BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP010D12 458 bp,:Filtered

Length=431
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011073533.1|  PREDICTED: putative E3 ubiquitin-protein lig...  72.8    4e-12   Sesamum indicum [beniseed]
ref|XP_011073534.1|  PREDICTED: putative E3 ubiquitin-protein lig...  72.4    5e-12   Sesamum indicum [beniseed]
gb|KDP40342.1|  hypothetical protein JCGZ_02340                       71.2    1e-11   Jatropha curcas
ref|XP_011029819.1|  PREDICTED: putative E3 ubiquitin-protein lig...  70.9    2e-11   Populus euphratica
ref|XP_011029820.1|  PREDICTED: putative E3 ubiquitin-protein lig...  70.5    3e-11   Populus euphratica
ref|XP_006379901.1|  hypothetical protein POPTR_0008s16740g           70.5    3e-11   Populus trichocarpa [western balsam poplar]
ref|XP_010262327.1|  PREDICTED: putative E3 ubiquitin-protein lig...  70.1    3e-11   Nelumbo nucifera [Indian lotus]
emb|CDO99242.1|  unnamed protein product                              70.1    4e-11   Coffea canephora [robusta coffee]
ref|XP_009764907.1|  PREDICTED: putative E3 ubiquitin-protein lig...  70.1    4e-11   Nicotiana sylvestris
ref|XP_002311673.1|  zinc finger family protein                       69.7    5e-11   Populus trichocarpa [western balsam poplar]
ref|XP_009764908.1|  PREDICTED: putative E3 ubiquitin-protein lig...  69.7    5e-11   Nicotiana sylvestris
ref|XP_009603580.1|  PREDICTED: putative E3 ubiquitin-protein lig...  69.7    6e-11   Nicotiana tomentosiformis
ref|XP_008438510.1|  PREDICTED: putative E3 ubiquitin-protein lig...  69.3    6e-11   Cucumis melo [Oriental melon]
ref|XP_009603581.1|  PREDICTED: putative E3 ubiquitin-protein lig...  69.3    6e-11   Nicotiana tomentosiformis
ref|XP_011091307.1|  PREDICTED: putative E3 ubiquitin-protein lig...  69.3    6e-11   Sesamum indicum [beniseed]
ref|XP_011091304.1|  PREDICTED: putative E3 ubiquitin-protein lig...  69.3    7e-11   Sesamum indicum [beniseed]
ref|XP_007221793.1|  hypothetical protein PRUPE_ppa004764mg           68.9    8e-11   Prunus persica
ref|XP_010671020.1|  PREDICTED: putative E3 ubiquitin-protein lig...  68.9    9e-11   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010671019.1|  PREDICTED: putative E3 ubiquitin-protein lig...  68.9    9e-11   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_008438514.1|  PREDICTED: putative E3 ubiquitin-protein lig...  68.9    9e-11   Cucumis melo [Oriental melon]
ref|XP_004167338.1|  PREDICTED: putative E3 ubiquitin-protein lig...  68.9    9e-11   
ref|XP_004134060.1|  PREDICTED: putative E3 ubiquitin-protein lig...  68.9    9e-11   
ref|XP_007221794.1|  hypothetical protein PRUPE_ppa004764mg           68.9    1e-10   Prunus persica
ref|XP_008224346.1|  PREDICTED: putative E3 ubiquitin-protein lig...  68.6    1e-10   Prunus mume [ume]
ref|XP_010104756.1|  Putative E3 ubiquitin-protein ligase XBAT35      68.2    1e-10   Morus notabilis
ref|XP_008224345.1|  PREDICTED: putative E3 ubiquitin-protein lig...  68.2    2e-10   Prunus mume [ume]
ref|XP_008382397.1|  PREDICTED: probable E3 ubiquitin-protein lig...  66.2    2e-10   Malus domestica [apple tree]
ref|XP_010650096.1|  PREDICTED: putative E3 ubiquitin-protein lig...  67.8    2e-10   Vitis vinifera
gb|KHN05066.1|  Putative E3 ubiquitin-protein ligase XBAT35           67.8    2e-10   Glycine soja [wild soybean]
ref|XP_011462270.1|  PREDICTED: putative E3 ubiquitin-protein lig...  67.8    2e-10   Fragaria vesca subsp. vesca
ref|XP_011462271.1|  PREDICTED: putative E3 ubiquitin-protein lig...  67.4    3e-10   Fragaria vesca subsp. vesca
emb|CDX85082.1|  BnaC07g08240D                                        67.4    3e-10   Brassica napus [oilseed rape]
ref|XP_006606389.1|  PREDICTED: putative E3 ubiquitin-protein lig...  67.4    3e-10   Glycine max [soybeans]
ref|XP_010650095.1|  PREDICTED: putative E3 ubiquitin-protein lig...  67.4    3e-10   Vitis vinifera
gb|EYU32559.1|  hypothetical protein MIMGU_mgv1a006594mg              67.0    3e-10   Erythranthe guttata [common monkey flower]
ref|XP_007143864.1|  hypothetical protein PHAVU_007G108300g           67.0    4e-10   Phaseolus vulgaris [French bean]
ref|XP_006354541.1|  PREDICTED: putative E3 ubiquitin-protein lig...  67.4    4e-10   
ref|XP_009102638.1|  PREDICTED: putative E3 ubiquitin-protein lig...  67.0    4e-10   Brassica rapa
gb|EYU18316.1|  hypothetical protein MIMGU_mgv1a006609mg              67.0    4e-10   Erythranthe guttata [common monkey flower]
ref|XP_008785241.1|  PREDICTED: probable E3 ubiquitin-protein lig...  67.0    4e-10   Phoenix dactylifera
ref|XP_010326762.1|  PREDICTED: putative E3 ubiquitin-protein lig...  67.0    5e-10   Solanum lycopersicum
ref|XP_010934320.1|  PREDICTED: probable E3 ubiquitin-protein lig...  67.0    5e-10   Elaeis guineensis
ref|XP_010326763.1|  PREDICTED: putative E3 ubiquitin-protein lig...  66.6    5e-10   Solanum lycopersicum
ref|XP_006589266.1|  PREDICTED: putative E3 ubiquitin-protein lig...  66.6    5e-10   Glycine max [soybeans]
gb|KHN30573.1|  Putative E3 ubiquitin-protein ligase XBAT35           66.2    6e-10   Glycine soja [wild soybean]
ref|XP_010512292.1|  PREDICTED: putative E3 ubiquitin-protein lig...  66.2    7e-10   Camelina sativa [gold-of-pleasure]
ref|XP_006299555.1|  hypothetical protein CARUB_v10015729mg           66.2    7e-10   Capsella rubella
ref|XP_008366256.1|  PREDICTED: putative E3 ubiquitin-protein lig...  66.2    7e-10   Malus domestica [apple tree]
ref|XP_009365983.1|  PREDICTED: putative E3 ubiquitin-protein lig...  66.2    8e-10   Pyrus x bretschneideri [bai li]
gb|KJB72373.1|  hypothetical protein B456_011G174600                  66.2    8e-10   Gossypium raimondii
gb|KEH42762.1|  E3 ubiquitin-protein ligase XBAT35, putative          66.2    8e-10   Medicago truncatula
ref|XP_009365984.1|  PREDICTED: putative E3 ubiquitin-protein lig...  66.2    8e-10   Pyrus x bretschneideri [bai li]
gb|KJB72370.1|  hypothetical protein B456_011G174600                  65.9    8e-10   Gossypium raimondii
gb|KJB72372.1|  hypothetical protein B456_011G174600                  65.9    9e-10   Gossypium raimondii
gb|KHG19957.1|  Putative E3 ubiquitin-protein ligase XBAT35 -like...  65.9    9e-10   Gossypium arboreum [tree cotton]
ref|XP_006406051.1|  hypothetical protein EUTSA_v10020731mg           65.9    9e-10   Eutrema salsugineum
ref|XP_010466651.1|  PREDICTED: putative E3 ubiquitin-protein lig...  65.9    1e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010512284.1|  PREDICTED: putative E3 ubiquitin-protein lig...  65.9    1e-09   Camelina sativa [gold-of-pleasure]
gb|KJB72371.1|  hypothetical protein B456_011G174600                  65.9    1e-09   Gossypium raimondii
ref|XP_010466650.1|  PREDICTED: putative E3 ubiquitin-protein lig...  65.5    1e-09   Camelina sativa [gold-of-pleasure]
ref|NP_850628.1|  putative E3 ubiquitin-protein ligase XBAT35         65.5    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883418.1|  zinc finger family protein                       65.5    1e-09   Arabidopsis lyrata subsp. lyrata
ref|NP_566724.1|  putative E3 ubiquitin-protein ligase XBAT35         65.1    2e-09   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65682.1|  unknown                                               65.1    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008802134.1|  PREDICTED: LOW QUALITY PROTEIN: putative E3 ...  65.5    2e-09   
ref|XP_003563184.1|  PREDICTED: probable E3 ubiquitin-protein lig...  65.1    2e-09   Brachypodium distachyon [annual false brome]
ref|XP_009376980.1|  PREDICTED: putative E3 ubiquitin-protein lig...  63.5    2e-09   Pyrus x bretschneideri [bai li]
ref|XP_006420248.1|  hypothetical protein CICLE_v10004847mg           64.7    2e-09   Citrus clementina
ref|XP_008460647.1|  PREDICTED: putative E3 ubiquitin-protein lig...  64.7    2e-09   Cucumis melo [Oriental melon]
ref|XP_006489718.1|  PREDICTED: putative E3 ubiquitin-protein lig...  64.7    2e-09   Citrus sinensis [Valencia orange]
ref|XP_006420249.1|  hypothetical protein CICLE_v10004847mg           64.7    2e-09   Citrus clementina
ref|XP_006489720.1|  PREDICTED: putative E3 ubiquitin-protein lig...  64.7    2e-09   Citrus sinensis [Valencia orange]
gb|EMT20370.1|  Ankyrin-2                                             64.7    2e-09   Aegilops tauschii
ref|XP_009102639.1|  PREDICTED: putative E3 ubiquitin-protein lig...  64.3    3e-09   Brassica rapa
gb|KFK39617.1|  hypothetical protein AALP_AA3G267100                  64.3    3e-09   Arabis alpina [alpine rockcress]
gb|KDO57575.1|  hypothetical protein CISIN_1g040660mg                 64.3    3e-09   Citrus sinensis [Valencia orange]
ref|XP_006489719.1|  PREDICTED: putative E3 ubiquitin-protein lig...  64.3    3e-09   Citrus sinensis [Valencia orange]
dbj|BAC79950.1|  auxin-regulated protein-like protein                 62.8    3e-09   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA95741.1|  unnamed protein product                              64.3    3e-09   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ95071.1|  predicted protein                                    63.9    4e-09   Hordeum vulgare subsp. vulgare [barley]
ref|XP_006378331.1|  zinc finger family protein                       63.9    4e-09   Populus trichocarpa [western balsam poplar]
gb|KFK39616.1|  hypothetical protein AALP_AA3G267100                  63.9    4e-09   Arabis alpina [alpine rockcress]
ref|XP_011030497.1|  PREDICTED: putative E3 ubiquitin-protein lig...  64.3    4e-09   Populus euphratica
ref|NP_001059535.1|  Os07g0446100                                     63.9    4e-09   
gb|EAZ03703.1|  hypothetical protein OsI_25836                        63.9    4e-09   Oryza sativa Indica Group [Indian rice]
gb|EPS57172.1|  hypothetical protein M569_17649                       63.2    4e-09   Genlisea aurea
gb|EAZ39648.1|  hypothetical protein OsJ_24077                        63.9    5e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007035133.1|  XB3 in, putative isoform 2                       63.9    5e-09   Theobroma cacao [chocolate]
gb|EMS60044.1|  putative E3 ubiquitin-protein ligase XBOS34           63.9    5e-09   Triticum urartu
ref|XP_010246787.1|  PREDICTED: putative E3 ubiquitin-protein lig...  63.5    6e-09   Nelumbo nucifera [Indian lotus]
ref|XP_010246785.1|  PREDICTED: putative E3 ubiquitin-protein lig...  63.5    6e-09   Nelumbo nucifera [Indian lotus]
ref|XP_007035132.1|  XB3 in, putative isoform 1                       63.5    6e-09   Theobroma cacao [chocolate]
ref|XP_009400812.1|  PREDICTED: probable E3 ubiquitin-protein lig...  63.5    6e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010246788.1|  PREDICTED: putative E3 ubiquitin-protein lig...  63.5    6e-09   Nelumbo nucifera [Indian lotus]
ref|XP_009396978.1|  PREDICTED: probable E3 ubiquitin-protein lig...  63.5    6e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010527401.1|  PREDICTED: putative E3 ubiquitin-protein lig...  63.2    7e-09   Tarenaya hassleriana [spider flower]
ref|XP_006378333.1|  zinc finger family protein                       63.2    8e-09   Populus trichocarpa [western balsam poplar]
ref|XP_006857296.1|  hypothetical protein AMTR_s00067p00047970        63.2    9e-09   Amborella trichopoda
gb|KJB72369.1|  hypothetical protein B456_011G174600                  62.8    9e-09   Gossypium raimondii
gb|KEH42761.1|  E3 ubiquitin-protein ligase XBAT35, putative          62.4    1e-08   Medicago truncatula
ref|XP_006387061.1|  hypothetical protein POPTR_2017s00200g           60.5    1e-08   Populus trichocarpa [western balsam poplar]
ref|XP_004147147.1|  PREDICTED: putative E3 ubiquitin-protein lig...  62.4    2e-08   Cucumis sativus [cucumbers]
ref|XP_010906818.1|  PREDICTED: putative E3 ubiquitin-protein lig...  62.4    2e-08   Elaeis guineensis
ref|XP_004160586.1|  PREDICTED: putative E3 ubiquitin-protein lig...  62.0    2e-08   
ref|XP_002461915.1|  hypothetical protein SORBIDRAFT_02g010610        62.0    2e-08   Sorghum bicolor [broomcorn]
ref|XP_006657658.1|  PREDICTED: probable E3 ubiquitin-protein lig...  62.0    2e-08   Oryza brachyantha
ref|XP_009766203.1|  PREDICTED: AMSH-like ubiquitin thioesterase 3    60.1    3e-08   Nicotiana sylvestris
ref|XP_004956090.1|  PREDICTED: probable E3 ubiquitin-protein lig...  61.6    3e-08   Setaria italica
ref|NP_001130389.1|  uncharacterized LOC100191485                     61.2    3e-08   Zea mays [maize]
ref|XP_004495377.1|  PREDICTED: probable methyltransferase PMT1-like  61.6    5e-08   
ref|XP_004956089.1|  PREDICTED: probable E3 ubiquitin-protein lig...  61.2    5e-08   
emb|CDY35522.1|  BnaA01g23900D                                        61.2    5e-08   Brassica napus [oilseed rape]
ref|XP_006378332.1|  hypothetical protein POPTR_0010s08160g           60.5    5e-08   Populus trichocarpa [western balsam poplar]
tpg|DAA60446.1|  TPA: putative RING zinc finger and ankyrin repea...  60.1    5e-08   Zea mays [maize]
ref|XP_001763413.1|  predicted protein                                60.1    8e-08   Physcomitrella patens
ref|XP_010023926.1|  PREDICTED: putative E3 ubiquitin-protein lig...  60.1    9e-08   Eucalyptus grandis [rose gum]
ref|XP_010023930.1|  PREDICTED: putative E3 ubiquitin-protein lig...  60.1    9e-08   Eucalyptus grandis [rose gum]
ref|XP_002967634.1|  hypothetical protein SELMODRAFT_88643            59.7    1e-07   Selaginella moellendorffii
ref|XP_001771059.1|  predicted protein                                59.3    1e-07   Physcomitrella patens
ref|XP_010679337.1|  PREDICTED: putative E3 ubiquitin-protein lig...  59.3    1e-07   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_002964399.1|  hypothetical protein SELMODRAFT_81884            59.3    2e-07   Selaginella moellendorffii
ref|XP_002274072.1|  PREDICTED: putative E3 ubiquitin-protein lig...  59.3    2e-07   Vitis vinifera
emb|CDY08997.1|  BnaC01g30940D                                        58.5    2e-07   Brassica napus [oilseed rape]
gb|KDO60480.1|  hypothetical protein CISIN_1g010439mg                 58.2    4e-07   Citrus sinensis [Valencia orange]
gb|KHG28017.1|  putative E3 ubiquitin-protein ligase XBOS34           57.8    5e-07   Gossypium arboreum [tree cotton]
gb|KDO60479.1|  hypothetical protein CISIN_1g010439mg                 57.8    5e-07   Citrus sinensis [Valencia orange]
ref|XP_006443829.1|  hypothetical protein CICLE_v10024413mg           57.8    5e-07   Citrus clementina
gb|KDO60477.1|  hypothetical protein CISIN_1g010439mg                 57.8    5e-07   Citrus sinensis [Valencia orange]
gb|KDP26523.1|  hypothetical protein JCGZ_17681                       57.4    6e-07   Jatropha curcas
ref|XP_007050280.1|  XB3 in, putative isoform 1                       57.4    7e-07   Theobroma cacao [chocolate]
ref|XP_001775781.1|  predicted protein                                57.0    7e-07   Physcomitrella patens
ref|XP_009603578.1|  PREDICTED: AMSH-like ubiquitin thioesterase 3    56.2    8e-07   Nicotiana tomentosiformis
ref|XP_002533469.1|  S-adenosylmethionine-dependent methyltransfe...  57.0    1e-06   
ref|XP_010440478.1|  PREDICTED: putative E3 ubiquitin-protein lig...  56.2    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_011030496.1|  PREDICTED: putative E3 ubiquitin-protein lig...  56.2    2e-06   Populus euphratica
gb|KDO60478.1|  hypothetical protein CISIN_1g010439mg                 56.2    2e-06   Citrus sinensis [Valencia orange]
gb|ABG37641.1|  auxin-regulated protein-like protein                  55.5    3e-06   Populus trichocarpa [western balsam poplar]
gb|KFK21923.1|  hypothetical protein AALP_AAs63887U000300             55.1    3e-06   Arabis alpina [alpine rockcress]
ref|XP_006365899.1|  PREDICTED: putative E3 ubiquitin-protein lig...  55.5    3e-06   Solanum tuberosum [potatoes]
ref|XP_002868287.1|  hypothetical protein ARALYDRAFT_493466           55.1    3e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_002963644.1|  hypothetical protein SELMODRAFT_141633           55.1    3e-06   Selaginella moellendorffii
ref|XP_002974733.1|  hypothetical protein SELMODRAFT_102072           55.1    3e-06   Selaginella moellendorffii
ref|XP_007050281.1|  XB3 in, putative isoform 2                       55.1    4e-06   Theobroma cacao [chocolate]
ref|XP_010450049.1|  PREDICTED: putative E3 ubiquitin-protein lig...  54.7    5e-06   Camelina sativa [gold-of-pleasure]
gb|KJB42275.1|  hypothetical protein B456_007G146700                  55.1    5e-06   Gossypium raimondii
ref|XP_002532035.1|  conserved hypothetical protein                   53.5    5e-06   
ref|XP_009125093.1|  PREDICTED: putative E3 ubiquitin-protein lig...  54.3    6e-06   Brassica rapa
emb|CDX67415.1|  BnaA07g14550D                                        54.3    7e-06   Brassica napus [oilseed rape]
ref|XP_011004046.1|  PREDICTED: putative E3 ubiquitin-protein lig...  54.3    7e-06   Populus euphratica
ref|NP_567428.1|  putative E3 ubiquitin-protein ligase XBAT34         53.9    9e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002306855.1|  hypothetical protein POPTR_0005s24690g           52.8    1e-05   Populus trichocarpa [western balsam poplar]
ref|XP_010435136.1|  PREDICTED: putative E3 ubiquitin-protein lig...  53.5    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_002324376.2|  hypothetical protein POPTR_0018s03330g           52.8    1e-05   Populus trichocarpa [western balsam poplar]
emb|CDY08992.1|  BnaC01g30990D                                        53.1    1e-05   Brassica napus [oilseed rape]
gb|AAM65242.1|  unknown                                               52.8    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009789557.1|  PREDICTED: putative E3 ubiquitin-protein lig...  52.8    2e-05   Nicotiana sylvestris
ref|XP_009628304.1|  PREDICTED: putative E3 ubiquitin-protein lig...  52.8    3e-05   Nicotiana tomentosiformis
emb|CDY62836.1|  BnaC05g50910D                                        52.4    3e-05   Brassica napus [oilseed rape]
ref|XP_010086625.1|  putative E3 ubiquitin-protein ligase XBOS34      52.4    3e-05   Morus notabilis
emb|CAB10215.1|  ankyrin like protein                                 52.8    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283994.1|  hypothetical protein CARUB_v10005117mg           52.0    3e-05   Capsella rubella
ref|XP_006283992.1|  hypothetical protein CARUB_v10005117mg           52.0    3e-05   Capsella rubella
ref|XP_009628305.1|  PREDICTED: putative E3 ubiquitin-protein lig...  52.4    3e-05   Nicotiana tomentosiformis
ref|XP_006283993.1|  hypothetical protein CARUB_v10005117mg           52.0    3e-05   Capsella rubella
ref|XP_009789556.1|  PREDICTED: putative E3 ubiquitin-protein lig...  52.4    3e-05   Nicotiana sylvestris
ref|XP_009789559.1|  PREDICTED: putative E3 ubiquitin-protein lig...  52.4    3e-05   Nicotiana sylvestris
emb|CDY49072.1|  BnaC06g12460D                                        52.0    4e-05   Brassica napus [oilseed rape]
ref|XP_010440475.1|  PREDICTED: putative E3 ubiquitin-protein lig...  51.2    6e-05   Camelina sativa [gold-of-pleasure]
gb|AEJ88251.1|  putative zinc finger family protein                   47.4    1e-04   Wolffia australiana
ref|XP_010440479.1|  PREDICTED: putative E3 ubiquitin-protein lig...  50.4    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010451527.1|  PREDICTED: vesicle-associated protein 2-1-like   48.5    3e-04   Camelina sativa [gold-of-pleasure]
ref|XP_006414726.1|  hypothetical protein EUTSA_v10025615mg           48.9    3e-04   Eutrema salsugineum
ref|XP_010440476.1|  PREDICTED: putative E3 ubiquitin-protein lig...  48.9    4e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010440477.1|  PREDICTED: putative E3 ubiquitin-protein lig...  48.5    4e-04   Camelina sativa [gold-of-pleasure]
ref|XP_004240501.1|  PREDICTED: putative E3 ubiquitin-protein lig...  47.8    9e-04   Solanum lycopersicum



>ref|XP_011073533.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT34 isoform 
X1 [Sesamum indicum]
Length=481

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIKAKKWGCPVCRAKIDQV+ +YAV
Sbjct  448  MAGCMSCLNEIKAKKWGCPVCRAKIDQVVRIYAV  481



>ref|XP_011073534.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT34 isoform 
X2 [Sesamum indicum]
Length=476

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIKAKKWGCPVCRAKIDQV+ +YAV
Sbjct  443  MAGCMSCLNEIKAKKWGCPVCRAKIDQVVRIYAV  476



>gb|KDP40342.1| hypothetical protein JCGZ_02340 [Jatropha curcas]
Length=492

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL E+KAKKWGCPVCRAKIDQ+I +YAV
Sbjct  459  MAGCMSCLKEVKAKKWGCPVCRAKIDQIIRLYAV  492



>ref|XP_011029819.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X1 [Populus euphratica]
Length=493

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIKAKKWGCPVCRAKIDQV+ +YAV
Sbjct  460  MAGCMSCLKEIKAKKWGCPVCRAKIDQVVRLYAV  493



>ref|XP_011029820.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X2 [Populus euphratica]
Length=475

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIKAKKWGCPVCRAKIDQV+ +YAV
Sbjct  442  MAGCMSCLKEIKAKKWGCPVCRAKIDQVVRLYAV  475



>ref|XP_006379901.1| hypothetical protein POPTR_0008s16740g [Populus trichocarpa]
 gb|ERP57698.1| hypothetical protein POPTR_0008s16740g [Populus trichocarpa]
Length=475

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIKAKKWGCPVCRAKIDQV+ +YAV
Sbjct  442  MAGCMSCLKEIKAKKWGCPVCRAKIDQVVRLYAV  475



>ref|XP_010262327.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT34 [Nelumbo 
nucifera]
Length=484

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIKAKKWGCPVCRAKIDQVI +YAV
Sbjct  450  MAGCMSCLNEIKAKKWGCPVCRAKIDQVIRLYAV  483



>emb|CDO99242.1| unnamed protein product [Coffea canephora]
Length=491

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL+EIKAKKWGCPVCRAKIDQV+ +YAV
Sbjct  458  MAGCMSCLSEIKAKKWGCPVCRAKIDQVVRLYAV  491



>ref|XP_009764907.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X1 [Nicotiana sylvestris]
Length=502

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIK KKWGCPVCRAKIDQVI +YAV
Sbjct  469  MAGCMSCLNEIKGKKWGCPVCRAKIDQVIRLYAV  502



>ref|XP_002311673.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE89040.1| zinc finger family protein [Populus trichocarpa]
Length=442

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIKAKKWGCPVCRAKIDQV+ +YAV
Sbjct  409  MAGCMSCLKEIKAKKWGCPVCRAKIDQVVRLYAV  442



>ref|XP_009764908.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X2 [Nicotiana sylvestris]
Length=477

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIK KKWGCPVCRAKIDQVI +YAV
Sbjct  444  MAGCMSCLNEIKGKKWGCPVCRAKIDQVIRLYAV  477



>ref|XP_009603580.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X1 [Nicotiana tomentosiformis]
Length=502

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIK KKWGCPVCRAKIDQVI +YAV
Sbjct  469  MAGCMSCLNEIKGKKWGCPVCRAKIDQVIRLYAV  502



>ref|XP_008438510.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X1 [Cucumis melo]
 ref|XP_008438511.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X1 [Cucumis melo]
 ref|XP_008438512.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X1 [Cucumis melo]
 ref|XP_008438513.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X1 [Cucumis melo]
Length=476

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCM+CL EIK+KKWGCPVCRAKIDQV+ +YAV
Sbjct  443  MAGCMNCLTEIKSKKWGCPVCRAKIDQVVRLYAV  476



>ref|XP_009603581.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT34 isoform 
X2 [Nicotiana tomentosiformis]
Length=477

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIK KKWGCPVCRAKIDQVI +YAV
Sbjct  444  MAGCMSCLNEIKGKKWGCPVCRAKIDQVIRLYAV  477



>ref|XP_011091307.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X2 [Sesamum indicum]
Length=452

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIKAKKWGCPVCR KIDQV+ +YAV
Sbjct  419  MAGCMSCLKEIKAKKWGCPVCRTKIDQVVRIYAV  452



>ref|XP_011091304.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X1 [Sesamum indicum]
 ref|XP_011091305.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X1 [Sesamum indicum]
 ref|XP_011091306.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X1 [Sesamum indicum]
Length=470

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIKAKKWGCPVCR KIDQV+ +YAV
Sbjct  437  MAGCMSCLKEIKAKKWGCPVCRTKIDQVVRIYAV  470



>ref|XP_007221793.1| hypothetical protein PRUPE_ppa004764mg [Prunus persica]
 gb|EMJ22992.1| hypothetical protein PRUPE_ppa004764mg [Prunus persica]
Length=467

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIKAKKWGCPVCRAKIDQ++ +Y+V
Sbjct  434  MAGCMSCLGEIKAKKWGCPVCRAKIDQIVKLYSV  467



>ref|XP_010671020.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=472

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIKAKKWGCPVCR  IDQVI VYAV
Sbjct  439  MAGCMSCLNEIKAKKWGCPVCRTNIDQVIKVYAV  472



>ref|XP_010671019.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=488

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIKAKKWGCPVCR  IDQVI VYAV
Sbjct  455  MAGCMSCLNEIKAKKWGCPVCRTNIDQVIKVYAV  488



>ref|XP_008438514.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X2 [Cucumis melo]
Length=459

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCM+CL EIK+KKWGCPVCRAKIDQV+ +YAV
Sbjct  426  MAGCMNCLTEIKSKKWGCPVCRAKIDQVVRLYAV  459



>ref|XP_004167338.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35-like [Cucumis 
sativus]
Length=459

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCM+CL EIK+KKWGCPVCRAKIDQV+ +YAV
Sbjct  426  MAGCMNCLTEIKSKKWGCPVCRAKIDQVVRLYAV  459



>ref|XP_004134060.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35-like [Cucumis 
sativus]
 gb|KGN56851.1| hypothetical protein Csa_3G134990 [Cucumis sativus]
Length=459

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCM+CL EIK+KKWGCPVCRAKIDQV+ +YAV
Sbjct  426  MAGCMNCLTEIKSKKWGCPVCRAKIDQVVRLYAV  459



>ref|XP_007221794.1| hypothetical protein PRUPE_ppa004764mg [Prunus persica]
 gb|EMJ22993.1| hypothetical protein PRUPE_ppa004764mg [Prunus persica]
Length=492

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIKAKKWGCPVCRAKIDQ++ +Y+V
Sbjct  459  MAGCMSCLGEIKAKKWGCPVCRAKIDQIVKLYSV  492



>ref|XP_008224346.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X2 [Prunus mume]
Length=463

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIKAKKWGCPVCR KIDQ++ +YAV
Sbjct  430  MAGCMSCLGEIKAKKWGCPVCRGKIDQIVRLYAV  463



>ref|XP_010104756.1| Putative E3 ubiquitin-protein ligase XBAT35 [Morus notabilis]
 gb|EXC01806.1| Putative E3 ubiquitin-protein ligase XBAT35 [Morus notabilis]
Length=463

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIKAKKWGCPVCRA+I+QV+ +YAV
Sbjct  430  MAGCMSCLNEIKAKKWGCPVCRAQINQVVRLYAV  463



>ref|XP_008224345.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X1 [Prunus mume]
Length=488

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIKAKKWGCPVCR KIDQ++ +YAV
Sbjct  455  MAGCMSCLGEIKAKKWGCPVCRGKIDQIVRLYAV  488



>ref|XP_008382397.1| PREDICTED: probable E3 ubiquitin-protein ligase XBOS34 [Malus 
domestica]
Length=268

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIK KKWGCPVCRAKIDQVI +YAV
Sbjct  235  MAGCMSCLKEIKGKKWGCPVCRAKIDQVIRLYAV  268



>ref|XP_010650096.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X2 [Vitis vinifera]
Length=476

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIKAKKWGCPVCRAKIDQV+ +Y+V
Sbjct  443  MAGCMSCLNEIKAKKWGCPVCRAKIDQVVKLYSV  476



>gb|KHN05066.1| Putative E3 ubiquitin-protein ligase XBAT35 [Glycine soja]
Length=457

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL E+K+KKWGCPVCRAKIDQVI +Y V
Sbjct  424  VAGCMSCLNEVKSKKWGCPVCRAKIDQVIKLYHV  457



>ref|XP_011462270.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT34 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=514

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIK KKWGCPVCRAKI+Q++ +YAV
Sbjct  481  MAGCMSCLTEIKGKKWGCPVCRAKIEQIVRLYAV  514



>ref|XP_011462271.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT34 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=499

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIK KKWGCPVCRAKI+Q++ +YAV
Sbjct  466  MAGCMSCLTEIKGKKWGCPVCRAKIEQIVRLYAV  499



>emb|CDX85082.1| BnaC07g08240D [Brassica napus]
Length=512

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL EIKAKKWGCPVCRAKIDQ+I +Y V
Sbjct  479  VAGCMSCLTEIKAKKWGCPVCRAKIDQIIKLYRV  512



>ref|XP_006606389.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35-like [Glycine 
max]
Length=457

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL E+K+KKWGCPVCRAKIDQVI +Y V
Sbjct  424  VAGCMSCLNEVKSKKWGCPVCRAKIDQVIKLYHV  457



>ref|XP_010650095.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X1 [Vitis vinifera]
 emb|CAN72662.1| hypothetical protein VITISV_013890 [Vitis vinifera]
Length=500

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIKAKKWGCPVCRAKIDQV+ +Y+V
Sbjct  467  MAGCMSCLNEIKAKKWGCPVCRAKIDQVVKLYSV  500



>gb|EYU32559.1| hypothetical protein MIMGU_mgv1a006594mg [Erythranthe guttata]
Length=437

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCM+CL EIKAKKWGCP+CRAKIDQVI +Y+V
Sbjct  404  LAGCMTCLNEIKAKKWGCPLCRAKIDQVIRIYSV  437



>ref|XP_007143864.1| hypothetical protein PHAVU_007G108300g [Phaseolus vulgaris]
 gb|ESW15858.1| hypothetical protein PHAVU_007G108300g [Phaseolus vulgaris]
Length=459

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL E+K+KKWGCPVCRAKIDQ+I +Y V
Sbjct  426  VAGCMSCLNEVKSKKWGCPVCRAKIDQIIKLYHV  459



>ref|XP_006354541.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35-like [Solanum 
tuberosum]
Length=522

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIK KKWGCPVCRA IDQVI +YAV
Sbjct  489  MAGCMSCLNEIKGKKWGCPVCRATIDQVIRLYAV  522



>ref|XP_009102638.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X1 [Brassica rapa]
Length=448

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL EIKAKKWGCPVCRAKIDQ+I +Y V
Sbjct  415  VAGCMSCLTEIKAKKWGCPVCRAKIDQIIKLYRV  448



>gb|EYU18316.1| hypothetical protein MIMGU_mgv1a006609mg [Erythranthe guttata]
Length=437

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL EIK+KKWGCPVCRA+IDQVI +YAV
Sbjct  404  LAGCMSCLNEIKSKKWGCPVCRAEIDQVIRIYAV  437



>ref|XP_008785241.1| PREDICTED: probable E3 ubiquitin-protein ligase XBOS34 [Phoenix 
dactylifera]
Length=520

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCM CL EIK K WGCPVCRAKIDQVI +YAV
Sbjct  487  MAGCMPCLKEIKTKNWGCPVCRAKIDQVIKLYAV  520



>ref|XP_010326762.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X1 [Solanum lycopersicum]
Length=501

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIK KKWGCPVCRA IDQVI +YAV
Sbjct  468  MAGCMSCLNEIKGKKWGCPVCRATIDQVIRLYAV  501



>ref|XP_010934320.1| PREDICTED: probable E3 ubiquitin-protein ligase XBOS34 [Elaeis 
guineensis]
Length=519

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCM+CL EIKAK WGCPVCRA+IDQVI +YAV
Sbjct  486  MAGCMACLKEIKAKNWGCPVCRAQIDQVIKLYAV  519



>ref|XP_010326763.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X2 [Solanum lycopersicum]
Length=476

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIK KKWGCPVCRA IDQVI +YAV
Sbjct  443  MAGCMSCLNEIKGKKWGCPVCRATIDQVIRLYAV  476



>ref|XP_006589266.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35-like [Glycine 
max]
Length=456

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL E+K+KKWGCPVCRAKIDQVI +Y V
Sbjct  423  VAGCMSCLNEVKSKKWGCPVCRAKIDQVIKLYHV  456



>gb|KHN30573.1| Putative E3 ubiquitin-protein ligase XBAT35 [Glycine soja]
Length=456

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL E+K+KKWGCPVCRAKIDQVI +Y V
Sbjct  423  VAGCMSCLNEVKSKKWGCPVCRAKIDQVIKLYHV  456



>ref|XP_010512292.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X2 [Camelina sativa]
Length=440

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL E+K+KKWGCPVCRAKIDQVI +Y V
Sbjct  407  VAGCMSCLNEVKSKKWGCPVCRAKIDQVIKLYRV  440



>ref|XP_006299555.1| hypothetical protein CARUB_v10015729mg [Capsella rubella]
 gb|EOA32453.1| hypothetical protein CARUB_v10015729mg [Capsella rubella]
Length=464

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL EIK+KKWGCPVCRAKIDQVI +Y V
Sbjct  431  VAGCMSCLNEIKSKKWGCPVCRAKIDQVIKLYRV  464



>ref|XP_008366256.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 [Malus 
domestica]
Length=475

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EI  KKWGCPVCRAKIDQVI +YAV
Sbjct  442  MAGCMSCLKEITGKKWGCPVCRAKIDQVIRLYAV  475



>ref|XP_009365983.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X1 [Pyrus x bretschneideri]
Length=508

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIK KKWGCPVCRAKIDQVI +YAV
Sbjct  475  MAGCMSCLKEIKGKKWGCPVCRAKIDQVIRLYAV  508



>gb|KJB72373.1| hypothetical protein B456_011G174600 [Gossypium raimondii]
Length=472

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL EIKAKKWGCPVCRAKI+QVI +Y V
Sbjct  439  VAGCMSCLNEIKAKKWGCPVCRAKIEQVIKLYRV  472



>gb|KEH42762.1| E3 ubiquitin-protein ligase XBAT35, putative [Medicago truncatula]
Length=459

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL E+K KKWGCPVCRAKIDQ+I +Y V
Sbjct  426  VAGCMSCLNEVKTKKWGCPVCRAKIDQIIKLYHV  459



>ref|XP_009365984.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X2 [Pyrus x bretschneideri]
Length=483

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIK KKWGCPVCRAKIDQVI +YAV
Sbjct  450  MAGCMSCLKEIKGKKWGCPVCRAKIDQVIRLYAV  483



>gb|KJB72370.1| hypothetical protein B456_011G174600 [Gossypium raimondii]
Length=461

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL EIKAKKWGCPVCRAKI+QVI +Y V
Sbjct  428  VAGCMSCLNEIKAKKWGCPVCRAKIEQVIKLYRV  461



>gb|KJB72372.1| hypothetical protein B456_011G174600 [Gossypium raimondii]
Length=500

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL EIKAKKWGCPVCRAKI+QVI +Y V
Sbjct  467  VAGCMSCLNEIKAKKWGCPVCRAKIEQVIKLYRV  500



>gb|KHG19957.1| Putative E3 ubiquitin-protein ligase XBAT35 -like protein [Gossypium 
arboreum]
Length=503

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL EIKAKKWGCPVCRAKI+QVI +Y V
Sbjct  470  VAGCMSCLNEIKAKKWGCPVCRAKIEQVIKLYRV  503



>ref|XP_006406051.1| hypothetical protein EUTSA_v10020731mg [Eutrema salsugineum]
 gb|ESQ47504.1| hypothetical protein EUTSA_v10020731mg [Eutrema salsugineum]
Length=445

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL EIK+KKWGCPVCRAKIDQ+I +Y V
Sbjct  412  VAGCMSCLTEIKSKKWGCPVCRAKIDQIIKLYRV  445



>ref|XP_010466651.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X2 [Camelina sativa]
Length=435

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL E+K+KKWGCPVCRAKIDQVI +Y V
Sbjct  402  VAGCMSCLNEVKSKKWGCPVCRAKIDQVIKLYRV  435



>ref|XP_010512284.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X1 [Camelina sativa]
Length=464

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL E+K+KKWGCPVCRAKIDQVI +Y V
Sbjct  431  VAGCMSCLNEVKSKKWGCPVCRAKIDQVIKLYRV  464



>gb|KJB72371.1| hypothetical protein B456_011G174600 [Gossypium raimondii]
Length=489

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL EIKAKKWGCPVCRAKI+QVI +Y V
Sbjct  456  VAGCMSCLNEIKAKKWGCPVCRAKIEQVIKLYRV  489



>ref|XP_010466650.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X1 [Camelina sativa]
Length=459

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL E+K+KKWGCPVCRAKIDQVI +Y V
Sbjct  426  VAGCMSCLNEVKSKKWGCPVCRAKIDQVIKLYRV  459



>ref|NP_850628.1| putative E3 ubiquitin-protein ligase XBAT35 [Arabidopsis thaliana]
 gb|AAK73995.1| AT3g23280/K14B15_17 [Arabidopsis thaliana]
 gb|AAL31143.1| AT3g23280/K14B15_17 [Arabidopsis thaliana]
 gb|AEE76747.1| putative E3 ubiquitin-protein ligase XBAT35 [Arabidopsis thaliana]
Length=438

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL EIK+K WGCPVCRAKIDQVI +Y V
Sbjct  405  VAGCMSCLKEIKSKNWGCPVCRAKIDQVIKLYRV  438



>ref|XP_002883418.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59677.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=462

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL EIK+K WGCPVCRAKIDQVI +Y V
Sbjct  429  VAGCMSCLKEIKSKNWGCPVCRAKIDQVIKLYRV  462



>ref|NP_566724.1| putative E3 ubiquitin-protein ligase XBAT35 [Arabidopsis thaliana]
 sp|Q4FE47.1|XB35_ARATH RecName: Full=Putative E3 ubiquitin-protein ligase XBAT35; AltName: 
Full=Ankyrin repeat domain and RING finger-containing 
protein XBAT35; AltName: Full=Protein XB3 homolog 5 [Arabidopsis 
thaliana]
 gb|AAZ14068.1| At3g23280 [Arabidopsis thaliana]
 gb|AEE76746.1| putative E3 ubiquitin-protein ligase XBAT35 [Arabidopsis thaliana]
Length=462

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL EIK+K WGCPVCRAKIDQVI +Y V
Sbjct  429  VAGCMSCLKEIKSKNWGCPVCRAKIDQVIKLYRV  462



>gb|AAM65682.1| unknown [Arabidopsis thaliana]
Length=462

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL EIK+K WGCPVCRAKIDQVI +Y V
Sbjct  429  VAGCMSCLKEIKSKNWGCPVCRAKIDQVIKLYRV  462



>ref|XP_008802134.1| PREDICTED: LOW QUALITY PROTEIN: putative E3 ubiquitin-protein 
ligase XBAT34 [Phoenix dactylifera]
Length=587

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            M GCM CL EIKAK WGCPVCRA +DQVI +YAV
Sbjct  554  MIGCMPCLKEIKAKNWGCPVCRANVDQVIKLYAV  587



>ref|XP_003563184.1| PREDICTED: probable E3 ubiquitin-protein ligase XBOS34 [Brachypodium 
distachyon]
Length=515

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL +I++KKWGCP+CRAKI+Q+I +YAV
Sbjct  482  MAGCMSCLKDIESKKWGCPICRAKINQIIRLYAV  515



>ref|XP_009376980.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 [Pyrus 
x bretschneideri]
Length=274

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EI  KKWGCPVCRAKIDQVI +Y V
Sbjct  241  MAGCMSCLKEITGKKWGCPVCRAKIDQVIRLYTV  274



>ref|XP_006420248.1| hypothetical protein CICLE_v10004847mg [Citrus clementina]
 gb|ESR33488.1| hypothetical protein CICLE_v10004847mg [Citrus clementina]
Length=487

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL E+KAKKWGCPVCRA I QVI +YAV
Sbjct  454  MAGCMSCLNEVKAKKWGCPVCRANISQVIRLYAV  487



>ref|XP_008460647.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT34 [Cucumis 
melo]
Length=495

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIKAK WGCPVCR KI+QVI +YAV
Sbjct  462  MAGCMSCLNEIKAKNWGCPVCRTKINQVIKLYAV  495



>ref|XP_006489718.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35-like isoform 
X1 [Citrus sinensis]
Length=487

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL E+KAKKWGCPVCRA I QVI +YAV
Sbjct  454  MAGCMSCLNEVKAKKWGCPVCRANISQVIRLYAV  487



>ref|XP_006420249.1| hypothetical protein CICLE_v10004847mg [Citrus clementina]
 gb|ESR33489.1| hypothetical protein CICLE_v10004847mg [Citrus clementina]
Length=470

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL E+KAKKWGCPVCRA I QVI +YAV
Sbjct  437  MAGCMSCLNEVKAKKWGCPVCRANISQVIRLYAV  470



>ref|XP_006489720.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35-like isoform 
X3 [Citrus sinensis]
Length=470

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL E+KAKKWGCPVCRA I QVI +YAV
Sbjct  437  MAGCMSCLNEVKAKKWGCPVCRANISQVIRLYAV  470



>gb|EMT20370.1| Ankyrin-2 [Aegilops tauschii]
Length=494

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL +I++KKWGCP+CRAKI+Q+I +YAV
Sbjct  461  MAGCMSCLKDIESKKWGCPICRAKINQIIRLYAV  494



>ref|XP_009102639.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X2 [Brassica rapa]
Length=424

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL EIKAKKWGCPVCRAKIDQ+I +Y V
Sbjct  391  VAGCMSCLTEIKAKKWGCPVCRAKIDQIIKLYRV  424



>gb|KFK39617.1| hypothetical protein AALP_AA3G267100 [Arabis alpina]
Length=437

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL EIK+K WGCPVCRAKIDQ+I +Y V
Sbjct  404  VAGCMSCLTEIKSKNWGCPVCRAKIDQIIKLYRV  437



>gb|KDO57575.1| hypothetical protein CISIN_1g040660mg [Citrus sinensis]
Length=487

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL E+KAKKWGCPVCRA I QVI +YAV
Sbjct  454  MAGCMSCLNEVKAKKWGCPVCRANISQVIRLYAV  487



>ref|XP_006489719.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35-like isoform 
X2 [Citrus sinensis]
Length=477

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL E+KAKKWGCPVCRA I QVI +YAV
Sbjct  444  MAGCMSCLNEVKAKKWGCPVCRANISQVIRLYAV  477



>dbj|BAC79950.1| auxin-regulated protein-like protein [Oryza sativa Japonica Group]
Length=260

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL +I++KKWGCP+CRAKI+Q+I +YAV
Sbjct  227  MAGCMSCLKDIESKKWGCPICRAKINQIIRLYAV  260



>dbj|BAA95741.1| unnamed protein product [Arabidopsis thaliana]
Length=454

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL EIK+K WGCPVCRAKIDQVI +Y V
Sbjct  421  VAGCMSCLKEIKSKNWGCPVCRAKIDQVIKLYRV  454



>dbj|BAJ95071.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=439

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL +I++KKWGCP+CRAKI+Q+I +YAV
Sbjct  406  MAGCMSCLKDIESKKWGCPICRAKINQIIRLYAV  439



>ref|XP_006378331.1| zinc finger family protein [Populus trichocarpa]
 gb|ERP56128.1| zinc finger family protein [Populus trichocarpa]
Length=444

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            M GCMSCL EIKAKKWGCPVCRA I+QV+ +YAV
Sbjct  411  MVGCMSCLKEIKAKKWGCPVCRATINQVVRLYAV  444



>gb|KFK39616.1| hypothetical protein AALP_AA3G267100 [Arabis alpina]
Length=461

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL EIK+K WGCPVCRAKIDQ+I +Y V
Sbjct  428  VAGCMSCLTEIKSKNWGCPVCRAKIDQIIKLYRV  461



>ref|XP_011030497.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT34 [Populus 
euphratica]
 ref|XP_011030498.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT34 [Populus 
euphratica]
Length=476

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            M GCMSCL EIKAKKWGCPVCRA I+QV+ +YAV
Sbjct  443  MVGCMSCLKEIKAKKWGCPVCRATINQVVRLYAV  476



>ref|NP_001059535.1| Os07g0446100 [Oryza sativa Japonica Group]
 sp|Q7XI08.1|XB34_ORYSJ RecName: Full=Probable E3 ubiquitin-protein ligase XBOS34; AltName: 
Full=Ankyrin repeat domain and RING finger-containing 
protein XBOS34; AltName: Full=XB3 protein homolog 4 [Oryza 
sativa Japonica Group]
 dbj|BAC79949.1| auxin-regulated protein-like protein [Oryza sativa Japonica Group]
 dbj|BAF21449.1| Os07g0446100 [Oryza sativa Japonica Group]
Length=513

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL +I++KKWGCP+CRAKI+Q+I +YAV
Sbjct  480  MAGCMSCLKDIESKKWGCPICRAKINQIIRLYAV  513



>gb|EAZ03703.1| hypothetical protein OsI_25836 [Oryza sativa Indica Group]
Length=493

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL +I++KKWGCP+CRAKI+Q+I +YAV
Sbjct  460  MAGCMSCLKDIESKKWGCPICRAKINQIIRLYAV  493



>gb|EPS57172.1| hypothetical protein M569_17649, partial [Genlisea aurea]
Length=321

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL E++ K WGCPVCRAKIDQVI +Y+V
Sbjct  288  MAGCMSCLNEVRDKNWGCPVCRAKIDQVIRIYSV  321



>gb|EAZ39648.1| hypothetical protein OsJ_24077 [Oryza sativa Japonica Group]
Length=493

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL +I++KKWGCP+CRAKI+Q+I +YAV
Sbjct  460  MAGCMSCLKDIESKKWGCPICRAKINQIIRLYAV  493



>ref|XP_007035133.1| XB3 in, putative isoform 2 [Theobroma cacao]
 gb|EOY06059.1| XB3 in, putative isoform 2 [Theobroma cacao]
Length=483

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL EIKAKKWGCPVCR KI+QVI +Y V
Sbjct  450  VAGCMSCLNEIKAKKWGCPVCRTKIEQVIRLYRV  483



>gb|EMS60044.1| putative E3 ubiquitin-protein ligase XBOS34 [Triticum urartu]
Length=632

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL +I++KKWGCP+CRAKI+Q+I +YAV
Sbjct  599  MAGCMSCLKDIESKKWGCPICRAKINQIIRLYAV  632



>ref|XP_010246787.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT34 isoform 
X2 [Nelumbo nucifera]
Length=496

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIK KKWGCPVCRA I+QV+ +YAV
Sbjct  462  MAGCMSCLNEIKEKKWGCPVCRATIEQVVRLYAV  495



>ref|XP_010246785.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT34 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010246786.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT34 isoform 
X1 [Nelumbo nucifera]
Length=512

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIK KKWGCPVCRA I+QV+ +YAV
Sbjct  478  MAGCMSCLNEIKEKKWGCPVCRATIEQVVRLYAV  511



>ref|XP_007035132.1| XB3 in, putative isoform 1 [Theobroma cacao]
 gb|EOY06058.1| XB3 in, putative isoform 1 [Theobroma cacao]
Length=512

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL EIKAKKWGCPVCR KI+QVI +Y V
Sbjct  479  VAGCMSCLNEIKAKKWGCPVCRTKIEQVIRLYRV  512



>ref|XP_009400812.1| PREDICTED: probable E3 ubiquitin-protein ligase XBOS34 [Musa 
acuminata subsp. malaccensis]
Length=517

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EI+AK WGCPVCR KI+Q+I +YAV
Sbjct  484  MAGCMSCLREIEAKNWGCPVCRTKINQIIKLYAV  517



>ref|XP_010246788.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT34 isoform 
X3 [Nelumbo nucifera]
Length=464

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIK KKWGCPVCRA I+QV+ +YAV
Sbjct  430  MAGCMSCLNEIKEKKWGCPVCRATIEQVVRLYAV  463



>ref|XP_009396978.1| PREDICTED: probable E3 ubiquitin-protein ligase XBOS34 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009396979.1| PREDICTED: probable E3 ubiquitin-protein ligase XBOS34 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009396980.1| PREDICTED: probable E3 ubiquitin-protein ligase XBOS34 [Musa 
acuminata subsp. malaccensis]
Length=513

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL +I+AK WGCP+CRAKI QVI +YAV
Sbjct  480  MAGCMSCLRDIEAKNWGCPICRAKIKQVIKLYAV  513



>ref|XP_010527401.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 [Tarenaya 
hassleriana]
Length=442

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL EIK+KKWGCPVCRA+I+QVI +Y V
Sbjct  409  VAGCMSCLNEIKSKKWGCPVCRAEINQVIKLYRV  442



>ref|XP_006378333.1| zinc finger family protein [Populus trichocarpa]
 gb|ERP56130.1| zinc finger family protein [Populus trichocarpa]
Length=455

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            M GCMSCL EIKAK+WGCPVCRA I+QV+ +YAV
Sbjct  422  MVGCMSCLKEIKAKEWGCPVCRATINQVVRLYAV  455



>ref|XP_006857296.1| hypothetical protein AMTR_s00067p00047970 [Amborella trichopoda]
 gb|ERN18763.1| hypothetical protein AMTR_s00067p00047970 [Amborella trichopoda]
Length=468

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCM CL EIKAK WGCPVCR KI+QV+ VYAV
Sbjct  435  MAGCMDCLKEIKAKGWGCPVCRTKIEQVMKVYAV  468



>gb|KJB72369.1| hypothetical protein B456_011G174600 [Gossypium raimondii]
Length=422

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL EIKAKKWGCPVCRAKI+QVI +Y V
Sbjct  389  VAGCMSCLNEIKAKKWGCPVCRAKIEQVIKLYRV  422



>gb|KEH42761.1| E3 ubiquitin-protein ligase XBAT35, putative [Medicago truncatula]
Length=392

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL E+K KKWGCPVCRAKIDQ+I +Y V
Sbjct  359  VAGCMSCLNEVKTKKWGCPVCRAKIDQIIKLYHV  392



>ref|XP_006387061.1| hypothetical protein POPTR_2017s00200g [Populus trichocarpa]
 gb|ERP45975.1| hypothetical protein POPTR_2017s00200g [Populus trichocarpa]
Length=219

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            M GCMSCL EIKAK+WGCPVCRA I+QV+ +YAV
Sbjct  186  MVGCMSCLKEIKAKEWGCPVCRATINQVVRLYAV  219



>ref|XP_004147147.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35-like [Cucumis 
sativus]
 gb|KGN61597.1| hypothetical protein Csa_2G174140 [Cucumis sativus]
Length=487

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIK K WGCPVCR KI+QVI +Y V
Sbjct  454  MAGCMSCLNEIKTKNWGCPVCRTKINQVIKLYVV  487



>ref|XP_010906818.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 [Elaeis 
guineensis]
Length=588

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            M GCM CL EIKAK WGCPVCRA +DQV+ +YAV
Sbjct  555  MVGCMPCLKEIKAKNWGCPVCRANVDQVVRLYAV  588



>ref|XP_004160586.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35-like [Cucumis 
sativus]
Length=487

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIK K WGCPVCR KI+QVI +Y V
Sbjct  454  MAGCMSCLNEIKTKNWGCPVCRTKINQVIKLYVV  487



>ref|XP_002461915.1| hypothetical protein SORBIDRAFT_02g010610 [Sorghum bicolor]
 gb|EER98436.1| hypothetical protein SORBIDRAFT_02g010610 [Sorghum bicolor]
Length=516

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL +I++KKWGCP+CRA I+QV+ +YAV
Sbjct  483  MAGCMSCLKDIESKKWGCPICRATINQVVRLYAV  516



>ref|XP_006657658.1| PREDICTED: probable E3 ubiquitin-protein ligase XBOS34-like [Oryza 
brachyantha]
Length=508

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCM+CL +I++KKWGCP+CRAKI+Q++ +YAV
Sbjct  475  MAGCMTCLKDIESKKWGCPICRAKINQIVRLYAV  508



>ref|XP_009766203.1| PREDICTED: AMSH-like ubiquitin thioesterase 3 [Nicotiana sylvestris]
Length=265

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIKAK WGCPVCR KI+ V+ +YAV
Sbjct  232  MAGCMSCLNEIKAKSWGCPVCRTKIELVLRLYAV  265



>ref|XP_004956090.1| PREDICTED: probable E3 ubiquitin-protein ligase XBOS34-like isoform 
X2 [Setaria italica]
Length=513

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL +I++KKWGCP+CRA I+QV+ +YAV
Sbjct  480  MAGCMSCLKDIESKKWGCPICRATINQVVRLYAV  513



>ref|NP_001130389.1| uncharacterized LOC100191485 [Zea mays]
 gb|ACF78587.1| unknown [Zea mays]
 gb|ACG43333.1| protein binding protein [Zea mays]
 gb|ACN34807.1| unknown [Zea mays]
 tpg|DAA60447.1| TPA: putative RING zinc finger and ankyrin repeat containing 
protein [Zea mays]
Length=517

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL +I++KKWGCP+CRA I+QV+ +YAV
Sbjct  484  MAGCMSCLKDIESKKWGCPICRATINQVVRLYAV  517



>ref|XP_004495377.1| PREDICTED: probable methyltransferase PMT1-like [Cicer arietinum]
Length=965

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVI  87
            +AGCMSCL E+K KKWGCPVCRAKIDQ+I
Sbjct  339  VAGCMSCLNEVKTKKWGCPVCRAKIDQII  367



>ref|XP_004956089.1| PREDICTED: probable E3 ubiquitin-protein ligase XBOS34-like isoform 
X1 [Setaria italica]
Length=554

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL +I++KKWGCP+CRA I+QV+ +YAV
Sbjct  521  MAGCMSCLKDIESKKWGCPICRATINQVVRLYAV  554



>emb|CDY35522.1| BnaA01g23900D [Brassica napus]
Length=561

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL EIK+K +GCPVCRAKIDQ+  +Y V
Sbjct  528  VAGCMSCLTEIKSKNYGCPVCRAKIDQITKLYRV  561



>ref|XP_006378332.1| hypothetical protein POPTR_0010s08160g [Populus trichocarpa]
 gb|ERP56129.1| hypothetical protein POPTR_0010s08160g [Populus trichocarpa]
Length=361

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            M GCMSCL EIKAK+WGCPVCRA I+QV+ +YAV
Sbjct  328  MVGCMSCLKEIKAKEWGCPVCRATINQVVRLYAV  361



>tpg|DAA60446.1| TPA: putative RING zinc finger and ankyrin repeat containing 
protein [Zea mays]
Length=334

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL +I++KKWGCP+CRA I+QV+ +YAV
Sbjct  301  MAGCMSCLKDIESKKWGCPICRATINQVVRLYAV  334



>ref|XP_001763413.1| predicted protein [Physcomitrella patens]
 gb|EDQ71943.1| predicted protein [Physcomitrella patens]
Length=473

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCM CL+EIK K WGCPVCR  I Q+I VYAV
Sbjct  440  LAGCMDCLSEIKEKGWGCPVCRTAIQQLIKVYAV  473



>ref|XP_010023926.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT34 isoform 
X1 [Eucalyptus grandis]
 ref|XP_010023927.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT34 isoform 
X1 [Eucalyptus grandis]
 ref|XP_010023928.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT34 isoform 
X1 [Eucalyptus grandis]
 gb|KCW60327.1| hypothetical protein EUGRSUZ_H03040 [Eucalyptus grandis]
Length=485

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL +I+AKK GCPVCR KIDQVI +YAV
Sbjct  452  MAGCMSCLEKIQAKKTGCPVCRTKIDQVIRLYAV  485



>ref|XP_010023930.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X2 [Eucalyptus grandis]
 gb|KCW60326.1| hypothetical protein EUGRSUZ_H03040 [Eucalyptus grandis]
Length=466

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL +I+AKK GCPVCR KIDQVI +YAV
Sbjct  433  MAGCMSCLEKIQAKKTGCPVCRTKIDQVIRLYAV  466



>ref|XP_002967634.1| hypothetical protein SELMODRAFT_88643 [Selaginella moellendorffii]
 gb|EFJ30981.1| hypothetical protein SELMODRAFT_88643 [Selaginella moellendorffii]
Length=475

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCM CL EIK KKWGCPVCR+ I+QV+ V+AV
Sbjct  442  LAGCMGCLQEIKNKKWGCPVCRSPIEQVVKVFAV  475



>ref|XP_001771059.1| predicted protein [Physcomitrella patens]
 gb|EDQ64060.1| predicted protein [Physcomitrella patens]
Length=451

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCM CL+EIK K WGCPVCR  I QV+ VY V
Sbjct  418  LAGCMDCLSEIKEKGWGCPVCRTAIQQVVKVYTV  451



>ref|XP_010679337.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 [Beta 
vulgaris subsp. vulgaris]
Length=523

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGC+SCL+EIK+KK  CPVCRAKIDQVI +YAV
Sbjct  490  MAGCISCLSEIKSKKGVCPVCRAKIDQVIRLYAV  523



>ref|XP_002964399.1| hypothetical protein SELMODRAFT_81884 [Selaginella moellendorffii]
 gb|EFJ34732.1| hypothetical protein SELMODRAFT_81884 [Selaginella moellendorffii]
Length=475

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCM CL EIK KKWGCPVCR+ I+QV+ V+AV
Sbjct  442  LAGCMGCLQEIKNKKWGCPVCRSPIEQVVKVFAV  475



>ref|XP_002274072.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT34 [Vitis 
vinifera]
 emb|CBI21850.3| unnamed protein product [Vitis vinifera]
Length=497

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCM+CL EIKAKK  CPVCRAKI QVI +YAV
Sbjct  464  MAGCMTCLNEIKAKKGVCPVCRAKIQQVIKLYAV  497



>emb|CDY08997.1| BnaC01g30940D [Brassica napus]
Length=376

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL EIK+K +GCPVCRAKIDQ++ +Y V
Sbjct  343  VAGCMSCLTEIKSKNYGCPVCRAKIDQIVRLYRV  376



>gb|KDO60480.1| hypothetical protein CISIN_1g010439mg [Citrus sinensis]
Length=510

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL+EIKAKK  CPVCR KI+QVI +Y V
Sbjct  477  MAGCMSCLSEIKAKKGDCPVCRTKINQVIRLYTV  510



>gb|KHG28017.1| putative E3 ubiquitin-protein ligase XBOS34 [Gossypium arboreum]
Length=506

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIKAK   CPVCR+KIDQVI +Y V
Sbjct  473  MAGCMSCLNEIKAKNGLCPVCRSKIDQVIRLYTV  506



>gb|KDO60479.1| hypothetical protein CISIN_1g010439mg [Citrus sinensis]
Length=508

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL+EIKAKK  CPVCR KI+QVI +Y V
Sbjct  475  MAGCMSCLSEIKAKKGDCPVCRTKINQVIRLYTV  508



>ref|XP_006443829.1| hypothetical protein CICLE_v10024413mg [Citrus clementina]
 ref|XP_006479531.1| PREDICTED: probable E3 ubiquitin-protein ligase XBOS34-like isoform 
X1 [Citrus sinensis]
 ref|XP_006479532.1| PREDICTED: probable E3 ubiquitin-protein ligase XBOS34-like isoform 
X2 [Citrus sinensis]
 gb|ESR57069.1| hypothetical protein CICLE_v10024413mg [Citrus clementina]
Length=508

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL+EIKAKK  CPVCR KI+QVI +Y V
Sbjct  475  MAGCMSCLSEIKAKKGDCPVCRTKINQVIRLYTV  508



>gb|KDO60477.1| hypothetical protein CISIN_1g010439mg [Citrus sinensis]
Length=497

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL+EIKAKK  CPVCR KI+QVI +Y V
Sbjct  464  MAGCMSCLSEIKAKKGDCPVCRTKINQVIRLYTV  497



>gb|KDP26523.1| hypothetical protein JCGZ_17681 [Jatropha curcas]
Length=493

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCM+CL+EIKAKK  CPVCRA++ QVI +YAV
Sbjct  460  MAGCMACLSEIKAKKGVCPVCRAQLSQVIRLYAV  493



>ref|XP_007050280.1| XB3 in, putative isoform 1 [Theobroma cacao]
 gb|EOX94437.1| XB3 in, putative isoform 1 [Theobroma cacao]
Length=537

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL E+KAK   CPVCR KIDQVI +YAV
Sbjct  504  MAGCMSCLNEVKAKNGLCPVCRGKIDQVIRLYAV  537



>ref|XP_001775781.1| predicted protein [Physcomitrella patens]
 gb|EDQ59464.1| predicted protein [Physcomitrella patens]
Length=364

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCM CL +IKA  WGCPVCR+ IDQ+I VYAV
Sbjct  331  LAGCMECLLKIKATNWGCPVCRSAIDQIIKVYAV  364



>ref|XP_009603578.1| PREDICTED: AMSH-like ubiquitin thioesterase 3 [Nicotiana tomentosiformis]
Length=274

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIKAK WGCPVC  KI  V+ +YAV
Sbjct  241  MAGCMSCLNEIKAKTWGCPVCLTKIQLVLRLYAV  274



>ref|XP_002533469.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
 gb|EEF28921.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
Length=951

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVI  87
            MAGCMSCL EIKAK+WGCPVCRAK+ +++
Sbjct  327  MAGCMSCLKEIKAKEWGCPVCRAKMTRLL  355



>ref|XP_010440478.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT34 isoform 
X4 [Camelina sativa]
Length=383

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGC+SCL EIK KK GCPVCRAKIDQVI +Y V
Sbjct  350  VAGCVSCLKEIKNKKMGCPVCRAKIDQVIKLYHV  383



>ref|XP_011030496.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT34 [Populus 
euphratica]
Length=451

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            M GCMSCL EIKAKKWGCP+C A I+Q + +YAV
Sbjct  418  MVGCMSCLKEIKAKKWGCPMCPATINQTVRLYAV  451



>gb|KDO60478.1| hypothetical protein CISIN_1g010439mg [Citrus sinensis]
Length=499

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL+EIKAKK  CPVCR KI+QVI +Y V
Sbjct  466  MAGCMSCLSEIKAKKGDCPVCRTKINQVIRLYTV  499



>gb|ABG37641.1| auxin-regulated protein-like protein [Populus trichocarpa]
Length=499

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCM+CL+EIKAKK  CP+CR+ I+QV  +YAV
Sbjct  466  MAGCMTCLSEIKAKKGVCPICRSNINQVTRLYAV  499



>gb|KFK21923.1| hypothetical protein AALP_AAs63887U000300 [Arabis alpina]
Length=372

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGC+SCL EIK KK GCPVCRA IDQVI +Y V
Sbjct  339  VAGCISCLKEIKNKKLGCPVCRANIDQVIKLYHV  372



>ref|XP_006365899.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35-like [Solanum 
tuberosum]
Length=563

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            M GCM CL +IK+KK  CPVCR KIDQVI +Y+V
Sbjct  530  MVGCMQCLNQIKSKKGECPVCRVKIDQVIKLYSV  563



>ref|XP_002868287.1| hypothetical protein ARALYDRAFT_493466 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44546.1| hypothetical protein ARALYDRAFT_493466 [Arabidopsis lyrata subsp. 
lyrata]
Length=372

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGC+SCL EIK KK GCPVCRA IDQVI +Y V
Sbjct  339  VAGCISCLKEIKNKKMGCPVCRANIDQVIKLYHV  372



>ref|XP_002963644.1| hypothetical protein SELMODRAFT_141633 [Selaginella moellendorffii]
 gb|EFJ35515.1| hypothetical protein SELMODRAFT_141633 [Selaginella moellendorffii]
Length=447

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCM+CL EIK K WGCPVCR  I QV+ V+ V
Sbjct  414  LAGCMNCLMEIKEKTWGCPVCRTSIQQVVKVFTV  447



>ref|XP_002974733.1| hypothetical protein SELMODRAFT_102072 [Selaginella moellendorffii]
 gb|EFJ24253.1| hypothetical protein SELMODRAFT_102072 [Selaginella moellendorffii]
Length=447

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCM+CL EIK K WGCPVCR  I QV+ V+ V
Sbjct  414  LAGCMNCLMEIKEKTWGCPVCRTSIQQVVKVFTV  447



>ref|XP_007050281.1| XB3 in, putative isoform 2 [Theobroma cacao]
 gb|EOX94438.1| XB3 in, putative isoform 2 [Theobroma cacao]
Length=427

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL E+KAK   CPVCR KIDQVI +YAV
Sbjct  394  MAGCMSCLNEVKAKNGLCPVCRGKIDQVIRLYAV  427



>ref|XP_010450049.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT34 isoform 
X3 [Camelina sativa]
Length=381

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGC+SCL EIK KK GCPVCRA IDQVI +Y V
Sbjct  348  VAGCVSCLKEIKNKKMGCPVCRANIDQVIKLYHV  381



>gb|KJB42275.1| hypothetical protein B456_007G146700 [Gossypium raimondii]
Length=501

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCMSCL EIKAK   CPVCR+KID+VI +Y +
Sbjct  468  MAGCMSCLNEIKAKNGLCPVCRSKIDKVIRLYTI  501



>ref|XP_002532035.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30351.1| conserved hypothetical protein [Ricinus communis]
Length=238

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCM+CL+EI AKK  CPVCRAKI QVI +YAV
Sbjct  205  MAGCMACLSEINAKKGVCPVCRAKIKQVIRLYAV  238



>ref|XP_009125093.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT34 [Brassica 
rapa]
Length=381

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGC+SCL EIK KK GCP+CRA IDQVI +Y V
Sbjct  348  VAGCISCLKEIKNKKLGCPICRASIDQVIKLYHV  381



>emb|CDX67415.1| BnaA07g14550D [Brassica napus]
Length=382

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGC+SCL EIK KK GCP+CRA IDQVI +Y V
Sbjct  349  VAGCISCLKEIKNKKLGCPICRASIDQVIKLYHV  382



>ref|XP_011004046.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT34 [Populus 
euphratica]
Length=492

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCM+CL EIKAKK  CPVCR+ I+QV  +YAV
Sbjct  459  MAGCMTCLREIKAKKGVCPVCRSNINQVTRLYAV  492



>ref|NP_567428.1| putative E3 ubiquitin-protein ligase XBAT34 [Arabidopsis thaliana]
 sp|Q9FPH0.1|XB34_ARATH RecName: Full=Putative E3 ubiquitin-protein ligase XBAT34; AltName: 
Full=Ankyrin repeat domain and RING finger-containing 
protein XBAT34; AltName: Full=Protein XB3 homolog 4 [Arabidopsis 
thaliana]
 gb|AAG40396.1|AF325044_1 AT4g14360 [Arabidopsis thaliana]
 gb|AAL32866.1| ankyrin homolog [Arabidopsis thaliana]
 gb|AAM10164.1| ankyrin homolog [Arabidopsis thaliana]
 gb|AAZ14066.1| At4g14365 [Arabidopsis thaliana]
 gb|AEE83429.1| putative E3 ubiquitin-protein ligase XBAT34 [Arabidopsis thaliana]
Length=376

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGC+SCL EI+ KK GCPVCRA IDQVI +Y V
Sbjct  343  VAGCISCLKEIENKKMGCPVCRANIDQVIKLYHV  376



>ref|XP_002306855.1| hypothetical protein POPTR_0005s24690g [Populus trichocarpa]
 gb|EEE93851.1| hypothetical protein POPTR_0005s24690g [Populus trichocarpa]
Length=241

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCM+CL+EIKAKK  CP+CR+ I+QV  +YAV
Sbjct  208  MAGCMTCLSEIKAKKGVCPICRSNINQVTRLYAV  241



>ref|XP_010435136.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT34 [Camelina 
sativa]
Length=382

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVY  96
            +AGC+SCL EIK KK GCPVCRA IDQVI +Y
Sbjct  349  VAGCVSCLKEIKNKKLGCPVCRANIDQVIKLY  380



>ref|XP_002324376.2| hypothetical protein POPTR_0018s03330g [Populus trichocarpa]
 gb|EEF02941.2| hypothetical protein POPTR_0018s03330g [Populus trichocarpa]
Length=295

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MAGCM+CL+EIKAKK  CPVCR+ I+QV+ +YAV
Sbjct  262  MAGCMACLSEIKAKKGVCPVCRSNINQVVRLYAV  295



>emb|CDY08992.1| BnaC01g30990D [Brassica napus]
Length=441

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGC SCL EIK+K  GC VCRAKIDQ++ VY V
Sbjct  408  VAGCTSCLTEIKSKNLGCLVCRAKIDQIVKVYRV  441



>gb|AAM65242.1| unknown [Arabidopsis thaliana]
Length=376

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGC+ CL EIK KK GCPVCRA IDQVI +Y V
Sbjct  343  VAGCIYCLKEIKNKKMGCPVCRANIDQVIKLYHV  376



>ref|XP_009789557.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X2 [Nicotiana sylvestris]
Length=504

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            M GCM CL +I +KK  CPVCR KIDQVI +Y+V
Sbjct  471  MIGCMQCLNQINSKKGECPVCRVKIDQVIKLYSV  504



>ref|XP_009628304.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X1 [Nicotiana tomentosiformis]
Length=571

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            M GCM CL +I +KK  CPVCR KIDQVI +Y+V
Sbjct  538  MIGCMQCLNQINSKKGECPVCRVKIDQVIKLYSV  571



>emb|CDY62836.1| BnaC05g50910D [Brassica napus]
Length=413

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCMSCL EIK+    CPVCRAKIDQ+I +Y V
Sbjct  380  LAGCMSCLIEIKSNNGRCPVCRAKIDQIIKLYRV  413



>ref|XP_010086625.1| putative E3 ubiquitin-protein ligase XBOS34 [Morus notabilis]
 gb|EXB22191.1| putative E3 ubiquitin-protein ligase XBOS34 [Morus notabilis]
Length=533

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            MA CMSCL EIKAKK  CPVCR+K+ +V+ +YAV
Sbjct  500  MACCMSCLIEIKAKKGVCPVCRSKMKRVVRIYAV  533



>emb|CAB10215.1| ankyrin like protein [Arabidopsis thaliana]
 emb|CAB78478.1| ankyrin like protein [Arabidopsis thaliana]
Length=936

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV*LF  111
            +AGC+SCL EI+ KK GCPVCRA IDQ IG+  V +F
Sbjct  307  VAGCISCLKEIENKKMGCPVCRANIDQ-IGISVVLVF  342



>ref|XP_006283994.1| hypothetical protein CARUB_v10005117mg [Capsella rubella]
 gb|EOA16892.1| hypothetical protein CARUB_v10005117mg [Capsella rubella]
Length=360

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGC+SCL +IK KK GCPVCRA IDQVI +Y V
Sbjct  327  VAGCVSCLKKIKNKKMGCPVCRANIDQVIKLYHV  360



>ref|XP_006283992.1| hypothetical protein CARUB_v10005117mg [Capsella rubella]
 gb|EOA16890.1| hypothetical protein CARUB_v10005117mg [Capsella rubella]
Length=360

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGC+SCL +IK KK GCPVCRA IDQVI +Y V
Sbjct  327  VAGCVSCLKKIKNKKMGCPVCRANIDQVIKLYHV  360



>ref|XP_009628305.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009628306.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X2 [Nicotiana tomentosiformis]
Length=465

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            M GCM CL +I +KK  CPVCR KIDQVI +Y+V
Sbjct  432  MIGCMQCLNQINSKKGECPVCRVKIDQVIKLYSV  465



>ref|XP_006283993.1| hypothetical protein CARUB_v10005117mg [Capsella rubella]
 gb|EOA16891.1| hypothetical protein CARUB_v10005117mg [Capsella rubella]
Length=360

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGC+SCL +IK KK GCPVCRA IDQVI +Y V
Sbjct  327  VAGCVSCLKKIKNKKMGCPVCRANIDQVIKLYHV  360



>ref|XP_009789556.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X1 [Nicotiana sylvestris]
Length=562

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            M GCM CL +I +KK  CPVCR KIDQVI +Y+V
Sbjct  529  MIGCMQCLNQINSKKGECPVCRVKIDQVIKLYSV  562



>ref|XP_009789559.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X3 [Nicotiana sylvestris]
Length=456

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            M GCM CL +I +KK  CPVCR KIDQVI +Y+V
Sbjct  423  MIGCMQCLNQINSKKGECPVCRVKIDQVIKLYSV  456



>emb|CDY49072.1| BnaC06g12460D [Brassica napus]
Length=382

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGC+SCL EIK KK  CP+CRA IDQVI +Y V
Sbjct  349  VAGCISCLKEIKNKKLACPICRASIDQVIKLYHV  382



>ref|XP_010440475.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT34 isoform 
X1 [Camelina sativa]
Length=416

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 41/69 (59%), Gaps = 10/69 (14%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV*LFREEAMEQVYVEELRLRVIFGLRS  180
            +AGC+SCL EIK KK GCPVCRAKIDQ         F  E+ +  Y    +   +  L S
Sbjct  350  VAGCVSCLKEIKNKKMGCPVCRAKIDQ---------FAMESKKSEYSGHEKFSFLCLLLS  400

Query  181  ILSR-GKIY  204
            +L++ G+I+
Sbjct  401  VLTKFGQIF  409



>gb|AEJ88251.1| putative zinc finger family protein [Wolffia australiana]
Length=57

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGCM+CL E++ KK GCPVCRA+I++++ +Y  
Sbjct  24   LAGCMACLRELERKKMGCPVCRARIERILKIYPT  57



>ref|XP_010440479.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT34 isoform 
X5 [Camelina sativa]
Length=383

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQV  84
            +AGC+SCL EIK KK GCPVCRAKIDQV
Sbjct  350  VAGCVSCLKEIKNKKMGCPVCRAKIDQV  377



>ref|XP_010451527.1| PREDICTED: vesicle-associated protein 2-1-like [Camelina sativa]
Length=247

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVI  87
            +AGC+SCL EIK  K GCPVCRA IDQVI
Sbjct  217  VAGCVSCLKEIKNMKMGCPVCRANIDQVI  245



>ref|XP_006414726.1| hypothetical protein EUTSA_v10025615mg [Eutrema salsugineum]
 gb|ESQ56179.1| hypothetical protein EUTSA_v10025615mg [Eutrema salsugineum]
Length=347

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQVIGVYAV  102
            +AGC+SCL EIK KK GCPVC A IDQVI +Y V
Sbjct  314  VAGCVSCLKEIKDKKLGCPVCCADIDQVIKLYHV  347



>ref|XP_010440476.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT34 isoform 
X2 [Camelina sativa]
Length=406

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQV  84
            +AGC+SCL EIK KK GCPVCRAKIDQ 
Sbjct  350  VAGCVSCLKEIKNKKMGCPVCRAKIDQF  377



>ref|XP_010440477.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT34 isoform 
X3 [Camelina sativa]
Length=384

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  1    MAGCMSCLAEIKAKKWGCPVCRAKIDQ  81
            +AGC+SCL EIK KK GCPVCRAKIDQ
Sbjct  350  VAGCVSCLKEIKNKKMGCPVCRAKIDQ  376



>ref|XP_004240501.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 [Solanum 
lycopersicum]
Length=559

 Score = 47.8 bits (112),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +1

Query  1    MAGCMSCLAEI-KAKKWGCPVCRAKIDQVIGVYAV  102
            M GCM CL +I K+K   CPVCR KIDQVI +Y+V
Sbjct  525  MVGCMQCLNQIIKSKIGACPVCRVKIDQVIKLYSV  559



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 551197703000