BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP010C12 375 bp,:Filtered

Length=340
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002280053.1|  PREDICTED: vacuolar protein sorting-associat...  95.9    1e-21   Vitis vinifera
ref|XP_010261957.1|  PREDICTED: vacuolar protein sorting-associat...  95.5    1e-21   Nelumbo nucifera [Indian lotus]
emb|CAN80030.1|  hypothetical protein VITISV_007913                   95.5    2e-21   Vitis vinifera
ref|XP_011009583.1|  PREDICTED: vacuolar protein sorting-associat...  95.5    2e-21   Populus euphratica
gb|KJB63439.1|  hypothetical protein B456_010G0867002                 92.4    2e-21   Gossypium raimondii
ref|XP_006372005.1|  SNF7 family protein                              95.5    2e-21   Populus trichocarpa [western balsam poplar]
gb|KDP33889.1|  hypothetical protein JCGZ_07460                       95.5    2e-21   Jatropha curcas
gb|EYU25879.1|  hypothetical protein MIMGU_mgv1a013337mg              95.5    2e-21   Erythranthe guttata [common monkey flower]
emb|CDP03113.1|  unnamed protein product                              95.1    2e-21   Coffea canephora [robusta coffee]
ref|XP_007012694.1|  Vacuolar protein sorting-associated protein 2    95.1    3e-21   Theobroma cacao [chocolate]
ref|XP_010666458.1|  PREDICTED: vacuolar protein sorting-associat...  94.7    3e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009804303.1|  PREDICTED: vacuolar protein sorting-associat...  94.7    3e-21   Nicotiana sylvestris
ref|XP_002514068.1|  Charged multivesicular body protein 2a, puta...  94.7    3e-21   Ricinus communis
ref|XP_006353552.1|  PREDICTED: vacuolar protein sorting-associat...  94.7    3e-21   Solanum tuberosum [potatoes]
ref|XP_011093797.1|  PREDICTED: vacuolar protein sorting-associat...  94.7    3e-21   Sesamum indicum [beniseed]
ref|NP_001235502.1|  uncharacterized protein LOC100526885             93.2    4e-21   Glycine max [soybeans]
ref|XP_009616620.1|  PREDICTED: vacuolar protein sorting-associat...  94.7    4e-21   Nicotiana tomentosiformis
ref|XP_010670585.1|  PREDICTED: vacuolar protein sorting-associat...  94.7    4e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008450903.1|  PREDICTED: vacuolar protein sorting-associat...  94.0    6e-21   Cucumis melo [Oriental melon]
ref|XP_004144020.1|  PREDICTED: vacuolar protein sorting-associat...  94.0    6e-21   Cucumis sativus [cucumbers]
gb|ACJ84123.1|  unknown                                               94.0    7e-21   Medicago truncatula
ref|XP_008802764.1|  PREDICTED: vacuolar protein sorting-associat...  94.0    7e-21   Phoenix dactylifera
ref|XP_006586647.1|  PREDICTED: uncharacterized protein LOC100526...  93.6    8e-21   Glycine max [soybeans]
ref|XP_003546475.1|  PREDICTED: vacuolar protein sorting-associat...  93.6    8e-21   Glycine max [soybeans]
gb|ADE76385.1|  unknown                                               93.6    8e-21   Picea sitchensis
ref|XP_004513469.1|  PREDICTED: vacuolar protein sorting-associat...  93.6    9e-21   Cicer arietinum [garbanzo]
ref|XP_006451568.1|  hypothetical protein CICLE_v10009411mg           93.6    9e-21   Citrus clementina
ref|XP_004510438.1|  PREDICTED: vacuolar protein sorting-associat...  93.6    9e-21   Cicer arietinum [garbanzo]
ref|XP_002521345.1|  Charged multivesicular body protein 2a, puta...  93.6    1e-20   Ricinus communis
ref|XP_004251682.1|  PREDICTED: vacuolar protein sorting-associat...  93.2    1e-20   Solanum lycopersicum
ref|XP_010918392.1|  PREDICTED: vacuolar protein sorting-associat...  93.2    1e-20   Elaeis guineensis
ref|XP_006846124.1|  hypothetical protein AMTR_s00012p00151310        93.2    1e-20   Amborella trichopoda
ref|XP_010273944.1|  PREDICTED: vacuolar protein sorting-associat...  93.2    1e-20   Nelumbo nucifera [Indian lotus]
ref|XP_006663126.1|  PREDICTED: vacuolar protein sorting-associat...  93.2    1e-20   Oryza brachyantha
gb|KDP40715.1|  hypothetical protein JCGZ_24714                       93.2    1e-20   Jatropha curcas
dbj|BAD11337.1|  BRI1-KD interacting protein 109                      93.2    1e-20   Oryza sativa Japonica Group [Japonica rice]
gb|KJB07297.1|  hypothetical protein B456_001G014300                  92.8    1e-20   Gossypium raimondii
ref|NP_001288541.1|  vacuolar protein sorting-associated protein ...  93.2    1e-20   Zea mays [maize]
ref|XP_010258662.1|  PREDICTED: vacuolar protein sorting-associat...  93.2    1e-20   Nelumbo nucifera [Indian lotus]
ref|XP_003557356.1|  PREDICTED: vacuolar protein sorting-associat...  93.2    1e-20   Brachypodium distachyon [annual false brome]
gb|EMT29285.1|  Vacuolar protein sorting-associated 2-1-like protein  93.6    1e-20   Aegilops tauschii
ref|XP_009416132.1|  PREDICTED: vacuolar protein sorting-associat...  93.2    1e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001132529.1|  uncharacterized protein LOC100193992             93.2    1e-20   Zea mays [maize]
ref|NP_001068537.1|  Os11g0703400                                     93.2    1e-20   
gb|ACF81407.1|  unknown                                               93.2    1e-20   Zea mays [maize]
gb|KHG00766.1|  Uncharacterized protein F383_22856                    92.8    1e-20   Gossypium arboreum [tree cotton]
gb|AFK39133.1|  unknown                                               92.8    2e-20   Lotus japonicus
ref|XP_009403447.1|  PREDICTED: vacuolar protein sorting-associat...  92.8    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002459581.1|  hypothetical protein SORBIDRAFT_02g007010        92.8    2e-20   Sorghum bicolor [broomcorn]
ref|XP_006657579.1|  PREDICTED: vacuolar protein sorting-associat...  92.8    2e-20   Oryza brachyantha
ref|XP_009402259.1|  PREDICTED: vacuolar protein sorting-associat...  92.8    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004955854.1|  PREDICTED: vacuolar protein sorting-associat...  92.8    2e-20   Setaria italica
ref|XP_007138681.1|  hypothetical protein PHAVU_009G229000g           92.8    2e-20   Phaseolus vulgaris [French bean]
gb|EMS49992.1|  Vacuolar protein sorting-associated protein 2-lik...  92.8    2e-20   Triticum urartu
ref|NP_001059248.1|  Os07g0236800                                     92.4    2e-20   
ref|XP_008776678.1|  PREDICTED: vacuolar protein sorting-associat...  92.4    2e-20   Phoenix dactylifera
ref|XP_002977724.1|  hypothetical protein SELMODRAFT_268105           92.4    2e-20   Selaginella moellendorffii
ref|XP_010533043.1|  PREDICTED: vacuolar protein sorting-associat...  92.4    2e-20   Tarenaya hassleriana [spider flower]
ref|XP_010047507.1|  PREDICTED: vacuolar protein sorting-associat...  92.4    3e-20   Eucalyptus grandis [rose gum]
ref|XP_010541975.1|  PREDICTED: vacuolar protein sorting-associat...  92.4    3e-20   Tarenaya hassleriana [spider flower]
ref|XP_008784527.1|  PREDICTED: vacuolar protein sorting-associat...  92.0    3e-20   Phoenix dactylifera
ref|XP_010922363.1|  PREDICTED: vacuolar protein sorting-associat...  92.0    4e-20   Elaeis guineensis
ref|XP_002451314.1|  hypothetical protein SORBIDRAFT_05g027600        92.0    4e-20   Sorghum bicolor [broomcorn]
gb|EAZ03311.1|  hypothetical protein OsI_25454                        92.4    4e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_003577210.1|  PREDICTED: vacuolar protein sorting-associat...  91.7    5e-20   Brachypodium distachyon [annual false brome]
ref|XP_010920626.1|  PREDICTED: vacuolar protein sorting-associat...  91.3    7e-20   Elaeis guineensis
ref|XP_004141696.1|  PREDICTED: vacuolar protein sorting-associat...  91.3    7e-20   Cucumis sativus [cucumbers]
ref|XP_003551143.1|  PREDICTED: vacuolar protein sorting-associat...  91.3    7e-20   Glycine max [soybeans]
ref|XP_008462317.1|  PREDICTED: vacuolar protein sorting-associat...  90.9    8e-20   Cucumis melo [Oriental melon]
ref|XP_008812040.1|  PREDICTED: vacuolar protein sorting-associat...  90.9    1e-19   Phoenix dactylifera
ref|XP_007135472.1|  hypothetical protein PHAVU_010G132400g           90.5    1e-19   Phaseolus vulgaris [French bean]
ref|XP_004980059.1|  PREDICTED: vacuolar protein sorting-associat...  90.5    1e-19   Setaria italica
gb|KEH18460.1|  charged multivesicular body protein                   90.1    2e-19   Medicago truncatula
ref|NP_001151055.1|  charged multivesicular body protein 2a           90.1    2e-19   Zea mays [maize]
ref|XP_007202543.1|  hypothetical protein PRUPE_ppa011120mg           90.1    2e-19   Prunus persica
ref|XP_008242200.1|  PREDICTED: vacuolar protein sorting-associat...  90.1    2e-19   Prunus mume [ume]
ref|XP_002299595.1|  hypothetical protein POPTR_0001s17040g           89.7    2e-19   Populus trichocarpa [western balsam poplar]
ref|XP_011035695.1|  PREDICTED: vacuolar protein sorting-associat...  89.7    2e-19   Populus euphratica
ref|XP_004287607.1|  PREDICTED: vacuolar protein sorting-associat...  89.7    3e-19   Fragaria vesca subsp. vesca
ref|XP_009340448.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    8e-19   Pyrus x bretschneideri [bai li]
gb|EPS66336.1|  hypothetical protein M569_08441                       88.2    9e-19   Genlisea aurea
ref|XP_011078064.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    1e-18   Sesamum indicum [beniseed]
gb|KFK39894.1|  hypothetical protein AALP_AA3G302700                  87.8    1e-18   Arabis alpina [alpine rockcress]
ref|XP_006298491.1|  hypothetical protein CARUB_v10014566mg           87.8    1e-18   Capsella rubella
ref|XP_010488799.1|  PREDICTED: vacuolar protein sorting-associat...  87.8    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010412961.1|  PREDICTED: vacuolar protein sorting-associat...  87.8    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010467127.1|  PREDICTED: vacuolar protein sorting-associat...  87.8    1e-18   Camelina sativa [gold-of-pleasure]
gb|AFK37485.1|  unknown                                               87.4    2e-18   Lotus japonicus
ref|XP_006396107.1|  hypothetical protein EUTSA_v10002656mg           87.0    2e-18   Eutrema salsugineum
ref|XP_008337763.1|  PREDICTED: vacuolar protein sorting-associat...  86.7    3e-18   Malus domestica [apple tree]
ref|XP_008388537.1|  PREDICTED: vacuolar protein sorting-associat...  86.7    3e-18   Malus domestica [apple tree]
emb|CDY50417.1|  BnaC03g45010D                                        86.7    3e-18   Brassica napus [oilseed rape]
ref|XP_007154604.1|  hypothetical protein PHAVU_003G132700g           86.3    4e-18   Phaseolus vulgaris [French bean]
gb|AAM67006.1|  unknown                                               85.5    7e-18   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565336.1|  vacuolar protein sorting-associated protein 2-1     85.5    8e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005648513.1|  subunit of the ESCRT-III complex                 85.9    8e-18   Coccomyxa subellipsoidea C-169
ref|XP_010920625.1|  PREDICTED: vacuolar protein sorting-associat...  85.5    9e-18   Elaeis guineensis
ref|XP_009136187.1|  PREDICTED: vacuolar protein sorting-associat...  85.1    1e-17   Brassica rapa
ref|XP_010920624.1|  PREDICTED: vacuolar protein sorting-associat...  84.3    2e-17   Elaeis guineensis
ref|XP_001762082.1|  predicted protein                                82.8    1e-16   Physcomitrella patens
ref|XP_005849915.1|  hypothetical protein CHLNCDRAFT_30464            80.5    2e-16   Chlorella variabilis
gb|KIZ03360.1|  charged multivesicular body protein 2A                75.5    4e-14   Monoraphidium neglectum
ref|XP_011399106.1|  Vacuolar protein sorting-associated protein ...  73.2    2e-13   Auxenochlorella protothecoides
ref|XP_010090117.1|  Vacuolar protein sorting-associated protein ...  73.2    3e-13   Morus notabilis
ref|XP_006396106.1|  hypothetical protein EUTSA_v10002656mg           72.8    3e-13   Eutrema salsugineum
ref|XP_002951144.1|  hypothetical protein VOLCADRAFT_81374            72.4    4e-13   Volvox carteri f. nagariensis
ref|XP_001698676.1|  subunit of the ESCRT-III complex                 70.5    2e-12   Chlamydomonas reinhardtii
gb|EJW78099.1|  hypothetical protein WUBG_10997                       67.8    2e-12   Wuchereria bancrofti [agent of lymphatic filariasis]
gb|EGT49800.1|  hypothetical protein CAEBREN_01727                    69.7    4e-12   Caenorhabditis brenneri
ref|XP_003099868.1|  CRE-VPS-2 protein                                68.6    1e-11   Caenorhabditis remanei
ref|XP_002631917.1|  Hypothetical protein CBG07905                    68.6    1e-11   Caenorhabditis briggsae
emb|CDP95331.1|  Protein BM-VPS-2                                     68.6    1e-11   Brugia malayi [agent of lymphatic filariasis]
ref|XP_001891908.1|  SNF7 family protein                              68.2    1e-11   Brugia malayi [agent of lymphatic filariasis]
ref|NP_496717.1|  Protein VPS-2                                       68.2    1e-11   Caenorhabditis elegans [roundworm]
emb|CAP27833.2|  Protein CBR-VPS-2                                    68.2    1e-11   Caenorhabditis briggsae
ref|XP_003384449.1|  PREDICTED: charged multivesicular body prote...  68.2    1e-11   Amphimedon queenslandica
ref|XP_007955188.1|  PREDICTED: charged multivesicular body prote...  67.8    2e-11   Orycteropus afer afer
ref|XP_003284061.1|  hypothetical protein DICPUDRAFT_45207            67.0    2e-11   Dictyostelium purpureum
emb|CAF31714.1|  putative Snf7-like protein                           67.0    3e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CAF31711.1|  putative Snf7-like protein                           67.0    3e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CAF31732.1|  putative Snf7-like protein                           67.0    3e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CAF31689.1|  putative Snf7-like protein                           67.0    3e-11   Arabidopsis thaliana [mouse-ear cress]
gb|ETN80536.1|  SNF7 family protein                                   67.0    3e-11   Necator americanus
emb|CAF31658.1|  putative Snf7-like protein                           67.0    3e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CAF31698.1|  putative Snf7-like protein                           67.0    3e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CAF31716.1|  putative Snf7-like protein                           67.0    3e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CAF31753.1|  putative Snf7-like protein                           67.0    3e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CAF31744.1|  putative Snf7-like protein                           67.0    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010769431.1|  PREDICTED: charged multivesicular body prote...  67.0    3e-11   Notothenia coriiceps [yellowbelly rockcod]
gb|EDL38081.1|  chromatin modifying protein 2A, isoform CRA_c         64.3    3e-11   Mus musculus [mouse]
ref|XP_007539072.1|  PREDICTED: charged multivesicular body prote...  67.0    4e-11   Erinaceus europaeus [common hedgehog]
emb|CBY08846.1|  unnamed protein product                              66.6    4e-11   Oikopleura dioica
ref|XP_629585.1|  SNF7 family protein                                 66.6    4e-11   Dictyostelium discoideum AX4
emb|CBY33517.1|  unnamed protein product                              66.6    4e-11   Oikopleura dioica
ref|XP_003766804.1|  PREDICTED: charged multivesicular body prote...  66.6    4e-11   Sarcophilus harrisii
gb|KHJ89884.1|  SNF7 family protein                                   66.6    4e-11   Oesophagostomum dentatum [nodule worm]
ref|NP_001085225.1|  charged multivesicular body protein 2a           66.6    5e-11   Xenopus laevis [clawed frog]
gb|KHJ93951.1|  SNF7 family protein                                   66.2    5e-11   Oesophagostomum dentatum [nodule worm]
ref|NP_001005008.1|  charged multivesicular body protein 2a           66.2    5e-11   Xenopus tropicalis [western clawed frog]
ref|XP_005831418.1|  vacuolar protein sorting 2B                      66.2    6e-11   Guillardia theta CCMP2712
gb|EDL38079.1|  chromatin modifying protein 2A, isoform CRA_a         65.5    7e-11   Mus musculus [mouse]
emb|CAF31740.1|  putative Snf7-like protein                           65.9    7e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KFD70564.1|  hypothetical protein M514_17357                       65.9    8e-11   Trichuris suis
gb|KHN72592.1|  Charged multivesicular body protein 2a                65.9    8e-11   Toxocara canis
emb|CAG00640.1|  unnamed protein product                              65.9    8e-11   Tetraodon nigroviridis
ref|XP_004358774.1|  SNF7 family protein                              65.9    8e-11   Dictyostelium fasciculatum
emb|CDW54979.1|  charged multivesicular body protein 2a               65.9    8e-11   Trichuris trichiura
ref|XP_003144918.1|  SNF7 family protein                              65.1    9e-11   Loa loa
emb|CDJ96210.1|  Snf7 domain containing protein                       65.5    1e-10   Haemonchus contortus [red stomach worm]
ref|XP_006877389.1|  PREDICTED: charged multivesicular body prote...  65.5    1e-10   Chrysochloris asiatica
ref|XP_002927108.1|  PREDICTED: charged multivesicular body prote...  65.5    1e-10   Ailuropoda melanoleuca
ref|XP_007123173.1|  PREDICTED: charged multivesicular body prote...  66.6    1e-10   Physeter catodon
ref|XP_007175446.1|  PREDICTED: charged multivesicular body prote...  66.6    1e-10   Balaenoptera acutorostrata scammoni
ref|XP_006172664.1|  PREDICTED: charged multivesicular body prote...  65.5    1e-10   Camelus ferus
ref|XP_004647797.1|  PREDICTED: charged multivesicular body prote...  65.5    1e-10   Octodon degus
ref|XP_004439189.1|  PREDICTED: charged multivesicular body prote...  65.5    1e-10   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_850536.1|  PREDICTED: charged multivesicular body protein ...  65.5    1e-10   Canis lupus familiaris [dogs]
ref|XP_004015515.1|  PREDICTED: charged multivesicular body prote...  65.5    1e-10   Ovis aries [domestic sheep]
ref|XP_010864287.1|  PREDICTED: charged multivesicular body prote...  65.5    1e-10   Esox lucius
gb|AAP36792.1|  Homo sapiens putative breast adenocarcinoma marke...  65.5    1e-10   synthetic construct
emb|CDQ60173.1|  unnamed protein product                              65.5    1e-10   Oncorhynchus mykiss
gb|ABW77501.1|  chromatin modifying protein 2a                        65.5    1e-10   Salmo salar
ref|NP_055268.1|  charged multivesicular body protein 2a              65.5    1e-10   Homo sapiens [man]
ref|XP_006903091.1|  PREDICTED: charged multivesicular body prote...  65.5    1e-10   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004616979.1|  PREDICTED: charged multivesicular body prote...  65.5    1e-10   Sorex araneus [Eurasian shrew]
ref|XP_004283295.1|  PREDICTED: charged multivesicular body prote...  65.5    1e-10   Orcinus orca [Orca]
ref|XP_005857339.1|  PREDICTED: charged multivesicular body prote...  65.5    1e-10   Myotis brandtii
ref|NP_001029722.1|  charged multivesicular body protein 2a           65.5    1e-10   Bos taurus [bovine]
gb|ETE58348.1|  Charged multivesicular body protein 2a                65.5    1e-10   Ophiophagus hannah
ref|XP_006747839.1|  PREDICTED: charged multivesicular body prote...  65.5    1e-10   Leptonychotes weddellii
ref|XP_005693091.1|  PREDICTED: charged multivesicular body prote...  65.5    1e-10   
ref|XP_006904815.1|  PREDICTED: charged multivesicular body prote...  65.5    1e-10   Pteropus alecto
ref|XP_003082345.1|  charged multivesicular body protein 2a (IC)      65.5    1e-10   Ostreococcus tauri
gb|ELK18813.1|  Charged multivesicular body protein 2a                65.5    1e-10   Pteropus alecto
ref|XP_004866580.1|  PREDICTED: charged multivesicular body prote...  65.5    1e-10   
ref|XP_008821010.1|  PREDICTED: charged multivesicular body prote...  65.1    1e-10   Nannospalax galili
ref|NP_081161.1|  charged multivesicular body protein 2a              65.1    1e-10   Mus musculus [mouse]
ref|XP_005960552.1|  PREDICTED: charged multivesicular body prote...  65.1    1e-10   Pantholops hodgsonii
ref|XP_010960333.1|  PREDICTED: charged multivesicular body prote...  65.1    1e-10   Camelus bactrianus [camel]
ref|XP_009231559.1|  PREDICTED: charged multivesicular body prote...  65.1    1e-10   Pongo abelii [orang utan]
gb|EJD73891.1|  hypothetical protein LOAG_18723                       65.1    1e-10   Loa loa
gb|EHB03822.1|  Charged multivesicular body protein 2a                65.1    2e-10   Heterocephalus glaber [naked mole rat]
ref|XP_002124006.1|  PREDICTED: charged multivesicular body prote...  65.1    2e-10   Ciona intestinalis [sea vase]
ref|XP_008987101.1|  PREDICTED: charged multivesicular body prote...  65.5    2e-10   Callithrix jacchus [common marmoset]
ref|XP_006103425.1|  PREDICTED: charged multivesicular body prote...  66.2    2e-10   
ref|NP_001188107.1|  charged multivesicular body protein 2a           65.1    2e-10   Ictalurus punctatus
ref|XP_001515747.3|  PREDICTED: charged multivesicular body prote...  63.2    2e-10   
ref|XP_010987515.1|  PREDICTED: charged multivesicular body prote...  64.7    2e-10   Camelus dromedarius [camel]
ref|XP_009193818.1|  PREDICTED: charged multivesicular body prote...  65.1    2e-10   Papio anubis [baboon]
ref|XP_003961124.1|  PREDICTED: charged multivesicular body prote...  64.7    2e-10   Takifugu rubripes [tiger puffer]
ref|XP_004886142.1|  PREDICTED: charged multivesicular body prote...  65.1    2e-10   
gb|EDL75761.1|  similar to RIKEN cDNA 1500016L11 (predicted), iso...  64.7    2e-10   Rattus norvegicus [brown rat]
ref|XP_005258803.1|  PREDICTED: charged multivesicular body prote...  65.1    2e-10   Homo sapiens [man]
ref|XP_004405739.1|  PREDICTED: charged multivesicular body prote...  65.1    2e-10   
ref|XP_006103424.1|  PREDICTED: charged multivesicular body prote...  66.2    2e-10   
ref|XP_010177418.1|  PREDICTED: charged multivesicular body prote...  64.3    2e-10   Mesitornis unicolor
gb|AAI71414.1|  Bc2 protein                                           64.7    2e-10   Danio rerio [leopard danio]
ref|XP_006228179.1|  PREDICTED: charged multivesicular body prote...  65.1    2e-10   Rattus norvegicus [brown rat]
ref|XP_006027537.1|  PREDICTED: charged multivesicular body prote...  64.7    2e-10   Alligator sinensis
emb|CEP16799.1|  hypothetical protein                                 64.7    2e-10   Parasitella parasitica
gb|KFO77177.1|  Charged multivesicular body protein 2a                64.3    2e-10   Cuculus canorus
ref|XP_006267388.1|  PREDICTED: charged multivesicular body prote...  64.7    2e-10   Alligator mississippiensis
ref|XP_007259175.1|  PREDICTED: charged multivesicular body prote...  64.7    2e-10   Astyanax mexicanus [blind cave fish]
ref|XP_002721945.1|  PREDICTED: charged multivesicular body prote...  64.7    2e-10   Oryctolagus cuniculus [domestic rabbit]
ref|XP_006103426.1|  PREDICTED: charged multivesicular body prote...  65.1    2e-10   
ref|XP_007432026.1|  PREDICTED: charged multivesicular body prote...  64.3    2e-10   Python bivittatus
ref|XP_005108008.1|  PREDICTED: charged multivesicular body prote...  64.3    3e-10   Aplysia californica
ref|NP_001158542.1|  Charged multivesicular body protein 2a           64.3    3e-10   Oncorhynchus mykiss
gb|EPZ31671.1|  Charged multivesicular body protein 2a-like protein   64.3    3e-10   Rozella allomycis CSF55
gb|ACM08962.1|  Charged multivesicular body protein 2a                64.3    3e-10   Salmo salar
ref|XP_006010043.1|  PREDICTED: charged multivesicular body prote...  64.3    3e-10   
ref|XP_005233068.1|  PREDICTED: charged multivesicular body prote...  63.9    3e-10   
ref|XP_006540407.1|  PREDICTED: charged multivesicular body prote...  64.7    3e-10   Mus musculus [mouse]
ref|XP_009698912.1|  PREDICTED: charged multivesicular body prote...  63.9    3e-10   Cariama cristata
ref|XP_009576231.1|  PREDICTED: charged multivesicular body prote...  63.5    3e-10   Fulmarus glacialis
gb|AAI52231.1|  Bc2 protein                                           63.9    4e-10   Danio rerio [leopard danio]
ref|XP_007096687.1|  PREDICTED: charged multivesicular body prote...  65.1    4e-10   
ref|XP_004565922.1|  PREDICTED: charged multivesicular body prote...  63.9    4e-10   Maylandia zebra
ref|XP_009492033.1|  PREDICTED: LOW QUALITY PROTEIN: charged mult...  63.5    4e-10   Pelecanus crispus
ref|XP_007512151.1|  Charged multivesicular body protein 2a           63.9    4e-10   Bathycoccus prasinos
ref|XP_010747181.1|  PREDICTED: charged multivesicular body prote...  63.5    5e-10   Larimichthys crocea [croceine croaker]
ref|XP_003448692.1|  PREDICTED: charged multivesicular body prote...  63.5    5e-10   Oreochromis niloticus
ref|XP_003224544.1|  PREDICTED: charged multivesicular body prote...  63.5    5e-10   Anolis carolinensis [Carolina anole]
ref|XP_008174106.1|  PREDICTED: charged multivesicular body prote...  63.5    5e-10   Chrysemys picta bellii
ref|XP_009283740.1|  PREDICTED: charged multivesicular body prote...  63.2    6e-10   Aptenodytes forsteri
ref|XP_005436379.1|  PREDICTED: charged multivesicular body prote...  63.5    6e-10   Falco cherrug
ref|XP_002111004.1|  hypothetical protein TRIADDRAFT_50029            63.5    6e-10   Trichoplax adhaerens
ref|XP_007067415.1|  PREDICTED: charged multivesicular body prote...  63.2    6e-10   Chelonia mydas [green seaturtle]
ref|XP_009560561.1|  PREDICTED: charged multivesicular body prote...  63.5    6e-10   Cuculus canorus
ref|XP_006133040.1|  PREDICTED: charged multivesicular body prote...  64.3    7e-10   Pelodiscus sinensis [Chinese softshell turtle]
dbj|GAN01983.1|  vacuolar sorting protein DID4                        63.2    8e-10   Mucor ambiguus
ref|XP_007572685.1|  PREDICTED: charged multivesicular body prote...  63.2    8e-10   Poecilia formosa
ref|XP_008435669.1|  PREDICTED: charged multivesicular body prote...  63.2    8e-10   Poecilia reticulata
emb|CEF60728.1|  Charged multivesicular body protein 2a               63.2    8e-10   Strongyloides ratti
ref|XP_004080703.1|  PREDICTED: charged multivesicular body prote...  62.8    8e-10   Oryzias latipes [Japanese rice fish]
ref|XP_005805434.1|  PREDICTED: charged multivesicular body prote...  62.8    9e-10   Xiphophorus maculatus
ref|XP_005534064.1|  PREDICTED: charged multivesicular body prote...  62.8    9e-10   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_001745003.1|  hypothetical protein                             62.8    9e-10   Monosiga brevicollis MX1
ref|XP_009071885.1|  PREDICTED: charged multivesicular body prote...  62.4    9e-10   Acanthisitta chloris
gb|KFP79368.1|  Charged multivesicular body protein 2a                62.4    1e-09   Acanthisitta chloris
ref|XP_009884267.1|  PREDICTED: charged multivesicular body prote...  65.1    1e-09   Charadrius vociferus
gb|EPB89927.1|  hypothetical protein HMPREF1544_03175                 62.8    1e-09   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_003747679.1|  PREDICTED: charged multivesicular body prote...  62.8    1e-09   Metaseiulus occidentalis
ref|XP_002595814.1|  hypothetical protein BRAFLDRAFT_115689           62.8    1e-09   Branchiostoma floridae
ref|XP_005515784.1|  PREDICTED: charged multivesicular body prote...  62.0    1e-09   Columba livia [carrier pigeon]
ref|XP_006680834.1|  hypothetical protein BATDEDRAFT_90635            62.0    2e-09   Batrachochytrium dendrobatidis JAM81
ref|XP_008312678.1|  PREDICTED: charged multivesicular body prote...  62.0    2e-09   Cynoglossus semilaevis
emb|CEJ00696.1|  Putative SNF7 family protein, charged multivesic...  62.0    2e-09   Rhizopus microsporus
emb|CBN81718.1|  Charged multivesicular body protein 2a               61.6    2e-09   Dicentrarchus labrax [European sea bass]
ref|XP_005431271.1|  PREDICTED: charged multivesicular body prote...  62.8    2e-09   
gb|KFM71242.1|  Charged multivesicular body protein 2a                61.2    3e-09   Stegodyphus mimosarum
ref|XP_008275984.1|  PREDICTED: charged multivesicular body prote...  61.6    3e-09   Stegastes partitus
gb|KDD71816.1|  Snf7-like protein                                     60.8    3e-09   Helicosporidium sp. ATCC 50920
ref|NP_998682.1|  charged multivesicular body protein 2a              61.2    4e-09   Danio rerio [leopard danio]
ref|XP_002161635.2|  PREDICTED: charged multivesicular body prote...  60.5    7e-09   Hydra vulgaris
ref|XP_008481454.1|  PREDICTED: charged multivesicular body prote...  60.5    8e-09   Diaphorina citri
emb|CCF46013.1|  Snf7 family protein                                  59.7    8e-09   Colletotrichum higginsianum
gb|ACO10416.1|  Charged multivesicular body protein 2a                60.1    1e-08   Caligus rogercresseyi
gb|ACO11124.1|  Charged multivesicular body protein 2a                60.1    1e-08   Caligus rogercresseyi
ref|XP_009065077.1|  hypothetical protein LOTGIDRAFT_203241           60.1    1e-08   Lottia gigantea
ref|XP_002400072.1|  vacuolar assembly/sorting protein DID4, puta...  60.1    1e-08   Ixodes scapularis [blacklegged tick]
ref|XP_011109512.1|  hypothetical protein H072_3542                   58.2    1e-08   Dactylellina haptotyla CBS 200.50
ref|XP_004992056.1|  charged multivesicular body protein 2a           59.3    1e-08   Salpingoeca rosetta
emb|CEP11046.1|  hypothetical protein                                 59.7    1e-08   Parasitella parasitica
gb|KFP04732.1|  Charged multivesicular body protein 2a                58.5    1e-08   Calypte anna
gb|EFQ25297.1|  Snf7 family protein                                   59.3    2e-08   Colletotrichum graminicola M1.001
gb|KDN61251.1|  putative Snf7 family protein                          59.3    2e-08   Colletotrichum sublineola
gb|EQB51515.1|  Snf7 family protein                                   59.3    2e-08   Colletotrichum gloeosporioides Cg-14
gb|EFX02759.1|  snf7 family protein                                   59.3    2e-08   Grosmannia clavigera kw1407
gb|KIH87200.1|  charged multivesicular body protein 2A                59.3    2e-08   Sporothrix brasiliensis 5110
gb|EXX51937.1|  Did4p                                                 59.3    2e-08   Rhizophagus irregularis DAOM 197198w
ref|XP_007882607.1|  PREDICTED: charged multivesicular body prote...  58.9    2e-08   Callorhinchus milii [Australian ghost shark]
gb|ERS98039.1|  hypothetical protein HMPREF1624_04817                 59.3    2e-08   Sporothrix schenckii ATCC 58251
gb|EPE09005.1|  snf7 family protein                                   59.3    2e-08   Ophiostoma piceae UAMH 11346
gb|EFX73396.1|  hypothetical protein DAPPUDRAFT_215551                59.3    2e-08   Daphnia pulex
ref|XP_011416153.1|  PREDICTED: charged multivesicular body prote...  58.9    2e-08   Crassostrea gigas
gb|ACO15521.1|  Charged multivesicular body protein 2a                58.9    2e-08   Caligus clemensi
ref|XP_007280695.1|  snf7 family protein                              59.7    2e-08   Colletotrichum gloeosporioides Nara gc5
gb|ACO11170.1|  Charged multivesicular body protein 2a                58.9    2e-08   Caligus rogercresseyi
gb|ACO11070.1|  Charged multivesicular body protein 2a                58.9    2e-08   
gb|ACO15754.1|  Charged multivesicular body protein 2a                58.9    3e-08   
ref|XP_007595143.1|  hypothetical protein CFIO01_07204                58.5    3e-08   
ref|XP_008597068.1|  putative class E vacuolar-protein sorting an...  58.9    3e-08   
ref|XP_003002371.1|  DOA4-independent degradation protein             58.5    3e-08   
ref|XP_007339006.1|  Snf7-domain-containing protein                   58.9    3e-08   
ref|XP_780405.1|  PREDICTED: charged multivesicular body protein ...  58.5    3e-08   
gb|ERL88001.1|  hypothetical protein D910_05390                       58.9    4e-08   
gb|ENH86510.1|  snf7 family protein                                   58.5    4e-08   
gb|KGQ04736.1|  DOA4-independent degradation protein 4                58.5    4e-08   
ref|XP_005178089.1|  PREDICTED: charged multivesicular body prote...  58.5    4e-08   
ref|XP_008497031.1|  PREDICTED: zinc finger protein 391-like          60.5    4e-08   
gb|ENN76371.1|  hypothetical protein YQE_07093                        58.5    4e-08   
ref|XP_002098945.1|  GE23653                                          58.5    5e-08   
ref|XP_002074094.1|  GK14462                                          58.5    5e-08   
emb|CEG79431.1|  Putative SNF7 family protein, charged multivesic...  60.5    5e-08   
ref|XP_002016893.1|  GL21825                                          58.5    5e-08   
gb|ESA15905.1|  hypothetical protein GLOINDRAFT_54813                 57.8    5e-08   
ref|XP_002053485.1|  GJ23912                                          58.5    5e-08   
ref|XP_001359168.2|  GA13067                                          58.5    6e-08   
ref|XP_002041345.1|  GM10303                                          58.5    6e-08   
ref|XP_002423474.1|  Charged multivesicular body protein 2A, puta...  57.8    6e-08   
ref|XP_009251527.1|  hypothetical protein FPSE_00132                  57.8    6e-08   
ref|XP_002105018.1|  GD21266                                          58.5    6e-08   
ref|XP_001981704.1|  GG11461                                          58.5    6e-08   
ref|NP_651455.1|  vacuolar protein sorting 2                          58.5    6e-08   
ref|XP_001990630.1|  GH19462                                          58.2    7e-08   
ref|XP_001999748.1|  GI24696                                          58.2    7e-08   
gb|EXX51938.1|  Did4p                                                 57.8    7e-08   
gb|EIE89863.1|  hypothetical protein RO3G_14574                       59.7    7e-08   
ref|XP_004922821.1|  PREDICTED: charged multivesicular body prote...  57.8    8e-08   
ref|XP_006963859.1|  predicted protein                                57.4    8e-08   
gb|KFA64580.1|  hypothetical protein S40285_04556                     57.8    8e-08   
gb|KEY65604.1|  hypothetical protein S7711_08791                      57.8    8e-08   
ref|XP_004333457.1|  charged multivesicular body protein 2a 2 fam...  58.5    8e-08   
gb|KFA46362.1|  hypothetical protein S40293_09367                     57.8    8e-08   
gb|EHK46574.1|  hypothetical protein TRIATDRAFT_317542                57.4    8e-08   
ref|XP_006674648.1|  SNF7 family protein                              57.4    8e-08   
emb|CCX31271.1|  Similar to DOA4-independent degradation protein ...  57.4    9e-08   
ref|XP_625164.1|  PREDICTED: charged multivesicular body protein ...  57.4    9e-08   
ref|XP_001954325.1|  GF16804                                          57.8    9e-08   
gb|KIO32456.1|  hypothetical protein M407DRAFT_18512                  57.8    9e-08   
ref|XP_007880186.1|  hypothetical protein PFL1_04471                  57.8    9e-08   
ref|XP_001635644.1|  predicted protein                                57.4    9e-08   
ref|XP_003696510.1|  PREDICTED: charged multivesicular body prote...  57.4    9e-08   
ref|XP_006623295.1|  PREDICTED: charged multivesicular body prote...  57.4    9e-08   
gb|EXV06149.1|  ESCRT-III complex subunit Vps2                        57.0    9e-08   
gb|KCW84746.1|  hypothetical protein EUGRSUZ_B01559                   58.5    9e-08   
ref|XP_003704122.1|  PREDICTED: charged multivesicular body prote...  57.4    1e-07   
gb|ACO12849.1|  Charged multivesicular body protein 2a                57.0    1e-07   
gb|EHK19803.1|  hypothetical protein TRIVIDRAFT_209821                57.0    1e-07   
gb|ACO12692.1|  Charged multivesicular body protein 2a                57.0    1e-07   
gb|ADD24056.1|  Charged multivesicular body protein 2a                57.0    1e-07   
ref|XP_003686608.1|  hypothetical protein TPHA_0G03340                57.0    1e-07   
gb|KID92610.1|  ESCRT-III component                                   58.9    1e-07   
ref|XP_001907995.1|  hypothetical protein                             57.0    1e-07   
gb|KDB16495.1|  ESCRT-III component                                   57.0    1e-07   
emb|CEF79063.1|  unnamed protein product                              57.8    1e-07   
emb|CDR42450.1|  CYFA0S09e03840g1_1                                   57.0    1e-07   
gb|KEI37340.1|  hypothetical protein L969DRAFT_53169                  58.9    1e-07   
emb|CEJ92100.1|  Putative DOA4-independent degradation protein 4      57.0    1e-07   
gb|KID78364.1|  ESCRT-III component                                   58.9    1e-07   
gb|KIE01581.1|  ESCRT-III component                                   58.5    1e-07   
gb|KHO01180.1|  ESCRT-III component                                   58.9    1e-07   
ref|XP_007818667.2|  SNF7 family protein                              58.9    1e-07   
dbj|GAA94938.1|  hypothetical protein E5Q_01593                       58.9    1e-07   
emb|CCE27527.1|  probable class E vacuolar-protein sorting and en...  57.0    1e-07   
gb|EWG51260.1|  hypothetical protein FVEG_10299                       57.0    1e-07   
gb|EMT65923.1|  DOA4-independent degradation protein 4                57.0    1e-07   
gb|EXM27147.1|  hypothetical protein FOTG_06533                       57.0    1e-07   
gb|KID62294.1|  ESCRT-III component                                   58.5    1e-07   
gb|KFH43957.1|  DOA4-independent degradation protein-like protein     57.0    1e-07   
gb|KFG82464.1|  ESCRT-III component                                   58.9    1e-07   
gb|EGU75818.1|  hypothetical protein FOXB_13665                       56.6    1e-07   
ref|XP_009217023.1|  DOA4-independent degradation protein 4           56.6    1e-07   
ref|XP_003655106.1|  hypothetical protein THITE_2118390               56.6    1e-07   
gb|AEE62278.1|  unknown                                               57.0    2e-07   
ref|XP_003045217.1|  hypothetical protein NECHADRAFT_70285            56.6    2e-07   
gb|EQL03138.1|  SNF7 family protein                                   56.6    2e-07   
ref|XP_011334692.1|  PREDICTED: charged multivesicular body prote...  56.6    2e-07   
ref|XP_006693115.1|  putative vacuolar-protein sorting-associated...  56.6    2e-07   
ref|XP_011139778.1|  PREDICTED: charged multivesicular body prote...  56.6    2e-07   
ref|XP_004518053.1|  PREDICTED: charged multivesicular body prote...  57.0    2e-07   
emb|CCG84747.1|  protein of unknown function                          56.2    2e-07   
gb|ELQ39067.1|  DOA4-independent degradation protein 4                56.2    2e-07   
ref|XP_011204584.1|  PREDICTED: charged multivesicular body prote...  56.6    2e-07   
ref|XP_011188268.1|  PREDICTED: charged multivesicular body prote...  56.6    2e-07   
ref|XP_956699.1|  SNF7 family protein                                 56.2    2e-07   
ref|XP_003712753.1|  DOA4-independent degradation protein 4           56.2    3e-07   
ref|XP_003348849.1|  hypothetical protein SMAC_01872                  56.2    3e-07   
ref|XP_007807986.1|  ESCRT-III component                              57.8    3e-07   
ref|XP_001215345.1|  charged multivesicular body protein 2a           54.7    3e-07   
ref|XP_001606844.1|  PREDICTED: charged multivesicular body prote...  55.8    3e-07   
dbj|GAM25882.1|  hypothetical protein SAMD00019534_090570             55.5    3e-07   
gb|KFB42764.1|  AGAP001285-PA-like protein                            55.8    3e-07   
ref|XP_003663153.1|  hypothetical protein MYCTH_2304659               55.8    3e-07   
gb|KIJ29861.1|  hypothetical protein M422DRAFT_268639                 56.2    3e-07   
ref|XP_003493690.1|  PREDICTED: charged multivesicular body prote...  55.8    3e-07   
ref|XP_001653066.1|  AAEL001336-PA                                    55.8    4e-07   
gb|EHJ68944.1|  hypothetical protein KGM_02113                        55.8    4e-07   
ref|XP_452125.1|  hypothetical protein                                55.8    4e-07   
ref|XP_001865636.1|  charged multivesicular body protein 2a           55.8    4e-07   
gb|KIY51140.1|  Snf7-domain-containing protein                        55.8    4e-07   
ref|XP_002550965.1|  hypothetical protein CTRG_05263                  55.8    4e-07   
gb|KDR14708.1|  Charged multivesicular body protein 2a                55.5    4e-07   
ref|XP_007919035.1|  putative doa4-independent degradation protei...  55.5    4e-07   
tpe|CBF71687.1|  TPA: SNF7 family protein (AFU_orthologue; AFUA_5...  55.5    5e-07   
ref|XP_010237376.1|  PREDICTED: vacuolar protein sorting-associat...  55.1    5e-07   
ref|XP_011298190.1|  PREDICTED: charged multivesicular body prote...  55.5    5e-07   
ref|XP_664502.1|  hypothetical protein AN6898.2                       55.5    5e-07   
ref|XP_011164272.1|  PREDICTED: charged multivesicular body prote...  55.5    5e-07   
gb|KDN45973.1|  Snf7-domain-containing protein                        55.8    5e-07   
ref|XP_001824185.2|  DOA4-independent degradation protein 4           55.1    5e-07   
ref|XP_005757884.1|  hypothetical protein EMIHUDRAFT_62400            54.3    5e-07   
ref|XP_002837346.1|  hypothetical protein                             55.1    5e-07   
gb|ELU07506.1|  hypothetical protein CAPTEDRAFT_158252                55.1    5e-07   
emb|CCO34162.1|  Charged multivesicular body protein 2a AltName: ...  54.3    5e-07   
ref|XP_007797236.1|  putative doa4-independent degradation protei...  55.5    5e-07   
gb|KIV87885.1|  hypothetical protein PV11_03402                       55.1    6e-07   
gb|KIV93530.1|  hypothetical protein PV10_04740                       55.1    6e-07   
ref|XP_008022184.1|  hypothetical protein SETTUDRAFT_167208           55.1    6e-07   
dbj|BAE63052.1|  unnamed protein product                              55.5    6e-07   
ref|XP_007684603.1|  hypothetical protein COCMIDRAFT_23388            55.1    6e-07   
ref|XP_002615211.1|  hypothetical protein CLUG_05226                  55.1    6e-07   
ref|XP_459862.2|  DEHA2E12782p                                        55.1    6e-07   
gb|EPS32372.1|  hypothetical protein PDE_07332                        55.1    6e-07   
gb|KIW59822.1|  hypothetical protein PV05_00088                       55.1    6e-07   
ref|XP_003842247.1|  similar to charged multivesicular body prote...  55.1    6e-07   
ref|XP_011063387.1|  PREDICTED: charged multivesicular body prote...  55.1    6e-07   
ref|XP_007728335.1|  hypothetical protein A1O1_09289                  55.1    6e-07   
gb|ETN59026.1|  charged multivesicular body protein 2a                55.1    7e-07   
ref|XP_001229627.1|  hypothetical protein CHGG_03111                  55.1    7e-07   
gb|KDN37423.1|  hypothetical protein RSAG8_10158                      53.9    7e-07   
ref|XP_001801046.1|  hypothetical protein SNOG_10787                  55.1    7e-07   
ref|XP_011120030.1|  hypothetical protein AOL_s00054g412              55.1    7e-07   
ref|XP_001940265.1|  charged multivesicular body protein 2a           55.1    7e-07   
ref|XP_004348045.2|  chromatin modifying protein 2a                   55.1    7e-07   
ref|XP_321862.3|  AGAP001285-PA                                       55.1    7e-07   
ref|XP_001598438.1|  hypothetical protein SS1G_00527                  55.1    7e-07   
ref|XP_002493404.1|  hypothetical protein                             54.7    7e-07   
ref|XP_001559330.1|  hypothetical protein BC1G_01994                  55.1    7e-07   
ref|XP_007732989.1|  DOA4-independent degradation protein 4           54.7    7e-07   
emb|CCD43985.1|  similar to Snf7 family protein                       55.1    8e-07   
gb|ESW99402.1|  class E vacuolar-protein sorting and endocytosis ...  54.7    8e-07   
ref|XP_001259345.1|  SNF7 family protein                              54.7    8e-07   
ref|XP_011260668.1|  PREDICTED: charged multivesicular body prote...  54.7    8e-07   
ref|XP_007749652.1|  hypothetical protein A1O5_10888                  55.1    8e-07   
gb|KIX08778.1|  hypothetical protein Z518_03435                       54.7    8e-07   
ref|XP_001274619.1|  SNF7 family protein                              54.7    8e-07   
emb|CDI55900.1|  related to DID4-class E vacuolar-protein sorting...  55.1    8e-07   
ref|XP_007761266.1|  DOA4-independent degradation protein 4           54.7    8e-07   
gb|KIW37274.1|  hypothetical protein PV06_10616                       54.7    8e-07   
gb|EZF28304.1|  hypothetical protein H101_08010                       54.7    8e-07   
ref|XP_007839222.1|  DOA4-independent degradation protein 4           54.7    8e-07   
gb|KIW87843.1|  hypothetical protein Z519_11427                       55.1    8e-07   
ref|XP_001401111.2|  DOA4-independent degradation protein 4           54.7    8e-07   
gb|KIW21586.1|  hypothetical protein PV08_02166                       54.7    9e-07   
emb|CAK42049.1|  unnamed protein product                              54.7    9e-07   
gb|EJU05591.1|  Snf7-domain-containing protein                        55.1    9e-07   
dbj|GAA90736.1|  SNF7 family protein                                  54.7    9e-07   
ref|XP_008546117.1|  PREDICTED: charged multivesicular body prote...  54.7    9e-07   
gb|KIW86536.1|  hypothetical protein Z517_01934                       55.1    9e-07   
gb|KHN17707.1|  Vacuolar protein sorting-associated protein 2 like 1  54.3    9e-07   
gb|KEZ45294.1|  hypothetical protein SAPIO_CDS2091                    54.3    1e-06   
ref|XP_007289721.1|  DOA4-independent degradation protein 4           54.7    1e-06   
gb|KFY20466.1|  hypothetical protein V491_03693                       54.7    1e-06   
ref|XP_002567407.1|  Pc21g03430                                       54.7    1e-06   
gb|EDK39259.2|  hypothetical protein PGUG_03357                       54.7    1e-06   
gb|KFH63944.1|  hypothetical protein MVEG_09769                       54.3    1e-06   
emb|CDM31010.1|  DOA4-independent degradation protein 4               54.3    1e-06   
gb|EKV05653.1|  SNF7 family protein                                   54.3    1e-06   
gb|KGO41536.1|  Snf7                                                  54.3    1e-06   
gb|EME47308.1|  hypothetical protein DOTSEDRAFT_69289                 54.3    1e-06   
gb|KDE06118.1|  hypothetical protein MVLG_03535                       54.7    1e-06   
ref|XP_753313.2|  SNF7 family protein                                 54.3    1e-06   
gb|KHJ31019.1|  putative class e vps protein of the escrt-iii com...  54.3    1e-06   
gb|KIK45916.1|  hypothetical protein CY34DRAFT_801076                 54.7    1e-06   
gb|KGG51300.1|  Snf7 family protein                                   53.5    1e-06   
emb|CBN73857.1|  conserved unknown protein                            54.7    1e-06   
gb|KFZ24094.1|  hypothetical protein V502_01428                       54.3    1e-06   
gb|KFY82194.1|  hypothetical protein V500_10737                       54.3    1e-06   
gb|KDQ12266.1|  hypothetical protein BOTBODRAFT_56843                 54.7    1e-06   
gb|EWC48184.1|  hypothetical protein DRE_02288                        56.2    1e-06   
gb|KIM96365.1|  hypothetical protein OIDMADRAFT_170012                53.9    1e-06   
ref|XP_003231031.1|  SNF7 family protein                              53.9    1e-06   
gb|EGD97456.1|  ESCRT-III component                                   54.3    1e-06   
ref|XP_002552995.1|  KLTH0D06292p                                     54.3    1e-06   
ref|XP_005778563.1|  vacuolar protein sorting protein 2A              53.9    1e-06   
gb|EYE92980.1|  SNF7 family protein                                   54.3    2e-06   
gb|EGE04340.1|  ESCRT-III component                                   53.9    2e-06   
ref|XP_003170451.1|  SNF7 family protein                              53.9    2e-06   
ref|XP_002677750.1|  charged multivesicular body protein 2a           53.9    2e-06   
gb|EHL00547.1|  putative DOA4-independent degradation protein 4       53.5    2e-06   
gb|KFY78203.1|  hypothetical protein V499_02578                       53.9    2e-06   
gb|ELR07560.1|  charged multivesicular body protein 2A                53.9    2e-06   
ref|XP_503370.1|  YALI0E00396p                                        53.5    2e-06   
gb|KFY62723.1|  hypothetical protein V496_04438                       53.9    2e-06   
ref|XP_008086251.1|  hypothetical protein GLAREA_02975                53.9    2e-06   
gb|KFY23509.1|  hypothetical protein V493_05818                       53.9    2e-06   
gb|KDQ59404.1|  hypothetical protein JAAARDRAFT_174666                54.3    2e-06   
emb|CCL98974.1|  predicted protein                                    53.9    2e-06   
gb|KFX86887.1|  hypothetical protein V490_08753                       53.9    2e-06   
gb|KIM19937.1|  hypothetical protein M408DRAFT_311171                 53.9    2e-06   
ref|XP_002734514.1|  PREDICTED: charged multivesicular body prote...  53.5    2e-06   
ref|XP_011501903.1|  PREDICTED: charged multivesicular body prote...  53.9    2e-06   
ref|XP_975186.1|  PREDICTED: charged multivesicular body protein 2a   53.5    2e-06   
emb|CEL51502.1|  Charged multivesicular body protein 2a homolog 2...  53.9    2e-06   
ref|XP_009497691.1|  hypothetical protein H696_05601                  53.1    2e-06   
ref|XP_002183441.1|  predicted protein                                53.1    3e-06   
gb|EFA86167.1|  SNF7 family protein                                   52.8    3e-06   
ref|XP_001386175.2|  class E vacuolar-protein sorting and endocyt...  53.5    3e-06   
ref|XP_003855685.1|  hypothetical protein MYCGRDRAFT_35593            53.1    3e-06   
ref|XP_007326599.1|  hypothetical protein AGABI1DRAFT_82635           53.5    3e-06   
gb|EMF16059.1|  Snf7-domain-containing protein                        53.1    3e-06   
gb|KEP53908.1|  DID4-class E vacuolar-protein sorting and endocyt...  53.5    3e-06   
gb|ELU36390.1|  sister chromatid cohesion-related protein             55.5    3e-06   
gb|KFY13748.1|  hypothetical protein V492_03050                       55.1    3e-06   
ref|XP_007396143.1|  hypothetical protein PHACADRAFT_184590           50.8    3e-06   
gb|KFY43992.1|  hypothetical protein V494_01701                       55.1    3e-06   
emb|CCU78049.1|  Class E Vps protein of the ESCRT-III complex         53.1    4e-06   
gb|EUC60652.1|  DID4-class E vacuolar-protein sorting and endocyt...  53.1    4e-06   



>ref|XP_002280053.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1 [Vitis vinifera]
 emb|CBI27837.3| unnamed protein product [Vitis vinifera]
Length=226

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGKKK PAELLRENKRMLDKSIREIE ERQGLQAQEKKLI EIKKSAK
Sbjct  1    MSFLFGKKKTPAELLRENKRMLDKSIREIERERQGLQAQEKKLIVEIKKSAK  52



>ref|XP_010261957.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Nelumbo nucifera]
Length=223

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFG KK PAELLRENKRMLDKSIREIE ERQGLQAQEKKLIAEIKKSAK
Sbjct  1    MSFLFGNKKTPAELLRENKRMLDKSIREIERERQGLQAQEKKLIAEIKKSAK  52



>emb|CAN80030.1| hypothetical protein VITISV_007913 [Vitis vinifera]
Length=226

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGKKK PAELLRENKRMLDKSIREIE ERQGLQAQEKKLI EIKKSAK
Sbjct  1    MSFLFGKKKTPAELLRENKRMLDKSIREIERERQGLQAQEKKLIVEIKKSAK  52



>ref|XP_011009583.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1 [Populus euphratica]
Length=223

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGKKK PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKKSAK
Sbjct  1    MSFLFGKKKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKSAK  52



>gb|KJB63439.1| hypothetical protein B456_010G0867002, partial [Gossypium raimondii]
Length=91

 Score = 92.4 bits (228),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K P+ELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKKSAK
Sbjct  1    MSFLFGKRKTPSELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKSAK  52



>ref|XP_006372005.1| SNF7 family protein [Populus trichocarpa]
 gb|ERP49802.1| SNF7 family protein [Populus trichocarpa]
Length=223

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGKKK PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKKSAK
Sbjct  1    MSFLFGKKKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKSAK  52



>gb|KDP33889.1| hypothetical protein JCGZ_07460 [Jatropha curcas]
Length=223

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGKKK PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKKSAK
Sbjct  1    MSFLFGKKKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKSAK  52



>gb|EYU25879.1| hypothetical protein MIMGU_mgv1a013337mg [Erythranthe guttata]
Length=223

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGKKK PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKKSAK
Sbjct  1    MSFLFGKKKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKSAK  52



>emb|CDP03113.1| unnamed protein product [Coffea canephora]
Length=223

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLDKSIR+IE ERQGLQAQEKKLIAEIKKSAK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDKSIRDIERERQGLQAQEKKLIAEIKKSAK  52



>ref|XP_007012694.1| Vacuolar protein sorting-associated protein 2 [Theobroma cacao]
 gb|EOY30313.1| Vacuolar protein sorting-associated protein 2 [Theobroma cacao]
Length=232

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKKSAK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKSAK  52



>ref|XP_010666458.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Beta vulgaris subsp. vulgaris]
Length=223

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKKSAK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKSAK  52



>ref|XP_009804303.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1 [Nicotiana sylvestris]
Length=223

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKKSAK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKSAK  52



>ref|XP_002514068.1| Charged multivesicular body protein 2a, putative [Ricinus communis]
 gb|EEF48022.1| Charged multivesicular body protein 2a, putative [Ricinus communis]
Length=223

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKKSAK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKSAK  52



>ref|XP_006353552.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Solanum tuberosum]
Length=223

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKKSAK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKSAK  52



>ref|XP_011093797.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1 [Sesamum indicum]
Length=223

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKKSAK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKSAK  52



>ref|NP_001235502.1| uncharacterized protein LOC100526885 [Glycine max]
 gb|ACU15894.1| unknown [Glycine max]
Length=156

 Score = 93.2 bits (230),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSF+FGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKKSAK
Sbjct  1    MSFIFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKSAK  52



>ref|XP_009616620.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1 [Nicotiana tomentosiformis]
Length=223

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKKSAK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKSAK  52



>ref|XP_010670585.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1 [Beta vulgaris subsp. vulgaris]
Length=223

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKKSAK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKSAK  52



>ref|XP_008450903.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1 [Cucumis melo]
Length=223

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLDKSIREI+ ERQGLQ QEKKLIAEIKKSAK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDKSIREIDRERQGLQTQEKKLIAEIKKSAK  52



>ref|XP_004144020.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Cucumis sativus]
 ref|XP_004170729.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Cucumis sativus]
 gb|KGN66277.1| hypothetical protein Csa_1G595810 [Cucumis sativus]
Length=223

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLDKSIREI+ ERQGLQ QEKKLIAEIKKSAK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDKSIREIDRERQGLQTQEKKLIAEIKKSAK  52



>gb|ACJ84123.1| unknown [Medicago truncatula]
 gb|AFK38536.1| unknown [Medicago truncatula]
 gb|KEH37542.1| charged multivesicular body protein [Medicago truncatula]
Length=223

 Score = 94.0 bits (232),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSF+FGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKKSAK
Sbjct  1    MSFIFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKSAK  52



>ref|XP_008802764.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1 [Phoenix dactylifera]
Length=223

 Score = 94.0 bits (232),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGKKK PAELLRENKRMLD+SIREIE ERQGLQ QEKKLIAEIKK+AK
Sbjct  1    MSFLFGKKKTPAELLRENKRMLDRSIREIERERQGLQTQEKKLIAEIKKTAK  52



>ref|XP_006586647.1| PREDICTED: uncharacterized protein LOC100526885 isoform X1 [Glycine 
max]
 gb|KHN12269.1| Vacuolar protein sorting-associated protein 2 like 1 [Glycine 
soja]
 gb|KHN28819.1| Vacuolar protein sorting-associated protein 2 like 1 [Glycine 
soja]
Length=223

 Score = 93.6 bits (231),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSF+FGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKKSAK
Sbjct  1    MSFIFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKSAK  52



>ref|XP_003546475.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Glycine max]
Length=223

 Score = 93.6 bits (231),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSF+FGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKKSAK
Sbjct  1    MSFIFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKSAK  52



>gb|ADE76385.1| unknown [Picea sitchensis]
Length=223

 Score = 93.6 bits (231),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGKKK PAELLRENKRMLD+SIREIE ERQGLQ QEKKLIAEIKK+AK
Sbjct  1    MSFLFGKKKTPAELLRENKRMLDRSIREIERERQGLQNQEKKLIAEIKKTAK  52



>ref|XP_004513469.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Cicer arietinum]
Length=223

 Score = 93.6 bits (231),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSF+FGKKK PAELLRENKRMLDKSIREIE ERQGLQ QEKKLI+EIKKSAK
Sbjct  1    MSFIFGKKKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLISEIKKSAK  52



>ref|XP_006451568.1| hypothetical protein CICLE_v10009411mg [Citrus clementina]
 ref|XP_006490816.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Citrus sinensis]
 gb|ESR64808.1| hypothetical protein CICLE_v10009411mg [Citrus clementina]
 gb|KDO62759.1| hypothetical protein CISIN_1g043389mg [Citrus sinensis]
Length=223

 Score = 93.6 bits (231),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLI+EIKKSAK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLISEIKKSAK  52



>ref|XP_004510438.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Cicer arietinum]
Length=224

 Score = 93.6 bits (231),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFG +K PAELLRENKRMLDKSIREIE ERQGLQ+QEKKLIAEIKKSAK
Sbjct  1    MSFLFGSRKTPAELLRENKRMLDKSIREIERERQGLQSQEKKLIAEIKKSAK  52



>ref|XP_002521345.1| Charged multivesicular body protein 2a, putative [Ricinus communis]
 gb|EEF41013.1| Charged multivesicular body protein 2a, putative [Ricinus communis]
Length=224

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGKKK PAELLRENKRM+DKSIREIE ERQGLQAQEKKLI EIKK+AK
Sbjct  1    MSFLFGKKKTPAELLRENKRMIDKSIREIERERQGLQAQEKKLIVEIKKNAK  52



>ref|XP_004251682.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1 [Solanum lycopersicum]
Length=223

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M+FLFGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKKSAK
Sbjct  1    MNFLFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKSAK  52



>ref|XP_010918392.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1 [Elaeis guineensis]
Length=223

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGKKK PAELLRENKRMLDKSIREIE ERQGLQ QEKKLI EIKK+AK
Sbjct  1    MSFLFGKKKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLITEIKKAAK  52



>ref|XP_006846124.1| hypothetical protein AMTR_s00012p00151310 [Amborella trichopoda]
 gb|ERN07799.1| hypothetical protein AMTR_s00012p00151310 [Amborella trichopoda]
Length=223

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLDKSIREIE ERQGLQAQEKKLI EIKK+AK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDKSIREIERERQGLQAQEKKLIMEIKKTAK  52



>ref|XP_010273944.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1 [Nelumbo nucifera]
Length=223

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLDKSIREIE ERQGLQ+QEKKLI EIKKSAK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDKSIREIERERQGLQSQEKKLIVEIKKSAK  52



>ref|XP_006663126.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Oryza brachyantha]
Length=225

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSF+FGK+K PAELLRENKRMLDKSIREIE ERQGLQAQEKKLIAEIKK AK
Sbjct  1    MSFIFGKRKTPAELLRENKRMLDKSIREIERERQGLQAQEKKLIAEIKKVAK  52



>gb|KDP40715.1| hypothetical protein JCGZ_24714 [Jatropha curcas]
Length=224

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGKKK PAELLRENKRM+DKSIREIE ERQGLQAQEKKLI EIKK+AK
Sbjct  1    MSFLFGKKKTPAELLRENKRMIDKSIREIERERQGLQAQEKKLIVEIKKNAK  52



>dbj|BAD11337.1| BRI1-KD interacting protein 109 [Oryza sativa Japonica Group]
Length=224

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSF+FGK+K PAELLRENKRMLDKSIREIE ERQGLQAQEKKLIAEIKK AK
Sbjct  1    MSFIFGKRKTPAELLRENKRMLDKSIREIERERQGLQAQEKKLIAEIKKVAK  52



>gb|KJB07297.1| hypothetical protein B456_001G014300 [Gossypium raimondii]
Length=196

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKK+AK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDKSIREIERERQGLQNQEKKLIAEIKKTAK  52



>ref|NP_001288541.1| vacuolar protein sorting-associated protein 2 homolog 1-like 
[Zea mays]
 gb|ACG31990.1| charged multivesicular body protein 2a [Zea mays]
 tpg|DAA39449.1| TPA: charged multivesicular body protein 2a [Zea mays]
Length=223

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLD+SIREIE ERQGLQAQEKKLI EIKK+AK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDRSIREIERERQGLQAQEKKLITEIKKTAK  52



>ref|XP_010258662.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Nelumbo nucifera]
Length=223

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLI EIKKSAK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLITEIKKSAK  52



>ref|XP_003557356.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Brachypodium distachyon]
Length=224

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLD+SIREIE ERQGLQAQEKKLI EIKK+AK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDRSIREIERERQGLQAQEKKLITEIKKTAK  52



>gb|EMT29285.1| Vacuolar protein sorting-associated 2-1-like protein [Aegilops 
tauschii]
Length=247

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKK AK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKVAK  52



>ref|XP_009416132.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1 [Musa acuminata subsp. malaccensis]
Length=223

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSF+FGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKK+AK
Sbjct  1    MSFIFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKTAK  52



>ref|NP_001132529.1| uncharacterized protein LOC100193992 [Zea mays]
 gb|ACG37331.1| charged multivesicular body protein 2a [Zea mays]
Length=223

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLD+SIREIE ERQGLQAQEKKLI EIKK+AK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDRSIREIERERQGLQAQEKKLITEIKKTAK  52



>ref|NP_001068537.1| Os11g0703400 [Oryza sativa Japonica Group]
 gb|AAX95348.1| SNF7 family, putative [Oryza sativa Japonica Group]
 gb|ABA95494.1| Charged multivesicular body protein 2a, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF28900.1| Os11g0703400 [Oryza sativa Japonica Group]
 gb|EAY81896.1| hypothetical protein OsI_37061 [Oryza sativa Indica Group]
 gb|EAZ19307.1| hypothetical protein OsJ_34849 [Oryza sativa Japonica Group]
 dbj|BAG93716.1| unnamed protein product [Oryza sativa Japonica Group]
Length=224

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSF+FGK+K PAELLRENKRMLDKSIREIE ERQGLQAQEKKLIAEIKK AK
Sbjct  1    MSFIFGKRKTPAELLRENKRMLDKSIREIERERQGLQAQEKKLIAEIKKVAK  52



>gb|ACF81407.1| unknown [Zea mays]
 tpg|DAA60093.1| TPA: charged multivesicular body protein 2a [Zea mays]
Length=223

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLD+SIREIE ERQGLQAQEKKLI EIKK+AK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDRSIREIERERQGLQAQEKKLITEIKKTAK  52



>gb|KHG00766.1| Uncharacterized protein F383_22856 [Gossypium arboreum]
 gb|KJB07295.1| hypothetical protein B456_001G014300 [Gossypium raimondii]
Length=223

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKK+AK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDKSIREIERERQGLQNQEKKLIAEIKKTAK  52



>gb|AFK39133.1| unknown [Lotus japonicus]
Length=223

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSF+FGK+K PAELLRENKRMLDKSIREIE ERQGLQAQEKKLI EIKKSAK
Sbjct  1    MSFIFGKRKTPAELLRENKRMLDKSIREIERERQGLQAQEKKLILEIKKSAK  52



>ref|XP_009403447.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Musa acuminata subsp. malaccensis]
Length=223

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSF+FGKKK PAELLRENKRMLDKSIR+IE ERQGLQ QEKKLIAEIKK+AK
Sbjct  1    MSFIFGKKKTPAELLRENKRMLDKSIRDIERERQGLQTQEKKLIAEIKKTAK  52



>ref|XP_002459581.1| hypothetical protein SORBIDRAFT_02g007010 [Sorghum bicolor]
 gb|EER96102.1| hypothetical protein SORBIDRAFT_02g007010 [Sorghum bicolor]
Length=223

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLD+SIREIE ERQGLQAQEKKLI EIKK+AK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDRSIREIERERQGLQAQEKKLITEIKKTAK  52



>ref|XP_006657579.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Oryza brachyantha]
Length=227

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLD+SIREIE ERQGLQAQEKKLI EIKK+AK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDRSIREIERERQGLQAQEKKLITEIKKTAK  52



>ref|XP_009402259.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Musa acuminata subsp. malaccensis]
Length=223

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSF+FGK+K PAELLRENKRMLDKSIREIE ERQGLQAQEKKLI EIKK+AK
Sbjct  1    MSFIFGKRKTPAELLRENKRMLDKSIREIERERQGLQAQEKKLIVEIKKTAK  52



>ref|XP_004955854.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Setaria italica]
Length=223

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLD+SIREIE ERQGLQAQEKKLI EIKK+AK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDRSIREIERERQGLQAQEKKLITEIKKTAK  52



>ref|XP_007138681.1| hypothetical protein PHAVU_009G229000g [Phaseolus vulgaris]
 gb|ESW10675.1| hypothetical protein PHAVU_009G229000g [Phaseolus vulgaris]
Length=224

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSF+FGK+K PAELLRENKRMLDKSIREIE ERQGLQAQEKKLI EIKKSAK
Sbjct  1    MSFIFGKRKTPAELLRENKRMLDKSIREIERERQGLQAQEKKLILEIKKSAK  52



>gb|EMS49992.1| Vacuolar protein sorting-associated protein 2-like protein 1 
[Triticum urartu]
Length=224

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKK AK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKVAK  52



>ref|NP_001059248.1| Os07g0236800 [Oryza sativa Japonica Group]
 dbj|BAC21461.1| breast adenocarcinoma marker-like [Oryza sativa Japonica Group]
 dbj|BAF21162.1| Os07g0236800 [Oryza sativa Japonica Group]
 dbj|BAG92302.1| unnamed protein product [Oryza sativa Japonica Group]
Length=225

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLD+SIREIE ERQGLQAQEKKLI EIKK+AK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDRSIREIERERQGLQAQEKKLITEIKKTAK  52



>ref|XP_008776678.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Phoenix dactylifera]
Length=223

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGKKK PAELLRENKRMLD+SIREIE ERQGLQ QEKKLI EIKK+AK
Sbjct  1    MSFLFGKKKTPAELLRENKRMLDRSIREIERERQGLQTQEKKLITEIKKAAK  52



>ref|XP_002977724.1| hypothetical protein SELMODRAFT_268105 [Selaginella moellendorffii]
 ref|XP_002979550.1| hypothetical protein SELMODRAFT_153345 [Selaginella moellendorffii]
 gb|EFJ19439.1| hypothetical protein SELMODRAFT_153345 [Selaginella moellendorffii]
 gb|EFJ21062.1| hypothetical protein SELMODRAFT_268105 [Selaginella moellendorffii]
Length=226

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGKKK PAELLRENKRMLDKSIREIE ERQ LQ QEKKLIAEIKK+AK
Sbjct  1    MSFLFGKKKTPAELLRENKRMLDKSIREIERERQNLQTQEKKLIAEIKKTAK  52



>ref|XP_010533043.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1 [Tarenaya hassleriana]
Length=224

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSF+FGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKK+AK
Sbjct  1    MSFIFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKTAK  52



>ref|XP_010047507.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1 [Eucalyptus grandis]
 gb|KCW79447.1| hypothetical protein EUGRSUZ_C00837 [Eucalyptus grandis]
Length=223

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLDKSIREI+ ERQGLQ QEKKLIAEIKK+AK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDKSIREIDRERQGLQTQEKKLIAEIKKNAK  52



>ref|XP_010541975.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1 [Tarenaya hassleriana]
Length=223

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSF+FGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKK+AK
Sbjct  1    MSFIFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKTAK  52



>ref|XP_008784527.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Phoenix dactylifera]
Length=224

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFG++K PAELLRENKRMLD+SIREIE ERQGLQAQEKKLI EIKK+AK
Sbjct  1    MSFLFGRRKTPAELLRENKRMLDRSIREIERERQGLQAQEKKLIVEIKKTAK  52



>ref|XP_010922363.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Elaeis guineensis]
Length=223

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGKKK PAELLRENKRMLD+SIREIE ERQGLQ QEKKLI EIKK+AK
Sbjct  1    MSFLFGKKKTPAELLRENKRMLDRSIREIERERQGLQTQEKKLITEIKKAAK  52



>ref|XP_002451314.1| hypothetical protein SORBIDRAFT_05g027600 [Sorghum bicolor]
 gb|EES10302.1| hypothetical protein SORBIDRAFT_05g027600 [Sorghum bicolor]
Length=224

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSF+FGKKK PAELLRENKRMLDKSIREIE ERQGLQAQEKKLI EIKK AK
Sbjct  1    MSFIFGKKKTPAELLRENKRMLDKSIREIERERQGLQAQEKKLINEIKKVAK  52



>gb|EAZ03311.1| hypothetical protein OsI_25454 [Oryza sativa Indica Group]
 gb|EAZ39215.1| hypothetical protein OsJ_23641 [Oryza sativa Japonica Group]
Length=250

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLD+SIREIE ERQGLQAQEKKLI EIKK+AK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDRSIREIERERQGLQAQEKKLITEIKKTAK  52



>ref|XP_003577210.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like isoform X1 [Brachypodium distachyon]
Length=224

 Score = 91.7 bits (226),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSF+FGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKK AK
Sbjct  1    MSFIFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKVAK  52



>ref|XP_010920626.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like isoform X3 [Elaeis guineensis]
Length=224

 Score = 91.3 bits (225),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFG +K PAELLRENKRMLD+SIREIE ERQGLQAQEKKLI EIKK+AK
Sbjct  1    MSFLFGSRKTPAELLRENKRMLDRSIREIERERQGLQAQEKKLIVEIKKTAK  52



>ref|XP_004141696.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Cucumis sativus]
 ref|XP_004169979.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Cucumis sativus]
 gb|KGN45498.1| hypothetical protein Csa_7G450570 [Cucumis sativus]
Length=220

 Score = 91.3 bits (225),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFG +K PAELLRENKRMLDKSIREIE ERQGLQ+QEKKLI EIKK+AK
Sbjct  1    MSFLFGSRKTPAELLRENKRMLDKSIREIERERQGLQSQEKKLIVEIKKNAK  52



>ref|XP_003551143.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Glycine max]
Length=223

 Score = 91.3 bits (225),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSF+FGK+K PAELLRENKRMLDKSIREI+ ERQGLQ+QEKKLI EIKKSAK
Sbjct  1    MSFIFGKRKTPAELLRENKRMLDKSIREIDRERQGLQSQEKKLILEIKKSAK  52



>ref|XP_008462317.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Cucumis melo]
Length=220

 Score = 90.9 bits (224),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFG +K PAELLRENKRMLDKSIREIE ERQGLQ+QEKKLI EIKK+AK
Sbjct  1    MSFLFGSRKTPAELLRENKRMLDKSIREIERERQGLQSQEKKLIVEIKKNAK  52



>ref|XP_008812040.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Phoenix dactylifera]
Length=224

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFG +K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLI EIKK+AK
Sbjct  1    MSFLFGNRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIVEIKKTAK  52



>ref|XP_007135472.1| hypothetical protein PHAVU_010G132400g [Phaseolus vulgaris]
 gb|ESW07466.1| hypothetical protein PHAVU_010G132400g [Phaseolus vulgaris]
Length=225

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFG +K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLI EIKK+AK
Sbjct  1    MSFLFGNRKTPAELLRENKRMLDKSIREIERERQGLQNQEKKLIVEIKKNAK  52



>ref|XP_004980059.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Setaria italica]
Length=225

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSF+FGKKK PAELLRENKRMLDKSIREIE ERQGLQ QEKKLI EIKK AK
Sbjct  1    MSFIFGKKKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLINEIKKVAK  52



>gb|KEH18460.1| charged multivesicular body protein [Medicago truncatula]
Length=224

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFG +K PAELLRENKRMLDKSIREIE ERQGLQ+QEKKLI EIKK+AK
Sbjct  1    MSFLFGSRKTPAELLRENKRMLDKSIREIERERQGLQSQEKKLIGEIKKNAK  52



>ref|NP_001151055.1| charged multivesicular body protein 2a [Zea mays]
 gb|ACG41435.1| charged multivesicular body protein 2a [Zea mays]
 gb|ACN31012.1| unknown [Zea mays]
Length=224

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSF+FGKKK PAELLRENKRMLDKSIREIE ERQGLQ QEKKLI EIKK AK
Sbjct  1    MSFIFGKKKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLINEIKKVAK  52



>ref|XP_007202543.1| hypothetical protein PRUPE_ppa011120mg [Prunus persica]
 gb|EMJ03742.1| hypothetical protein PRUPE_ppa011120mg [Prunus persica]
Length=223

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLDKSIREIE ERQ LQ QEKKLI EIKKSAK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDKSIREIERERQALQGQEKKLIMEIKKSAK  52



>ref|XP_008242200.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1 [Prunus mume]
Length=223

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLDKSIREIE ERQ LQ QEKKLI EIKKSAK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDKSIREIERERQALQGQEKKLIMEIKKSAK  52



>ref|XP_002299595.1| hypothetical protein POPTR_0001s17040g [Populus trichocarpa]
 gb|EEE84400.1| hypothetical protein POPTR_0001s17040g [Populus trichocarpa]
Length=226

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K P+ELLRENKRM+DKSIREIE ERQGLQ QEKKLI EIKK+AK
Sbjct  1    MSFLFGKRKTPSELLRENKRMMDKSIREIERERQGLQTQEKKLIVEIKKNAK  52



>ref|XP_011035695.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Populus euphratica]
Length=226

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K P+ELLRENKRM+DKSIREIE ERQGLQ QEKKLI EIKK+AK
Sbjct  1    MSFLFGKRKTPSELLRENKRMMDKSIREIERERQGLQTQEKKLIVEIKKNAK  52



>ref|XP_004287607.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1 [Fragaria vesca subsp. vesca]
Length=223

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSF+FGK+K PAELLRENKRMLDKSIREIE ER  LQAQEKKLIAEIKKSAK
Sbjct  1    MSFIFGKRKTPAELLRENKRMLDKSIREIERERGSLQAQEKKLIAEIKKSAK  52



>ref|XP_009340448.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Pyrus x bretschneideri]
Length=225

 Score = 88.2 bits (217),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLDKSIREIE ER  LQAQEKKLI EIKKSAK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDKSIREIERERGALQAQEKKLILEIKKSAK  52



>gb|EPS66336.1| hypothetical protein M569_08441 [Genlisea aurea]
Length=223

 Score = 88.2 bits (217),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFG++K PAE+LRENKRMLDKSIREIE ER GLQ QEKKLI EIKKSAK
Sbjct  1    MSFLFGRRKTPAEILRENKRMLDKSIREIERERVGLQTQEKKLIVEIKKSAK  52



>ref|XP_011078064.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1 [Sesamum indicum]
Length=223

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGKKK  AEL+RENKRMLDKSIRE+E ERQGLQ QEKKLI EIKKSAK
Sbjct  1    MSFLFGKKKTTAELMRENKRMLDKSIRELERERQGLQTQEKKLILEIKKSAK  52



>gb|KFK39894.1| hypothetical protein AALP_AA3G302700 [Arabis alpina]
Length=225

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M+ +FGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKK+AK
Sbjct  2    MNSIFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKTAK  53



>ref|XP_006298491.1| hypothetical protein CARUB_v10014566mg [Capsella rubella]
 gb|EOA31389.1| hypothetical protein CARUB_v10014566mg [Capsella rubella]
Length=225

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M+ +FGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKK+AK
Sbjct  2    MNSIFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKTAK  53



>ref|XP_010488799.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1 [Camelina sativa]
Length=225

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M+ +FGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKK+AK
Sbjct  2    MNSIFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKTAK  53



>ref|XP_010412961.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Camelina sativa]
Length=225

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M+ +FGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKK+AK
Sbjct  2    MNSIFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKTAK  53



>ref|XP_010467127.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like [Camelina sativa]
Length=227

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M+ +FGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLIAEIKK+AK
Sbjct  2    MNSIFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKTAK  53



>gb|AFK37485.1| unknown [Lotus japonicus]
Length=224

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFG +K PAELLRENKRMLDKSIREI+ ERQGLQ QEKKLI EIKK+AK
Sbjct  1    MSFLFGSRKTPAELLRENKRMLDKSIREIKRERQGLQNQEKKLIVEIKKNAK  52



>ref|XP_006396107.1| hypothetical protein EUTSA_v10002656mg [Eutrema salsugineum]
 gb|ESQ36886.1| hypothetical protein EUTSA_v10002656mg [Eutrema salsugineum]
Length=225

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M+ +FGK+K PAELLRENKRMLDKSIR+IE ERQGLQ+QEKKLIAEIKK+AK
Sbjct  2    MNSIFGKRKTPAELLRENKRMLDKSIRDIERERQGLQSQEKKLIAEIKKTAK  53



>ref|XP_008337763.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1 [Malus domestica]
Length=225

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLDKSIREIE ER  LQ QEKKLI EIKKSAK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDKSIREIERERGALQGQEKKLILEIKKSAK  52



>ref|XP_008388537.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1 [Malus domestica]
 ref|XP_009361679.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1 [Pyrus x bretschneideri]
Length=225

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K PAELLRENKRMLDKSIREIE ER  LQ QEKKLI EIKKSAK
Sbjct  1    MSFLFGKRKTPAELLRENKRMLDKSIREIERERGALQGQEKKLILEIKKSAK  52



>emb|CDY50417.1| BnaC03g45010D [Brassica napus]
Length=225

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M+ +FGK+K PAELLRENKRMLDKSIR+IE ERQGLQ QEKKLIAEIKK+AK
Sbjct  2    MNSIFGKRKTPAELLRENKRMLDKSIRDIERERQGLQTQEKKLIAEIKKTAK  53



>ref|XP_007154604.1| hypothetical protein PHAVU_003G132700g [Phaseolus vulgaris]
 gb|ESW26598.1| hypothetical protein PHAVU_003G132700g [Phaseolus vulgaris]
Length=222

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSF+FGK+K PAE++RENKRMLDKSIREIE ER GLQ+QEKKLI EIKKSAK
Sbjct  1    MSFIFGKRKTPAEIVRENKRMLDKSIREIERERLGLQSQEKKLILEIKKSAK  52



>gb|AAM67006.1| unknown [Arabidopsis thaliana]
Length=224

 Score = 85.5 bits (210),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M+ +FGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLI EIKK+AK
Sbjct  1    MNSIFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLINEIKKTAK  52



>ref|NP_565336.1| vacuolar protein sorting-associated protein 2-1 [Arabidopsis 
thaliana]
 ref|XP_002885821.1| SNF7 family protein [Arabidopsis lyrata subsp. lyrata]
 sp|Q9SKI2.2|VPS2A_ARATH RecName: Full=Vacuolar protein sorting-associated protein 2 homolog 
1; Short=AtVPS2-1; AltName: Full=Charged multivesicular 
body protein 2 homolog 1; AltName: Full=ESCRT-III complex 
subunit VPS2 homolog 1; AltName: Full=SNF7-like protein [Arabidopsis 
thaliana]
 gb|AAD25152.2| expressed protein [Arabidopsis thaliana]
 gb|AAM13999.1| unknown protein [Arabidopsis thaliana]
 gb|EFH62080.1| SNF7 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|AEC06012.1| vacuolar protein sorting-associated protein 2-1 [Arabidopsis 
thaliana]
Length=225

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M+ +FGK+K PAELLRENKRMLDKSIREIE ERQGLQ QEKKLI EIKK+AK
Sbjct  2    MNSIFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLINEIKKTAK  53



>ref|XP_005648513.1| subunit of the ESCRT-III complex [Coccomyxa subellipsoidea C-169]
 gb|EIE23969.1| subunit of the ESCRT-III complex [Coccomyxa subellipsoidea C-169]
Length=231

 Score = 85.9 bits (211),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MS+LFGKKK PAELLRENKRMLDK+IR+++ ER GLQ QEKKL+AEIKK+AK
Sbjct  1    MSWLFGKKKTPAELLRENKRMLDKAIRDLDRERVGLQTQEKKLVAEIKKTAK  52



>ref|XP_010920625.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like isoform X2 [Elaeis guineensis]
Length=228

 Score = 85.5 bits (210),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 48/56 (86%), Gaps = 4/56 (7%)
 Frame = +2

Query  185  MSFLFGKKKIPA----ELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFG +K PA    ELLRENKRMLD+SIREIE ERQGLQAQEKKLI EIKK+AK
Sbjct  1    MSFLFGSRKTPAGVIAELLRENKRMLDRSIREIERERQGLQAQEKKLIVEIKKTAK  56



>ref|XP_009136187.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1 [Brassica rapa]
 emb|CDX93097.1| BnaA03g38190D [Brassica napus]
Length=225

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M+ +FGK+K PAELLRENKRMLDKSIR+IE ERQGLQ QEKKLI EIKK+AK
Sbjct  2    MNSIFGKRKTPAELLRENKRMLDKSIRDIERERQGLQTQEKKLITEIKKTAK  53



>ref|XP_010920624.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
1-like isoform X1 [Elaeis guineensis]
Length=231

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 48/59 (81%), Gaps = 7/59 (12%)
 Frame = +2

Query  185  MSFLFGKKKIPA-------ELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFG +K PA       ELLRENKRMLD+SIREIE ERQGLQAQEKKLI EIKK+AK
Sbjct  1    MSFLFGSRKTPAVLAGVIAELLRENKRMLDRSIREIERERQGLQAQEKKLIVEIKKTAK  59



>ref|XP_001762082.1| predicted protein [Physcomitrella patens]
 gb|EDQ73186.1| predicted protein [Physcomitrella patens]
Length=229

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +2

Query  185  MSF-LFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSF LFGKKK PAELLRENKR LDKSIREIE ERQ LQ QEKKLI EIKK+AK
Sbjct  1    MSFNLFGKKKTPAELLRENKRALDKSIREIERERQNLQNQEKKLIVEIKKTAK  53



>ref|XP_005849915.1| hypothetical protein CHLNCDRAFT_30464, partial [Chlorella variabilis]
 gb|EFN57813.1| hypothetical protein CHLNCDRAFT_30464, partial [Chlorella variabilis]
Length=135

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M +LFGKKK PAELLRENKRMLD++IRE++ ER GLQ QEKKLI EIKK AK
Sbjct  1    MEWLFGKKKTPAELLRENKRMLDRAIRELDRERMGLQTQEKKLILEIKKMAK  52



>gb|KIZ03360.1| charged multivesicular body protein 2A [Monoraphidium neglectum]
Length=237

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            +FGKKK PAE+LRENKRMLDK++RE++ ER GLQ QEKKLI EIKK AK
Sbjct  1    MFGKKKTPAEILRENKRMLDKAMRELDRERMGLQNQEKKLIGEIKKMAK  49



>ref|XP_011399106.1| Vacuolar protein sorting-associated protein 2-like protein 1 
[Auxenochlorella protothecoides]
 gb|KFM26210.1| Vacuolar protein sorting-associated protein 2-like protein 1 
[Auxenochlorella protothecoides]
Length=204

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  191  FLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            +LFGK+K  AELLRENKR+LD+SIRE++ ER GLQ QEKKL+ EIKK AK
Sbjct  2    WLFGKRKTAAELLRENKRLLDRSIRELDRERTGLQNQEKKLVMEIKKMAK  51



>ref|XP_010090117.1| Vacuolar protein sorting-associated protein 2-1-like protein 
[Morus notabilis]
 gb|EXB38914.1| Vacuolar protein sorting-associated protein 2-1-like protein 
[Morus notabilis]
Length=238

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  212  IPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            + +ELLRENKRMLDKSIREIE ERQGLQAQEKKLI EIKKSAK
Sbjct  3    VISELLRENKRMLDKSIREIERERQGLQAQEKKLIMEIKKSAK  45



>ref|XP_006396106.1| hypothetical protein EUTSA_v10002656mg [Eutrema salsugineum]
 gb|ESQ36885.1| hypothetical protein EUTSA_v10002656mg [Eutrema salsugineum]
Length=220

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 5/52 (10%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M+ +FGK     +LLRENKRMLDKSIR+IE ERQGLQ+QEKKLIAEIKK+AK
Sbjct  2    MNSIFGK-----QLLRENKRMLDKSIRDIERERQGLQSQEKKLIAEIKKTAK  48



>ref|XP_002951144.1| hypothetical protein VOLCADRAFT_81374 [Volvox carteri f. nagariensis]
 gb|EFJ47673.1| hypothetical protein VOLCADRAFT_81374 [Volvox carteri f. nagariensis]
Length=221

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            LFGKKK PAE+LRENKR LDK+IRE++ ER GLQ QEKK I EIKK AK
Sbjct  5    LFGKKKTPAEMLRENKRQLDKAIRELDRERMGLQQQEKKTIMEIKKMAK  53



>ref|XP_001698676.1| subunit of the ESCRT-III complex [Chlamydomonas reinhardtii]
 gb|EDO99358.1| subunit of the ESCRT-III complex [Chlamydomonas reinhardtii]
Length=223

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
             FGKKK PAE+LRENKR LDK+IRE++ ER  LQ QEKK +AEIKK AK
Sbjct  5    FFGKKKTPAEMLRENKRQLDKAIRELDRERMSLQQQEKKTVAEIKKMAK  53



>gb|EJW78099.1| hypothetical protein WUBG_10997, partial [Wuchereria bancrofti]
Length=63

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFG+KK PAE+LR+N+R L+K++RE++ ER  L+ QEKK+IA+IKK AK
Sbjct  1    MDFLFGRKKTPAEMLRQNQRALNKAMRELDRERSRLEMQEKKIIADIKKMAK  52



>gb|EGT49800.1| hypothetical protein CAEBREN_01727 [Caenorhabditis brenneri]
Length=232

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFG++K PAELLR+N+R L K+IRE++ ERQ ++AQEKK+IA+IK  AK
Sbjct  1    MDFLFGRRKTPAELLRQNQRALQKAIRELDRERQRMEAQEKKIIADIKAMAK  52



>ref|XP_003099868.1| CRE-VPS-2 protein [Caenorhabditis remanei]
 gb|EFP10088.1| CRE-VPS-2 protein [Caenorhabditis remanei]
Length=230

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFG++K PAELLR+N+R L+K+IRE++ ER  ++AQEKK+IA+IK  AK
Sbjct  1    MDFLFGRRKTPAELLRQNQRALNKAIRELDRERARMEAQEKKIIADIKNMAK  52



>ref|XP_002631917.1| Hypothetical protein CBG07905 [Caenorhabditis briggsae]
Length=231

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFG++K PAELLR+N+R L+K+IRE++ ER  ++AQEKK+IA+IK  AK
Sbjct  1    MDFLFGRRKTPAELLRQNQRALNKAIRELDRERARMEAQEKKIIADIKNMAK  52



>emb|CDP95331.1| Protein BM-VPS-2 [Brugia malayi]
Length=232

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFG+KK PAE+LR+N+R L+K++RE++ ER  L+ QEKK+IA+IKK AK
Sbjct  14   MDFLFGRKKTPAEMLRQNQRALNKAMRELDRERSRLEMQEKKIIADIKKMAK  65



>ref|XP_001891908.1| SNF7 family protein [Brugia malayi]
Length=219

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFG+KK PAE+LR+N+R L+K++RE++ ER  L+ QEKK+IA+IKK AK
Sbjct  1    MDFLFGRKKTPAEMLRQNQRALNKAMRELDRERSRLEMQEKKIIADIKKMAK  52



>ref|NP_496717.1| Protein VPS-2 [Caenorhabditis elegans]
 emb|CAB60355.1| VPS-2 [Caenorhabditis elegans]
Length=237

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFG++K PAELLR+N+R L+K+IRE++ ER  ++AQEKK+IA+IK  AK
Sbjct  1    MDFLFGRRKTPAELLRQNQRALNKAIRELDRERARMEAQEKKVIADIKNMAK  52



>emb|CAP27833.2| Protein CBR-VPS-2 [Caenorhabditis briggsae]
Length=239

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFG++K PAELLR+N+R L+K+IRE++ ER  ++AQEKK+IA+IK  AK
Sbjct  1    MDFLFGRRKTPAELLRQNQRALNKAIRELDRERARMEAQEKKIIADIKNMAK  52



>ref|XP_003384449.1| PREDICTED: charged multivesicular body protein 2a-like [Amphimedon 
queenslandica]
Length=222

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGK+K P E+LR+N+R L K IRE+E ER  L+ QEKKLI +IKK AK
Sbjct  1    MSFLFGKRKTPEEMLRQNQRALQKVIRELEKERTALERQEKKLITDIKKMAK  52



>ref|XP_007955188.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Orycteropus afer afer]
Length=238

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = +2

Query  170  VPTIAMSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            VP  AM  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  13   VPA-AMDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  68



>ref|XP_003284061.1| hypothetical protein DICPUDRAFT_45207 [Dictyostelium purpureum]
 gb|EGC39387.1| hypothetical protein DICPUDRAFT_45207 [Dictyostelium purpureum]
Length=197

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  191  FLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            FLFGK+K P E+LREN+R L+KS+REI+ ER  LQ QEKK+I +IKK AK
Sbjct  2    FLFGKQKTPKEILRENQRALNKSMREIDRERVNLQNQEKKIILDIKKMAK  51



>emb|CAF31714.1| putative Snf7-like protein [Arabidopsis thaliana]
Length=211

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  224  LLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            LLRENKRMLDKSIREIE ERQGLQ QEKKLI EIKK+AK
Sbjct  1    LLRENKRMLDKSIREIERERQGLQTQEKKLINEIKKTAK  39



>emb|CAF31711.1| putative Snf7-like protein [Arabidopsis thaliana]
 emb|CAF31717.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31730.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31737.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
Length=211

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  224  LLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            LLRENKRMLDKSIREIE ERQGLQ QEKKLI EIKK+AK
Sbjct  1    LLRENKRMLDKSIREIERERQGLQTQEKKLINEIKKTAK  39



>emb|CAF31732.1| putative Snf7-like protein [Arabidopsis thaliana]
Length=211

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  224  LLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            LLRENKRMLDKSIREIE ERQGLQ QEKKLI EIKK+AK
Sbjct  1    LLRENKRMLDKSIREIERERQGLQTQEKKLINEIKKTAK  39



>emb|CAF31689.1| putative Snf7-like protein [Arabidopsis thaliana]
Length=211

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  224  LLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            LLRENKRMLDKSIREIE ERQGLQ QEKKLI EIKK+AK
Sbjct  1    LLRENKRMLDKSIREIERERQGLQTQEKKLINEIKKTAK  39



>gb|ETN80536.1| SNF7 family protein [Necator americanus]
Length=222

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFG++K PAELLR+N+R L+K+IRE++ E+  ++ QEKK+IAEIKK AK
Sbjct  1    MDFLFGRRKTPAELLRQNQRALNKAIRELDREKSRMEMQEKKVIAEIKKMAK  52



>emb|CAF31658.1| putative Snf7-like protein [Arabidopsis thaliana]
 emb|CAF31659.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31660.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31661.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31662.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31663.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31664.1| putative Snf7-like protein [Arabidopsis thaliana]
 emb|CAF31665.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31666.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31667.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31668.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31669.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31670.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31671.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31672.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31673.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31674.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31675.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31676.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31677.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31678.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31679.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31680.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31681.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31682.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31683.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31684.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31685.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31686.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31687.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31688.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31690.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31691.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31692.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31693.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31694.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31695.1| putative Snf7-like protein [Arabidopsis thaliana]
 emb|CAF31696.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31697.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31699.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31700.1| putative Snf7-like protein [Arabidopsis thaliana]
 emb|CAF31701.1| putative Snf7-like protein [Arabidopsis thaliana]
 emb|CAF31702.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31703.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31704.1| putative Snf7-like protein [Arabidopsis thaliana]
 emb|CAF31705.1| putative Snf7-like protein [Arabidopsis thaliana]
 emb|CAF31706.1| putative Snf7-like protein [Arabidopsis thaliana]
 emb|CAF31707.1| putative Snf7-like protein [Arabidopsis thaliana]
 emb|CAF31708.1| putative Snf7-like protein [Arabidopsis thaliana]
 emb|CAF31709.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31710.1| putative Snf7-like protein [Arabidopsis thaliana]
 emb|CAF31712.1| putative Snf7-like protein [Arabidopsis thaliana]
 emb|CAF31713.1| putative Snf7-like protein [Arabidopsis thaliana]
 emb|CAF31715.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31718.1| putative Snf7-like protein [Arabidopsis thaliana]
 emb|CAF31719.1| putative Snf7-like protein [Arabidopsis thaliana]
 emb|CAF31720.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31721.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31722.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31723.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31724.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31725.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31726.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31727.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31728.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31729.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31731.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31733.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31734.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31735.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31736.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31738.1| putative Snf7-like protein [Arabidopsis thaliana]
 emb|CAF31739.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31741.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31742.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31743.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31745.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31746.1| putative Snf7-like protein [Arabidopsis thaliana]
 emb|CAF31747.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31748.1| putative Snf7-like protein [Arabidopsis thaliana]
 emb|CAF31749.1| putative Snf7-like protein [Arabidopsis thaliana]
 emb|CAF31750.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31751.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31752.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
 emb|CAF31754.1| putative Snf7-like protein [Arabidopsis thaliana]
 emb|CAF31755.1| putative Snf7-like protein, partial [Arabidopsis thaliana]
Length=211

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  224  LLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            LLRENKRMLDKSIREIE ERQGLQ QEKKLI EIKK+AK
Sbjct  1    LLRENKRMLDKSIREIERERQGLQTQEKKLINEIKKTAK  39



>emb|CAF31698.1| putative Snf7-like protein [Arabidopsis thaliana]
Length=211

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  224  LLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            LLRENKRMLDKSIREIE ERQGLQ QEKKLI EIKK+AK
Sbjct  1    LLRENKRMLDKSIREIERERQGLQTQEKKLINEIKKTAK  39



>emb|CAF31716.1| putative Snf7-like protein [Arabidopsis thaliana]
Length=211

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  224  LLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            LLRENKRMLDKSIREIE ERQGLQ QEKKLI EIKK+AK
Sbjct  1    LLRENKRMLDKSIREIERERQGLQTQEKKLINEIKKTAK  39



>emb|CAF31753.1| putative Snf7-like protein [Arabidopsis thaliana]
Length=211

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  224  LLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            LLRENKRMLDKSIREIE ERQGLQ QEKKLI EIKK+AK
Sbjct  1    LLRENKRMLDKSIREIERERQGLQTQEKKLINEIKKTAK  39



>emb|CAF31744.1| putative Snf7-like protein [Arabidopsis thaliana]
Length=211

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  224  LLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            LLRENKRMLDKSIREIE ERQGLQ QEKKLI EIKK+AK
Sbjct  1    LLRENKRMLDKSIREIERERQGLQTQEKKLINEIKKTAK  39



>ref|XP_010769431.1| PREDICTED: charged multivesicular body protein 2a [Notothenia 
coriiceps]
Length=220

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFGK+K P E+LR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDFLFGKRKTPEEMLRQNQRALNRAMRELDRERQKLEQQEKKIIADIKKMAK  52



>gb|EDL38081.1| chromatin modifying protein 2A, isoform CRA_c [Mus musculus]
Length=56

 Score = 64.3 bits (155),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_007539072.1| PREDICTED: charged multivesicular body protein 2a [Erinaceus 
europaeus]
Length=221

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+AQEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLEAQEKKIIADIKKMAK  52



>emb|CBY08846.1| unnamed protein product [Oikopleura dioica]
Length=214

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGKKK PA+++REN+R+L +++R+++ ER  ++ QE+K+IA+IKK AK
Sbjct  1    MSFLFGKKKTPAQMMRENQRLLQRAMRDLDRERAAMEKQEQKIIADIKKMAK  52



>ref|XP_629585.1| SNF7 family protein [Dictyostelium discoideum AX4]
 sp|Q54DB1.1|CM2A2_DICDI RecName: Full=Charged multivesicular body protein 2a homolog 
2; AltName: Full=Vacuolar protein-sorting-associated protein 
2B [Dictyostelium discoideum]
 gb|EAL61179.1| SNF7 family protein [Dictyostelium discoideum AX4]
Length=198

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  191  FLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            FLFGK+K P E+LREN+R L+KS+REI+ ER  LQ QEKK+I +IKK AK
Sbjct  2    FLFGKQKTPKEVLRENQRNLNKSMREIDRERVALQNQEKKIILDIKKMAK  51



>emb|CBY33517.1| unnamed protein product [Oikopleura dioica]
Length=214

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFGKKK PA+++REN+R+L +++R+++ ER  ++ QE+K+IA+IKK AK
Sbjct  1    MSFLFGKKKTPAQMMRENQRLLQRAMRDLDRERAAMEKQEQKIIADIKKMAK  52



>ref|XP_003766804.1| PREDICTED: charged multivesicular body protein 2a [Sarcophilus 
harrisii]
Length=221

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+AQEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLEAQEKKIIADIKKMAK  52



>gb|KHJ89884.1| SNF7 family protein [Oesophagostomum dentatum]
Length=225

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFG++K PAE+LR+N+R L+K+IRE++ E+  ++ QEKK+IAEIKK AK
Sbjct  1    MDFLFGRRKTPAEMLRQNQRALNKAIRELDREKSRMEMQEKKVIAEIKKMAK  52



>ref|NP_001085225.1| charged multivesicular body protein 2a [Xenopus laevis]
 sp|Q6IP52.1|CHM2A_XENLA RecName: Full=Charged multivesicular body protein 2a; AltName: 
Full=Chromatin-modifying protein 2a; Short=CHMP2a [Xenopus 
laevis]
 gb|AAH72066.1| MGC78953 protein [Xenopus laevis]
 gb|AAI06619.1| MGC78953 protein [Xenopus laevis]
Length=220

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MEFLFGRRKTPEELLRQNQRALNRAMRELDRERQKLEQQEKKIIADIKKMAK  52



>gb|KHJ93951.1| SNF7 family protein [Oesophagostomum dentatum]
Length=180

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFG++K PAE+LR+N+R L+K+IRE++ E+  ++ QEKK+IAEIKK AK
Sbjct  1    MDFLFGRRKTPAEMLRQNQRALNKAIRELDREKSRMEMQEKKVIAEIKKMAK  52



>ref|NP_001005008.1| charged multivesicular body protein 2a [Xenopus (Silurana) tropicalis]
 sp|Q6DFS6.1|CHM2A_XENTR RecName: Full=Charged multivesicular body protein 2a; AltName: 
Full=Chromatin-modifying protein 2a; Short=CHMP2a [Xenopus 
(Silurana) tropicalis]
 gb|AAH76657.1| chromatin modifying protein 2A [Xenopus (Silurana) tropicalis]
 gb|AAH82521.1| MGC79546 protein [Xenopus (Silurana) tropicalis]
 emb|CAJ82871.1| chromatin modifying protein 2A [Xenopus (Silurana) tropicalis]
Length=220

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFG++K P E+LR+N+R L+K++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MEFLFGRRKTPEEMLRQNQRALNKAMREMDRERQKLEQQEKKIIADIKKMAK  52



>ref|XP_005831418.1| vacuolar protein sorting 2B [Guillardia theta CCMP2712]
 gb|EKX44438.1| vacuolar protein sorting 2B [Guillardia theta CCMP2712]
Length=198

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 1/53 (2%)
 Frame = +2

Query  185  MSFLFG-KKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFG KKK P EL+RE KR +DKS+REIE E+  LQ QEKK+I +I+K+AK
Sbjct  1    MSFLFGGKKKTPQELMREYKRNVDKSVREIEREKTKLQTQEKKIINDIRKAAK  53



>gb|EDL38079.1| chromatin modifying protein 2A, isoform CRA_a [Mus musculus]
Length=154

 Score = 65.5 bits (158),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>emb|CAF31740.1| putative Snf7-like protein [Arabidopsis thaliana]
Length=211

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  224  LLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            LLRENKRMLDKSIREIE ERQGLQ QEKKLI +IKK+AK
Sbjct  1    LLRENKRMLDKSIREIERERQGLQTQEKKLINQIKKTAK  39



>gb|KFD70564.1| hypothetical protein M514_17357 [Trichuris suis]
 gb|KHJ47405.1| SNF7 family protein [Trichuris suis]
Length=218

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFGK+K P E+LR+N+R+L++++R+++ ER  L+ QEKKLIA+IKK AK
Sbjct  1    MEFLFGKRKTPQEMLRQNQRVLNRAMRDLDRERGQLEGQEKKLIADIKKMAK  52



>gb|KHN72592.1| Charged multivesicular body protein 2a [Toxocara canis]
Length=219

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFG++K PAE+LR+N+R L+K++RE++ ER  L+ QEKK+IA+IKK A+
Sbjct  1    MEFLFGRRKTPAEMLRQNQRALNKAMRELDRERSRLEMQEKKIIADIKKMAR  52



>emb|CAG00640.1| unnamed protein product [Tetraodon nigroviridis]
Length=220

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M F+FG++K P ++LREN+R+L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MEFIFGRRKTPEQMLRENQRLLNRAMRELDRERQKLEQQEKKIIADIKKMAK  52



>ref|XP_004358774.1| SNF7 family protein [Dictyostelium fasciculatum]
 gb|EGG20924.1| SNF7 family protein [Dictyostelium fasciculatum]
Length=198

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  191  FLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            FLFGK+K P E+LREN+R L+KS+RE++ ER  LQ QEKK+I +IKK AK
Sbjct  2    FLFGKQKTPKEILRENQRSLNKSMRELDRERVSLQNQEKKIILDIKKMAK  51



>emb|CDW54979.1| charged multivesicular body protein 2a [Trichuris trichiura]
Length=218

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFGK+K P E+LR+N+R+L++++R+++ ER  L+ QEKKLIA+IKK AK
Sbjct  1    MEFLFGKRKTPQEMLRQNQRVLNRAMRDLDRERGQLEGQEKKLIADIKKMAK  52



>ref|XP_003144918.1| SNF7 family protein [Loa loa]
Length=146

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFG+KK P E+LR+N+R L+K++RE++ ER  L+ QEKK+I +IKK AK
Sbjct  1    MDFLFGRKKTPTEMLRQNQRALNKAMRELDRERSRLEIQEKKIIVDIKKMAK  52



>emb|CDJ96210.1| Snf7 domain containing protein [Haemonchus contortus]
Length=223

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M +LFG++K PAELLR+N+R L+K+IRE++ E+  ++ QEKK+IAEIKK AK
Sbjct  1    MEYLFGRRKTPAELLRQNQRALNKAIRELDREKSRMEMQEKKVIAEIKKMAK  52



>ref|XP_006877389.1| PREDICTED: charged multivesicular body protein 2a [Chrysochloris 
asiatica]
Length=222

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_002927108.1| PREDICTED: charged multivesicular body protein 2a [Ailuropoda 
melanoleuca]
 ref|XP_002927109.1| PREDICTED: charged multivesicular body protein 2a [Ailuropoda 
melanoleuca]
 ref|XP_008159312.1| PREDICTED: charged multivesicular body protein 2a [Eptesicus 
fuscus]
Length=222

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_007123173.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Physeter catodon]
 ref|XP_007123174.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Physeter catodon]
Length=307

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  182  AMSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            AM  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  85   AMDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  137



>ref|XP_007175446.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Balaenoptera acutorostrata scammoni]
Length=305

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  182  AMSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            AM  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  83   AMDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  135



>ref|XP_006172664.1| PREDICTED: charged multivesicular body protein 2a [Camelus ferus]
 ref|XP_006218739.1| PREDICTED: charged multivesicular body protein 2a [Vicugna pacos]
 ref|XP_010960332.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Camelus bactrianus]
 ref|XP_010960334.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Camelus bactrianus]
 gb|EPY90082.1| putative breast adenocarcinoma marker isoform 1-like protein 
[Camelus ferus]
Length=222

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_004647797.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Octodon degus]
 ref|XP_004647798.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Octodon degus]
Length=222

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_004439189.1| PREDICTED: charged multivesicular body protein 2a isoform 1 [Ceratotherium 
simum simum]
 ref|XP_004439190.1| PREDICTED: charged multivesicular body protein 2a isoform 2 [Ceratotherium 
simum simum]
Length=222

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_850536.1| PREDICTED: charged multivesicular body protein 2a isoform 2 [Canis 
lupus familiaris]
 ref|XP_004405740.1| PREDICTED: charged multivesicular body protein 2a isoform 2 [Odobenus 
rosmarus divergens]
 ref|XP_004405741.1| PREDICTED: charged multivesicular body protein 2a isoform 3 [Odobenus 
rosmarus divergens]
 ref|XP_004780496.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Mustela putorius furo]
 ref|XP_004780497.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Mustela putorius furo]
 ref|XP_004826488.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Mustela putorius furo]
 ref|XP_004826489.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Mustela putorius furo]
 ref|XP_007096688.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Panthera tigris altaica]
 ref|XP_007096689.1| PREDICTED: charged multivesicular body protein 2a isoform X3 
[Panthera tigris altaica]
 ref|XP_008542859.1| PREDICTED: charged multivesicular body protein 2a [Equus przewalskii]
 ref|XP_008542860.1| PREDICTED: charged multivesicular body protein 2a [Equus przewalskii]
 ref|XP_008704674.1| PREDICTED: charged multivesicular body protein 2a [Ursus maritimus]
 ref|XP_008704675.1| PREDICTED: charged multivesicular body protein 2a [Ursus maritimus]
 ref|XP_011287827.1| PREDICTED: charged multivesicular body protein 2a [Felis catus]
Length=222

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_004015515.1| PREDICTED: charged multivesicular body protein 2a isoform 1 [Ovis 
aries]
 ref|XP_004015516.1| PREDICTED: charged multivesicular body protein 2a isoform 2 [Ovis 
aries]
 ref|XP_004015517.1| PREDICTED: charged multivesicular body protein 2a isoform 3 [Ovis 
aries]
Length=222

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_010864287.1| PREDICTED: charged multivesicular body protein 2a [Esox lucius]
Length=220

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFGK+K P E+LR+N+R L++++R+++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MEFLFGKRKTPEEMLRQNQRALNRAMRDLDRERQRLEQQEKKIIADIKKMAK  52



>gb|AAP36792.1| Homo sapiens putative breast adenocarcinoma marker (32kD) [synthetic 
construct]
 gb|AAX36753.1| putative breast adenocarcinoma marker, partial [synthetic construct]
 gb|AAX42699.1| putative breast adenocarcinoma marker [synthetic construct]
 gb|AAX42700.1| putative breast adenocarcinoma marker, partial [synthetic construct]
 gb|AAX43716.1| putative breast adenocarcinoma marker, partial [synthetic construct]
 gb|AAX43717.1| putative breast adenocarcinoma marker, partial [synthetic construct]
Length=223

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>emb|CDQ60173.1| unnamed protein product [Oncorhynchus mykiss]
Length=220

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFGK+K P E+LR+N+R L++++R+++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MEFLFGKRKTPEEMLRQNQRALNRAMRDLDRERQRLEQQEKKIIADIKKMAK  52



>gb|ABW77501.1| chromatin modifying protein 2a [Salmo salar]
 gb|ACM09242.1| Charged multivesicular body protein 2a [Salmo salar]
 gb|ACN11087.1| Charged multivesicular body protein 2a [Salmo salar]
Length=220

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFGK+K P E+LR+N+R L++++R+++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MEFLFGKRKTPEEMLRQNQRALNRAMRDLDRERQRLEQQEKKIIADIKKMAK  52



>ref|NP_055268.1| charged multivesicular body protein 2a [Homo sapiens]
 ref|NP_940818.1| charged multivesicular body protein 2a [Homo sapiens]
 ref|NP_001181051.1| charged multivesicular body protein 2a [Macaca mulatta]
 ref|XP_512956.2| PREDICTED: charged multivesicular body protein 2a [Pan troglodytes]
 ref|XP_003277338.1| PREDICTED: charged multivesicular body protein 2a [Nomascus leucogenys]
 ref|XP_003316813.1| PREDICTED: charged multivesicular body protein 2a [Pan troglodytes]
 ref|XP_003406283.1| PREDICTED: charged multivesicular body protein 2a [Loxodonta 
africana]
 ref|XP_003795383.1| PREDICTED: charged multivesicular body protein 2a [Otolemur garnettii]
 ref|XP_003816688.1| PREDICTED: charged multivesicular body protein 2a [Pan paniscus]
 ref|XP_003816689.1| PREDICTED: charged multivesicular body protein 2a [Pan paniscus]
 ref|XP_003916327.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Papio anubis]
 ref|XP_004061664.1| PREDICTED: charged multivesicular body protein 2a isoform 1 [Gorilla 
gorilla gorilla]
 ref|XP_004061665.1| PREDICTED: charged multivesicular body protein 2a isoform 2 [Gorilla 
gorilla gorilla]
 ref|XP_004386972.1| PREDICTED: charged multivesicular body protein 2a [Trichechus 
manatus latirostris]
 ref|XP_004472777.1| PREDICTED: charged multivesicular body protein 2a isoform 1 [Dasypus 
novemcinctus]
 ref|XP_004472778.1| PREDICTED: charged multivesicular body protein 2a isoform 2 [Dasypus 
novemcinctus]
 ref|XP_004472779.1| PREDICTED: charged multivesicular body protein 2a isoform 3 [Dasypus 
novemcinctus]
 ref|XP_004472780.1| PREDICTED: charged multivesicular body protein 2a isoform 4 [Dasypus 
novemcinctus]
 ref|XP_004715715.1| PREDICTED: charged multivesicular body protein 2a [Echinops telfairi]
 ref|XP_005088009.1| PREDICTED: charged multivesicular body protein 2a [Mesocricetus 
auratus]
 ref|XP_005590681.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Macaca fascicularis]
 ref|XP_005590682.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Macaca fascicularis]
 ref|XP_006166779.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Tupaia chinensis]
 ref|XP_006166780.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Tupaia chinensis]
 ref|XP_007955189.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Orycteropus afer afer]
 ref|XP_007996652.1| PREDICTED: charged multivesicular body protein 2a [Chlorocebus 
sabaeus]
 ref|XP_007996653.1| PREDICTED: charged multivesicular body protein 2a [Chlorocebus 
sabaeus]
 ref|XP_008047931.1| PREDICTED: charged multivesicular body protein 2a [Tarsius syrichta]
 ref|XP_008967911.1| PREDICTED: charged multivesicular body protein 2a [Pan paniscus]
 ref|XP_009193820.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Papio anubis]
 ref|XP_010359481.1| PREDICTED: charged multivesicular body protein 2a [Rhinopithecus 
roxellana]
 ref|XP_010359482.1| PREDICTED: charged multivesicular body protein 2a [Rhinopithecus 
roxellana]
 sp|O43633.1|CHM2A_HUMAN RecName: Full=Charged multivesicular body protein 2a; AltName: 
Full=Chromatin-modifying protein 2a; Short=CHMP2a; AltName: 
Full=Putative breast adenocarcinoma marker BC-2; AltName: 
Full=Vacuolar protein sorting-associated protein 2-1; Short=Vps2-1; 
Short=hVps2-1 [Homo sapiens]
 gb|AAC00005.1| BC-2 protein [Homo sapiens]
 emb|CAC14310.1| BC-2 protein [Homo sapiens]
 gb|AAH02502.1| Chromatin modifying protein 2A [Homo sapiens]
 gb|AAP35962.1| putative breast adenocarcinoma marker (32kD) [Homo sapiens]
 gb|AAQ76807.1| putative breast adenocarcinoma marker [Homo sapiens]
 emb|CAG33283.1| BC-2 [Homo sapiens]
 gb|AAX32090.1| putative breast adenocarcinoma marker [synthetic construct]
 gb|AAX32091.1| putative breast adenocarcinoma marker [synthetic construct]
 gb|AAX36301.1| putative breast adenocarcinoma marker [synthetic construct]
 gb|AAX41133.1| putative breast adenocarcinoma marker [synthetic construct]
 gb|AAX41134.1| putative breast adenocarcinoma marker [synthetic construct]
 gb|EAW72609.1| chromatin modifying protein 2A, isoform CRA_b [Homo sapiens]
 gb|EAW72610.1| chromatin modifying protein 2A, isoform CRA_b [Homo sapiens]
 gb|EAW72611.1| chromatin modifying protein 2A, isoform CRA_b [Homo sapiens]
 gb|ABM83513.1| chromatin modifying protein 2A [synthetic construct]
 gb|ABM86731.1| chromatin modifying protein 2A [synthetic construct]
 dbj|BAG34913.1| unnamed protein product [Homo sapiens]
 gb|EHH30501.1| hypothetical protein EGK_11184 [Macaca mulatta]
 gb|EHH59995.1| hypothetical protein EGM_10240 [Macaca fascicularis]
 gb|ELV11456.1| Charged multivesicular body protein 2a [Tupaia chinensis]
 gb|AIC51202.1| CHMP2A, partial [synthetic construct]
Length=222

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_006903091.1| PREDICTED: charged multivesicular body protein 2a [Elephantulus 
edwardii]
Length=224

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_004616979.1| PREDICTED: charged multivesicular body protein 2a [Sorex araneus]
Length=222

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_004283295.1| PREDICTED: charged multivesicular body protein 2a isoform 1 [Orcinus 
orca]
 ref|XP_004283296.1| PREDICTED: charged multivesicular body protein 2a isoform 2 [Orcinus 
orca]
 ref|XP_004317834.1| PREDICTED: charged multivesicular body protein 2a isoform 1 [Tursiops 
truncatus]
 ref|XP_004317835.1| PREDICTED: charged multivesicular body protein 2a isoform 2 [Tursiops 
truncatus]
 ref|XP_004317836.1| PREDICTED: charged multivesicular body protein 2a isoform 3 [Tursiops 
truncatus]
 ref|XP_007123175.1| PREDICTED: charged multivesicular body protein 2a isoform X3 
[Physeter catodon]
 ref|XP_007123176.1| PREDICTED: charged multivesicular body protein 2a isoform X4 
[Physeter catodon]
 ref|XP_007123177.1| PREDICTED: charged multivesicular body protein 2a isoform X5 
[Physeter catodon]
 ref|XP_007123178.1| PREDICTED: charged multivesicular body protein 2a isoform X6 
[Physeter catodon]
 ref|XP_007123179.1| PREDICTED: charged multivesicular body protein 2a isoform X7 
[Physeter catodon]
 ref|XP_007123180.1| PREDICTED: charged multivesicular body protein 2a isoform X8 
[Physeter catodon]
 ref|XP_007175447.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Balaenoptera acutorostrata scammoni]
 ref|XP_007175448.1| PREDICTED: charged multivesicular body protein 2a isoform X3 
[Balaenoptera acutorostrata scammoni]
 ref|XP_007457549.1| PREDICTED: charged multivesicular body protein 2a [Lipotes vexillifer]
Length=222

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_005857339.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Myotis brandtii]
 ref|XP_005857338.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Myotis brandtii]
 gb|EPQ02094.1| Charged multivesicular body protein 2a [Myotis brandtii]
Length=224

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|NP_001029722.1| charged multivesicular body protein 2a [Bos taurus]
 ref|XP_005219843.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Bos taurus]
 ref|XP_005902481.1| PREDICTED: charged multivesicular body protein 2a [Bos mutus]
 ref|XP_006067343.1| PREDICTED: charged multivesicular body protein 2a [Bubalus bubalis]
 ref|XP_010855927.1| PREDICTED: charged multivesicular body protein 2a [Bison bison 
bison]
 ref|XP_010855928.1| PREDICTED: charged multivesicular body protein 2a [Bison bison 
bison]
 gb|AAI02259.1| Chromatin modifying protein 2A [Bos taurus]
 tpg|DAA19248.1| TPA: chromatin modifying protein 2A [Bos taurus]
 gb|ELR51548.1| Charged multivesicular body protein 2a [Bos mutus]
Length=222

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>gb|ETE58348.1| Charged multivesicular body protein 2a, partial [Ophiophagus 
hannah]
Length=237

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  176  TIAMSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            ++ M  LFG++K P E+LR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  15   SVRMDLLFGRRKTPEEMLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  69



>ref|XP_006747839.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Leptonychotes weddellii]
 ref|XP_006747840.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Leptonychotes weddellii]
Length=222

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKVIADIKKMAK  52



>ref|XP_005693091.1| PREDICTED: charged multivesicular body protein 2a [Capra hircus]
Length=222

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_006904815.1| PREDICTED: charged multivesicular body protein 2a [Pteropus alecto]
 ref|XP_011382938.1| PREDICTED: charged multivesicular body protein 2a [Pteropus vampyrus]
Length=224

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_003082345.1| charged multivesicular body protein 2a (IC), partial [Ostreococcus 
tauri]
Length=226

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  191  FLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            +LF K+K P ELLR+NKR LD+SIREIE ER  +  QEKKLIAEIK+ AK
Sbjct  2    WLFRKQKTPQELLRDNKRSLDRSIREIERERTQMMNQEKKLIAEIKRVAK  51



>gb|ELK18813.1| Charged multivesicular body protein 2a [Pteropus alecto]
Length=229

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_004866580.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Heterocephalus glaber]
 ref|XP_004866581.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Heterocephalus glaber]
Length=233

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  182  AMSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
             M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  11   TMDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  63



>ref|XP_008821010.1| PREDICTED: charged multivesicular body protein 2a [Nannospalax 
galili]
 ref|XP_008821011.1| PREDICTED: charged multivesicular body protein 2a [Nannospalax 
galili]
 ref|XP_008821012.1| PREDICTED: charged multivesicular body protein 2a [Nannospalax 
galili]
 ref|XP_008821013.1| PREDICTED: charged multivesicular body protein 2a [Nannospalax 
galili]
Length=222

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|NP_081161.1| charged multivesicular body protein 2a [Mus musculus]
 ref|NP_001102376.1| charged multivesicular body protein 2a [Rattus norvegicus]
 ref|XP_002762613.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Callithrix jacchus]
 ref|XP_002762614.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Callithrix jacchus]
 ref|XP_002829980.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Pongo abelii]
 ref|XP_003467238.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Cavia porcellus]
 ref|XP_003944488.1| PREDICTED: charged multivesicular body protein 2a [Saimiri boliviensis 
boliviensis]
 ref|XP_004596966.1| PREDICTED: charged multivesicular body protein 2a [Ochotona princeps]
 ref|XP_004672946.1| PREDICTED: charged multivesicular body protein 2a [Jaculus jaculus]
 ref|XP_004866582.1| PREDICTED: charged multivesicular body protein 2a isoform X3 
[Heterocephalus glaber]
 ref|XP_005002557.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Cavia porcellus]
 ref|XP_005361140.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Microtus ochrogaster]
 ref|XP_005361141.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Microtus ochrogaster]
 ref|XP_005342460.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Ictidomys tridecemlineatus]
 ref|XP_005342461.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Ictidomys tridecemlineatus]
 ref|XP_005342462.1| PREDICTED: charged multivesicular body protein 2a isoform X3 
[Ictidomys tridecemlineatus]
 ref|XP_005414459.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Chinchilla lanigera]
 ref|XP_005414460.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Chinchilla lanigera]
 ref|XP_006228180.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Rattus norvegicus]
 ref|XP_006540408.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Mus musculus]
 ref|XP_006997257.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Peromyscus maniculatus bairdii]
 ref|XP_006997258.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Peromyscus maniculatus bairdii]
 ref|XP_006997259.1| PREDICTED: charged multivesicular body protein 2a isoform X3 
[Peromyscus maniculatus bairdii]
 ref|XP_007636747.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Cricetulus griseus]
 ref|XP_007636748.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Cricetulus griseus]
 ref|XP_007636749.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Cricetulus griseus]
 ref|XP_008577185.1| PREDICTED: charged multivesicular body protein 2a [Galeopterus 
variegatus]
 ref|XP_008577186.1| PREDICTED: charged multivesicular body protein 2a [Galeopterus 
variegatus]
 ref|XP_010330678.1| PREDICTED: charged multivesicular body protein 2a [Saimiri boliviensis 
boliviensis]
 ref|XP_010614649.1| PREDICTED: charged multivesicular body protein 2a [Fukomys damarensis]
 ref|XP_010614656.1| PREDICTED: charged multivesicular body protein 2a [Fukomys damarensis]
 ref|XP_010614665.1| PREDICTED: charged multivesicular body protein 2a [Fukomys damarensis]
 ref|XP_010614674.1| PREDICTED: charged multivesicular body protein 2a [Fukomys damarensis]
 ref|XP_010614684.1| PREDICTED: charged multivesicular body protein 2a [Fukomys damarensis]
 sp|Q9DB34.1|CHM2A_MOUSE RecName: Full=Charged multivesicular body protein 2a; AltName: 
Full=Chromatin-modifying protein 2a; Short=CHMP2a; AltName: 
Full=Vacuolar protein sorting-associated protein 2; Short=mVps2 
[Mus musculus]
 dbj|BAB23919.1| unnamed protein product [Mus musculus]
 gb|AAH12230.1| Chromatin modifying protein 2A [Mus musculus]
 gb|EDL38080.1| chromatin modifying protein 2A, isoform CRA_b [Mus musculus]
 gb|EDL75763.1| similar to RIKEN cDNA 1500016L11 (predicted), isoform CRA_c [Rattus 
norvegicus]
 gb|EDL75765.1| similar to RIKEN cDNA 1500016L11 (predicted), isoform CRA_c [Rattus 
norvegicus]
 gb|AAI67093.1| Chromatin modifying protein 2A [Rattus norvegicus]
 gb|ERE43144.1| charged multivesicular body protein 2a-like protein [Cricetulus 
griseus]
 gb|KFO36441.1| Charged multivesicular body protein 2a [Fukomys damarensis]
Length=222

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_005960552.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Pantholops hodgsonii]
 ref|XP_005960553.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Pantholops hodgsonii]
Length=224

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_010960333.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Camelus bactrianus]
Length=216

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_009231559.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Pongo abelii]
Length=236

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>gb|EJD73891.1| hypothetical protein LOAG_18723 [Loa loa]
Length=219

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFG+KK P E+LR+N+R L+K++RE++ ER  L+ QEKK+I +IKK AK
Sbjct  1    MDFLFGRKKTPTEMLRQNQRALNKAMRELDRERSRLEIQEKKIIVDIKKMAK  52



>gb|EHB03822.1| Charged multivesicular body protein 2a, partial [Heterocephalus 
glaber]
Length=222

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_002124006.1| PREDICTED: charged multivesicular body protein 2a-like [Ciona 
intestinalis]
 ref|XP_009857707.1| PREDICTED: charged multivesicular body protein 2a-like [Ciona 
intestinalis]
Length=222

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFGKKK PA+ LRE KRMLD++ R+++ ER  ++AQEKK+I +IKK AK
Sbjct  1    MEFLFGKKKTPAQRLRETKRMLDRAARDLDRERVKMEAQEKKVIQDIKKMAK  52



>ref|XP_008987101.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Callithrix jacchus]
 ref|XP_008987102.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Callithrix jacchus]
 ref|XP_008987103.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Callithrix jacchus]
Length=251

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_006103425.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Myotis lucifugus]
Length=314

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  182  AMSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            AM  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  90   AMDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  142



>ref|NP_001188107.1| charged multivesicular body protein 2a [Ictalurus punctatus]
 gb|ADO28209.1| charged multivesicular body protein 2a [Ictalurus furcatus]
 gb|ADO28498.1| charged multivesicular body protein 2a [Ictalurus punctatus]
Length=220

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFG++K P E+LR+N+R L++++RE++ ERQ ++ QEKK+IA+IKK AK
Sbjct  1    MEFLFGRRKTPEEMLRQNQRALNRAMRELDRERQRMEQQEKKIIADIKKMAK  52



>ref|XP_001515747.3| PREDICTED: charged multivesicular body protein 2a-like, partial 
[Ornithorhynchus anatinus]
Length=73

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L +++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MELLFGRRKTPEELLRQNQRALTRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_010987515.1| PREDICTED: charged multivesicular body protein 2a, partial [Camelus 
dromedarius]
Length=210

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_009193818.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Papio anubis]
 ref|XP_009193819.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Papio anubis]
Length=244

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_003961124.1| PREDICTED: charged multivesicular body protein 2a-like [Takifugu 
rubripes]
Length=220

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M F+FG++K P ++LREN+R+L++++R+++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MEFIFGRRKTPEQMLRENQRLLNRAMRDLDRERQKLEQQEKKIIADIKKMAK  52



>ref|XP_004886142.1| PREDICTED: charged multivesicular body protein 2a [Heterocephalus 
glaber]
Length=242

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>gb|EDL75761.1| similar to RIKEN cDNA 1500016L11 (predicted), isoform CRA_a [Rattus 
norvegicus]
 gb|EDL75764.1| similar to RIKEN cDNA 1500016L11 (predicted), isoform CRA_a [Rattus 
norvegicus]
Length=225

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_005258803.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Homo sapiens]
 ref|XP_005258804.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Homo sapiens]
Length=265

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_004405739.1| PREDICTED: charged multivesicular body protein 2a isoform 1 [Odobenus 
rosmarus divergens]
Length=252

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_006103424.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Myotis lucifugus]
Length=359

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  182  AMSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            AM  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  90   AMDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  142



>ref|XP_010177418.1| PREDICTED: charged multivesicular body protein 2a, partial [Mesitornis 
unicolor]
 gb|KFQ20899.1| Charged multivesicular body protein 2a, partial [Mesitornis unicolor]
Length=159

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L +++RE++ ERQ L+AQEKK+I +IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALTRAMRELDRERQKLEAQEKKIIVDIKKMAK  52



>gb|AAI71414.1| Bc2 protein [Danio rerio]
Length=220

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFG++K P E+LR+N+R L++++R+++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MEFLFGRRKTPEEMLRQNQRALNRAMRDLDRERQRLEQQEKKIIADIKKMAK  52



>ref|XP_006228179.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Rattus norvegicus]
Length=247

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_006027537.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Alligator sinensis]
 ref|XP_006027538.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Alligator sinensis]
 ref|XP_006027539.1| PREDICTED: charged multivesicular body protein 2a isoform X3 
[Alligator sinensis]
Length=220

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P E+LR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEEMLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>emb|CEP16799.1| hypothetical protein [Parasitella parasitica]
Length=218

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFGKKK PAEL R+++R L K+ RE+E ERQ L+ QEKKL  +IKKSAK
Sbjct  1    MEFLFGKKKTPAELCRQHQRSLQKAQRELERERQRLERQEKKLTLDIKKSAK  52



>gb|KFO77177.1| Charged multivesicular body protein 2a, partial [Cuculus canorus]
Length=163

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L +++RE++ ERQ L+AQEKK+I +IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALTRAMRELDRERQKLEAQEKKIIVDIKKMAK  52



>ref|XP_006267388.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Alligator mississippiensis]
 ref|XP_006267389.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Alligator mississippiensis]
 ref|XP_006267390.1| PREDICTED: charged multivesicular body protein 2a isoform X3 
[Alligator mississippiensis]
Length=220

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P E+LR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEEMLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_007259175.1| PREDICTED: charged multivesicular body protein 2a-like isoform 
X1 [Astyanax mexicanus]
 ref|XP_007259176.1| PREDICTED: charged multivesicular body protein 2a-like isoform 
X2 [Astyanax mexicanus]
Length=220

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFG++K P E+LR+N+R L++++R+++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MEFLFGRRKTPEEMLRQNQRALNRAMRDLDRERQRLEQQEKKIIADIKKMAK  52



>ref|XP_002721945.1| PREDICTED: charged multivesicular body protein 2a [Oryctolagus 
cuniculus]
 ref|XP_008247257.1| PREDICTED: charged multivesicular body protein 2a [Oryctolagus 
cuniculus]
Length=222

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLEMQEKKIIADIKKMAK  52



>ref|XP_006103426.1| PREDICTED: charged multivesicular body protein 2a isoform X3 
[Myotis lucifugus]
Length=269

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_007432026.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Python bivittatus]
 ref|XP_007432027.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Python bivittatus]
 ref|XP_007432028.1| PREDICTED: charged multivesicular body protein 2a isoform X3 
[Python bivittatus]
Length=220

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P E+LR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEEMLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_005108008.1| PREDICTED: charged multivesicular body protein 2a-like isoform 
X1 [Aplysia californica]
 ref|XP_005108009.1| PREDICTED: charged multivesicular body protein 2a-like isoform 
X2 [Aplysia californica]
 ref|XP_005108010.1| PREDICTED: charged multivesicular body protein 2a-like isoform 
X3 [Aplysia californica]
Length=222

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  179  IAMSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            + + FLFG+KK P E+LR+N+R L+K++RE++ ERQ ++ QEKK+IA+I+K AK
Sbjct  1    MPLEFLFGRKKTPEEMLRQNQRALNKAMRELDRERQKMEQQEKKVIADIRKMAK  54



>ref|NP_001158542.1| Charged multivesicular body protein 2a [Oncorhynchus mykiss]
 gb|ACO08208.1| Charged multivesicular body protein 2a [Oncorhynchus mykiss]
Length=220

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFGK+K P E+LR+N+R L +++R+++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MEFLFGKRKTPEEMLRQNQRALTRAMRDLDRERQRLEQQEKKIIADIKKMAK  52



>gb|EPZ31671.1| Charged multivesicular body protein 2a-like protein [Rozella 
allomycis CSF55]
Length=205

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG+ K PAEL+RE++R++ K++RE+E ER  LQ QEKKLI +IKK+AK
Sbjct  1    MQLLFGRSKTPAELMREHQRVIQKAVRELERERGKLQQQEKKLIGDIKKAAK  52



>gb|ACM08962.1| Charged multivesicular body protein 2a [Salmo salar]
 emb|CDQ61818.1| unnamed protein product [Oncorhynchus mykiss]
Length=220

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFGK+K P E+LR+N+R L +++R+++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MEFLFGKRKTPEEMLRQNQRALTRAMRDLDRERQRLEQQEKKIIADIKKMAK  52



>ref|XP_006010043.1| PREDICTED: charged multivesicular body protein 2a [Latimeria 
chalumnae]
Length=192

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            MSFLFG +K P E+LR+N+R L++++R+++ ER  L+ QEKK+IA+IKK AK
Sbjct  1    MSFLFGTRKTPEEMLRQNQRALNRAMRDLDRERSKLEQQEKKIIADIKKMAK  52



>ref|XP_005233068.1| PREDICTED: charged multivesicular body protein 2a [Falco peregrinus]
Length=162

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L +++RE++ ERQ L+AQEKK+I +IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALARAMRELDRERQKLEAQEKKIIVDIKKMAK  52



>ref|XP_006540407.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Mus musculus]
 ref|XP_011248992.1| PREDICTED: charged multivesicular body protein 2a isoform X2 
[Mus musculus]
Length=250

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_009698912.1| PREDICTED: charged multivesicular body protein 2a, partial [Cariama 
cristata]
 gb|KFM11727.1| Charged multivesicular body protein 2a, partial [Aptenodytes 
forsteri]
 gb|KFP58519.1| Charged multivesicular body protein 2a, partial [Cariama cristata]
 gb|KGL94086.1| Charged multivesicular body protein 2a, partial [Charadrius vociferus]
Length=159

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L +++RE++ ERQ L+AQEKK+I +IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALARAMRELDRERQKLEAQEKKIIVDIKKMAK  52



>ref|XP_009576231.1| PREDICTED: charged multivesicular body protein 2a, partial [Fulmarus 
glacialis]
Length=151

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L +++RE++ ERQ L+AQEKK+I +IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALARAMRELDRERQKLEAQEKKIIVDIKKMAK  52



>gb|AAI52231.1| Bc2 protein [Danio rerio]
Length=220

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFG++K P E+LR+N+R L++++R ++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MEFLFGRRKTPEEMLRQNQRALNRAMRNLDRERQRLEQQEKKIIADIKKMAK  52



>ref|XP_007096687.1| PREDICTED: charged multivesicular body protein 2a isoform X1 
[Panthera tigris altaica]
Length=325

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L++++RE++ ERQ L+ QEKK+IA+IKK AK
Sbjct  104  MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAK  155



>ref|XP_004565922.1| PREDICTED: charged multivesicular body protein 2a-like [Maylandia 
zebra]
 ref|XP_005725837.1| PREDICTED: charged multivesicular body protein 2a-like [Pundamilia 
nyererei]
 ref|XP_005913786.1| PREDICTED: charged multivesicular body protein 2a-like [Haplochromis 
burtoni]
 ref|XP_006793256.1| PREDICTED: charged multivesicular body protein 2a-like [Neolamprologus 
brichardi]
Length=220

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFG++K P E+LR+N+R L++++RE++ ER  L+ QEKK+IA+IKK AK
Sbjct  1    MDFLFGRRKTPEEMLRQNQRALNRAMRELDRERMKLEQQEKKIIADIKKMAK  52



>ref|XP_009492033.1| PREDICTED: LOW QUALITY PROTEIN: charged multivesicular body protein 
2a, partial [Pelecanus crispus]
Length=168

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L +++RE++ ERQ L+AQEKK+I +IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALARAMRELDRERQKLEAQEKKIIVDIKKMAK  52



>ref|XP_007512151.1| Charged multivesicular body protein 2a [Bathycoccus prasinos]
 emb|CCO66239.1| Charged multivesicular body protein 2a [Bathycoccus prasinos]
Length=239

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LF KKK P+E+LRE+KR LDKSIRE++ ER  +Q QEKKL  EIK++AK
Sbjct  1    MWSLFQKKKTPSEILREHKRTLDKSIRELDRERTQMQNQEKKLTLEIKRTAK  52



>ref|XP_010747181.1| PREDICTED: charged multivesicular body protein 2a [Larimichthys 
crocea]
Length=220

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFG++K P E+LR+N+R L++++RE++ ER  L+ QEKK+IA+IKK AK
Sbjct  1    MDFLFGRRKTPEEMLRQNQRALNRAMRELDRERMKLEQQEKKIIADIKKMAK  52



>ref|XP_003448692.1| PREDICTED: charged multivesicular body protein 2a-like [Oreochromis 
niloticus]
Length=220

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFG++K P E+LR+N+R L++++RE++ ER  L+ QEKK+IA+IKK AK
Sbjct  1    MDFLFGRRKTPEEMLRQNQRALNRAMRELDRERMKLEQQEKKIIADIKKMAK  52



>ref|XP_003224544.1| PREDICTED: charged multivesicular body protein 2a [Anolis carolinensis]
Length=220

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P E+LR+N+R L++++R+++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEEMLRQNQRALNRAMRDLDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_008174106.1| PREDICTED: charged multivesicular body protein 2a [Chrysemys 
picta bellii]
 ref|XP_008174107.1| PREDICTED: charged multivesicular body protein 2a [Chrysemys 
picta bellii]
Length=220

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P E+LR+N+R L++++R+++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEEMLRQNQRALNRAMRDMDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_009283740.1| PREDICTED: charged multivesicular body protein 2a [Aptenodytes 
forsteri]
Length=190

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L +++RE++ ERQ L+AQEKK+I +IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALARAMRELDRERQKLEAQEKKIIVDIKKMAK  52



>ref|XP_005436379.1| PREDICTED: charged multivesicular body protein 2a [Falco cherrug]
Length=220

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L +++RE++ ERQ L+AQEKK+I +IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALARAMRELDRERQKLEAQEKKIIVDIKKMAK  52



>ref|XP_002111004.1| hypothetical protein TRIADDRAFT_50029 [Trichoplax adhaerens]
 gb|EDV27008.1| hypothetical protein TRIADDRAFT_50029 [Trichoplax adhaerens]
Length=228

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  179  IAMSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            + + FLFGKKK P ELL++N+R L+K+IR+++ ER  L+ QEKK+IA+IKK AK
Sbjct  1    MPLEFLFGKKKTPEELLKQNQRALNKAIRDLDRERVKLEQQEKKVIADIKKMAK  54



>ref|XP_007067415.1| PREDICTED: charged multivesicular body protein 2a [Chelonia mydas]
 gb|EMP28662.1| Charged multivesicular body protein 2a [Chelonia mydas]
Length=220

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P E+LR+N+R L++++R+++ ERQ L+ QEKK+IA+IKK AK
Sbjct  1    MDLLFGRRKTPEEMLRQNQRALNRAMRDMDRERQKLETQEKKIIADIKKMAK  52



>ref|XP_009560561.1| PREDICTED: charged multivesicular body protein 2a [Cuculus canorus]
Length=248

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L +++RE++ ERQ L+AQEKK+I +IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALTRAMRELDRERQKLEAQEKKIIVDIKKMAK  52



>ref|XP_006133040.1| PREDICTED: charged multivesicular body protein 2a [Pelodiscus 
sinensis]
Length=299

 Score = 64.3 bits (155),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = +2

Query  167  IVPTIAMSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            +VP + M  LFG++K P E+LR+N+R L++++R+++ ERQ L+ QEKK+IA+IKK AK
Sbjct  75   LVP-LRMDLLFGRRKTPEEMLRQNQRALNRAMRDLDRERQKLETQEKKIIADIKKMAK  131



>dbj|GAN01983.1| vacuolar sorting protein DID4 [Mucor ambiguus]
Length=231

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  191  FLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            FLFGK+K PAELLR+++R + K+ RE++ ER+ L+ QEKKLI++IKKSAK
Sbjct  9    FLFGKRKTPAELLRQHQRAITKAQRELDREREKLERQEKKLISDIKKSAK  58



>ref|XP_007572685.1| PREDICTED: charged multivesicular body protein 2a [Poecilia formosa]
Length=221

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFGK+K P E+LR+N+R L++++R+++ ER  L+ QEKK+IA+IKK AK
Sbjct  2    MEFLFGKRKTPEEMLRQNQRALNRAMRDLDRERMKLEQQEKKIIADIKKMAK  53



>ref|XP_008435669.1| PREDICTED: charged multivesicular body protein 2a [Poecilia reticulata]
Length=221

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFGK+K P E+LR+N+R L++++R+++ ER  L+ QEKK+IA+IKK AK
Sbjct  2    MEFLFGKRKTPEEMLRQNQRALNRAMRDLDRERMKLEQQEKKIIADIKKMAK  53



>emb|CEF60728.1| Charged multivesicular body protein 2a [Strongyloides ratti]
Length=222

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            +FGK+K PAE+LREN+R L+K++RE++ E+  L+A+EKK+IAEIKK AK
Sbjct  5    IFGKRKTPAEMLRENQRALNKAMRELDREKSRLEAEEKKVIAEIKKMAK  53



>ref|XP_004080703.1| PREDICTED: charged multivesicular body protein 2a [Oryzias latipes]
Length=220

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFGK+K P E+LR+N+R L++++R+++ ER  L+ QEKK+IA+IKK AK
Sbjct  1    MEFLFGKRKTPEEMLRQNQRALNRAMRDLDRERMKLEQQEKKIIADIKKMAK  52



>ref|XP_005805434.1| PREDICTED: charged multivesicular body protein 2a-like [Xiphophorus 
maculatus]
Length=221

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFGK+K P E+LR+N+R L++++R+++ ER  L+ QEKK+IA+IKK AK
Sbjct  2    MEFLFGKRKTPEEMLRQNQRALNRAMRDLDRERMKLEQQEKKIIADIKKMAK  53



>ref|XP_005534064.1| PREDICTED: charged multivesicular body protein 2a [Pseudopodoces 
humilis]
Length=222

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG+++ P ELLR+N+R L +++RE++ ERQ L+AQEKK+I +IKK AK
Sbjct  1    MELLFGRRRTPEELLRQNQRALARAVRELDRERQKLEAQEKKIIVDIKKMAK  52



>ref|XP_001745003.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ90236.1| predicted protein, partial [Monosiga brevicollis MX1]
Length=183

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M +LFG+KK P ELLREN+RML K++RE++ ER  L+ QE K + +IKK+AK
Sbjct  1    MEWLFGRKKTPEELLRENQRMLKKAMRELDRERTALERQEAKTLIDIKKAAK  52



>ref|XP_009071885.1| PREDICTED: charged multivesicular body protein 2a, partial [Acanthisitta 
chloris]
Length=141

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L +++RE++ ERQ L+AQEKK+I +IKK AK
Sbjct  1    MELLFGRRKSPEELLRQNQRALGRALRELDRERQKLEAQEKKIIVDIKKMAK  52



>gb|KFP79368.1| Charged multivesicular body protein 2a, partial [Acanthisitta 
chloris]
Length=158

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L +++RE++ ERQ L+AQEKK+I +IKK AK
Sbjct  1    MELLFGRRKSPEELLRQNQRALGRALRELDRERQKLEAQEKKIIVDIKKMAK  52



>ref|XP_009884267.1| PREDICTED: charged multivesicular body protein 2a [Charadrius 
vociferus]
Length=571

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L +++RE++ ERQ L+AQEKK+I +IKK AK
Sbjct  1    MDLLFGRRKTPEELLRQNQRALARAMRELDRERQKLEAQEKKIIVDIKKMAK  52



>gb|EPB89927.1| hypothetical protein HMPREF1544_03175 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=230

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  191  FLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            FLFGKKK PAELLR+++R + K+ RE++ ER+ L+ QEKKLI +IKKSAK
Sbjct  7    FLFGKKKTPAELLRQHQRAITKAQRELDREREKLERQEKKLILDIKKSAK  56



>ref|XP_003747679.1| PREDICTED: charged multivesicular body protein 2a-like [Metaseiulus 
occidentalis]
Length=222

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M +LFG++K P E+LREN+R L+K+IR+++ ER  ++ QEKKLI +IKK AK
Sbjct  1    MEWLFGRRKTPEEMLRENQRALNKAIRDLDRERTKMEQQEKKLIQDIKKQAK  52



>ref|XP_002595814.1| hypothetical protein BRAFLDRAFT_115689 [Branchiostoma floridae]
 gb|EEN51826.1| hypothetical protein BRAFLDRAFT_115689 [Branchiostoma floridae]
Length=227

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  179  IAMSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            + + +LFGKKK PAE+L++N+R L+++IR+++ ER  L+ QEKK+IA+IKK AK
Sbjct  1    MPLEWLFGKKKTPAEMLKQNQRALNRAIRDLDRERGKLEQQEKKIIADIKKMAK  54



>ref|XP_005515784.1| PREDICTED: charged multivesicular body protein 2a-like, partial 
[Columba livia]
 gb|EMC85219.1| Charged multivesicular body protein 2a, partial [Columba livia]
Length=159

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG++K P ELLR+N+R L ++ RE++ ERQ L+AQEKK+I +IKK AK
Sbjct  1    MELLFGRRKTPEELLRQNQRALARATRELDRERQKLEAQEKKIILDIKKMAK  52



>ref|XP_006680834.1| hypothetical protein BATDEDRAFT_90635 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF78426.1| hypothetical protein BATDEDRAFT_90635 [Batrachochytrium dendrobatidis 
JAM81]
Length=208

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFG +K PAE+L++++R L+K+ R+++ ER  L+ QEKKLIA+IK++AK
Sbjct  1    MDFLFGSRKTPAEMLKQHQRALNKAQRDLDRERTKLEQQEKKLIADIKRTAK  52



>ref|XP_008312678.1| PREDICTED: charged multivesicular body protein 2a [Cynoglossus 
semilaevis]
Length=220

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFGK+K P E+L++N+R L++++RE++ ER  L+ QEKK+IA+IKK AK
Sbjct  1    MEFLFGKRKTPEEILKQNQRALNRAMRELDRERMKLEQQEKKIIADIKKMAK  52



>emb|CEJ00696.1| Putative SNF7 family protein, charged multivesicular body protein 
2A [Rhizopus microsporus]
Length=224

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFGK+K PAE+LR+++R + K+ RE++ ER+ L+ QEKKLI +IKKSAK
Sbjct  1    MEFLFGKRKTPAEVLRQHQRAITKAQRELDREREKLERQEKKLILDIKKSAK  52



>emb|CBN81718.1| Charged multivesicular body protein 2a [Dicentrarchus labrax]
Length=220

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M FLFG++K P ELL++N+R L++++RE++ ER  L+ QEKK+IA+IKK AK
Sbjct  1    MDFLFGRRKSPEELLKQNQRALNRAMRELDRERMKLEQQEKKIIADIKKMAK  52



>ref|XP_005431271.1| PREDICTED: charged multivesicular body protein 2a [Geospiza fortis]
Length=294

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  185  MSFLFGKKKIPAELLRENKRMLDKSIREIEGERQGLQAQEKKLIAEIKKSAK  340
            M  LFG+++ P ELLR+N+R L +++RE+E ERQ L+AQEKK+I +IKK AK
Sbjct  1    MELLFGRRRSPEELLRQNQRALSRAVRELERERQKLEAQEKKIIVDIKKMAK  52



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 558646673120