIIDGGQSLPGVPLYSSL  289



>ref|XP_008787372.1| PREDICTED: LOW QUALITY PROTEIN: estradiol 17-beta-dehydrogenase 
8-like [Phoenix dactylifera]
Length=203

 Score =   225 bits (574),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = +1

Query  106  GRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivsissisgLNRGQLP  285
            G V++PLD  EEEWN L  TNL+G WLVSK++C RM + K  GS ++ISSISG  RG+LP
Sbjct  35   GCVYSPLDWPEEEWNSLISTNLSGLWLVSKHICRRMHDTKQNGSGINISSISGTQRGELP  94

Query  286  GGLAYTTSKTAVNALTRVMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTV  465
            GG+AY  SK  V A+T+VMALELG + IRVN+I PGLFKSEIT+GLMQK WL++V  RTV
Sbjct  95   GGVAYAASKAGVGAITKVMALELGVHSIRVNAIXPGLFKSEITEGLMQKGWLDRVTKRTV  154

Query  466  PLRTFGTSNPALTSLVRYLIHDSSEYISGNTYIVDAGNTLPGVPIFSSL  612
            PL+T  TS+PALTSLVRYLIHDSSEY+SG+ +IVDAG TLPGVP+FSSL
Sbjct  155  PLQTLDTSDPALTSLVRYLIHDSSEYVSGSIFIVDAGTTLPGVPLFSSL  203



>ref|XP_001760079.1| predicted protein [Physcomitrella patens]
 gb|EDQ75204.1| predicted protein [Physcomitrella patens]
Length=274

 Score =   228 bits (580),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 155/204 (76%), Gaps = 0/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSA  P I+AAV++AW A G ID L+NNAG+RG V TP+D  E EWN +  TNL GT
Sbjct  71   ELDVSASEPVIDAAVEKAWAALGYIDVLVNNAGLRGPVRTPIDQEEHEWNAIFNTNLRGT  130

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WL+SK V  R+  AK GGSI++ISSI G+ RG LPGGLAY+TSK AV  L+++MA+ELG 
Sbjct  131  WLMSKAVSKRLVAAKRGGSIINISSIGGIERGLLPGGLAYSTSKAAVIHLSKIMAMELGH  190

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            + IR N+I+ GLFKSEIT+ L QK+WL+KVA + VP   +G  +P LTSLV  L  D S+
Sbjct  191  HNIRTNAIAAGLFKSEITNDLFQKEWLHKVATKIVPAGKWGAVDPDLTSLVILLASDDSQ  250

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            YI+GNT+IVD G +LPG+PI+SSL
Sbjct  251  YITGNTFIVDGGQSLPGLPIWSSL  274



>ref|XP_002884088.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH60347.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=278

 Score =   226 bits (576),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 150/204 (74%), Gaps = 21/204 (10%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D P I+ A          ID LINNAG RG            W+ + KTNLTGT
Sbjct  96   ELDVSSDAPTIQKA----------IDVLINNAGFRG-----------NWDKVIKTNLTGT  134

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+ M +AK GGS++SI S+SGL+RGQ+PGG+AY  SK  V+ +TR+MA+ LG 
Sbjct  135  WLVSKYVCILMRDAKRGGSVISILSVSGLHRGQVPGGVAYACSKGGVDTMTRMMAVGLGV  194

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             KIRVNSI+PGL KSEIT GLMQK+WL  V  R VPL+     +P LTSLVRYLIHDSS+
Sbjct  195  YKIRVNSIAPGLLKSEITQGLMQKEWLKNVNERIVPLKVQQAVDPGLTSLVRYLIHDSSQ  254

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            YISGNTYIVD+G++LPGVPIFSSL
Sbjct  255  YISGNTYIVDSGSSLPGVPIFSSL  278



>ref|XP_011075456.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase 4-like 
isoform X2 [Sesamum indicum]
Length=284

 Score =   226 bits (576),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 158/204 (77%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELD+++D  AI A++ +AWDAFG ID LINNAGVRG+  + L++ +EEWN +  TNL GT
Sbjct  82   ELDITSDDNAIGASIAKAWDAFGHIDVLINNAGVRGQKRSSLEIGKEEWNQVLNTNLIGT  141

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            W VSK V  R+  A+   SI++ISSI+GLNR Q  GG+AY +SK+A++++TR+MALELG 
Sbjct  142  WEVSKCVASRLRFARRKASIINISSITGLNRVQFFGGIAYNSSKSAIDSITRIMALELGG  201

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVNSI+PGLF SEI+  + Q D L  +A + +PL T G  NPALTSLVRYL+HDSS 
Sbjct  202  YNIRVNSIAPGLFPSEISGPIFQHD-LEILAKKIIPLGTSGAINPALTSLVRYLVHDSSN  260

Query  541  YISGNTYIVDAGNTLPGVPIFSSL  612
            Y+SGNT+IVD G++LPG+PI+SSL
Sbjct  261  YVSGNTFIVDFGSSLPGLPIYSSL  284



>emb|CBI32789.3| unnamed protein product [Vitis vinifera]
Length=271

 Score =   225 bits (573),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 145/172 (84%), Gaps = 0/172 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV++ G +I A+VQ+AW+AFGRID L+NNAG+RG V++PLD++EEEWN+  KTNLTG+
Sbjct  83   ELDVTSGGSSISASVQKAWEAFGRIDVLLNNAGIRGNVNSPLDISEEEWNNTLKTNLTGS  142

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYV +RM +AK GGSI++ISSI  LNRGQ PG +AY +SK+ ++A+T+VMALELG 
Sbjct  143  WLVSKYVGMRMRDAKNGGSIINISSIVSLNRGQSPGAVAYVSSKSGLSAMTKVMALELGA  202

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVR  516
              IR N+I+PG+FKSEIT GLMQKDWLN V  RT PLR +GTS+PALTSL +
Sbjct  203  YNIRANAIAPGIFKSEITAGLMQKDWLNTVVQRTCPLRAYGTSDPALTSLAQ  254



>ref|XP_004170138.1| PREDICTED: uncharacterized oxidoreductase Rv1714/MT1753.1-like 
[Cucumis sativus]
Length=174

 Score =   221 bits (562),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = +1

Query  106  GRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivsissisgLNRGQLP  285
            G V +PL+L+E+EW+D   TNL G WLVSKYVC+ M  A  GGSI++ISSISGLNR    
Sbjct  6    GSVKSPLELSEKEWDDTMDTNLKGQWLVSKYVCILMNKANRGGSIINISSISGLNRPLEM  65

Query  286  GGLAYTTSKTAVNALTRVMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTV  465
            G +AY TSK A+N  T+VMA+ELG +KIRVNSI PGLFKSEIT  LM+KDW+  VA R V
Sbjct  66   GAVAYITSKAALNTFTKVMAMELGAHKIRVNSICPGLFKSEITKDLMKKDWIKNVARRMV  125

Query  466  PLRTFGTSNPALTSLVRYLIHDSSEYISGNTYIVDAGNTLPGVPIFSSL  612
            PLRTFGTSNPALT++VRYL+HDSS+Y+SGN +IVDAG+TLPGVPIFSSL
Sbjct  126  PLRTFGTSNPALTTIVRYLVHDSSKYVSGNIFIVDAGSTLPGVPIFSSL  174



>ref|XP_007028286.1| 2,4-dienoyl-CoA reductase, putative isoform 1 [Theobroma cacao]
 gb|EOY08788.1| 2,4-dienoyl-CoA reductase, putative isoform 1 [Theobroma cacao]
Length=364

 Score =   224 bits (571),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 137/268 (51%), Positives = 169/268 (63%), Gaps = 64/268 (24%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV A G  I+++V+ AWDAFGRID+LINNAG+RG V  P++L+EEEWN   KTNLTG+
Sbjct  97   ELDVCAKGATIQSSVKTAWDAFGRIDSLINNAGIRGNVKNPMELSEEEWNQTIKTNLTGS  156

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRV-----MA  345
            WLVSKYVC+ M +A  GGSI++ISSI+GLNRGQLPGG+AY  SK  + A+T++     ++
Sbjct  157  WLVSKYVCMHMLDANQGGSIINISSIAGLNRGQLPGGVAYAASKAGLIAMTKLTFDARLS  216

Query  346  LE------------------------------LGTNKI-----------------RVNSI  384
            LE                              L T+KI                 R  ++
Sbjct  217  LEYQSFCGVCNPTQLLPPVMVRCRRNLRMETGLSTDKISELDELAVWFSSSFLLERSMAL  276

Query  385  SPGLFK---SEITDGL---------MQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIH  528
              G  K   + I+ GL         M+KDWL  VA RT PLRTFGTS+PALTSLVRYLIH
Sbjct  277  ELGAHKIRVNSISPGLFKSEITQGLMKKDWLTNVATRTAPLRTFGTSDPALTSLVRYLIH  336

Query  529  DSSEYISGNTYIVDAGNTLPGVPIFSSL  612
            DSSEY+SGN +IVDAG TLPG+PIFSSL
Sbjct  337  DSSEYVSGNMFIVDAGVTLPGIPIFSSL  364



>ref|XP_011075454.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase 4-like 
isoform X1 [Sesamum indicum]
Length=287

 Score =   221 bits (562),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 158/207 (76%), Gaps = 4/207 (2%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVR---GRVHTPLDLTEEEWNDLTKTNL  171
            ELD+++D  AI A++ +AWDAFG ID LINNAGVR   G+  + L++ +EEWN +  TNL
Sbjct  82   ELDITSDDNAIGASIAKAWDAFGHIDVLINNAGVRAEVGQKRSSLEIGKEEWNQVLNTNL  141

Query  172  TGTWLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALE  351
             GTW VSK V  R+  A+   SI++ISSI+GLNR Q  GG+AY +SK+A++++TR+MALE
Sbjct  142  IGTWEVSKCVASRLRFARRKASIINISSITGLNRVQFFGGIAYNSSKSAIDSITRIMALE  201

Query  352  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  531
            LG   IRVNSI+PGLF SEI+  + Q D L  +A + +PL T G  NPALTSLVRYL+HD
Sbjct  202  LGGYNIRVNSIAPGLFPSEISGPIFQHD-LEILAKKIIPLGTSGAINPALTSLVRYLVHD  260

Query  532  SSEYISGNTYIVDAGNTLPGVPIFSSL  612
            SS Y+SGNT+IVD G++LPG+PI+SSL
Sbjct  261  SSNYVSGNTFIVDFGSSLPGLPIYSSL  287



>ref|XP_009786105.1| PREDICTED: D-erythrulose reductase-like [Nicotiana sylvestris]
Length=251

 Score =   215 bits (548),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 138/175 (79%), Gaps = 1/175 (1%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            E D++ADG  IEAAVQRAWDAFGRIDAL+NNAGVRG + + L L+E+EWN    TNL GT
Sbjct  65   EFDITADGSTIEAAVQRAWDAFGRIDALVNNAGVRGNIGSSLKLSEDEWNHTFNTNLKGT  124

Query  181  WLVSKYVCLRMCNAKFg-gsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSKYVC RM +AK   GS+++ISS + LNR    G LAY +SK A++ +T++MALELG
Sbjct  125  WLVSKYVCSRMRDAKQDGGSVINISSAAALNRALFKGSLAYASSKMALDMITKIMALELG  184

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYL  522
             +KIRVNSISPG+FKSEIT+ L+Q+   +    + VPLRTFGT++PALTS+VRY+
Sbjct  185  VHKIRVNSISPGIFKSEITENLVQQKRFHNAVFKAVPLRTFGTTDPALTSVVRYI  239



>ref|XP_006367340.1| PREDICTED: probable L-xylulose reductase-like, partial [Solanum 
tuberosum]
Length=271

 Score =   215 bits (547),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 151/205 (74%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+++G  IE AVQ AW+AFGRID LINNAG+RG V   L+L+EEEW     TNL G 
Sbjct  67   ELDVTSNGATIEVAVQIAWNAFGRIDTLINNAGIRGSVSFSLELSEEEWEHTFNTNLRGA  126

Query  181  WLVSKYVCLRMCNAKFggsivsissisg-LNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSKYVC RM +AK GG  V   S    LNR  LPG +AY +SK A++  TR+MALE+G
Sbjct  127  WLVSKYVCRRMRDAKQGGGSVINISSVSGLNRVLLPGSVAYASSKMALDMFTRMMALEMG  186

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
               IRVNSI+P +F+SEIT+ L+QK+   +V  + VPLR FG +NPA+TS+VRYL   +S
Sbjct  187  VYNIRVNSIAPAIFRSEITESLIQKESYKRVVSKIVPLRDFGKTNPAITSVVRYLNLHAS  246

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
            EY+SGN +IVD+G +L GVPIFSSL
Sbjct  247  EYVSGNIFIVDSGCSLTGVPIFSSL  271



>ref|XP_003632638.2| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Vitis vinifera]
Length=297

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 131/196 (67%), Gaps = 23/196 (12%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            E DV+AD P I+A+V +AWD FGRID LINN G RG V   L+L EEEW +  KTNL GT
Sbjct  83   EFDVTADDPTIDASVHKAWDGFGRIDVLINNVGFRGTVKNSLELDEEEWGEGMKTNLNGT  142

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK+VC RM                   R    GGL     K  V     VMA+E G 
Sbjct  143  WLVSKHVCRRM-------------------RDGHQGGLC----KLYVVTTKLVMAIEFGM  179

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              +RVN+ISPGLFKSEIT+GL+QK WLN V L+ VPL+TFGT +PA+TSLVR+L+HDSS 
Sbjct  180  YNVRVNAISPGLFKSEITEGLLQKSWLNNVTLKMVPLQTFGTLDPAVTSLVRFLVHDSSR  239

Query  541  YISGNTYIVDAGNTLP  588
            YI+GN  IVDAG++LP
Sbjct  240  YITGNILIVDAGSSLP  255



>ref|XP_009394522.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=246

 Score =   210 bits (534),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVSA G  IEAAVQRAWDAFGRIDALINNAGVRG V++PLD  EE+WN    TNLTG 
Sbjct  81   ELDVSAGGSVIEAAVQRAWDAFGRIDALINNAGVRGGVYSPLDWPEEDWNATFATNLTGL  140

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC +M NAK  G++++ISSISGLNRG+LPG +AY  SK  VNA+T+VMALE+G 
Sbjct  141  WLVSKYVCKQMVNAKLKGTVINISSISGLNRGKLPGAIAYAVSKEGVNAITKVMALEMGV  200

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTV  465
            + IRVNSISPG+FKSEIT+ LM+K W+NKV L  V
Sbjct  201  HNIRVNSISPGIFKSEITESLMRKKWINKVPLYQV  235



>ref|XP_006362945.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
isoform X3 [Solanum tuberosum]
Length=260

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 131/206 (64%), Positives = 159/206 (77%), Gaps = 18/206 (9%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+A+G  IEAAVQ AWDAFGRIDAL+NNAGVRG V + L+L+EEEW     TNL G 
Sbjct  71   ELDVTANGGNIEAAVQIAWDAFGRIDALVNNAGVRGSVSSSLELSEEEWEHTFTTNLRGA  130

Query  181  WLVSKYVCLRMCNAKF-ggsivsissisgLNRGQLPGGLAYTTSKTAVNALT-RVMALEL  354
            WLVSK+VC  M +AK  GGSI+++SSI+GLNR  +PGGLAY +SK A++ LT ++MALEL
Sbjct  131  WLVSKFVCRHMIDAKQGGGSIINVSSIAGLNRVLVPGGLAYASSKMALDRLTEQMMALEL  190

Query  355  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  534
            G +KIRVNSI+PG+FKS+                RT PLRT GT++PALTSLVRYLIH +
Sbjct  191  GVHKIRVNSIAPGIFKSD----------------RTTPLRTIGTTDPALTSLVRYLIHAA  234

Query  535  SEYISGNTYIVDAGNTLPGVPIFSSL  612
            SEY+SGN +IVD+G TL GVPIFSSL
Sbjct  235  SEYVSGNVFIVDSGATLIGVPIFSSL  260



>ref|XP_006408894.1| hypothetical protein EUTSA_v10002227mg, partial [Eutrema salsugineum]
 gb|ESQ50347.1| hypothetical protein EUTSA_v10002227mg, partial [Eutrema salsugineum]
Length=283

 Score =   208 bits (530),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 137/184 (74%), Gaps = 0/184 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            E DVS+D   I+ AV+ AW  FG+IDALINNAG+ G V + LDL E+EW+++ +TNLTG 
Sbjct  84   EPDVSSDAATIQKAVKEAWQVFGKIDALINNAGITGSVKSSLDLCEDEWDNVFRTNLTGP  143

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WL+SKYVC+ M + K  GS+++ISSISGLNR  +P  LAY  SK +V+ +TR+MA+ELG 
Sbjct  144  WLISKYVCVLMRDCKLSGSVINISSISGLNRTIVPCALAYNCSKASVHTMTRMMAIELGV  203

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
              IRVNSI+PGLFKSEIT  L+QK W   V  R +PL+     +P LTSLVRYLIHDSS+
Sbjct  204  YNIRVNSIAPGLFKSEITQSLLQKVWFKNVVERIIPLKKPQAVDPGLTSLVRYLIHDSSQ  263

Query  541  YISG  552
            Y+S 
Sbjct  264  YVSA  267



>gb|EMS63120.1| 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Triticum urartu]
Length=193

 Score =   202 bits (513),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 138/169 (82%), Gaps = 0/169 (0%)
 Frame = +1

Query  106  GRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivsissisgLNRGQLP  285
            G VH+ LD  E+EW+ L KTNLTG WLV+K+VC  M +AK  GS+++ISS++GLNRG LP
Sbjct  25   GGVHSLLDWPEDEWDKLIKTNLTGLWLVAKHVCRHMRDAKIKGSVINISSVAGLNRGNLP  84

Query  286  GGLAYTTSKTAVNALTRVMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTV  465
            G + Y +SK+AV+++T++MALELG   IRVN+I+PG+F+SEIT  L+QK WL+ V  + V
Sbjct  85   GSIGYASSKSAVHSVTKIMALELGGYGIRVNAIAPGIFQSEITAPLLQKRWLSTVVSKIV  144

Query  466  PLRTFGTSNPALTSLVRYLIHDSSEYISGNTYIVDAGNTLPGVPIFSSL  612
            PL+T GT++PALTSLVR+LIH+ + YI+GN +IVD+G T+PGVPIFSSL
Sbjct  145  PLKTNGTTDPALTSLVRFLIHEKASYITGNIFIVDSGVTVPGVPIFSSL  193



>ref|XP_010314672.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 1-like isoform X1 [Solanum lycopersicum]
Length=614

 Score =   211 bits (537),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 132/173 (76%), Gaps = 1/173 (1%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            +LD++AD   I+AAVQ AWDAFGRIDALINNAG+RG V+  LDL EEEW    KTNL G 
Sbjct  67   QLDITADSATIQAAVQIAWDAFGRIDALINNAGLRGNVYDSLDLPEEEWEHTYKTNLRGA  126

Query  181  WLVSKYVCLRMCNAKFggsivsissisg-LNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSKYVC  M ++K GG  V   S    LNR  +PGGLAY +SK A++ +T++MALELG
Sbjct  127  WLVSKYVCRHMRDSKQGGGSVINISSIAGLNRVLIPGGLAYASSKMALDMVTKMMALELG  186

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVR  516
             + IRVNSISPG+FKSEIT  LM+K+W N V +RT+PLRT GT++PALTS VR
Sbjct  187  VDNIRVNSISPGIFKSEITKSLMEKEWFNNVTVRTIPLRTLGTTDPALTSTVR  239



>ref|XP_004252861.2| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 1-like isoform X2 [Solanum lycopersicum]
Length=613

 Score =   211 bits (537),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 132/173 (76%), Gaps = 1/173 (1%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            +LD++AD   I+AAVQ AWDAFGRIDALINNAG+RG V+  LDL EEEW    KTNL G 
Sbjct  67   QLDITADSATIQAAVQIAWDAFGRIDALINNAGLRGNVYDSLDLPEEEWEHTYKTNLRGA  126

Query  181  WLVSKYVCLRMCNAKFggsivsissisg-LNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSKYVC  M ++K GG  V   S    LNR  +PGGLAY +SK A++ +T++MALELG
Sbjct  127  WLVSKYVCRHMRDSKQGGGSVINISSIAGLNRVLIPGGLAYASSKMALDMVTKMMALELG  186

Query  358  TNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVR  516
             + IRVNSISPG+FKSEIT  LM+K+W N V +RT+PLRT GT++PALTS VR
Sbjct  187  VDNIRVNSISPGIFKSEITKSLMEKEWFNNVTVRTIPLRTLGTTDPALTSTVR  239



>gb|EYU20809.1| hypothetical protein MIMGU_mgv11b016674mg [Erythranthe guttata]
Length=267

 Score =   202 bits (514),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 141/188 (75%), Gaps = 1/188 (1%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+AD  AIEA+V +AWDAFG ID LINNAG RG+V +PL L+ EEWN + KT LTG+
Sbjct  74   ELDVTADPAAIEASVWKAWDAFGHIDTLINNAGFRGQVRSPLTLSPEEWNQVVKTILTGS  133

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLV+K V  RM  A   GSI++ISS+SGLNRG   GG+A  +SK A++ +T+++ALE G 
Sbjct  134  WLVAKSVGKRMRAAARNGSIINISSVSGLNRGVFRGGVACDSSKAAIDTMTKIVALEFGD  193

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRT-VPLRTFGTSNPALTSLVRYLIHDSS  537
             KIRVNSI+PGLFKSEIT+ L  K    K A++  VPL  FG  +PALT LVRYLI DSS
Sbjct  194  YKIRVNSIAPGLFKSEITENLFNKKLGLKNAMKKLVPLGEFGEGDPALTCLVRYLIDDSS  253

Query  538  EYISGNTY  561
            EY+SGN +
Sbjct  254  EYVSGNIF  261



>ref|XP_009769812.1| PREDICTED: carbonyl reductase [NADPH] 2-like [Nicotiana sylvestris]
 ref|XP_009772623.1| PREDICTED: carbonyl reductase [NADPH] 2-like [Nicotiana sylvestris]
Length=134

 Score =   194 bits (494),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  265  LNRGQLPGGLAYTTSKTAVNALTRVMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLN  444
            LNRGQLPGGLAY +SKTA+N + ++MA+ELG  KI+VNSISPGLF+SEIT+GLMQKDWL+
Sbjct  19   LNRGQLPGGLAYASSKTALNTVMKMMAIELGPYKIKVNSISPGLFRSEITEGLMQKDWLH  78

Query  445  KVALRTVPLRTFGTSNPALTSLVRYLIHDSSEYISGNTYIVDAGNTLPGVPIFSSL  612
             +ALRT+PLRT GTS+PALTS+VRYLIHDSSEY+SGN +IV+AG TLPGVPIFSSL
Sbjct  79   NIALRTIPLRTHGTSDPALTSVVRYLIHDSSEYVSGNIFIVEAGATLPGVPIFSSL  134



>ref|XP_002963314.1| hypothetical protein SELMODRAFT_80357 [Selaginella moellendorffii]
 gb|EFJ35185.1| hypothetical protein SELMODRAFT_80357 [Selaginella moellendorffii]
Length=275

 Score =   196 bits (498),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 138/216 (64%), Gaps = 13/216 (6%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGR-----------VHTPLDLTEEEW  147
            ELDVSA    I+A V RAW+ FG +D L+NNAG+RG            V +PL+L E++W
Sbjct  61   ELDVSASEKFIDAGVDRAWNCFGGVDVLVNNAGIRGNIIFCFSFPSGPVKSPLELDEDDW  120

Query  148  NDLTKTNLTGTWLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNA  327
            N    TN  GTWLVSK V  RM  AK     +   S +  + G LPGG+AY +SK A+N 
Sbjct  121  NKTFNTNTRGTWLVSKAVARRMVAAK-KPGSIINISSTASSGGLLPGGIAYASSKAAINR  179

Query  328  LTRVMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTS  507
            LT+ MALELG  KIRVN+I+ G+F SEITD L+ K W++  A + VPLR FG  +P LTS
Sbjct  180  LTQSMALELGKFKIRVNAIAAGIFPSEITDSLLDKAWVHDAAAKIVPLRRFGQVSPDLTS  239

Query  508  LVRYLIHDS-SEYISGNTYIVDAGNTLPGVPIFSSL  612
            LV  L  D  S YI+G  Y VD G+TLPG+ ++SSL
Sbjct  240  LVLMLASDEHSSYITGQIYHVDGGHTLPGIQLWSSL  275



>ref|XP_002963719.1| hypothetical protein SELMODRAFT_80710, partial [Selaginella moellendorffii]
 gb|EFJ35590.1| hypothetical protein SELMODRAFT_80710, partial [Selaginella moellendorffii]
Length=221

 Score =   193 bits (491),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 140/218 (64%), Gaps = 15/218 (7%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGR-------------VHTPLDLTEE  141
            ELDVSA   +I+AA+ RAW  FG +D LINNAG+RG              V +PL+L EE
Sbjct  5    ELDVSASERSIDAAIDRAWSFFGGVDVLINNAGIRGNSLSLSRLQIPSRPVKSPLELDEE  64

Query  142  EWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAV  321
            +WN    TN  GTWLVSK V  RM  AK     +   S S  + G LPGG AY +SK A+
Sbjct  65   DWNKTFNTNTRGTWLVSKAVARRMVAAK-KPGSIINISSSASSGGILPGGTAYGSSKAAI  123

Query  322  NALTRVMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPAL  501
            N LT++MALELG  KIRVN+I+ G+F+SEIT+GL+ + W++  A   VPLR FG  +P L
Sbjct  124  NRLTQIMALELGKFKIRVNAIAAGIFRSEITEGLLDQAWVHDAAATIVPLRRFGLVSPGL  183

Query  502  TSLVRYLIHDS-SEYISGNTYIVDAGNTLPGVPIFSSL  612
            TSLV  L  D  S YI+G  Y+ D G+TLPG+ ++SSL
Sbjct  184  TSLVLILASDEHSSYITGQIYLEDGGHTLPGIQLWSSL  221



>gb|ABK21106.1| unknown [Picea sitchensis]
Length=295

 Score =   196 bits (497),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 145/205 (71%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            +LDVSA    I+ AV++AW  FG ID L+NNAG RG V +PL   EEEWN +  TN+ G 
Sbjct  91   QLDVSASEKDIDMAVEKAWQGFGAIDILVNNAGYRGTVKSPLQYDEEEWNTVINTNMRGV  150

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK V  RM +A   GSI++ISS +  NRG LPG + Y TSK  VN +T++MALELG 
Sbjct  151  WLVSKCVAKRMRDAGKKGSIINISSTASANRGNLPGSMIYATSKVGVNQITKMMALELGR  210

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALT-SLVRYLIHDSS  537
              IRVN+I+ G+FKSE+T G+ +KDW +KVA + VP + +G+++P  T  L+    + +S
Sbjct  211  YGIRVNAIAAGIFKSEMTKGIFEKDWSHKVAEKVVPAQRWGSTDPDFTSLLLLLASNAAS  270

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
             Y++GN +I+D G+T+PG+P++SSL
Sbjct  271  SYVTGNIFILDGGHTIPGLPLWSSL  295



>ref|XP_002974604.1| hypothetical protein SELMODRAFT_101607 [Selaginella moellendorffii]
 gb|EFJ24124.1| hypothetical protein SELMODRAFT_101607 [Selaginella moellendorffii]
Length=278

 Score =   194 bits (493),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 140/220 (64%), Gaps = 17/220 (8%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGR---------------VHTPLDLT  135
            ELDVSA+   I+AAV RAW+ FG +D LINNAG+RG                V +PL+L 
Sbjct  60   ELDVSANEKFIDAAVDRAWNCFGGVDVLINNAGIRGNSSISFSLSFENMKRPVKSPLELD  119

Query  136  EEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKT  315
            E++WN    TN  GTWLVSK V  RM  AK     +   S +  + G LPGG+AY +SK 
Sbjct  120  EDDWNKTFNTNTRGTWLVSKAVARRMVAAK-KPGSIINISSTASSGGLLPGGIAYASSKA  178

Query  316  AVNALTRVMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNP  495
            A+N LT+ MALELG  KIRVN+I+ G+F+SEITD L+ K W++  A + VPL  FG  +P
Sbjct  179  AINRLTQSMALELGKFKIRVNAIAAGIFRSEITDSLLDKAWVHDAAAKIVPLLRFGQVSP  238

Query  496  ALTSLVRYLI-HDSSEYISGNTYIVDAGNTLPGVPIFSSL  612
             LTSLV  L   + S YI+G  Y VD G+TLPG+ ++SSL
Sbjct  239  DLTSLVLMLASEEHSSYITGQIYHVDGGHTLPGIRLWSSL  278



>ref|XP_006299633.1| hypothetical protein CARUB_v10015813mg, partial [Capsella rubella]
 gb|EOA32531.1| hypothetical protein CARUB_v10015813mg, partial [Capsella rubella]
Length=195

 Score =   189 bits (481),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV+ AW+ FG+IDALINNAG RG V + LDL+E+EW+ + KTNLTGT
Sbjct  42   ELDVSSDAATIQKAVKEAWEIFGKIDALINNAGFRGNVRSSLDLSEDEWDKVFKTNLTGT  101

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKY+C+ M +AK GGS+++ISS+SGL+RG +PGG+AY  SK  V+ +TR+MALELG 
Sbjct  102  WLVSKYICVLMRDAKHGGSVINISSVSGLHRGLVPGGIAYACSKGGVDTMTRMMALELGV  161

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRT  462
             KIRVNSI+PGL KSEIT GLM+K+WL  V  RT
Sbjct  162  YKIRVNSIAPGLLKSEITHGLMEKEWLKTVTERT  195



>emb|CBI32788.3| unnamed protein product [Vitis vinifera]
Length=305

 Score =   192 bits (489),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 123/196 (63%), Gaps = 23/196 (12%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            E DV+AD P I+A+V +AWD FGRID LINN G RG V   L+L EEEW +  KTNL GT
Sbjct  64   EFDVTADDPTIDASVHKAWDGFGRIDVLINNVGFRGTVKNSLELDEEEWGEGMKTNLNGT  123

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK+VC RM                   R    GGL                 L    
Sbjct  124  WLVSKHVCRRM-------------------RDGHQGGLWPQNCFLFFKYYANYTWLP---  161

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
             +  VN+ISPGLFKSEIT+GL+QK WLN V L+ VPL+TFGT +PA+TSLVR+L+HDSS 
Sbjct  162  -QNWVNAISPGLFKSEITEGLLQKSWLNNVTLKMVPLQTFGTLDPAVTSLVRFLVHDSSR  220

Query  541  YISGNTYIVDAGNTLP  588
            YI+GN  IVDAG++LP
Sbjct  221  YITGNILIVDAGSSLP  236



>gb|KGN54695.1| hypothetical protein Csa_4G429290 [Cucumis sativus]
Length=134

 Score =   175 bits (444),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +1

Query  265  LNRGQLPGGLAYTTSKTAVNALTRVMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLN  444
            LNR    G LAY TSK A+N LT+VMA+ELG +KIRVNSI PGLFKSEIT  LM+KDW+ 
Sbjct  19   LNRALQRGALAYITSKAALNTLTKVMAMELGAHKIRVNSICPGLFKSEITKDLMEKDWIK  78

Query  445  KVALRTVPLRTFGTSNPALTSLVRYLIHDSSEYISGNTYIVDAGNTLPGVPIFSSL  612
             VA R +PLRTFGTSNPALT+ VRYL+H+SS+Y+SGN +IVDAGN+L GVPIFSSL
Sbjct  79   NVAKRMIPLRTFGTSNPALTTTVRYLVHESSKYVSGNIFIVDAGNSLLGVPIFSSL  134



>emb|CDY07809.1| BnaC03g48130D [Brassica napus]
Length=148

 Score =   171 bits (434),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 107/147 (73%), Gaps = 1/147 (1%)
 Frame = +1

Query  175  GTWLVSKYVCLRMCNAKFggsivsissisg-LNRGQLPGGLAYTTSKTAVNALTRVMALE  351
            G+WLVSKYVC+ MC+AK GG  V   S    LNR    G +AY +SK+ V+ +TR MA+E
Sbjct  2    GSWLVSKYVCILMCDAKQGGGSVINISSISGLNRSLSYGAVAYASSKSGVDTMTRAMAIE  61

Query  352  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  531
            LG   IRVNSI+PGLFKSEIT  L+QK WL  V  R VPL    T +P LTSLVRYLIHD
Sbjct  62   LGVYNIRVNSIAPGLFKSEITQALIQKKWLKNVTDRIVPLTAEQTVDPGLTSLVRYLIHD  121

Query  532  SSEYISGNTYIVDAGNTLPGVPIFSSL  612
            SS+Y+S N +IVDAG TLPG+PIFSSL
Sbjct  122  SSQYVSCNVFIVDAGATLPGLPIFSSL  148



>emb|CDY29207.1| BnaA06g25500D [Brassica napus]
Length=148

 Score =   169 bits (429),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 105/147 (71%), Gaps = 1/147 (1%)
 Frame = +1

Query  175  GTWLVSKYVCLRMCNAKFggsivsissisg-LNRGQLPGGLAYTTSKTAVNALTRVMALE  351
            G WLVSKYVC+ MC+AK GG  V   S    L+R    G +AY +SK+ V+ +TR MA+E
Sbjct  2    GAWLVSKYVCILMCDAKQGGGSVINISSVSGLHRSLSYGAVAYASSKSGVDTMTRAMAIE  61

Query  352  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  531
            LG   IRVNSI+PGLFKSEIT  L+QK W   V  R  PL    T +P LTSLVRYLIHD
Sbjct  62   LGVYNIRVNSIAPGLFKSEITQALIQKKWFKNVTDRIFPLTAEQTVDPGLTSLVRYLIHD  121

Query  532  SSEYISGNTYIVDAGNTLPGVPIFSSL  612
            SS+Y+SGN +IVDAG TLPG+PIFSSL
Sbjct  122  SSQYVSGNVFIVDAGATLPGLPIFSSL  148



>gb|ABE65821.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
thaliana]
Length=135

 Score =   169 bits (428),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +1

Query  265  LNRGQLPGGLAYTTSKTAVNALTRVMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLN  444
            L+RGQ+PGG+AY  SK  V+ +TR+MALELG  KIRVNSI+PGL KSEIT GLMQK+WL 
Sbjct  20   LHRGQVPGGVAYACSKGGVDTMTRMMALELGVYKIRVNSIAPGLLKSEITQGLMQKEWLK  79

Query  445  KVALRTVPLRTFGTSNPALTSLVRYLIHDSSEYISGNTYIVDAGNTLPGVPIFSSL  612
             V  RTVPL+   T +P LTSL+RYL+HDSS+YISGNTYIVDAG +L G+PIFSSL
Sbjct  80   TVIERTVPLKVQQTVDPGLTSLLRYLVHDSSKYISGNTYIVDAGASLVGLPIFSSL  135



>dbj|BAE99083.1| putative reductase [Arabidopsis thaliana]
Length=136

 Score =   165 bits (418),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +1

Query  265  LNRGQLPGGLAYTTSKTAVNALTRVMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLN  444
            L+RG L GGLAY  SK  V+ +TR+MA+EL   KIRVNSI+PG+F+SEIT GL QK+WL 
Sbjct  19   LHRGLLRGGLAYACSKGGVDTMTRMMAIELAVYKIRVNSIAPGIFRSEITQGLFQKEWLK  78

Query  445  KVALRTVPLRTFGTSNPALTSLVRYLIHDSSEYISGNTYIVDAGNTLPGVPIFSSL  612
            KV  + VPL+   T +P LTSLVRYLIHDSS+Y++GNTYIVD+G TLPGVPIFSSL
Sbjct  79   KVTEKVVPLKMQQTVDPGLTSLVRYLIHDSSQYVTGNTYIVDSGTTLPGVPIFSSL  134



>ref|NP_001185300.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE34093.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=215

 Score =   155 bits (391),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS++   I  AV+ AW+ FG+ID LINNAG+RG V + LDL+EEEW+ + +TNLTG+
Sbjct  79   ELDVSSEADTIRKAVKEAWETFGKIDVLINNAGIRGNVKSSLDLSEEEWDKVFRTNLTGS  138

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WL+SKYVCL M +A+ GGS++++SSISGL+RG L GGLAY  SK  V+ +TR+MA+EL  
Sbjct  139  WLISKYVCLLMRDAERGGSVINVSSISGLHRGLLRGGLAYACSKGGVDTMTRMMAIELAV  198

Query  361  NKIRVNSISPGLFK  402
             KIRVNSI+PG+F+
Sbjct  199  YKIRVNSIAPGIFR  212



>ref|XP_010265876.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Nelumbo nucifera]
Length=91

 Score =   149 bits (376),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  340  MALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRY  519
            MA+E+G  KIRVN+I+PG+FKSEIT+ LM+K+W+N V  +TVPL TFGTS+PALTSLVRY
Sbjct  1    MAVEMGPYKIRVNAIAPGIFKSEITEKLMEKEWINNVMKKTVPLGTFGTSDPALTSLVRY  60

Query  520  LIHDSSEYISGNTYIVDAGNTLPGVPIFSSL  612
            LIHDSSEY+SGN +IVDAG TLPGVPIFSSL
Sbjct  61   LIHDSSEYVSGNVFIVDAGATLPGVPIFSSL  91



>ref|XP_006430532.1| hypothetical protein CICLE_v10012408mg [Citrus clementina]
 gb|ESR43772.1| hypothetical protein CICLE_v10012408mg [Citrus clementina]
Length=204

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV AD   IE +VQ+AW+AFGR+DAL+NNAG+RG V +PL+++EEEWN + KTNLTG 
Sbjct  79   ELDVCADAATIEISVQKAWEAFGRVDALVNNAGIRGSVKSPLEMSEEEWNRVMKTNLTGC  138

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALEL  354
            WLV+KYVC+RM +AK GGS+++ISS  GLNRG LPGG+AY +SK  +NA+T+V++L  
Sbjct  139  WLVAKYVCIRMRDAKQGGSVINISSTGGLNRGHLPGGVAYASSKAGLNAMTKVISLSF  196



>emb|CDY02920.1| BnaC04g25660D [Brassica napus]
Length=237

 Score =   151 bits (381),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/205 (44%), Positives = 120/205 (59%), Gaps = 45/205 (22%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+D   I+ AV++AWD FG+ID LINNAG+R  V T LDL+E+EW+ + +TNLTG 
Sbjct  77   ELDVSSDAATIQKAVKQAWDIFGKIDVLINNAGIRSNVKTCLDLSEDEWDRVFRTNLTGA  136

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC  M +AK                    GG     S  ++             
Sbjct  137  WLVSKYVCSLMRDAK-------------------RGGSVINRSLVSI-------------  164

Query  361  NKIR-VNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSS  537
             +IR V+  SP L+ +          W +++ L T+PL+   T +  +TSLVRYLIHDSS
Sbjct  165  -QIRLVHRRSPPLYVTH---------W-SRICL-TIPLKVQQTVDLGITSLVRYLIHDSS  212

Query  538  EYISGNTYIVDAGNTLPGVPIFSSL  612
             Y+SGN YI+D+G T+PG+PI SSL
Sbjct  213  RYVSGNIYILDSGATIPGLPIISSL  237



>gb|KJB54602.1| hypothetical protein B456_009G041000 [Gossypium raimondii]
Length=230

 Score =   149 bits (377),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV ADG  I+++V+ AWDAFGRIDALINNAGVRG V  PL+LTEEEWN   +TNLTG+
Sbjct  80   ELDVCADGSTIQSSVKAAWDAFGRIDALINNAGVRGNVKDPLELTEEEWNQNIRTNLTGS  139

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMAL  348
            WLVSKYVC+ M +AK GGS+++ISSI+GLNRGQLPGGLAY +SK  +N +T+V+ L
Sbjct  140  WLVSKYVCMLMRDAKQGGSVINISSIAGLNRGQLPGGLAYASSKAGLNTMTKVIIL  195



>ref|XP_006430533.1| hypothetical protein CICLE_v10012432mg [Citrus clementina]
 gb|ESR43773.1| hypothetical protein CICLE_v10012432mg [Citrus clementina]
Length=200

 Score =   147 bits (372),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV ADG AIE++VQ+AW+AF RID LINNAGVRG V +PLD TEEEW+   KTNLTG+
Sbjct  73   ELDVCADGAAIESSVQKAWEAFWRIDVLINNAGVRGSVKSPLDWTEEEWDHNIKTNLTGS  132

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMAL  348
            WLVSKYVC+RM +A  GGSI++ISSI+G+NRGQLPGG+AY +SK  +N++T+V+ +
Sbjct  133  WLVSKYVCIRMRDANLGGSIINISSIAGINRGQLPGGVAYASSKAGLNSMTKVIII  188



>ref|XP_006302904.1| hypothetical protein CARUB_v10021033mg, partial [Capsella rubella]
 gb|EOA35802.1| hypothetical protein CARUB_v10021033mg, partial [Capsella rubella]
Length=175

 Score =   140 bits (352),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDVS+DG  I+ AV+ AW+ FG ID LINNAG+RG V + LD +EEEW+ + +TNLTG+
Sbjct  56   ELDVSSDGDTIQRAVKEAWEIFGNIDVLINNAGIRGNVKSSLDWSEEEWDKVFRTNLTGS  115

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSKYVC+ M +AK GGS+++ISSISGL+RG LPGGLAY  SK  V+ +TR+MA+ELG 
Sbjct  116  WLVSKYVCVLMRDAKRGGSVINISSISGLHRGLLPGGLAYACSKGGVDTITRMMAIELGV  175



>emb|CBI32790.3| unnamed protein product [Vitis vinifera]
Length=144

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  265  LNRGQLPGGLAYTTSKTAVNALTRVMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLN  444
            LNRGQLPGG+AY +SK+ ++A+T+VMALELG   IR N+I+PGLFKSEIT GLMQKDWLN
Sbjct  19   LNRGQLPGGVAYVSSKSGLSAMTKVMALELGAYNIRANAIAPGLFKSEITSGLMQKDWLN  78

Query  445  KVALRTVPLRTFGTSNPALTSLVR  516
             VA RT P+RTFGTS+PALTSLV+
Sbjct  79   TVAQRTCPMRTFGTSDPALTSLVQ  102



>ref|XP_006374241.1| hypothetical protein POPTR_0015s05345g [Populus trichocarpa]
 gb|ERP52038.1| hypothetical protein POPTR_0015s05345g [Populus trichocarpa]
Length=96

 Score =   131 bits (330),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 76/95 (80%), Gaps = 5/95 (5%)
 Frame = +1

Query  340  MALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRY  519
            MA+E G  KIRVNSIS  L KSEI  GLMQKDWL+ VA +TVP RTFGT++PA TSLVRY
Sbjct  1    MAMEKGVYKIRVNSISSRLSKSEIMQGLMQKDWLSNVAQKTVPSRTFGTADPASTSLVRY  60

Query  520  LIHDSSEYISGNTYIV-----DAGNTLPGVPIFSS  609
            LIH+SSEY++GN +IV     DAG TLPGVP+FSS
Sbjct  61   LIHESSEYVTGNNFIVDAIKEDAGATLPGVPLFSS  95



>ref|XP_002308881.1| hypothetical protein POPTR_0006s03530g [Populus trichocarpa]
 gb|EEE92404.1| hypothetical protein POPTR_0006s03530g [Populus trichocarpa]
Length=97

 Score =   117 bits (292),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +1

Query  340  MALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRY  519
            MA+E G  KIRVNSIS GL KSEI  GL+QKDWL+ VA +TVP RTFGT+NPA TSLVRY
Sbjct  1    MAMEKGVYKIRVNSISSGLSKSEIMQGLVQKDWLSIVAQKTVPSRTFGTANPASTSLVRY  60

Query  520  LIHDSSEYISGNTYIVDA  573
            LIH+S EY++GN +IVDA
Sbjct  61   LIHESLEYVTGNNFIVDA  78



>gb|EYU20811.1| hypothetical protein MIMGU_mgv11b022665mg [Erythranthe guttata]
Length=203

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+AD  AIE  V++AWDAFG IDALINNAG RG V + L+L  EEWN + KTNLTG+
Sbjct  77   ELDVTADPTAIEECVRKAWDAFGHIDALINNAGFRGSVKSSLNLPSEEWNQVVKTNLTGS  136

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTR  336
            WLV+K+V  RM  A  GGSI++ISSISGLNR Q+PG +AY++SK  ++ +T+
Sbjct  137  WLVAKFVGKRMRAAARGGSIINISSISGLNRIQVPGAIAYSSSKAGLHLMTK  188



>ref|XP_009599581.1| PREDICTED: glucose and ribitol dehydrogenase homolog isoform 
X1 [Nicotiana tomentosiformis]
Length=180

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 87/125 (70%), Gaps = 1/125 (1%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELD++ADG  I+A VQ AWDAFG IDAL+NNAGVRG V + +D +E+E N    TNL G 
Sbjct  53   ELDITADGATIKAPVQIAWDAFGGIDALVNNAGVRGSVSSSVDFSEDERNHTFNTNLRGA  112

Query  181  WLVSKYVCLRMCNAKF-ggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELG  357
            WLVSKYVC RM +AK  GGS++S SS + LNR   PG LAYT+S  A++ LT+V    L 
Sbjct  113  WLVSKYVCRRMRDAKQGGGSVISTSSAAALNRVVYPGSLAYTSSNMALDMLTKVRTYVLA  172

Query  358  TNKIR  372
            +   R
Sbjct  173  SVSSR  177



>gb|ACJ85419.1| unknown [Medicago truncatula]
Length=204

 Score =   118 bits (295),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELDV+ADG AIE  VQ+AW+AFG IDALINNAGVRG V +PL+LTEEEWN++ KTN+TGT
Sbjct  70   ELDVAADGGAIEKYVQKAWEAFGHIDALINNAGVRGNVSSPLELTEEEWNNVFKTNITGT  129

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLP  285
            WLVSKYVC  M ++K  GSI++ISSI+GL RG + 
Sbjct  130  WLVSKYVCKLMRDSKRKGSIINISSIAGLERGAIA  164



>ref|XP_009599582.1| PREDICTED: carbonyl reductase [NADPH] 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=167

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 83/113 (73%), Gaps = 1/113 (1%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            ELD++ADG  I+A VQ AWDAFG IDAL+NNAGVRG V + +D +E+E N    TNL G 
Sbjct  53   ELDITADGATIKAPVQIAWDAFGGIDALVNNAGVRGSVSSSVDFSEDERNHTFNTNLRGA  112

Query  181  WLVSKYVCLRMCNAKF-ggsivsissisgLNRGQLPGGLAYTTSKTAVNALTR  336
            WLVSKYVC RM +AK  GGS++S SS + LNR   PG LAYT+S  A++ LT+
Sbjct  113  WLVSKYVCRRMRDAKQGGGSVISTSSAAALNRVVYPGSLAYTSSNMALDMLTK  165



>ref|XP_006850023.1| hypothetical protein AMTR_s00022p00188500 [Amborella trichopoda]
 gb|ERN11604.1| hypothetical protein AMTR_s00022p00188500 [Amborella trichopoda]
Length=91

 Score =   112 bits (279),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = +1

Query  340  MALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRY  519
            M + LG   I+VN ++P +FKS IT  L++KDWL+KV  +T PL+T GT++PALTSL+ Y
Sbjct  1    MTIALGKYNIKVNLVAPDIFKSAITSSLLEKDWLDKVVKKTYPLQTLGTTDPALTSLIVY  60

Query  520  LIHDSSEYISGNTYIVDAGNTLPGVPIFSSL  612
            LI D S Y++GN ++VD+G  L GVPI+SSL
Sbjct  61   LIGDDSNYVTGNAFVVDSGGALAGVPIYSSL  91



>ref|XP_006298324.1| hypothetical protein CARUB_v10014388mg [Capsella rubella]
 gb|EOA31222.1| hypothetical protein CARUB_v10014388mg [Capsella rubella]
Length=269

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 109/195 (56%), Gaps = 1/195 (1%)
 Frame = +1

Query  4    LDVSADGP-AIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            LD+ AD   A +AAVQ+AW   G  DA +N+   +G++   L +++ E+  +TK NLT  
Sbjct  66   LDMEADSQDAFDAAVQKAWTCLGNFDAFLNSYTYQGKIQDILQVSQHEFKRITKINLTAP  125

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            W + K V  RM + + GGSIV +++I+   R   PG  AYTT+  A++ L R  A+ LG 
Sbjct  126  WFLLKAVAKRMKDHRSGGSIVFMATIASGERVLYPGADAYTTTSAAIHQLVRASAMSLGK  185

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVN IS GL   +     + +D   K+     PL  +   +  L S V Y I D S 
Sbjct  186  HKIRVNMISRGLHLDDEYPASVGRDRAQKLVKDAAPLGQWLNPDTDLYSTVLYFISDGSR  245

Query  541  YISGNTYIVDAGNTL  585
            +++G T +VD G +L
Sbjct  246  FMTGTTVLVDGGQSL  260



>emb|CAN59906.1| hypothetical protein VITISV_033146 [Vitis vinifera]
Length=132

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 74/144 (51%), Gaps = 46/144 (32%)
 Frame = +1

Query  1    ELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            E DV+AD P I+A+V +AWD FG ID LINN   RG V   L+L EEEW +  KTNL GT
Sbjct  31   EXDVTADDPTIDASVHKAWDGFGXIDVLINNXXFRGTVKNSLELDEEEWGEGMKTNLNGT  90

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            WLVSK+                                              VMA E G 
Sbjct  91   WLVSKH----------------------------------------------VMAXEFGM  104

Query  361  NKIRVNSISPGLFKSEITDGLMQK  432
              +RVN+ISPGLFKSEIT+GL+QK
Sbjct  105  YNVRVNAISPGLFKSEITEGLLQK  128



>ref|XP_010482176.1| PREDICTED: L-xylulose reductase-like [Camelina sativa]
Length=266

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 110/195 (56%), Gaps = 1/195 (1%)
 Frame = +1

Query  4    LDVSADGPAI-EAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            LD+ +D   + +AAVQ+AW   G  DA +N+   +G++   L ++++E+   TK NLT +
Sbjct  63   LDMESDSEQVFDAAVQKAWACSGNFDAFVNSYTYQGKIQDILQVSQDEFKKTTKINLTAS  122

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            W + K V  RM +   GGSIV +++I+   RG  PG  AYTT+  A++ L R  A+ LG 
Sbjct  123  WFLLKAVASRMKDHGSGGSIVFMATIASGQRGLYPGADAYTTTSAAIHQLVRASAISLGK  182

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVN IS GL   +     + +D   K+     PL  +   +  L S V YLI D S 
Sbjct  183  HKIRVNMISRGLHLDDEYPASVGRDRAIKMVKDAAPLGQWLNPSTDLYSTVIYLISDGSR  242

Query  541  YISGNTYIVDAGNTL  585
            +I+G T +VD   +L
Sbjct  243  FITGTTVLVDGAQSL  257



>dbj|BAH19676.1| AT3G01980 [Arabidopsis thaliana]
Length=266

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 109/195 (56%), Gaps = 1/195 (1%)
 Frame = +1

Query  4    LDVSADGP-AIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGT  180
            LD+ +D   A  AAVQ+AW+  G  DA +N+   +G+V   L ++++E++ +TK NLT  
Sbjct  63   LDMESDSEVAFHAAVQKAWELSGHFDAFLNSYTYQGKVQDILQVSQDEFHRITKINLTAP  122

Query  181  WLVSKYVCLRMCNAKFggsivsissisgLNRGQLPGGLAYTTSKTAVNALTRVMALELGT  360
            W + K V  RM +   GGSIV +++I+   R   PG  AY ++  A++ L R  A+ LG 
Sbjct  123  WFLLKAVATRMKDHGSGGSIVFMATIASGERALYPGADAYASTSAAIHQLVRASAMSLGK  182

Query  361  NKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDSSE  540
            +KIRVN IS GL   +     + +D   K+     PL  +   +  L S V YLI D S 
Sbjct  183  HKIRVNMISRGLHLDDEYTASVGRDRAQKLVKDAAPLGQWLNPDTDLYSTVIYLISDGSR  242

Query  541  YISGNTYIVDAGNTL  585
            +++G T +VD   +L
Sbjct  243  FMTGTTVLVDGAQSL  257



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950