BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP010C05 332 bp,:Filtered

Length=332
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAK27969.1|AF242373_1  cysteine protease                             134   3e-35   Ipomoea batatas [batate]
gb|AAF40415.1|AF216784_1  papain-like cysteine proteinase isoform II    133   7e-35   Ipomoea batatas [batate]
gb|AAF40414.1|AF216783_1  papain-like cysteine proteinase isoform I     133   8e-35   Ipomoea batatas [batate]
gb|AAF61440.1|AF138264_1  papain-like cysteine proteinase isoform I     133   8e-35   Ipomoea batatas [batate]
gb|AAF61441.1|AF138265_1  papain-like cysteine proteinase isoform II    133   1e-34   Ipomoea batatas [batate]
gb|AAF40416.1|AF216785_1  papain-like cysteine proteinase isoform...    132   3e-34   Ipomoea batatas [batate]
gb|KDP41743.1|  hypothetical protein JCGZ_26761                         127   1e-32   Jatropha curcas
gb|ACI04578.1|  cysteine protease-like protein                          126   2e-32   Robinia pseudoacacia [black locust]
ref|XP_002512963.1|  cysteine protease, putative                        126   5e-32   Ricinus communis
gb|KHG24064.1|  Cysteinease RD19a -like protein                         125   5e-32   Gossypium arboreum [tree cotton]
ref|XP_009406357.1|  PREDICTED: cysteine proteinase 1-like              125   6e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007042077.1|  Papain family cysteine protease                    126   6e-32   Theobroma cacao [chocolate]
ref|XP_011088458.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    125   8e-32   Sesamum indicum [beniseed]
gb|AIB06024.1|  CP2                                                     125   9e-32   Hevea brasiliensis [jebe]
gb|AAX19661.1|  cysteine proteinase                                     124   1e-31   Populus tomentosa [Chinese white poplar]
emb|CDP20652.1|  unnamed protein product                                124   2e-31   Coffea canephora [robusta coffee]
gb|KJB32561.1|  hypothetical protein B456_005G247000                    124   2e-31   Gossypium raimondii
ref|XP_011047717.1|  PREDICTED: cysteine proteinase RD19a               124   2e-31   Populus euphratica
gb|KDO49483.1|  hypothetical protein CISIN_1g017318mg                   124   2e-31   Citrus sinensis [apfelsine]
ref|XP_006487337.1|  PREDICTED: cysteine proteinase RD19a-like          124   2e-31   Citrus sinensis [apfelsine]
gb|ABQ10201.1|  cysteine protease Cp3                                   124   2e-31   Actinidia deliciosa [Chinese gooseberry]
ref|XP_010271520.1|  PREDICTED: cysteine proteinase RD19a-like          124   2e-31   Nelumbo nucifera [Indian lotus]
sp|P05993.1|PAPA5_CARPA  RecName: Full=Cysteine proteinase; AltNa...    117   2e-31   Carica papaya [mamon]
ref|XP_002280798.2|  PREDICTED: cysteine proteinase 15A                 124   2e-31   Vitis vinifera
ref|XP_002275759.1|  PREDICTED: cysteine proteinase RD19a               124   3e-31   Vitis vinifera
gb|KJB79047.1|  hypothetical protein B456_013G033800                    124   3e-31   Gossypium raimondii
emb|CAE54306.1|  putative papain-like cysteine proteinase               123   4e-31   Gossypium hirsutum [American cotton]
ref|NP_001267989.1|  cysteine protease precursor                        123   5e-31   Vitis vinifera
ref|XP_006423403.1|  hypothetical protein CICLE_v10028670mg             123   6e-31   Citrus clementina
ref|XP_011028940.1|  PREDICTED: cysteine proteinase 15A-like            123   6e-31   Populus euphratica
ref|XP_007131787.1|  hypothetical protein PHAVU_011G041600g             122   6e-31   Phaseolus vulgaris [French bean]
ref|XP_007017672.1|  Papain family cysteine protease                    123   7e-31   Theobroma cacao [chocolate]
ref|XP_003523684.1|  PREDICTED: cysteine proteinase 15A-like            122   7e-31   Glycine max [soybeans]
gb|KHG15253.1|  Cysteinease RD19a -like protein                         122   8e-31   Gossypium arboreum [tree cotton]
ref|XP_002313770.1|  cysteine proteinase A494 precursor                 122   8e-31   Populus trichocarpa [western balsam poplar]
gb|ABK92536.1|  unknown                                                 122   8e-31   Populus trichocarpa [western balsam poplar]
ref|XP_004291404.1|  PREDICTED: cysteine proteinase 15A-like            122   8e-31   Fragaria vesca subsp. vesca
ref|NP_001241450.1|  uncharacterized protein LOC100778716 precursor     122   9e-31   Glycine max [soybeans]
ref|XP_011037175.1|  PREDICTED: cysteine proteinase RD19a-like          122   1e-30   Populus euphratica
gb|ABK94801.1|  unknown                                                 122   1e-30   Populus trichocarpa [western balsam poplar]
ref|XP_010061009.1|  PREDICTED: cysteine proteinase RD19a-like          122   1e-30   Eucalyptus grandis [rose gum]
gb|KHN45894.1|  Cysteine proteinase RD19a                               122   1e-30   Glycine soja [wild soybean]
ref|XP_009373025.1|  PREDICTED: cysteine proteinase RD19a-like          122   1e-30   Pyrus x bretschneideri [bai li]
ref|XP_011092831.1|  PREDICTED: cysteine proteinase RD19a-like          122   1e-30   Sesamum indicum [beniseed]
ref|XP_010105270.1|  Cysteine proteinase 15A                            122   2e-30   Morus notabilis
ref|XP_003539008.1|  PREDICTED: cysteine proteinase RD19a-like          121   2e-30   Glycine max [soybeans]
gb|ABK96580.1|  unknown                                                 121   2e-30   Populus trichocarpa x Populus deltoides
emb|CDQ51995.1|  Cysteine proteinase                                    117   2e-30   Fagus sylvatica
ref|XP_002510469.1|  cysteine protease, putative                        121   2e-30   Ricinus communis
ref|XP_002305451.2|  cysteine proteinase A494 precursor                 121   2e-30   Populus trichocarpa [western balsam poplar]
ref|XP_004507484.1|  PREDICTED: cysteine proteinase RD19a-like          121   2e-30   Cicer arietinum [garbanzo]
ref|XP_004290288.1|  PREDICTED: probable cysteine proteinase A494       121   2e-30   Fragaria vesca subsp. vesca
dbj|BAJ53178.1|  JHL18I08.12                                            121   2e-30   Jatropha curcas
ref|XP_010268619.1|  PREDICTED: cysteine proteinase RD19a-like          121   3e-30   Nelumbo nucifera [Indian lotus]
ref|XP_004148554.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    121   3e-30   
gb|KGN43159.1|  Papain-like cysteine proteinase isoform I               121   3e-30   Cucumis sativus [cucumbers]
ref|XP_004165230.1|  PREDICTED: cysteine proteinase RD19a-like          121   3e-30   
gb|KHN39817.1|  Cysteine proteinase RD19a                               120   4e-30   Glycine soja [wild soybean]
ref|XP_002302004.2|  hypothetical protein POPTR_0002s03020g             120   4e-30   Populus trichocarpa [western balsam poplar]
ref|XP_008236965.1|  PREDICTED: cysteine proteinase RD19a               120   4e-30   Prunus mume [ume]
gb|AAR92156.1|  putative cysteine protease 3                            119   4e-30   Iris x hollandica [Dutch iris]
gb|ABF46642.1|  papain-like cysteine proteinase                         120   4e-30   Pachysandra terminalis
ref|XP_009373000.1|  PREDICTED: cysteine proteinase RD19a               120   4e-30   Pyrus x bretschneideri [bai li]
gb|KHN22211.1|  Cysteine proteinase 15A                                 120   4e-30   Glycine soja [wild soybean]
ref|XP_008382317.1|  PREDICTED: cysteine proteinase RD19a               120   5e-30   Malus domestica [apple tree]
ref|XP_007201310.1|  hypothetical protein PRUPE_ppa007454mg             120   5e-30   Prunus persica
ref|XP_008775532.1|  PREDICTED: cysteine proteinase 1-like              120   5e-30   Phoenix dactylifera
ref|XP_010028631.1|  PREDICTED: cysteine proteinase RD19a-like          120   6e-30   Eucalyptus grandis [rose gum]
gb|AAL69389.1|AF462226_1  putative cysteine proteinase                  115   6e-30   Narcissus pseudonarcissus
gb|ABK96252.1|  unknown                                                 115   6e-30   Populus trichocarpa x Populus deltoides
ref|XP_009392632.1|  PREDICTED: cysteine proteinase 1-like              120   7e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003540987.1|  PREDICTED: cysteine proteinase RD19a-like          120   7e-30   Glycine max [soybeans]
ref|XP_010066197.1|  PREDICTED: probable cysteine proteinase A494       120   7e-30   Eucalyptus grandis [rose gum]
ref|XP_008448073.1|  PREDICTED: cysteine proteinase RD19a-like          120   8e-30   Cucumis melo [Oriental melon]
ref|XP_010672379.1|  PREDICTED: cysteine proteinase RD19a-like          120   8e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004150061.1|  PREDICTED: cysteine proteinase RD19a-like          120   9e-30   Cucumis sativus [cucumbers]
gb|EYU37835.1|  hypothetical protein MIMGU_mgv1a008237mg                119   1e-29   Erythranthe guttata [common monkey flower]
ref|XP_007136047.1|  hypothetical protein PHAVU_009G013600g             119   1e-29   Phaseolus vulgaris [French bean]
gb|KJB07487.1|  hypothetical protein B456_001G026600                    119   1e-29   Gossypium raimondii
ref|XP_011045161.1|  PREDICTED: cysteine proteinase 15A-like            119   1e-29   Populus euphratica
ref|XP_010910124.1|  PREDICTED: cysteine proteinase 1-like              119   1e-29   Elaeis guineensis
gb|AGV54334.1|  cysteine proteinase RD19a-like protein                  119   1e-29   Phaseolus vulgaris [French bean]
gb|AAU81589.1|  cysteine proteinase                                     117   1e-29   Petunia x hybrida [garden petunia]
ref|XP_008460996.1|  PREDICTED: cysteine proteinase RD19a-like          119   1e-29   Cucumis melo [Oriental melon]
gb|AAD29084.1|AF082181_1  cysteine proteinase precursor                 119   1e-29   Solanum melongena [aubergine]
ref|XP_010530325.1|  PREDICTED: cysteine proteinase RD19a               119   1e-29   Tarenaya hassleriana [spider flower]
ref|XP_009376976.1|  PREDICTED: cysteine proteinase RD19a-like          119   2e-29   Pyrus x bretschneideri [bai li]
ref|XP_008387995.1|  PREDICTED: cysteine proteinase 15A                 119   2e-29   Malus domestica [apple tree]
gb|AIB06025.1|  CP3                                                     119   2e-29   Hevea brasiliensis [jebe]
ref|XP_002280808.2|  PREDICTED: cysteine proteinase 15A                 118   2e-29   Vitis vinifera
dbj|BAC41322.1|  hypothetical protein                                   118   3e-29   Lotus japonicus
ref|XP_003606998.1|  Cysteine proteinase                                118   3e-29   Medicago truncatula
gb|AAL05851.1|AF411121_1  cysteine proteinase precursor                 118   3e-29   Sandersonia aurantiaca [Chinese-lantern lily]
ref|XP_006473584.1|  PREDICTED: cysteine proteinase 15A-like            118   3e-29   Citrus sinensis [apfelsine]
ref|XP_009376977.1|  PREDICTED: cysteine proteinase RD19a-like          119   3e-29   Pyrus x bretschneideri [bai li]
ref|XP_009146338.1|  PREDICTED: cysteine proteinase 15A-like            118   4e-29   Brassica rapa
gb|KDO84720.1|  hypothetical protein CISIN_1g017548mg                   118   4e-29   Citrus sinensis [apfelsine]
gb|KHN25410.1|  Cysteine proteinase RD19a                               118   4e-29   Glycine soja [wild soybean]
emb|CAE45588.1|  papain-like cysteine proteinase-like protein 1         117   5e-29   Lotus japonicus
ref|XP_002306900.1|  hypothetical protein POPTR_0005s25540g             117   5e-29   Populus trichocarpa [western balsam poplar]
emb|CDY34441.1|  BnaC01g21920D                                          117   5e-29   Brassica napus [oilseed rape]
emb|CAE45589.1|  papain-like cysteine proteinase-like protein 2         117   5e-29   Lotus japonicus
gb|EYU42593.1|  hypothetical protein MIMGU_mgv1a008336mg                117   5e-29   Erythranthe guttata [common monkey flower]
emb|CDX98179.1|  BnaC07g09190D                                          110   5e-29   Brassica napus [oilseed rape]
ref|XP_006435090.1|  hypothetical protein CICLE_v10001559mg             117   6e-29   Citrus clementina
gb|ABK93575.1|  unknown                                                 113   7e-29   Populus trichocarpa [western balsam poplar]
ref|XP_003589348.1|  Cysteine proteinase                                117   7e-29   Medicago truncatula
ref|XP_010531457.1|  PREDICTED: probable cysteine proteinase A494       117   7e-29   Tarenaya hassleriana [spider flower]
dbj|BAF98584.1|  CM0216.500.nc                                          117   7e-29   Lotus japonicus
dbj|BAF98585.1|  CM0216.510.nc                                          117   8e-29   Lotus japonicus
ref|XP_009351218.1|  PREDICTED: cysteine proteinase RD19a-like          115   8e-29   Pyrus x bretschneideri [bai li]
ref|XP_004230928.1|  PREDICTED: cysteine proteinase RD19a               117   9e-29   Solanum lycopersicum
ref|XP_008221329.1|  PREDICTED: cysteine proteinase 15A-like            117   9e-29   Prunus mume [ume]
emb|CAB53397.1|  cysteine protease                                      114   1e-28   Medicago sativa [alfalfa]
gb|ACK57563.1|  cysteine protease-like protein                          117   1e-28   Arachis hypogaea [goober]
ref|XP_006362019.1|  PREDICTED: cysteine proteinase RD19a-like          117   1e-28   Solanum tuberosum [potatoes]
ref|XP_010440192.1|  PREDICTED: cysteine proteinase RD19a-like          117   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_003550405.2|  PREDICTED: cysteine proteinase 15A                 117   1e-28   
ref|XP_010434865.1|  PREDICTED: cysteine proteinase 15A-like            116   1e-28   Camelina sativa [gold-of-pleasure]
emb|CDY09707.1|  BnaC07g33540D                                          116   1e-28   Brassica napus [oilseed rape]
ref|XP_007223351.1|  hypothetical protein PRUPE_ppa007441mg             116   1e-28   Prunus persica
ref|XP_007160702.1|  hypothetical protein PHAVU_001G009900g             116   2e-28   Phaseolus vulgaris [French bean]
ref|XP_010449835.1|  PREDICTED: cysteine proteinase 15A-like            116   2e-28   Camelina sativa [gold-of-pleasure]
gb|AAM65162.1|  cysteine proteinase RD19A                               116   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009602233.1|  PREDICTED: cysteine proteinase RD19a-like          116   2e-28   Nicotiana tomentosiformis
gb|AAU81591.1|  cysteine proteinase                                     112   2e-28   Petunia x hybrida [garden petunia]
emb|CAA82995.1|  cysteine proteinase                                    115   2e-28   Vicia sativa [spring vetch]
sp|P25804.1|CYSP_PEA  RecName: Full=Cysteine proteinase 15A; AltN...    115   2e-28   Pisum sativum [garden pea]
emb|CAD40319.2|  OSJNBb0054B09.3                                        115   2e-28   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD94010.1|  drought-inducible cysteine proteinase RD19A prec...    109   2e-28   Arabidopsis thaliana [mouse-ear cress]
gb|AJP16692.1|  cysteine protease                                       111   3e-28   Striga hermonthica [purple witchweed]
gb|KJB29611.1|  hypothetical protein B456_005G110200                    115   3e-28   Gossypium raimondii
gb|EEE60725.1|  hypothetical protein OsJ_14236                          115   3e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008775280.1|  PREDICTED: cysteine proteinase 1-like              115   3e-28   Phoenix dactylifera
ref|XP_003579573.2|  PREDICTED: cysteine proteinase 1-like              115   3e-28   Brachypodium distachyon [annual false brome]
ref|XP_009335626.1|  PREDICTED: cysteine proteinase 15A                 115   3e-28   Pyrus x bretschneideri [bai li]
gb|AAO11786.1|  pre-pro cysteine proteinase                             115   3e-28   Vicia faba [broad bean]
ref|XP_009109502.1|  PREDICTED: cysteine proteinase RD19a-like          115   3e-28   Brassica rapa
gb|AAB67878.1|  pre-pro-cysteine proteinase                             115   4e-28   Vicia faba [broad bean]
gb|AAB62937.1|  stress-induced cysteine proteinase                      111   4e-28   Lavatera thuringiaca
gb|EAY93546.1|  hypothetical protein OsI_15336                          115   4e-28   Oryza sativa Indica Group [Indian rice]
gb|KHG15062.1|  Cysteinease RD19a -like protein                         115   4e-28   Gossypium arboreum [tree cotton]
ref|XP_006283974.1|  hypothetical protein CARUB_v10005098mg             115   5e-28   Capsella rubella
ref|XP_004238314.1|  PREDICTED: cysteine proteinase 15A                 115   5e-28   
gb|KJB58164.1|  hypothetical protein B456_009G197400                    115   5e-28   Gossypium raimondii
dbj|BAF46302.1|  cysteine proteinase precursor                          115   5e-28   Ipomoea nil [qian niu]
ref|XP_006341997.1|  PREDICTED: cysteine proteinase 15A-like            115   5e-28   Solanum tuberosum [potatoes]
ref|XP_009611293.1|  PREDICTED: cysteine proteinase 15A-like            114   6e-28   Nicotiana tomentosiformis
gb|ACX54787.2|  cysteine protease                                       114   6e-28   Arachis diogoi
gb|AAK07731.1|  CPR2-like cysteine proteinase                           114   6e-28   Nicotiana tabacum [American tobacco]
emb|CDP07452.1|  unnamed protein product                                114   6e-28   Coffea canephora [robusta coffee]
ref|XP_009136751.1|  PREDICTED: cysteine proteinase RD19a-like          114   7e-28   Brassica rapa
emb|CDX90537.1|  BnaA03g42440D                                          114   7e-28   Brassica napus [oilseed rape]
gb|AAQ81938.1|  cysteine proteinase precursor                           114   7e-28   Ipomoea batatas [batate]
emb|CAA78361.1|  tobacco pre-pro-cysteine proteinase                    114   7e-28   Nicotiana tabacum [American tobacco]
gb|EMT16425.1|  Cysteine proteinase 1                                   114   8e-28   Aegilops tauschii
ref|XP_006283963.1|  hypothetical protein CARUB_v10005086mg             114   9e-28   Capsella rubella
emb|CAA78365.1|  tobacco pre-pro-cysteine proteinase                    114   9e-28   Nicotiana tabacum [American tobacco]
ref|XP_008444769.1|  PREDICTED: cysteine proteinase RD19a-like          114   9e-28   Cucumis melo [Oriental melon]
ref|XP_011083631.1|  PREDICTED: cysteine proteinase 15A-like            114   1e-27   Sesamum indicum [beniseed]
ref|XP_009405542.1|  PREDICTED: cysteine proteinase 1-like              114   1e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN12668.1|  Cysteine proteinase 15A                                 110   1e-27   Glycine soja [wild soybean]
emb|CDY71205.1|  BnaCnng71840D                                          114   1e-27   Brassica napus [oilseed rape]
gb|AAL60581.1|AF454959_1  senescence-associated cysteine protease       114   1e-27   Brassica oleracea
ref|XP_004952477.1|  PREDICTED: cysteine proteinase 1-like              114   1e-27   Setaria italica
ref|XP_006653265.1|  PREDICTED: cysteine proteinase 1-like              114   1e-27   
ref|XP_010943608.1|  PREDICTED: cysteine proteinase 1-like              114   1e-27   Elaeis guineensis
gb|EPS70818.1|  cysteine proteinase                                     114   1e-27   Genlisea aurea
dbj|BAA92495.1|  cysteine protease                                      114   1e-27   Vigna mungo [urad dal]
ref|NP_001266121.1|  uncharacterized protein LOC101501911 precursor     113   1e-27   Cicer arietinum [garbanzo]
gb|EMS53996.1|  Cysteine proteinase 1                                   114   2e-27   Triticum urartu
emb|CAQ00101.1|  papain-like cysteine proteinase                        113   2e-27   Hordeum vulgare subsp. vulgare [barley]
ref|XP_009776238.1|  PREDICTED: cysteine proteinase 15A-like            113   2e-27   Nicotiana sylvestris
gb|AJA74415.1|  cysteine protease                                       113   2e-27   Cicer arietinum [garbanzo]
ref|XP_010431862.1|  PREDICTED: cysteine proteinase RD19a               113   2e-27   Camelina sativa [gold-of-pleasure]
emb|CAB17075.1|  cysteine proteinase precursor                          113   2e-27   Phaseolus vulgaris [French bean]
ref|XP_006414378.1|  hypothetical protein EUTSA_v10025521mg             113   2e-27   Eutrema salsugineum
ref|XP_006828787.1|  hypothetical protein AMTR_s00001p00114210          113   3e-27   Amborella trichopoda
emb|CAA78403.1|  pre-pro-cysteine proteinase                            112   3e-27   Solanum lycopersicum
gb|ACM80348.1|  cysteine proteinase                                     113   3e-27   Solanum lycopersicum
dbj|BAF03553.1|  cysteine proteinase CP2                                112   3e-27   Phaseolus vulgaris [French bean]
ref|XP_004975256.1|  PREDICTED: cysteine proteinase 1-like              113   3e-27   Setaria italica
ref|NP_567489.1|  papain family cysteine protease                       112   3e-27   Arabidopsis thaliana [mouse-ear cress]
dbj|BAG16515.1|  putative cysteine proteinase                           112   4e-27   Capsicum chinense [bonnet pepper]
ref|NP_568052.1|  cysteine proteinase RD19a                             112   4e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870174.1|  hypothetical protein ARALYDRAFT_915142             112   4e-27   Arabidopsis lyrata subsp. lyrata
gb|ABK24153.1|  unknown                                                 112   4e-27   Picea sitchensis
ref|NP_001105685.1|  cysteine proteinase 1 precursor                    112   6e-27   Zea mays [maize]
ref|XP_006411706.1|  hypothetical protein EUTSA_v10025494mg             112   6e-27   Eutrema salsugineum
gb|KFK30492.1|  hypothetical protein AALP_AA7G268600                    112   6e-27   Arabis alpina [alpine rockcress]
gb|ACF86683.1|  unknown                                                 112   7e-27   Zea mays [maize]
gb|KFK24413.1|  hypothetical protein AALP_AAs58848U000200               111   8e-27   Arabis alpina [alpine rockcress]
ref|NP_001052440.1|  Os04g0311400                                       111   9e-27   
ref|XP_006665032.1|  PREDICTED: cysteine proteinase 1-like              108   9e-27   
ref|XP_003574963.1|  PREDICTED: cysteine proteinase 1-like              111   9e-27   Brachypodium distachyon [annual false brome]
ref|XP_002279862.1|  PREDICTED: cysteine proteinase RD19a               111   1e-26   Vitis vinifera
ref|XP_004152668.1|  PREDICTED: cysteine proteinase RD19a-like          111   1e-26   Cucumis sativus [cucumbers]
ref|XP_002452058.1|  hypothetical protein SORBIDRAFT_04g017830          111   1e-26   Sorghum bicolor [broomcorn]
ref|XP_006404590.1|  hypothetical protein EUTSA_v10000210mg             110   2e-26   Eutrema salsugineum
gb|AGS43121.1|  cysteine protease 1                                     105   2e-26   Zea mays [maize]
ref|XP_002868883.1|  hypothetical protein ARALYDRAFT_490677             110   2e-26   Arabidopsis lyrata subsp. lyrata
ref|XP_003545051.1|  PREDICTED: cysteine proteinase 15A-like            110   2e-26   Glycine max [soybeans]
emb|CDY41960.1|  BnaA01g05320D                                          110   2e-26   Brassica napus [oilseed rape]
gb|EPS65881.1|  cysteine proteinase                                     110   2e-26   Genlisea aurea
ref|XP_002880378.1|  hypothetical protein ARALYDRAFT_481008             110   3e-26   Arabidopsis lyrata subsp. lyrata
ref|XP_010446443.1|  PREDICTED: cysteine proteinase RD19a               110   3e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010437007.1|  PREDICTED: cysteine proteinase RD19a-like          110   3e-26   Camelina sativa [gold-of-pleasure]
emb|CAA57675.1|  cysteine proteinase                                    105   4e-26   Zea mays [maize]
dbj|BAD10859.1|  cysteine protease                                      109   4e-26   Tripolium pannonicum [sea starwort]
ref|XP_003607110.1|  Cysteine proteinase                                109   4e-26   Medicago truncatula
emb|CDX99593.1|  BnaC04g33500D                                          109   4e-26   Brassica napus [oilseed rape]
emb|CDY15894.1|  BnaA04g12170D                                          109   5e-26   Brassica napus [oilseed rape]
gb|EYU27644.1|  hypothetical protein MIMGU_mgv1a008452mg                109   5e-26   Erythranthe guttata [common monkey flower]
ref|XP_009140277.1|  PREDICTED: probable cysteine proteinase A494       109   5e-26   Brassica rapa
ref|XP_009150026.1|  PREDICTED: cysteine proteinase RD19a               109   5e-26   Brassica rapa
gb|AAZ32411.1|  cysteine proteinase glycinain type                      109   6e-26   Nicotiana benthamiana
ref|NP_001046828.1|  Os02g0469600                                       109   6e-26   
gb|EMT10192.1|  Cysteine proteinase 1                                   108   9e-26   Aegilops tauschii
gb|ABK21238.1|  unknown                                                 108   1e-25   Picea sitchensis
tpe|CAD66657.1|  TPA: putative cysteine proteinase precursor            108   1e-25   Hordeum vulgare subsp. vulgare [barley]
gb|ABK24688.1|  unknown                                                 108   1e-25   Picea sitchensis
dbj|BAD43619.1|  putative cysteine proteinase                           108   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565512.1|  Papain family cysteine protease                       108   1e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CAA52403.1|  putative thiol protease                                107   1e-25   Arabidopsis thaliana [mouse-ear cress]
gb|ACN40679.1|  unknown                                                 108   1e-25   Picea sitchensis
gb|AAW21813.1|  cysteine protease                                       107   2e-25   Triticum aestivum [Canadian hard winter wheat]
gb|AEX97108.1|  cysteine proteinase                                     103   3e-25   Malus domestica [apple tree]
gb|AAB16996.1|  thiol protease isoform B                                105   7e-25   Glycine max [soybeans]
gb|KEH30505.1|  papain family cysteine protease                         105   1e-24   Medicago truncatula
gb|EMS64962.1|  Cysteine proteinase 1                                   104   2e-24   Triticum urartu
emb|CAH59428.1|  cysteine protease 2                                    103   2e-24   Plantago major [cart-track plant]
ref|XP_002969223.1|  hypothetical protein SELMODRAFT_91274              104   4e-24   Selaginella moellendorffii
ref|XP_009786000.1|  PREDICTED: cysteine proteinase RD19a-like          102   1e-23   Nicotiana sylvestris
dbj|BAC57957.1|  thiol protease                                       99.8    2e-23   Tripolium pannonicum [sea starwort]
gb|AAB53103.1|  cysteine protease                                     96.3    4e-23   Brassica napus [oilseed rape]
ref|XP_010690815.1|  PREDICTED: cysteine proteinase RD19a               100   8e-23   Beta vulgaris subsp. vulgaris [field beet]
gb|AAB16997.1|  thiol protease isoform A                                100   9e-23   Glycine max [soybeans]
ref|XP_002960585.1|  hypothetical protein SELMODRAFT_266583           99.8    1e-22   Selaginella moellendorffii
gb|AES89347.2|  papain family cysteine protease                       99.8    1e-22   Medicago truncatula
ref|XP_003607150.1|  Cysteine proteinase                              99.8    1e-22   
ref|NP_001059639.1|  Os07g0480900                                     97.8    7e-22   
ref|XP_002460693.1|  hypothetical protein SORBIDRAFT_02g033270        97.4    1e-21   Sorghum bicolor [broomcorn]
ref|XP_009404192.1|  PREDICTED: cysteine proteinase 15A               96.3    3e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006658557.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...  95.5    5e-21   Oryza brachyantha
ref|XP_006293095.1|  hypothetical protein CARUB_v10019394mg           95.5    5e-21   Capsella rubella
ref|XP_004959670.1|  PREDICTED: cysteine proteinase 1-like            95.5    5e-21   Setaria italica
gb|KFK34737.1|  hypothetical protein AALP_AA5G186400                  95.1    6e-21   Arabis alpina [alpine rockcress]
gb|EMS59778.1|  Cysteine proteinase 15A                               93.2    7e-21   Triticum urartu
tpg|DAA40800.1|  TPA: putative cysteine protease family protein       95.1    7e-21   Zea mays [maize]
emb|CAQ00102.1|  papain-like cysteine proteinase                      94.7    8e-21   Hordeum vulgare subsp. vulgare [barley]
gb|ADY04293.1|  cysteine protease                                     90.9    2e-20   Clarkia xantiana subsp. xantiana
ref|XP_008776953.1|  PREDICTED: cysteine proteinase-like              90.9    2e-20   Phoenix dactylifera
ref|XP_003560213.1|  PREDICTED: cysteine proteinase 1                 93.6    2e-20   Brachypodium distachyon [annual false brome]
gb|ADY04361.1|  cysteine protease                                     90.5    3e-20   Clarkia xantiana subsp. xantiana
ref|XP_001781954.1|  predicted protein                                93.2    3e-20   Physcomitrella patens
gb|ADY04414.1|  cysteine protease                                     90.5    3e-20   Clarkia xantiana subsp. xantiana
gb|ADY04336.1|  cysteine protease                                     90.5    3e-20   Clarkia xantiana subsp. xantiana
gb|ADY04342.1|  cysteine protease                                     90.5    3e-20   Clarkia xantiana subsp. xantiana
gb|ADY04262.1|  cysteine protease                                     90.5    3e-20   Clarkia xantiana subsp. xantiana
gb|ADY04457.1|  cysteine protease                                     90.5    3e-20   Clarkia xantiana subsp. xantiana
ref|XP_008354070.1|  PREDICTED: cysteine proteinase 15A-like          92.4    4e-20   Malus domestica [apple tree]
gb|ADY04359.1|  cysteine protease                                     90.1    4e-20   Clarkia xantiana subsp. xantiana
ref|XP_008804021.1|  PREDICTED: cysteine proteinase RD19a-like        91.7    4e-20   Phoenix dactylifera
ref|XP_008362714.1|  PREDICTED: cysteine proteinase 15A               92.8    4e-20   Malus domestica [apple tree]
gb|ADY04482.1|  cysteine protease                                     89.7    5e-20   Clarkia xantiana subsp. xantiana
gb|ADY04358.1|  cysteine protease                                     89.4    6e-20   Clarkia xantiana subsp. xantiana
gb|ADY04368.1|  cysteine protease                                     89.4    7e-20   Clarkia xantiana subsp. xantiana
gb|ADY04268.1|  cysteine protease                                     89.4    8e-20   Clarkia xantiana subsp. xantiana
gb|ADY04480.1|  cysteine protease                                     89.0    9e-20   Clarkia xantiana subsp. xantiana
ref|XP_010504326.1|  PREDICTED: cysteine proteinase 15A-like          91.7    1e-19   Camelina sativa [gold-of-pleasure]
emb|CAB41090.1|  cysteine proteinase precursor-like protein           91.7    1e-19   Arabidopsis thaliana [mouse-ear cress]
gb|KEH43476.1|  papain family cysteine protease                       91.7    1e-19   Medicago truncatula
gb|AEQ54770.1|  cysteine proteinase CP1                               92.0    1e-19   Coffea canephora [robusta coffee]
ref|XP_002876278.1|  hypothetical protein ARALYDRAFT_485911           91.7    1e-19   Arabidopsis lyrata subsp. lyrata
ref|NP_567010.5|  Papain family cysteine protease                     91.7    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001761980.1|  predicted protein                                91.7    1e-19   Physcomitrella patens
gb|EEC82027.1|  hypothetical protein OsI_25996                        93.6    1e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_008802783.1|  PREDICTED: probable cysteine proteinase A494     91.7    2e-19   Phoenix dactylifera
ref|XP_010534431.1|  PREDICTED: cysteine proteinase 15A               91.3    2e-19   Tarenaya hassleriana [spider flower]
gb|ADY04295.1|  cysteine protease                                     88.2    2e-19   
ref|XP_007218137.1|  hypothetical protein PRUPE_ppa007240mg           90.9    2e-19   
ref|XP_008233261.1|  PREDICTED: cysteine proteinase 15A               90.9    2e-19   
ref|XP_006403513.1|  hypothetical protein EUTSA_v10010475mg           90.9    2e-19   
gb|KJB73490.1|  hypothetical protein B456_011G235500                  90.9    3e-19   
gb|KHG08355.1|  Cysteinease 1                                         90.5    3e-19   
gb|KHN00877.1|  Cysteine proteinase 15A                               90.1    4e-19   
ref|XP_004496226.1|  PREDICTED: cysteine proteinase 15A-like          90.5    4e-19   
emb|CDO99795.1|  unnamed protein product                              90.1    6e-19   
gb|EYU39642.1|  hypothetical protein MIMGU_mgv1a008552mg              89.4    7e-19   
ref|XP_009789260.1|  PREDICTED: cysteine proteinase 15A               89.7    8e-19   
ref|XP_010918606.1|  PREDICTED: probable cysteine proteinase A494     89.4    9e-19   
ref|XP_009117680.1|  PREDICTED: probable cysteine proteinase A494     89.0    9e-19   
emb|CAB16316.1|  cysteine proteinase precursor                        89.0    1e-18   
gb|KHN37802.1|  Cysteine proteinase 1                                 87.8    2e-18   
gb|KDP30486.1|  hypothetical protein JCGZ_16165                       88.2    3e-18   
gb|AAD46920.1|AF167986_1  putative cysteine proteinase GmPM33         87.8    3e-18   
ref|XP_010243268.1|  PREDICTED: cysteine proteinase 15A               87.8    3e-18   
ref|NP_001236888.1|  cysteine proteinase precursor                    87.8    3e-18   
ref|XP_008446834.1|  PREDICTED: cysteine proteinase 15A               87.4    4e-18   
gb|AEW08440.1|  hypothetical protein 2_9845_02                        82.8    4e-18   
gb|ADE76932.1|  unknown                                               87.8    4e-18   
ref|XP_004157559.1|  PREDICTED: cysteine proteinase 15A-like          87.8    4e-18   
ref|XP_004142497.1|  PREDICTED: cysteine proteinase 15A-like          87.8    4e-18   
ref|XP_009617441.1|  PREDICTED: cysteine proteinase 15A               87.4    4e-18   
ref|XP_009116190.1|  PREDICTED: probable cysteine proteinase A494     87.0    5e-18   
emb|CDY56961.1|  BnaA09g55030D                                        87.0    5e-18   
emb|CDX73424.1|  BnaC08g25790D                                        87.0    5e-18   
ref|XP_004250044.1|  PREDICTED: cysteine proteinase 15A               87.0    6e-18   
emb|CCA95098.1|  putative responsive to dehydration 19                84.3    6e-18   
ref|XP_011094506.1|  PREDICTED: cysteine proteinase 15A               86.3    1e-17   
ref|XP_006850211.1|  hypothetical protein AMTR_s00022p00251800        85.9    1e-17   
emb|CBI31400.3|  unnamed protein product                              85.1    1e-17   
ref|XP_006436511.1|  hypothetical protein CICLE_v10031865mg           85.9    2e-17   
ref|XP_007143764.1|  hypothetical protein PHAVU_007G099600g           86.7    2e-17   
ref|XP_011024366.1|  PREDICTED: cysteine proteinase 15A               85.1    3e-17   
ref|XP_010034320.1|  PREDICTED: cysteine proteinase 1                 84.3    6e-17   
emb|CDY13816.1|  BnaA09g43180D                                        83.6    6e-17   
ref|XP_006361690.1|  PREDICTED: cysteine proteinase 15A-like          84.3    7e-17   
emb|CAB17077.1|  cysteine proteinase precursor                        84.0    7e-17   
ref|XP_002316398.1|  hypothetical protein POPTR_0010s23510g           82.8    1e-16   
ref|XP_010688493.1|  PREDICTED: cysteine proteinase 15A               83.6    1e-16   
ref|XP_007510080.1|  unknown                                          84.0    2e-16   
ref|XP_002533377.1|  cysteine protease, putative                      82.4    3e-16   
gb|ABO93617.1|  papain-like cysteine proteinase                       80.1    3e-16   
emb|CAN64491.1|  hypothetical protein VITISV_015725                   81.6    4e-16   
gb|ADY04490.1|  cysteine protease                                     79.3    4e-16   
ref|XP_002266821.1|  PREDICTED: cysteine proteinase 15A               82.0    4e-16   
ref|XP_011469621.1|  PREDICTED: cysteine proteinase 15A-like          80.1    7e-16   
ref|XP_010103534.1|  putative cysteine proteinase A494                81.3    7e-16   
gb|EPS63354.1|  hypothetical protein M569_11429                       80.9    1e-15   
ref|XP_007010012.1|  Papain family cysteine protease                  80.9    1e-15   
ref|XP_003081549.1|  Cysteine proteinase Cathepsin F (ISS)            79.7    2e-15   
ref|XP_001419933.1|  predicted protein                                79.3    2e-15   
gb|EGI66903.1|  Putative cysteine proteinase                          81.6    3e-15   
emb|CEF99324.1|  Cysteine peptidase, cysteine active site             80.1    3e-15   
ref|XP_011052455.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  81.6    3e-15   
ref|XP_011169692.1|  PREDICTED: putative cysteine proteinase CG12163  81.6    3e-15   
ref|XP_008647122.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin 7-...  78.2    5e-15   
gb|EFN80374.1|  Putative cysteine proteinase CG12163                  80.5    8e-15   
ref|XP_011145705.1|  PREDICTED: uncharacterized protein LOC105186896  80.5    8e-15   
ref|XP_011496222.1|  PREDICTED: uncharacterized protein LOC105360904  80.1    1e-14   
gb|ABY75169.1|  cysteine protease                                     72.8    2e-14   
ref|XP_006608091.1|  PREDICTED: uncharacterized protein LOC102680728  79.3    2e-14   
ref|XP_003696602.1|  PREDICTED: putative cysteine proteinase CG12...  79.3    2e-14   
dbj|BAI44279.1|  cysteine proteinase inhibitor precursor              79.7    2e-14   
emb|CCA95082.1|  putative responsive to dehydration 19                74.7    2e-14   
ref|XP_003492760.1|  PREDICTED: hypothetical protein LOC100745708     79.0    2e-14   
gb|AFW72358.1|  putative cysteine protease family protein             78.2    3e-14   
ref|XP_003707276.1|  PREDICTED: uncharacterized protein LOC100880620  78.2    4e-14   
ref|XP_005184486.1|  PREDICTED: putative cysteine proteinase CG12...  77.8    5e-14   
ref|XP_005184487.1|  PREDICTED: putative cysteine proteinase CG12...  77.8    6e-14   
ref|XP_011184040.1|  PREDICTED: putative cysteine proteinase CG12163  77.4    7e-14   
ref|XP_392381.3|  PREDICTED: putative cysteine proteinase CG12163...  77.4    7e-14   
ref|XP_006567715.1|  PREDICTED: putative cysteine proteinase CG12...  77.4    7e-14   
ref|XP_001607324.1|  PREDICTED: uncharacterized protein LOC100123649  77.8    7e-14   
ref|XP_011203808.1|  PREDICTED: putative cysteine proteinase CG12163  77.0    1e-13   
ref|XP_004519757.1|  PREDICTED: putative cysteine proteinase CG12...  77.0    1e-13   
ref|XP_003057227.1|  predicted protein                                75.1    1e-13   
gb|KFB38327.1|  AGAP002879-PB-like protein                            76.6    2e-13   
gb|EFN65613.1|  Putative cysteine proteinase CG12163                  75.9    3e-13   
ref|XP_011493714.1|  AAEL017153-PA                                    75.9    3e-13   
ref|XP_011260522.1|  PREDICTED: uncharacterized protein LOC105253881  75.9    3e-13   
ref|XP_001844355.1|  conserved hypothetical protein                   75.9    3e-13   
ref|XP_003436277.1|  AGAP002879-PB                                    75.9    4e-13   
ref|XP_312034.5|  AGAP002879-PA                                       75.9    4e-13   
gb|ETN61472.1|  hypothetical protein AND_006867                       75.1    7e-13   
ref|XP_008550537.1|  PREDICTED: uncharacterized protein LOC103573287  74.7    9e-13   
gb|EHJ64782.1|  cysteine proteinase inhibitor precursor               70.5    9e-13   
ref|XP_001994049.1|  GH22731                                          73.2    2e-12   
gb|AFQ01139.1|  cathepsin F-like protease                             72.8    2e-12   
ref|XP_002000409.1|  GI10216                                          73.2    2e-12   
ref|XP_002073772.1|  GK14287                                          73.2    2e-12   
ref|XP_003436276.1|  AGAP002879-PC                                    73.2    2e-12   
emb|CBY11269.1|  unnamed protein product                              72.0    2e-12   
gb|ABE72973.1|  cathepsin L                                           70.5    2e-12   
gb|ACR08662.1|  cathepsin F                                           69.7    3e-12   
gb|AJF94882.1|  C1 family cathepsin F10                               73.2    3e-12   
ref|XP_011309436.1|  PREDICTED: uncharacterized protein LOC105270293  72.8    3e-12   
ref|XP_002056575.1|  GJ11017                                          72.4    3e-12   
ref|XP_002017233.1|  GL22196                                          72.4    3e-12   
ref|XP_002137768.1|  GA27408, isoform A                               72.4    4e-12   
ref|XP_002096026.1|  GE25302                                          72.0    4e-12   
ref|NP_730901.1|  CG12163, isoform A                                  72.0    4e-12   
gb|AFM37363.1|  cathepsin F1                                          71.6    4e-12   
ref|XP_005184488.1|  PREDICTED: putative cysteine proteinase CG12...  71.6    4e-12   
ref|XP_002038380.1|  GM10654                                          72.0    5e-12   
gb|EZA58965.1|  Putative cysteine proteinase                          72.0    5e-12   
ref|XP_001978897.1|  GG11133                                          71.6    5e-12   
ref|XP_002988513.1|  hypothetical protein SELMODRAFT_128220           68.2    5e-12   
ref|XP_003115597.1|  CRE-TAG-196 protein                              71.2    6e-12   
ref|XP_011331416.1|  PREDICTED: uncharacterized protein LOC105275911  72.0    6e-12   
ref|XP_003736743.1|  GA27408, isoform B                               70.9    7e-12   
ref|NP_505215.2|  Protein TAG-196                                     70.9    8e-12   
ref|XP_004519758.1|  PREDICTED: putative cysteine proteinase CG12...  71.2    9e-12   
ref|XP_008195657.1|  PREDICTED: uncharacterized protein LOC662417...  71.6    1e-11   
ref|XP_008195656.1|  PREDICTED: uncharacterized protein LOC662417...  71.6    1e-11   
ref|NP_649521.1|  CG12163, isoform B                                  70.5    1e-11   
emb|CBY31096.1|  unnamed protein product                              69.7    1e-11   
ref|XP_002979143.1|  hypothetical protein SELMODRAFT_110288           67.8    1e-11   
ref|XP_002635317.1|  C. briggsae CBR-TAG-196 protein                  69.7    2e-11   
gb|KDR17524.1|  Putative cysteine proteinase                          70.5    2e-11   
gb|ENN81374.1|  hypothetical protein YQE_02191                        70.5    2e-11   
gb|EGT34543.1|  hypothetical protein CAEBREN_26318                    69.3    3e-11   
gb|ERG79645.1|  cysteine proteinase                                   65.5    3e-11   
gb|KIH48456.1|  cysteine proteinase family protein                    64.7    3e-11   
gb|EYC18288.1|  hypothetical protein Y032_0028g1777                   65.1    3e-11   
gb|KHN72698.1|  Putative cysteine proteinase                          65.5    3e-11   
gb|EGT34572.1|  hypothetical protein CAEBREN_13324                    68.9    4e-11   
gb|ABC48936.1|  cathepsin F like protease                             68.2    7e-11   
ref|XP_001955780.1|  GF16067                                          68.2    9e-11   
emb|CDJ92562.1|  Proteinase inhibitor I25 and Proteinase inhibito...  67.4    1e-10   
emb|CDJ88889.1|  Proteinase inhibitor I25 and Proteinase inhibito...  67.4    1e-10   
gb|KFM67613.1|  putative cysteine proteinase                          67.4    1e-10   
emb|CAN71324.1|  hypothetical protein VITISV_013970                   67.0    2e-10   
ref|XP_011434326.1|  PREDICTED: uncharacterized protein LOC105333...  67.4    2e-10   
ref|XP_011434325.1|  PREDICTED: uncharacterized protein LOC105333...  67.4    2e-10   
gb|AII16490.1|  cathepsin F                                           65.9    2e-10   
gb|ERL92611.1|  hypothetical protein D910_09924                       67.0    2e-10   
gb|EKC42097.1|  Cathepsin F                                           67.4    2e-10   
emb|CAN80141.1|  hypothetical protein VITISV_038978                   66.6    2e-10   
ref|XP_635417.1|  cysteine proteinase 1                               66.2    2e-10   
emb|CAA26255.1|  cysteine proteinase I precursor                      66.2    2e-10   
ref|XP_008177856.1|  PREDICTED: cathepsin W-like                      62.8    3e-10   
gb|ELW65130.1|  Cathepsin W                                           66.2    4e-10   
ref|XP_006268168.1|  PREDICTED: cathepsin F-like                      65.9    4e-10   
ref|XP_002682087.1|  predicted protein                                65.5    4e-10   
ref|XP_003148243.1|  hypothetical protein LOAG_12683                  63.5    4e-10   
gb|EFO15826.2|  hypothetical protein LOAG_12683                       63.5    5e-10   
gb|EFX71333.1|  hypothetical protein DAPPUDRAFT_189155                63.9    5e-10   
ref|XP_006149977.1|  PREDICTED: cathepsin W                           65.1    5e-10   
ref|XP_006036937.1|  PREDICTED: cathepsin F-like                      65.5    6e-10   
ref|XP_009047014.1|  hypothetical protein LOTGIDRAFT_172186           63.9    6e-10   
ref|XP_007438969.1|  PREDICTED: cathepsin F-like                      62.8    8e-10   
ref|XP_003386471.1|  PREDICTED: cysteine proteinase 1-like            64.7    9e-10   
ref|XP_006038953.1|  PREDICTED: cathepsin W-like                      64.3    1e-09   
ref|XP_006121731.1|  PREDICTED: cathepsin W-like                      62.4    1e-09   
ref|XP_005305646.1|  PREDICTED: cathepsin W-like                      63.9    1e-09   
gb|ELV09527.1|  Cathepsin F                                           64.7    1e-09   
emb|CDX88753.1|  BnaA03g08960D                                        63.9    1e-09   
ref|XP_004596903.1|  PREDICTED: cathepsin W                           63.9    1e-09   
ref|XP_002427787.1|  Cathepsin F precursor, putative                  64.3    1e-09   
ref|NP_001156454.1|  cathepsin F isoform 2 precursor                  64.7    1e-09   
ref|XP_003747496.1|  PREDICTED: cathepsin L-like                      63.5    2e-09   
gb|AAO12867.1|  papain-like cysteine proteinase                       59.3    2e-09   
ref|XP_009161938.1|  hypothetical protein T265_00017                  61.6    2e-09   
emb|CAN81617.1|  hypothetical protein VITISV_001998                   62.8    2e-09   
emb|CAN81619.1|  hypothetical protein VITISV_002000                   62.8    2e-09   
dbj|BAD94378.1|  hypothetical protein                                 59.3    2e-09   
ref|XP_009029595.1|  hypothetical protein HELRODRAFT_157956           62.8    2e-09   
emb|CDJ26737.1|  cathepsin F-like cysteine peptidase protein          63.9    2e-09   
ref|XP_002505924.1|  cysteine endopeptidase                           62.8    2e-09   
dbj|GAA47436.1|  cathepsin L                                          61.6    3e-09   
ref|XP_005305525.1|  PREDICTED: cathepsin W-like                      62.8    3e-09   
ref|XP_011367167.1|  PREDICTED: cathepsin W                           63.2    3e-09   
gb|AAB82455.1|  lymphopain                                            63.2    3e-09   
ref|XP_006007112.1|  PREDICTED: cathepsin F-like                      63.5    3e-09   
gb|AAP33049.1|  cysteine proteinase 1                                 62.8    3e-09   
ref|NP_034115.2|  cathepsin W preproprotein                           63.2    3e-09   
ref|XP_006980634.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      63.5    3e-09   
ref|XP_006911151.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin W      62.8    3e-09   
emb|CBI23088.3|  unnamed protein product                              60.5    4e-09   
ref|XP_004618593.1|  PREDICTED: cathepsin W                           62.8    4e-09   
ref|XP_003122571.2|  PREDICTED: cathepsin W                           62.8    4e-09   
dbj|BAA84280.1|  Cysteine proteinase                                  60.8    4e-09   
gb|AAF21470.1|U85983_1  cysteine proteinase                           61.2    5e-09   
ref|XP_006036386.1|  PREDICTED: cathepsin W-like                      60.1    5e-09   
ref|XP_007648967.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      62.8    5e-09   
ref|XP_006258352.1|  PREDICTED: cathepsin W-like                      61.6    6e-09   
ref|XP_005770574.1|  hypothetical protein EMIHUDRAFT_349865           62.4    6e-09   
ref|XP_004364962.1|  cysteine proteinase 7                            62.0    6e-09   
ref|XP_005305555.1|  PREDICTED: cathepsin F                           62.0    6e-09   
ref|XP_008821074.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      62.4    7e-09   
ref|XP_003093665.1|  hypothetical protein CRE_29181                   59.7    7e-09   
ref|XP_006827472.1|  hypothetical protein AMTR_s00009p00129100        61.6    7e-09   
gb|AAW25676.1|  SJCHGC01753 protein                                   62.4    7e-09   
ref|XP_003093674.1|  hypothetical protein CRE_29187                   62.0    8e-09   
gb|ABK91811.1|  cathepsin F precursor                                 61.6    8e-09   
gb|ABC69431.1|  cysteine protease                                     61.6    8e-09   
ref|XP_009131925.1|  PREDICTED: thiol protease aleurain-like          61.6    8e-09   
gb|ABC69430.1|  cysteine protease                                     61.6    8e-09   
gb|ABC69429.1|  cysteine protease                                     61.6    8e-09   
gb|ABC69433.1|  cysteine protease                                     61.6    9e-09   
gb|AAF40479.1|  cystein protease                                      61.2    9e-09   
ref|XP_010765827.1|  PREDICTED: cathepsin W                           62.4    9e-09   
ref|XP_006276364.1|  PREDICTED: uncharacterized protein LOC102558525  62.4    9e-09   
gb|ABJ89814.1|  cysteine protease preprotein                          61.2    9e-09   
gb|ABC69432.1|  cysteine protease                                     61.2    9e-09   
gb|ABK91805.1|  cysteine proteinase 7 precursor                       61.2    9e-09   
gb|AAT09103.1|  digestive cysteine proteinase                         61.6    9e-09   
ref|XP_002916735.1|  PREDICTED: cathepsin W isoform X2                61.6    1e-08   
ref|NP_001029282.1|  cathepsin F precursor                            62.0    1e-08   
ref|XP_003379333.1|  dipeptidyl-peptidase 1                           61.6    1e-08   
ref|XP_007056266.1|  PREDICTED: cathepsin F-like                      62.0    1e-08   
ref|XP_004351999.1|  cysteine protease                                61.2    1e-08   
gb|ACN56478.1|  cathepsin F                                           62.0    1e-08   
ref|XP_006129733.1|  PREDICTED: cathepsin F-like                      61.2    1e-08   
ref|NP_001156453.1|  cathepsin F isoform 1 precursor                  62.0    1e-08   
ref|XP_004355074.1|  cathepsin L 2 precursor, putative                60.8    1e-08   
ref|XP_006861134.1|  PREDICTED: cathepsin W                           61.2    1e-08   
ref|NP_063914.1|  cathepsin F precursor                               61.6    1e-08   



>gb|AAK27969.1|AF242373_1 cysteine protease [Ipomoea batatas]
Length=366

 Score =   134 bits (338),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN CGVDSMVSTVAAV+T
Sbjct  303  LLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVST  362

Query  183  PTSD  194
             TSD
Sbjct  363  TTSD  366



>gb|AAF40415.1|AF216784_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=368

 Score =   133 bits (335),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN CGVDSMVSTVAAV+T
Sbjct  305  LLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVST  364

Query  183  PTSD  194
             TSD
Sbjct  365  TTSD  368



>gb|AAF40414.1|AF216783_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   133 bits (335),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN CGVDSMVSTVAAV+T
Sbjct  305  LLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVST  364

Query  183  PTSD  194
             TSD
Sbjct  365  TTSD  368



>gb|AAF61440.1|AF138264_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   133 bits (335),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN CGVDSMVSTVAAV+T
Sbjct  305  LLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVST  364

Query  183  PTSD  194
             TSD
Sbjct  365  TTSD  368



>gb|AAF61441.1|AF138265_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=366

 Score =   133 bits (334),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN CGVDSMVSTVAAV+T
Sbjct  303  LLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVST  362

Query  183  PTSD  194
             TSD
Sbjct  363  TTSD  366



>gb|AAF40416.1|AF216785_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
 gb|AAF61442.1|AF138266_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
Length=366

 Score =   132 bits (331),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICRGRN CGVDSMVSTVAAV+T
Sbjct  303  LLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVST  362

Query  183  PTSD  194
             TSD
Sbjct  363  TTSD  366



>gb|KDP41743.1| hypothetical protein JCGZ_26761 [Jatropha curcas]
Length=370

 Score =   127 bits (319),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAPIRLKEKPYWIIKNSWGE+WGE GYYKICRGRN CGVDSMVSTVAAV T
Sbjct  308  LLVGYGSAGYAPIRLKEKPYWIIKNSWGETWGESGYYKICRGRNVCGVDSMVSTVAAVQT  367

Query  183  PT  188
             +
Sbjct  368  SS  369



>gb|ACI04578.1| cysteine protease-like protein [Robinia pseudoacacia]
Length=335

 Score =   126 bits (317),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 56/60 (93%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG AGYAPIRLKEKPYWIIKNSWGESWGE GYYKICRGRN CGVDSMVSTVAAV+T
Sbjct  273  LLVGYGKAGYAPIRLKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVHT  332



>ref|XP_002512963.1| cysteine protease, putative [Ricinus communis]
 gb|EEF49466.1| cysteine protease, putative [Ricinus communis]
Length=373

 Score =   126 bits (316),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAPIR+KEKPYWIIKNSWGE+WGE GYYKICRGRN CGVDSMVSTVAAV T
Sbjct  311  LLVGYGSAGYAPIRMKEKPYWIIKNSWGENWGESGYYKICRGRNICGVDSMVSTVAAVQT  370

Query  183  PT  188
             +
Sbjct  371  AS  372



>gb|KHG24064.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=374

 Score =   125 bits (315),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 55/60 (92%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAPIRLK+KPYWIIKNSWGE+WGE GYYKICRGRN CGVDS+VSTVAAVNT
Sbjct  312  LLVGYGSAGYAPIRLKDKPYWIIKNSWGETWGENGYYKICRGRNVCGVDSLVSTVAAVNT  371



>ref|XP_009406357.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=372

 Score =   125 bits (315),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGY+PIRLK+KP+WIIKNSWGE+WGEKGYYKICRGRN CGVDSMVSTV A+NT
Sbjct  309  LLVGYGSAGYSPIRLKQKPFWIIKNSWGETWGEKGYYKICRGRNVCGVDSMVSTVTAINT  368



>ref|XP_007042077.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOX97908.1| Papain family cysteine protease [Theobroma cacao]
Length=395

 Score =   126 bits (316),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAP+R+K+KPYWIIKNSWGESWGE G+YKICRGRN CGVDSMVSTVAAV+T
Sbjct  333  LLVGYGSAGYAPVRMKDKPYWIIKNSWGESWGEDGFYKICRGRNICGVDSMVSTVAAVDT  392



>ref|XP_011088458.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Sesamum indicum]
Length=379

 Score =   125 bits (314),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 55/60 (92%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG AGYAPIR KEKPYWIIKNSWGE WGEKGYYKICRGRN CGVDSMVSTVAAV+T
Sbjct  318  LLVGYGEAGYAPIRRKEKPYWIIKNSWGEKWGEKGYYKICRGRNICGVDSMVSTVAAVST  377



>gb|AIB06024.1| CP2 [Hevea brasiliensis]
Length=372

 Score =   125 bits (314),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 56/63 (89%), Positives = 59/63 (94%), Gaps = 1/63 (2%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAA-VN  179
            LLVGYGSAGYAP+RLKEKPYWIIKNSWGE+WGE GYYKICRGRN CGVDSMVSTVAA V 
Sbjct  309  LLVGYGSAGYAPVRLKEKPYWIIKNSWGENWGESGYYKICRGRNICGVDSMVSTVAAVVQ  368

Query  180  TPT  188
            TP+
Sbjct  369  TPS  371



>gb|AAX19661.1| cysteine proteinase [Populus tomentosa]
Length=374

 Score =   124 bits (312),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAP+R+KEKPYWIIKNSWGESWGE G+YKICRGRN CGVDSMVSTVAAV T
Sbjct  312  LLVGYGSAGYAPVRMKEKPYWIIKNSWGESWGENGFYKICRGRNICGVDSMVSTVAAVQT  371

Query  183  PT  188
             +
Sbjct  372  SS  373



>emb|CDP20652.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   124 bits (312),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS+GYAPIR+KEKPYWIIKNSWGE WGE GYYKICRG N CGVDSMVSTVAAV+T
Sbjct  311  LLVGYGSSGYAPIRMKEKPYWIIKNSWGEHWGENGYYKICRGHNICGVDSMVSTVAAVHT  370

Query  183  PT  188
             T
Sbjct  371  ST  372



>gb|KJB32561.1| hypothetical protein B456_005G247000 [Gossypium raimondii]
Length=374

 Score =   124 bits (312),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 54/60 (90%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAPIRLK+KPYWIIKNSWGE+WGE G+YKICRGRN CGVDS+VSTVAAVNT
Sbjct  312  LLVGYGSAGYAPIRLKDKPYWIIKNSWGETWGENGFYKICRGRNVCGVDSLVSTVAAVNT  371



>ref|XP_011047717.1| PREDICTED: cysteine proteinase RD19a [Populus euphratica]
Length=368

 Score =   124 bits (312),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 54/60 (90%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAP+R+KEKPYWIIKNSWGESWGE G+YKICRGRN CGVDSMVSTVAAV T
Sbjct  306  LLVGYGSAGYAPVRMKEKPYWIIKNSWGESWGENGFYKICRGRNICGVDSMVSTVAAVQT  365



>gb|KDO49483.1| hypothetical protein CISIN_1g017318mg [Citrus sinensis]
Length=373

 Score =   124 bits (312),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 55/57 (96%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAA  173
            LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE GYYKICRGRN CGVDSMVSTVAA
Sbjct  315  LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAA  371



>ref|XP_006487337.1| PREDICTED: cysteine proteinase RD19a-like [Citrus sinensis]
Length=373

 Score =   124 bits (311),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 55/57 (96%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAA  173
            LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE GYYKICRGRN CGVDSMVSTVAA
Sbjct  315  LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAA  371



>gb|ABQ10201.1| cysteine protease Cp3 [Actinidia deliciosa]
Length=365

 Score =   124 bits (311),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 54/63 (86%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE G+YKIC+GRN CGVDSMVSTVAAV+T
Sbjct  303  LLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGFYKICQGRNVCGVDSMVSTVAAVHT  362

Query  183  PTS  191
             ++
Sbjct  363  TSN  365



>ref|XP_010271520.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=370

 Score =   124 bits (311),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 54/59 (92%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVN  179
            LLVGYGS GYAPIRLK+KPYWIIKNSWGE WGE GYYKICRGRN CGVDSMVSTVAAVN
Sbjct  308  LLVGYGSEGYAPIRLKDKPYWIIKNSWGEGWGENGYYKICRGRNVCGVDSMVSTVAAVN  366



>sp|P05993.1|PAPA5_CARPA RecName: Full=Cysteine proteinase; AltName: Full=Clone PLBPC13, 
partial [Carica papaya]
 emb|CAA27609.1| pot. cysteine proteinase [Carica papaya]
Length=96

 Score =   117 bits (294),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAPIRLKEKPYW+IKNSWGE+WGE GYYKICRGRN CGVDSMVSTVAAV+T
Sbjct  34   LLVGYGSAGYAPIRLKEKPYWVIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHT  93

Query  183  PTS  191
             + 
Sbjct  94   TSQ  96



>ref|XP_002280798.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CAN73591.1| hypothetical protein VITISV_022889 [Vitis vinifera]
 emb|CBI19785.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   124 bits (311),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 53/60 (88%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGY+PIR KEKPYWIIKNSWGESWGE+GYYKICRG N CGVDSMVSTVAA++T
Sbjct  309  LLVGYGSAGYSPIRFKEKPYWIIKNSWGESWGEQGYYKICRGHNICGVDSMVSTVAAIHT  368



>ref|XP_002275759.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI17456.3| unnamed protein product [Vitis vinifera]
Length=367

 Score =   124 bits (310),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            +LVGYGSAGYAPIR KEKPYWIIKNSWGESWGE GYYKICRG N CGVDSMVSTVAA+ T
Sbjct  305  VLVGYGSAGYAPIRFKEKPYWIIKNSWGESWGEDGYYKICRGHNACGVDSMVSTVAAIQT  364

Query  183  PT  188
             T
Sbjct  365  TT  366



>gb|KJB79047.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
Length=373

 Score =   124 bits (310),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 52/60 (87%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAP+R+K+KPYWIIKNSWGE+WGE G+Y+ICRGRN CGVDSMVSTVAAVNT
Sbjct  311  LLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGENGFYRICRGRNICGVDSMVSTVAAVNT  370



>emb|CAE54306.1| putative papain-like cysteine proteinase [Gossypium hirsutum]
Length=373

 Score =   123 bits (309),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 52/60 (87%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAP+R+K+KPYWIIKNSWGE+WGE G+Y+ICRGRN CGVDSMVSTVAAVNT
Sbjct  311  LLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGENGFYRICRGRNICGVDSMVSTVAAVNT  370



>ref|NP_001267989.1| cysteine protease precursor [Vitis vinifera]
 gb|ABX79341.1| cysteine protease [Vitis vinifera]
Length=377

 Score =   123 bits (309),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 53/63 (84%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAPIR+K+KPYWIIKNSWGE+WGE G+YKICRGRN CGVDSMVSTVAAV+T
Sbjct  315  LLVGYGSAGYAPIRMKDKPYWIIKNSWGENWGENGFYKICRGRNVCGVDSMVSTVAAVHT  374

Query  183  PTS  191
             ++
Sbjct  375  TSN  377



>ref|XP_006423403.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
 gb|ESR36643.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
Length=375

 Score =   123 bits (308),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 54/57 (95%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAA  173
            LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE GYYKICRGRN CGVDSMVST+AA
Sbjct  315  LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTIAA  371



>ref|XP_011028940.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score =   123 bits (308),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 53/60 (88%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAPIR KEKP+WIIKNSWGE+WGE GYYKICRGRN CGVDSMVSTVAA++T
Sbjct  305  LLVGYGSAGYAPIRFKEKPFWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAIHT  364



>ref|XP_007131787.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
 gb|ESW03781.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
Length=361

 Score =   122 bits (307),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS  YAPIR+KEKPYWIIKNSWGE+WGE GYYKICRGRN CGVDSMVSTVAAV+T
Sbjct  299  LLVGYGSGAYAPIRMKEKPYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHT  358

Query  183  PT  188
             T
Sbjct  359  TT  360



>ref|XP_007017672.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOY14897.1| Papain family cysteine protease [Theobroma cacao]
Length=401

 Score =   123 bits (308),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE+GYYKICRGRN CGVDSMVS+VAA+ T
Sbjct  339  LLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEEGYYKICRGRNVCGVDSMVSSVAALQT  398

Query  183  PT  188
             +
Sbjct  399  KS  400



>ref|XP_003523684.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=366

 Score =   122 bits (307),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 52/59 (88%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVN  179
            LLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYYKICRGRN CGVDSMVSTVAA++
Sbjct  304  LLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYKICRGRNVCGVDSMVSTVAAIH  362



>gb|KHG15253.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=373

 Score =   122 bits (307),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 52/60 (87%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAP+R+K+KPYWIIKNSWGE+WGE G+Y+ICRGRN CGVDSMVSTVAAVNT
Sbjct  311  LLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGENGFYRICRGRNICGVDSMVSTVAAVNT  370



>ref|XP_002313770.1| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE87725.1| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   122 bits (307),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 53/60 (88%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSA YAP+R+KEKPYWIIKNSWGESWGE G+YKICRGRN CGVDSMVSTVAAV T
Sbjct  306  LLVGYGSAAYAPVRMKEKPYWIIKNSWGESWGENGFYKICRGRNICGVDSMVSTVAAVQT  365



>gb|ABK92536.1| unknown [Populus trichocarpa]
Length=368

 Score =   122 bits (307),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 53/60 (88%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSA YAP+R+KEKPYWIIKNSWGESWGE G+YKICRGRN CGVDSMVSTVAAV T
Sbjct  306  LLVGYGSAAYAPVRMKEKPYWIIKNSWGESWGENGFYKICRGRNICGVDSMVSTVAAVQT  365



>ref|XP_004291404.1| PREDICTED: cysteine proteinase 15A-like [Fragaria vesca subsp. 
vesca]
Length=365

 Score =   122 bits (307),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS+GYAPIR KEKPYWIIKNSWG+SWGE+GYYKICRGRN CGVDSMVSTVAA++T
Sbjct  306  LLVGYGSSGYAPIRFKEKPYWIIKNSWGQSWGEEGYYKICRGRNVCGVDSMVSTVAAMHT  365



>ref|NP_001241450.1| uncharacterized protein LOC100778716 precursor [Glycine max]
 gb|ACU20049.1| unknown [Glycine max]
Length=366

 Score =   122 bits (306),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 52/59 (88%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVN  179
            LLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYYKICRGRN CGVDSMVSTVAA++
Sbjct  304  LLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYKICRGRNVCGVDSMVSTVAAIH  362



>ref|XP_011037175.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
 ref|XP_011037176.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
Length=368

 Score =   122 bits (306),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGY+PIR+K+KPYWIIKNSWGE WGE G+YKICRGRN CGVDSMVSTVAAV T
Sbjct  306  LLVGYGSAGYSPIRMKDKPYWIIKNSWGEKWGENGFYKICRGRNVCGVDSMVSTVAAVQT  365

Query  183  PT  188
             +
Sbjct  366  TS  367



>gb|ABK94801.1| unknown [Populus trichocarpa]
Length=367

 Score =   122 bits (306),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 52/60 (87%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAPIR KEKP+WIIKNSWG++WGE GYYKICRGRN CGVDSMVSTVAA++T
Sbjct  305  LLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGENGYYKICRGRNICGVDSMVSTVAAIHT  364



>ref|XP_010061009.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW67908.1| hypothetical protein EUGRSUZ_F01612 [Eucalyptus grandis]
Length=369

 Score =   122 bits (306),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 53/60 (88%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYKICRGR+ CGVDSMVSTVAA++T
Sbjct  307  LLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGRDICGVDSMVSTVAAIHT  366



>gb|KHN45894.1| Cysteine proteinase RD19a [Glycine soja]
Length=366

 Score =   122 bits (305),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 52/59 (88%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVN  179
            LLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYYKICRGRN CGVDSMVSTVAA++
Sbjct  304  LLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYKICRGRNVCGVDSMVSTVAAIH  362



>ref|XP_009373025.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=371

 Score =   122 bits (306),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 52/63 (83%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YKICRGRN CGVDSMVSTVAA + 
Sbjct  307  LLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAASV  366

Query  183  PTS  191
             T+
Sbjct  367  KTN  369



>ref|XP_011092831.1| PREDICTED: cysteine proteinase RD19a-like [Sesamum indicum]
Length=378

 Score =   122 bits (306),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 53/60 (88%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+A YAPIRLKEKPYWIIKNSWGE+WGE GYYKICRG N CGVDSMVSTVAAV+T
Sbjct  317  LLVGYGAASYAPIRLKEKPYWIIKNSWGENWGENGYYKICRGHNVCGVDSMVSTVAAVST  376



>ref|XP_010105270.1| Cysteine proteinase 15A [Morus notabilis]
 gb|EXC04205.1| Cysteine proteinase 15A [Morus notabilis]
Length=372

 Score =   122 bits (305),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 51/59 (86%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVN  179
            LLVGYG+AGYAPIR K+KPYWIIKNSWGE+WGE+GYYKICRGRN CGVDSMVSTVAA++
Sbjct  305  LLVGYGTAGYAPIRFKDKPYWIIKNSWGENWGEQGYYKICRGRNVCGVDSMVSTVAALH  363



>ref|XP_003539008.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=363

 Score =   121 bits (304),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYKICRGRN CGVDSMVSTVAAV+T
Sbjct  301  LLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHT  360

Query  183  PT  188
             T
Sbjct  361  TT  362



>gb|ABK96580.1| unknown [Populus trichocarpa x Populus deltoides]
Length=367

 Score =   121 bits (304),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 52/60 (87%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAPIR KEKP+WIIKNSWG++WGE GYYKICRGRN CGVDSMVSTVAA++T
Sbjct  305  LLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGENGYYKICRGRNICGVDSMVSTVAAIHT  364



>emb|CDQ51995.1| Cysteine proteinase, partial [Fagus sylvatica]
Length=165

 Score =   117 bits (293),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVN  179
            LLVG+GSAGYAPIRLKEKP+WIIKNSWGE+WGE GYYKICRGRN CGVDSMVSTVAA+N
Sbjct  106  LLVGFGSAGYAPIRLKEKPFWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVAAIN  164



>ref|XP_002510469.1| cysteine protease, putative [Ricinus communis]
 gb|EEF52656.1| cysteine protease, putative [Ricinus communis]
Length=366

 Score =   121 bits (304),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 50/60 (83%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            +LVGYGSAGYAP+RLK+KP+WIIKNSWGE+WGE GYYKICRGRN CGVD+MVSTVAA++T
Sbjct  304  VLVGYGSAGYAPVRLKDKPFWIIKNSWGENWGENGYYKICRGRNVCGVDAMVSTVAAIHT  363



>ref|XP_002305451.2| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE85962.2| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   121 bits (304),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGY+P+R+KEKP+WIIKNSWGE WGE G+YKICRGRN CGVDSMVSTVAAV T
Sbjct  306  LLVGYGSAGYSPVRMKEKPFWIIKNSWGEKWGENGFYKICRGRNVCGVDSMVSTVAAVQT  365

Query  183  PT  188
             +
Sbjct  366  SS  367



>ref|XP_004507484.1| PREDICTED: cysteine proteinase RD19a-like [Cicer arietinum]
Length=363

 Score =   121 bits (304),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS  YAPIR+KEKPYWIIKNSWGE+WGE G+YKICRGRN CGVDSMVSTVAAV+T
Sbjct  301  LLVGYGSGAYAPIRMKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAVHT  360

Query  183  PT  188
             T
Sbjct  361  TT  362



>ref|XP_004290288.1| PREDICTED: probable cysteine proteinase A494 [Fragaria vesca 
subsp. vesca]
Length=372

 Score =   121 bits (304),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 52/58 (90%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAV  176
            LLVGYGSAGY+P+R+KEKPYWIIKNSWGE+WGEKG+YKICRGRN CGVDSMVSTVAAV
Sbjct  313  LLVGYGSAGYSPVRMKEKPYWIIKNSWGENWGEKGFYKICRGRNICGVDSMVSTVAAV  370



>dbj|BAJ53178.1| JHL18I08.12 [Jatropha curcas]
 gb|KDP38578.1| hypothetical protein JCGZ_04503 [Jatropha curcas]
Length=368

 Score =   121 bits (304),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 52/63 (83%), Positives = 59/63 (94%), Gaps = 1/63 (2%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAPIRLK+KP+WIIKNSWGESWGE GYY+ICRGRN CGVD+MVS+VAA++ 
Sbjct  305  LLVGYGSAGYAPIRLKDKPFWIIKNSWGESWGENGYYRICRGRNICGVDAMVSSVAAIH-  363

Query  183  PTS  191
            P S
Sbjct  364  PNS  366



>ref|XP_010268619.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=369

 Score =   121 bits (303),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 51/60 (85%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS GY+PIR+K+KPYWIIKNSWGESWGE GYYKICRGR+ CGVDSMVSTVAA++T
Sbjct  307  LLVGYGSEGYSPIRMKDKPYWIIKNSWGESWGENGYYKICRGRDVCGVDSMVSTVAAIHT  366



>ref|XP_004148554.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Cucumis sativus]
Length=381

 Score =   121 bits (303),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 51/59 (86%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVN  179
            LLVGYGSAGYAPIR+++K YWIIKNSWGESWGE GYYKICRGRN CGVDS+VSTVAAV+
Sbjct  309  LLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGENGYYKICRGRNICGVDSLVSTVAAVH  367



>gb|KGN43159.1| Papain-like cysteine proteinase isoform I [Cucumis sativus]
Length=387

 Score =   121 bits (303),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 51/59 (86%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVN  179
            LLVGYGSAGYAPIR+++K YWIIKNSWGESWGE GYYKICRGRN CGVDS+VSTVAAV+
Sbjct  315  LLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGENGYYKICRGRNICGVDSLVSTVAAVH  373



>ref|XP_004165230.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
Length=387

 Score =   121 bits (303),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 51/59 (86%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVN  179
            LLVGYGSAGYAPIR+++K YWIIKNSWGESWGE GYYKICRGRN CGVDS+VSTVAAV+
Sbjct  315  LLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGENGYYKICRGRNICGVDSLVSTVAAVH  373



>gb|KHN39817.1| Cysteine proteinase RD19a [Glycine soja]
Length=332

 Score =   120 bits (301),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYKICRGRN CGVDSMVSTVAAV+T
Sbjct  270  LLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHT  329

Query  183  PT  188
             T
Sbjct  330  TT  331



>ref|XP_002302004.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
 gb|ABK94746.1| unknown [Populus trichocarpa]
 gb|EEE81277.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
Length=367

 Score =   120 bits (302),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 52/60 (87%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAPIR KEKP+WIIKNSWG++WGE GYYKICRGRN CGVDSMVSTVAA++T
Sbjct  305  LLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGENGYYKICRGRNICGVDSMVSTVAAIHT  364



>ref|XP_008236965.1| PREDICTED: cysteine proteinase RD19a [Prunus mume]
Length=367

 Score =   120 bits (302),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 51/63 (81%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+AGY+PIR+KEKPYWIIKNSWGE+WGEKG+YKIC+GRN CGVDSMVSTVAA + 
Sbjct  303  LLVGYGAAGYSPIRMKEKPYWIIKNSWGENWGEKGFYKICKGRNICGVDSMVSTVAAASV  362

Query  183  PTS  191
             T+
Sbjct  363  ETN  365



>gb|AAR92156.1| putative cysteine protease 3 [Iris x hollandica]
Length=292

 Score =   119 bits (299),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAPIRLKEKPYWIIKNSWGE+WGE GYYKICRGRN CGVDSMVSTV A++T
Sbjct  228  LLVGYGSAGYAPIRLKEKPYWIIKNSWGETWGENGYYKICRGRNVCGVDSMVSTVTAIHT  287



>gb|ABF46642.1| papain-like cysteine proteinase [Pachysandra terminalis]
Length=374

 Score =   120 bits (302),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAG+APIR KEKPYWIIKNSWGESWGEKGYYKICRGRN CG+DSMVS VAA   
Sbjct  312  LLVGYGSAGFAPIRFKEKPYWIIKNSWGESWGEKGYYKICRGRNICGMDSMVSAVAAA-V  370

Query  183  PT  188
            PT
Sbjct  371  PT  372



>ref|XP_009373000.1| PREDICTED: cysteine proteinase RD19a [Pyrus x bretschneideri]
Length=371

 Score =   120 bits (302),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 52/63 (83%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YKICRGRN CGVDSMVSTVAA + 
Sbjct  307  LLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAASV  366

Query  183  PTS  191
             T+
Sbjct  367  KTN  369



>gb|KHN22211.1| Cysteine proteinase 15A [Glycine soja]
Length=366

 Score =   120 bits (301),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 51/59 (86%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVN  179
            LLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYY ICRGRN CGVDSMVSTVAA++
Sbjct  304  LLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYNICRGRNVCGVDSMVSTVAAIH  362



>ref|XP_008382317.1| PREDICTED: cysteine proteinase RD19a [Malus domestica]
Length=371

 Score =   120 bits (301),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 52/63 (83%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YKICRGRN CGVDSMVSTVAA + 
Sbjct  307  LLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAASV  366

Query  183  PTS  191
             T+
Sbjct  367  KTN  369



>ref|XP_007201310.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
 gb|EMJ02509.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
Length=367

 Score =   120 bits (301),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 51/63 (81%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+AGY+PIR+KEKPYWIIKNSWGE+WGEKG+YKIC+GRN CGVDSMVSTVAA + 
Sbjct  303  LLVGYGAAGYSPIRMKEKPYWIIKNSWGENWGEKGFYKICKGRNICGVDSMVSTVAAASV  362

Query  183  PTS  191
             T+
Sbjct  363  ETN  365



>ref|XP_008775532.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=371

 Score =   120 bits (301),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 53/60 (88%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSA YAPIR KEKPYWIIKNSWGE WGE GYYKICRGRN CGVDSMVSTVAAV +
Sbjct  311  LLVGYGSAAYAPIRFKEKPYWIIKNSWGEKWGENGYYKICRGRNVCGVDSMVSTVAAVRS  370



>ref|XP_010028631.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW55393.1| hypothetical protein EUGRSUZ_I01305 [Eucalyptus grandis]
Length=370

 Score =   120 bits (301),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 55/65 (85%), Positives = 58/65 (89%), Gaps = 2/65 (3%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAV--  176
            LLVGYGSAGYAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRN CGVDSMVSTVAA   
Sbjct  305  LLVGYGSAGYAPIRMKDKPYWIIKNSWGETWGENGYYKICRGRNICGVDSMVSTVAAAVH  364

Query  177  NTPTS  191
             TP S
Sbjct  365  TTPGS  369



>gb|AAL69389.1|AF462226_1 putative cysteine proteinase [Narcissus pseudonarcissus]
Length=136

 Score =   115 bits (287),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS+G+APIR KEKPYWIIKNSWGE+WGEKGYYKIC+GRN CGVDSMVSTV A++T
Sbjct  73   LLVGYGSSGWAPIRFKEKPYWIIKNSWGENWGEKGYYKICKGRNVCGVDSMVSTVTAIHT  132

Query  183  PTSD  194
               D
Sbjct  133  TPKD  136



>gb|ABK96252.1| unknown [Populus trichocarpa x Populus deltoides]
Length=156

 Score =   115 bits (289),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGY+P+R+KEKP+WIIKNSWGE WGE G+YKICRGRN CGVDSMVSTVAAV T
Sbjct  95   LLVGYGSAGYSPVRMKEKPFWIIKNSWGEKWGENGFYKICRGRNVCGVDSMVSTVAAVQT  154

Query  183  PT  188
             +
Sbjct  155  SS  156



>ref|XP_009392632.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=369

 Score =   120 bits (300),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 50/60 (83%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGY+PIRLK+KP+WIIKNSWGE+WGE GYYKICRGRN CGVDSMVS+V+A++T
Sbjct  306  LLVGYGSAGYSPIRLKDKPFWIIKNSWGENWGEHGYYKICRGRNICGVDSMVSSVSAIHT  365



>ref|XP_003540987.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=365

 Score =   120 bits (300),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYKICRGRN CGVDSMVSTVA+V+T
Sbjct  303  LLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVASVHT  362

Query  183  PT  188
             T
Sbjct  363  TT  364



>ref|XP_010066197.1| PREDICTED: probable cysteine proteinase A494 [Eucalyptus grandis]
 gb|KCW64029.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
 gb|KCW64030.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
Length=376

 Score =   120 bits (300),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 51/60 (85%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSA Y+PIR+KEKPYWIIKNSWGE+WGE G+YKICRGRN CGVDSMVSTVAA++T
Sbjct  314  LLVGYGSAAYSPIRMKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAIHT  373



>ref|XP_008448073.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=385

 Score =   120 bits (300),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 50/59 (85%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVN  179
            LLVGYGSAGYAPIR+++K YWIIKNSWGE+WGE GYYKICRGRN CGVDS+VSTVAAV+
Sbjct  313  LLVGYGSAGYAPIRMRDKDYWIIKNSWGENWGENGYYKICRGRNICGVDSLVSTVAAVH  371



>ref|XP_010672379.1| PREDICTED: cysteine proteinase RD19a-like [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score =   120 bits (300),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 51/59 (86%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVN  179
            +LVGYGSAGYAPIR KEKPYWIIKNSWG +WG++GYYKICRG N CGVDSMVSTVAAVN
Sbjct  312  VLVGYGSAGYAPIRFKEKPYWIIKNSWGPNWGDQGYYKICRGHNVCGVDSMVSTVAAVN  370



>ref|XP_004150061.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004166953.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN61836.1| Cysteine protease [Cucumis sativus]
Length=377

 Score =   120 bits (300),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 53/60 (88%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS GYAPIRLK+KPYWIIKNSWG +WGE GYYKICRGRN CGVDSMVSTVAAV+T
Sbjct  315  LLVGYGSDGYAPIRLKDKPYWIIKNSWGANWGENGYYKICRGRNICGVDSMVSTVAAVHT  374



>gb|EYU37835.1| hypothetical protein MIMGU_mgv1a008237mg [Erythranthe guttata]
Length=380

 Score =   119 bits (299),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG  GY+PIR+KEKPYWIIKNSWG +WGE GYYKICRGRN CGVDSMVSTVAAV+T
Sbjct  318  LLVGYGETGYSPIRMKEKPYWIIKNSWGPNWGEDGYYKICRGRNICGVDSMVSTVAAVST  377

Query  183  PT  188
             +
Sbjct  378  TS  379



>ref|XP_007136047.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
 gb|ESW08041.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
Length=366

 Score =   119 bits (299),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+  YAPIR KEKP+WIIKNSWGESWGE GYYKICRG N CGVDSMVSTVAA++T
Sbjct  304  LLVGYGAGAYAPIRFKEKPFWIIKNSWGESWGENGYYKICRGHNVCGVDSMVSTVAAIHT  363

Query  183  PT  188
             +
Sbjct  364  SS  365



>gb|KJB07487.1| hypothetical protein B456_001G026600 [Gossypium raimondii]
Length=377

 Score =   119 bits (299),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGY+PI LK+KPYWIIKNSWGE+WGE GYYKICRG N CGVDS+VSTV A+NT
Sbjct  315  LLVGYGSAGYSPIHLKDKPYWIIKNSWGENWGENGYYKICRGSNVCGVDSLVSTVVALNT  374

Query  183  PT  188
             +
Sbjct  375  KS  376



>ref|XP_011045161.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score =   119 bits (299),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 50/59 (85%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVN  179
            LLVGYG+AGYAPIR KEKP+WIIKNSWGE+WGE GYYKICR RN CGVDSMVSTVAA++
Sbjct  305  LLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGENGYYKICRARNICGVDSMVSTVAAIH  363



>ref|XP_010910124.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=374

 Score =   119 bits (299),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 52/60 (87%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYKIC+GRN CGVDSMVSTV AV +
Sbjct  314  LLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEDGYYKICKGRNVCGVDSMVSTVTAVRS  373



>gb|AGV54334.1| cysteine proteinase RD19a-like protein [Phaseolus vulgaris]
Length=366

 Score =   119 bits (298),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+  YAPIR KEKP+WIIKNSWGESWGE GYYKICRG N CGVDSMVSTVAA++T
Sbjct  304  LLVGYGAGAYAPIRFKEKPFWIIKNSWGESWGENGYYKICRGHNVCGVDSMVSTVAAIHT  363

Query  183  PT  188
             +
Sbjct  364  SS  365



>gb|AAU81589.1| cysteine proteinase [Petunia x hybrida]
Length=257

 Score =   117 bits (293),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAG+APIRLKEKPYWIIKNSWGESWGE+GYYKICRGRN CGVD+MVSTV A +T
Sbjct  193  LLVGYGSAGFAPIRLKEKPYWIIKNSWGESWGEQGYYKICRGRNICGVDAMVSTVTAAHT  252



>ref|XP_008460996.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=377

 Score =   119 bits (298),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 52/60 (87%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS GYAPIR+K+KPYWIIKNSWG +WGE GYYKICRGRN CGVDSMVSTVAAV+T
Sbjct  315  LLVGYGSEGYAPIRMKDKPYWIIKNSWGANWGENGYYKICRGRNICGVDSMVSTVAAVHT  374



>gb|AAD29084.1|AF082181_1 cysteine proteinase precursor [Solanum melongena]
Length=363

 Score =   119 bits (298),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 51/60 (85%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAG+APIRLKEKPYWIIKNSWGE+WGE GYYKICRG N CGVD+MVSTV A +T
Sbjct  299  LLVGYGSAGFAPIRLKEKPYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTATHT  358



>ref|XP_010530325.1| PREDICTED: cysteine proteinase RD19a [Tarenaya hassleriana]
Length=370

 Score =   119 bits (298),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGY+PIRLKEKPYWIIKNSWG +WGE+GYYKIC GRN CG+D+MVS+VAAV+T
Sbjct  308  LLVGYGSAGYSPIRLKEKPYWIIKNSWGANWGEEGYYKICHGRNLCGMDTMVSSVAAVHT  367

Query  183  PT  188
             T
Sbjct  368  ST  369



>ref|XP_009376976.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=445

 Score =   119 bits (299),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+AGY+PIRLKEKPYWIIKNSWGESW E G+YKICRGRN CGVDSMVSTVAA + 
Sbjct  381  LLVGYGAAGYSPIRLKEKPYWIIKNSWGESWRESGFYKICRGRNICGVDSMVSTVAAASV  440

Query  183  PTS  191
             T+
Sbjct  441  KTN  443



>ref|XP_008387995.1| PREDICTED: cysteine proteinase 15A [Malus domestica]
Length=365

 Score =   119 bits (297),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 50/60 (83%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS+G+APIRLKEKPYWI+KNSWG+SWGE+GYYKICRG N+CGVDS+VSTVAA++T
Sbjct  303  LLVGYGSSGFAPIRLKEKPYWILKNSWGQSWGEQGYYKICRGYNSCGVDSLVSTVAALHT  362



>gb|AIB06025.1| CP3 [Hevea brasiliensis]
Length=366

 Score =   119 bits (297),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 48/60 (80%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+AGYAPIR K+KP+WIIKNSWGE+WGE GYYKICRGRN CG+D+MVS+VAA++T
Sbjct  304  LLVGYGAAGYAPIRFKDKPFWIIKNSWGENWGENGYYKICRGRNICGMDAMVSSVAAIHT  363



>ref|XP_002280808.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CBI19783.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   118 bits (296),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGY+PIR KEKPYW++KNSWG++WGE GYYKICRG N CGVDSMVSTVAA+ +
Sbjct  304  LLVGYGSAGYSPIRFKEKPYWLLKNSWGQNWGEHGYYKICRGHNICGVDSMVSTVAAIQS  363

Query  183  PT  188
             T
Sbjct  364  AT  365



>dbj|BAC41322.1| hypothetical protein [Lotus japonicus]
Length=358

 Score =   118 bits (296),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 51/60 (85%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRN CGVDSMVSTVAA++T
Sbjct  298  LLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAALHT  357



>ref|XP_003606998.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89195.1| papain family cysteine protease [Medicago truncatula]
Length=362

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS  Y+PIRLKEKPYWIIKNSWGE+WGE GYYKICRGRN CGVDSMVSTVAAV+T
Sbjct  301  LLVGYGSGAYSPIRLKEKPYWIIKNSWGETWGENGYYKICRGRNICGVDSMVSTVAAVHT  360

Query  183  PT  188
             T
Sbjct  361  TT  362



>gb|AAL05851.1|AF411121_1 cysteine proteinase precursor [Sandersonia aurantiaca]
Length=360

 Score =   118 bits (296),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 51/60 (85%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAG+APIR KEKPYWIIKNSWGE+WGE GYYKICRGRN CGVDSMVS+V+A +T
Sbjct  299  LLVGYGSAGFAPIRFKEKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSSVSAFHT  358



>ref|XP_006473584.1| PREDICTED: cysteine proteinase 15A-like [Citrus sinensis]
Length=369

 Score =   118 bits (296),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 51/63 (81%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            L+VGYGS+G+APIR KEKPYWIIKNSWGE+WGE GYYKIC GRN CGVDSMVS+VAAV+T
Sbjct  307  LIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGENGYYKICMGRNVCGVDSMVSSVAAVHT  366

Query  183  PTS  191
             +S
Sbjct  367  TSS  369



>ref|XP_009376977.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=447

 Score =   119 bits (297),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+AGY+PIRLKEKPYWIIKNSWGESW E G+YKICRGRN CGVDSMVSTVAA + 
Sbjct  383  LLVGYGAAGYSPIRLKEKPYWIIKNSWGESWRESGFYKICRGRNICGVDSMVSTVAAASV  442

Query  183  PTS  191
             T+
Sbjct  443  KTN  445



>ref|XP_009146338.1| PREDICTED: cysteine proteinase 15A-like [Brassica rapa]
 emb|CDY32227.1| BnaA01g17570D [Brassica napus]
Length=368

 Score =   118 bits (295),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 52/63 (83%), Positives = 58/63 (92%), Gaps = 1/63 (2%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR-NTCGVDSMVSTVAAVN  179
            LLVG+GS+GYAPIRLKEKPYWIIKNSWG +WGE GYYKICRGR N CG+D+MVSTVAAV+
Sbjct  305  LLVGFGSSGYAPIRLKEKPYWIIKNSWGSTWGEDGYYKICRGRHNICGMDTMVSTVAAVH  364

Query  180  TPT  188
            T T
Sbjct  365  TST  367



>gb|KDO84720.1| hypothetical protein CISIN_1g017548mg [Citrus sinensis]
Length=369

 Score =   118 bits (295),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 50/63 (79%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            L+VGYGS+G+APIR KEKPYWIIKNSWGE+WGE GYYKIC GRN CGVDSMVS+VAA++T
Sbjct  307  LIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGENGYYKICMGRNVCGVDSMVSSVAAIHT  366

Query  183  PTS  191
             +S
Sbjct  367  TSS  369



>gb|KHN25410.1| Cysteine proteinase RD19a [Glycine soja]
Length=365

 Score =   118 bits (295),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYKICRGR+ CGVDSMVSTVA+V+T
Sbjct  303  LLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKICRGRSICGVDSMVSTVASVHT  362

Query  183  PT  188
             T
Sbjct  363  TT  364



>emb|CAE45588.1| papain-like cysteine proteinase-like protein 1 [Lotus japonicus]
Length=359

 Score =   117 bits (294),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 51/60 (85%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRN CGVDSMVSTVAA++T
Sbjct  299  LLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAALHT  358



>ref|XP_002306900.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
 gb|ABK92924.1| unknown [Populus trichocarpa]
 gb|EEE93896.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
Length=367

 Score =   117 bits (294),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 50/59 (85%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVN  179
            LLVGYG+AGYAPIR KEKP+WIIKNSWGE+WGE GYYKICR RN CGVDSMVSTVAA++
Sbjct  305  LLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGENGYYKICRARNICGVDSMVSTVAAIH  363



>emb|CDY34441.1| BnaC01g21920D [Brassica napus]
Length=368

 Score =   117 bits (294),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 52/63 (83%), Positives = 58/63 (92%), Gaps = 1/63 (2%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR-NTCGVDSMVSTVAAVN  179
            LLVG+GS+GYAPIRLKEKPYWIIKNSWG +WGE GYYKICRGR N CG+D+MVSTVAAV+
Sbjct  305  LLVGFGSSGYAPIRLKEKPYWIIKNSWGSTWGEDGYYKICRGRHNICGMDTMVSTVAAVH  364

Query  180  TPT  188
            T T
Sbjct  365  TST  367



>emb|CAE45589.1| papain-like cysteine proteinase-like protein 2 [Lotus japonicus]
Length=361

 Score =   117 bits (294),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 51/60 (85%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRN CGVDSMVSTVAA++T
Sbjct  299  LLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVAALHT  358



>gb|EYU42593.1| hypothetical protein MIMGU_mgv1a008336mg [Erythranthe guttata]
Length=377

 Score =   117 bits (294),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 50/60 (83%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+  +APIR+KEKPYWIIKNSWG +WGEKGYYKIC+GRN CGVDSMVSTVAAV T
Sbjct  317  LLVGYGAGAFAPIRMKEKPYWIIKNSWGPNWGEKGYYKICQGRNLCGVDSMVSTVAAVTT  376



>emb|CDX98179.1| BnaC07g09190D [Brassica napus]
Length=72

 Score =   110 bits (276),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKICRGRN CGVDS+VSTV A  +
Sbjct  9    LLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEDGFYKICRGRNVCGVDSLVSTVTATVS  68

Query  183  PTSD  194
            P + 
Sbjct  69   PAAH  72



>ref|XP_006435090.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
 gb|ESR48330.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
Length=369

 Score =   117 bits (294),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 50/63 (79%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            L+VGYGS+G+APIR KEKPYWIIKNSWGE+WGE GYYKIC GRN CGVDSMVS+VAA++T
Sbjct  307  LIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGENGYYKICMGRNVCGVDSMVSSVAAIHT  366

Query  183  PTS  191
             +S
Sbjct  367  TSS  369



>gb|ABK93575.1| unknown [Populus trichocarpa]
Length=157

 Score =   113 bits (282),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+AGYAPIR KEKP+WIIKNSWGE+WGE GYYKICR RN CGVDSMVSTVAA++ 
Sbjct  95   LLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGENGYYKICRARNICGVDSMVSTVAAIHA  154



>ref|XP_003589348.1| Cysteine proteinase [Medicago truncatula]
 gb|AES59599.1| papain family cysteine protease [Medicago truncatula]
Length=364

 Score =   117 bits (293),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 49/60 (82%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LL+G+G  GYAPIRLKEKPYWIIKNSWG++WGE+GYYKICRGRN CGVDSMVSTVAA  +
Sbjct  305  LLLGFGQGGYAPIRLKEKPYWIIKNSWGQNWGEEGYYKICRGRNVCGVDSMVSTVAAAQS  364



>ref|XP_010531457.1| PREDICTED: probable cysteine proteinase A494 [Tarenaya hassleriana]
Length=364

 Score =   117 bits (293),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 50/57 (88%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAA  173
            LLVGYGSAGYAP R+KEKP+WIIKNSWGE+WGEKG+YKICRGRN CGVDS+VSTVAA
Sbjct  304  LLVGYGSAGYAPARMKEKPFWIIKNSWGENWGEKGFYKICRGRNICGVDSLVSTVAA  360



>dbj|BAF98584.1| CM0216.500.nc [Lotus japonicus]
Length=360

 Score =   117 bits (293),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 51/60 (85%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRN CGVDSMVSTVAA++T
Sbjct  298  LLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAALHT  357



>dbj|BAF98585.1| CM0216.510.nc [Lotus japonicus]
Length=360

 Score =   117 bits (293),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 51/60 (85%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRN CGVDSMVSTVAA++T
Sbjct  298  LLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVAALHT  357



>ref|XP_009351218.1| PREDICTED: cysteine proteinase RD19a-like, partial [Pyrus x bretschneideri]
Length=282

 Score =   115 bits (289),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YKICRGRN CGVDSMVSTVAA + 
Sbjct  218  LLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAASV  277

Query  183  PTS  191
             T+
Sbjct  278  KTN  280



>ref|XP_004230928.1| PREDICTED: cysteine proteinase RD19a [Solanum lycopersicum]
Length=369

 Score =   117 bits (292),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKICRGRN CGVDSMVSTVAAV+T
Sbjct  308  LLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGESGYYKICRGRNVCGVDSMVSTVAAVST  366

Query  183  PT  188
             +
Sbjct  367  SS  368



>ref|XP_008221329.1| PREDICTED: cysteine proteinase 15A-like [Prunus mume]
Length=366

 Score =   117 bits (292),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 48/60 (80%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS+G+APIR KEKPYWI+KNSWG+SWGE+GYYKICRG N CGVDS+VSTVA+++T
Sbjct  304  LLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEEGYYKICRGHNPCGVDSLVSTVASLHT  363



>emb|CAB53397.1| cysteine protease [Medicago sativa]
Length=209

 Score =   114 bits (285),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVG+GS GYAPIRLKEKPYWIIKNSWG++WGE+GYYKICRGRN CGVDSMVSTVAA  +
Sbjct  150  LLVGFGSGGYAPIRLKEKPYWIIKNSWGQNWGEEGYYKICRGRNVCGVDSMVSTVAAAQS  209



>gb|ACK57563.1| cysteine protease-like protein [Arachis hypogaea]
Length=364

 Score =   117 bits (292),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 50/60 (83%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+ GYAPIR KEKPYWIIKNSWGE+WGE GYYKICRG N CGVDSMVSTV A++T
Sbjct  302  LLVGYGAGGYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGPNMCGVDSMVSTVIAIHT  361



>ref|XP_006362019.1| PREDICTED: cysteine proteinase RD19a-like [Solanum tuberosum]
Length=368

 Score =   117 bits (292),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKICRGRN CGVDSMVSTVAAV+T
Sbjct  308  LLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGENGYYKICRGRNVCGVDSMVSTVAAVST  366

Query  183  PT  188
             +
Sbjct  367  SS  368



>ref|XP_010440192.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=365

 Score =   117 bits (292),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 53/63 (84%), Positives = 56/63 (89%), Gaps = 1/63 (2%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-RNTCGVDSMVSTVAAVN  179
            LLVG+GSAGYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  N CG+DSMVSTVAAV+
Sbjct  302  LLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGPHNVCGMDSMVSTVAAVH  361

Query  180  TPT  188
            T T
Sbjct  362  TTT  364



>ref|XP_003550405.2| PREDICTED: cysteine proteinase 15A [Glycine max]
Length=392

 Score =   117 bits (292),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAV  176
            LLVGYG   YAPIR K KPYWIIKNSWGESWGE GYYKICRGRN CGVDSMVSTVAA+
Sbjct  330  LLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAI  387



>ref|XP_010434865.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score =   116 bits (291),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 53/63 (84%), Positives = 56/63 (89%), Gaps = 1/63 (2%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-RNTCGVDSMVSTVAAVN  179
            LLVG+GSAGYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  N CG+DSMVSTVAAV+
Sbjct  302  LLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGPHNMCGMDSMVSTVAAVH  361

Query  180  TPT  188
            T T
Sbjct  362  TTT  364



>emb|CDY09707.1| BnaC07g33540D [Brassica napus]
Length=366

 Score =   116 bits (291),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 52/61 (85%), Positives = 56/61 (92%), Gaps = 1/61 (2%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR-NTCGVDSMVSTVAAVN  179
            LLVG+GSAGYAP+RL+EKPYWIIKNSWG  WGEKGYYKICRG  N CGVD+MVSTVAAVN
Sbjct  303  LLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEKGYYKICRGTPNICGVDTMVSTVAAVN  362

Query  180  T  182
            T
Sbjct  363  T  363



>ref|XP_007223351.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
 gb|EMJ24550.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
Length=367

 Score =   116 bits (291),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 47/60 (78%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS+G+APIR KEKPYWI+KNSWG+SWGE+G+YKICRG N+CGVDS+VSTVA+++T
Sbjct  305  LLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEEGFYKICRGHNSCGVDSLVSTVASLHT  364



>ref|XP_007160702.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
 gb|ESW32696.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
Length=365

 Score =   116 bits (290),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG   YAPIR KEKPYWIIKNSWGE+WGE GYYKICRGRN CGVDSMVSTV A++ 
Sbjct  303  LLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVGAIHA  362

Query  183  PT  188
             T
Sbjct  363  ST  364



>ref|XP_010449835.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score =   116 bits (290),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 53/63 (84%), Positives = 56/63 (89%), Gaps = 1/63 (2%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-RNTCGVDSMVSTVAAVN  179
            LLVG+GSAGYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  N CG+DSMVSTVAAV+
Sbjct  302  LLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGPHNMCGMDSMVSTVAAVH  361

Query  180  TPT  188
            T T
Sbjct  362  TTT  364



>gb|AAM65162.1| cysteine proteinase RD19A [Arabidopsis thaliana]
Length=368

 Score =   116 bits (290),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 50/63 (79%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+AGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRN CGVDSMVSTVAA  +
Sbjct  305  LLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSMVSTVAATVS  364

Query  183  PTS  191
             T+
Sbjct  365  TTA  367



>ref|XP_009602233.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana tomentosiformis]
Length=369

 Score =   116 bits (290),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKICRGRN CGVDSMVSTVAAV+T
Sbjct  308  LLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGENGYYKICRGRNVCGVDSMVSTVAAVST  366

Query  183  PT  188
             +
Sbjct  367  SS  368



>gb|AAU81591.1| cysteine proteinase, partial [Petunia x hybrida]
Length=190

 Score =   112 bits (281),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS G+APIR+KEKPYWIIKNSWGE WGE GYYKICRGRN CGVDSMVSTVAAV+T
Sbjct  130  LLVGYGS-GFAPIRMKEKPYWIIKNSWGEKWGESGYYKICRGRNVCGVDSMVSTVAAVST  188

Query  183  PT  188
             +
Sbjct  189  SS  190



>emb|CAA82995.1| cysteine proteinase [Vicia sativa]
Length=358

 Score =   115 bits (289),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 49/60 (82%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVG+G   YAPIRLKEKPYWIIKNSWG++WGE+GYYKICRGRN CGVDSMVSTVAA  +
Sbjct  297  LLVGFGKGAYAPIRLKEKPYWIIKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTVAAAQS  356



>sp|P25804.1|CYSP_PEA RecName: Full=Cysteine proteinase 15A; AltName: Full=Turgor-responsive 
protein 15A; Flags: Precursor [Pisum sativum]
 emb|CAA38242.1| unnamed protein product [Pisum sativum]
Length=363

 Score =   115 bits (289),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 49/60 (82%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVG+G   YAPIRLKEKPYWIIKNSWG++WGE+GYYKICRGRN CGVDSMVSTVAA  +
Sbjct  302  LLVGFGKGAYAPIRLKEKPYWIIKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTVAAAQS  361



>emb|CAD40319.2| OSJNBb0054B09.3 [Oryza sativa Japonica Group]
 emb|CAH66180.1| OSIGBa0130O15.4 [Oryza sativa Indica Group]
 emb|CAH66205.1| OSIGBa0148D14.11 [Oryza sativa Indica Group]
Length=381

 Score =   115 bits (289),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 3/63 (5%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNTCGVDSMVSTVAA  173
            LLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYKICRG   +N CGVDSMVS+V A
Sbjct  314  LLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKICRGPHDKNKCGVDSMVSSVTA  373

Query  174  VNT  182
            ++T
Sbjct  374  IHT  376



>dbj|BAD94010.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
Length=86

 Score =   109 bits (273),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+AGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRN CGVDSMVSTVAA  +
Sbjct  23   LLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSMVSTVAATVS  82

Query  183  PTSD  194
             T+ 
Sbjct  83   TTAH  86



>gb|AJP16692.1| cysteine protease, partial [Striga hermonthica]
Length=148

 Score =   111 bits (277),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAA  173
            LLVGYG +GYAPIR+K+KPYWIIKNSWGE+WGE GYYKICRGRN CGVDSMVSTVAA
Sbjct  92   LLVGYGESGYAPIRMKDKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVAA  148



>gb|KJB29611.1| hypothetical protein B456_005G110200 [Gossypium raimondii]
Length=370

 Score =   115 bits (289),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 48/62 (77%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+AGY+PIR K+KP+WIIKNSWG +WGE GYYKICRGRN CGVDSMVS+VAA++T
Sbjct  308  LLVGYGAAGYSPIRFKDKPFWIIKNSWGANWGEDGYYKICRGRNVCGVDSMVSSVAALHT  367

Query  183  PT  188
             +
Sbjct  368  KS  369



>gb|EEE60725.1| hypothetical protein OsJ_14236 [Oryza sativa Japonica Group]
Length=364

 Score =   115 bits (288),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 3/63 (5%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNTCGVDSMVSTVAA  173
            LLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYKICRG   +N CGVDSMVS+V A
Sbjct  297  LLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKICRGPHDKNKCGVDSMVSSVTA  356

Query  174  VNT  182
            ++T
Sbjct  357  IHT  359



>ref|XP_008775280.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=368

 Score =   115 bits (288),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 49/58 (84%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAV  176
            LLVGYGSAGYAPIR K+KPYWIIKNSWGE+WGE GYYKICRG N CGV+SMVSTV A+
Sbjct  309  LLVGYGSAGYAPIRFKDKPYWIIKNSWGENWGEDGYYKICRGHNICGVESMVSTVTAI  366



>ref|XP_003579573.2| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=399

 Score =   115 bits (289),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 51/67 (76%), Positives = 57/67 (85%), Gaps = 3/67 (4%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNTCGVDSMVSTVAA  173
            LLVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVSTV A
Sbjct  333  LLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKICRGAHVKNKCGVDSMVSTVTA  392

Query  174  VNTPTSD  194
            ++T   +
Sbjct  393  IHTSNKE  399



>ref|XP_009335626.1| PREDICTED: cysteine proteinase 15A [Pyrus x bretschneideri]
Length=366

 Score =   115 bits (288),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 48/59 (81%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVN  179
            LLVGYGS+G+APIR KEKPYWI+KNSWG+SWGE+GYYKICRG N+CGVDS+VSTVAA++
Sbjct  304  LLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEQGYYKICRGYNSCGVDSLVSTVAALH  362



>gb|AAO11786.1| pre-pro cysteine proteinase [Vicia faba]
Length=363

 Score =   115 bits (288),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 48/60 (80%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVG+G   YAPIRLKEKPYWI+KNSWG++WGE+GYYKICRGRN CGVDSMVSTVAA  +
Sbjct  302  LLVGFGKGAYAPIRLKEKPYWIVKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTVAAAQS  361



>ref|XP_009109502.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
 emb|CDX90310.1| BnaA08g16740D [Brassica napus]
Length=369

 Score =   115 bits (288),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKICRGRN CGVDS+VSTV A  +
Sbjct  306  LLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICRGRNVCGVDSLVSTVTAAVS  365

Query  183  PTS  191
            PT+
Sbjct  366  PTA  368



>gb|AAB67878.1| pre-pro-cysteine proteinase [Vicia faba]
Length=363

 Score =   115 bits (288),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 48/60 (80%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVG+G   YAPIRLKEKPYWI+KNSWG++WGE+GYYKICRGRN CGVDSMVSTVAA  +
Sbjct  302  LLVGFGKGAYAPIRLKEKPYWIVKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTVAAAQS  361



>gb|AAB62937.1| stress-induced cysteine proteinase [Lavatera thuringiaca]
Length=175

 Score =   111 bits (278),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+AGYAP+R KEKP+WIIKNSWG +WGE GYYKICRGRN CGVDSMVS+VAA+ T
Sbjct  113  LLVGYGAAGYAPVRFKEKPFWIIKNSWGANWGEDGYYKICRGRNVCGVDSMVSSVAALQT  172

Query  183  PTS  191
             + 
Sbjct  173  KSQ  175



>gb|EAY93546.1| hypothetical protein OsI_15336 [Oryza sativa Indica Group]
Length=348

 Score =   115 bits (287),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 3/63 (5%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNTCGVDSMVSTVAA  173
            LLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYKICRG   +N CGVDSMVS+V A
Sbjct  281  LLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKICRGPHDKNKCGVDSMVSSVTA  340

Query  174  VNT  182
            ++T
Sbjct  341  IHT  343



>gb|KHG15062.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=370

 Score =   115 bits (287),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 47/62 (76%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+AGY+PIR K+KP+WIIKNSWG +WGE GYY+ICRGRN CGVDSMVS+VAA++T
Sbjct  308  LLVGYGAAGYSPIRFKDKPFWIIKNSWGANWGEDGYYRICRGRNVCGVDSMVSSVAALHT  367

Query  183  PT  188
             +
Sbjct  368  KS  369



>ref|XP_006283974.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
 gb|EOA16872.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
Length=365

 Score =   115 bits (287),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 51/63 (81%), Positives = 56/63 (89%), Gaps = 1/63 (2%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-RNTCGVDSMVSTVAAVN  179
            LLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  N CG+D+MVSTVAAV+
Sbjct  302  LLVGFGSSGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGPHNMCGMDTMVSTVAAVH  361

Query  180  TPT  188
            T T
Sbjct  362  TTT  364



>ref|XP_004238314.1| PREDICTED: cysteine proteinase 15A [Solanum lycopersicum]
Length=363

 Score =   115 bits (287),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 48/60 (80%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS G+APIRLK KPYWIIKNSWG++WGE GYYKICRG N CGVD+MVSTV A +T
Sbjct  299  LLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEHGYYKICRGHNICGVDAMVSTVTATHT  358



>gb|KJB58164.1| hypothetical protein B456_009G197400 [Gossypium raimondii]
Length=375

 Score =   115 bits (287),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 48/59 (81%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVN  179
            LLVGYGSAGYAP+R K KPYWIIKNSWGE+WGE GYYKICRG N CGVDSMVS+V+A++
Sbjct  308  LLVGYGSAGYAPVRFKNKPYWIIKNSWGENWGENGYYKICRGNNVCGVDSMVSSVSALH  366



>dbj|BAF46302.1| cysteine proteinase precursor [Ipomoea nil]
Length=369

 Score =   115 bits (287),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 48/60 (80%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+AGYAPIR K+KPYWI+KNSWGE+WGE+GYYKICRG N CG+DSMVSTV A +T
Sbjct  307  LLVGYGAAGYAPIRFKDKPYWIVKNSWGENWGEEGYYKICRGNNICGIDSMVSTVTAAST  366



>ref|XP_006341997.1| PREDICTED: cysteine proteinase 15A-like [Solanum tuberosum]
Length=376

 Score =   115 bits (287),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 48/60 (80%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS G+APIRLK KPYWIIKNSWG++WGE GYYKICRG N CGVD+MVSTV A +T
Sbjct  312  LLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEHGYYKICRGHNICGVDAMVSTVTATHT  371



>ref|XP_009611293.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana tomentosiformis]
 emb|CAB44983.1| putative preprocysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   114 bits (286),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 49/60 (82%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG N CGVD+MVSTV A +T
Sbjct  299  LLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  358



>gb|ACX54787.2| cysteine protease [Arachis diogoi]
Length=360

 Score =   114 bits (286),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+AGYAPIR K+KP+WIIKNSWGESWGE GYYKICRG+N CGVDSMVS+V A   
Sbjct  296  LLVGYGAAGYAPIRFKDKPFWIIKNSWGESWGEDGYYKICRGKNVCGVDSMVSSVVATTF  355

Query  183  PTSD  194
             +S+
Sbjct  356  TSSN  359



>gb|AAK07731.1| CPR2-like cysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   114 bits (286),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 49/60 (82%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG N CGVD+MVSTV A +T
Sbjct  299  LLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  358



>emb|CDP07452.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   114 bits (286),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 51/61 (84%), Positives = 56/61 (92%), Gaps = 1/61 (2%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-RNTCGVDSMVSTVAAVN  179
            LLVGYG+AGYAPIRLK+KPYWIIKNSWGE+WGE GYYK CR  RN CGVDSMVS+VAAV+
Sbjct  316  LLVGYGAAGYAPIRLKDKPYWIIKNSWGENWGENGYYKFCRADRNLCGVDSMVSSVAAVH  375

Query  180  T  182
            T
Sbjct  376  T  376



>ref|XP_009136751.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
Length=368

 Score =   114 bits (286),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 51/61 (84%), Positives = 56/61 (92%), Gaps = 1/61 (2%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR-NTCGVDSMVSTVAAVN  179
            LLVG+GSAGYAP+RL+EKPYWIIKNSWG  WGEKGYYKICRG  N CGVD+MVSTVAAV+
Sbjct  305  LLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEKGYYKICRGTPNICGVDTMVSTVAAVH  364

Query  180  T  182
            T
Sbjct  365  T  365



>emb|CDX90537.1| BnaA03g42440D [Brassica napus]
Length=366

 Score =   114 bits (286),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 51/61 (84%), Positives = 56/61 (92%), Gaps = 1/61 (2%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR-NTCGVDSMVSTVAAVN  179
            LLVG+GSAGYAP+RL+EKPYWIIKNSWG  WGEKGYYKICRG  N CGVD+MVSTVAAV+
Sbjct  303  LLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEKGYYKICRGTPNICGVDTMVSTVAAVH  362

Query  180  T  182
            T
Sbjct  363  T  363



>gb|AAQ81938.1| cysteine proteinase precursor [Ipomoea batatas]
Length=371

 Score =   114 bits (286),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 48/60 (80%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            L+VGYG+AGYAPIR K+KPYWIIKNSWGE+WGE+GYYKICRG N CGVDSMVS+V A +T
Sbjct  309  LIVGYGAAGYAPIRFKDKPYWIIKNSWGENWGEEGYYKICRGNNICGVDSMVSSVTAAST  368



>emb|CAA78361.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   114 bits (286),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 49/60 (82%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG N CGVD+MVSTV A +T
Sbjct  299  LLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  358



>gb|EMT16425.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=379

 Score =   114 bits (286),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 51/63 (81%), Positives = 56/63 (89%), Gaps = 3/63 (5%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNTCGVDSMVSTVAA  173
            LLVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVSTV A
Sbjct  313  LLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKICRGPHVKNKCGVDSMVSTVTA  372

Query  174  VNT  182
            ++T
Sbjct  373  IHT  375



>ref|XP_006283963.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
 gb|EOA16861.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
Length=368

 Score =   114 bits (285),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 49/63 (78%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRN CGVDS+VSTV+A  +
Sbjct  305  LLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVSATVS  364

Query  183  PTS  191
             T+
Sbjct  365  TTA  367



>emb|CAA78365.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=365

 Score =   114 bits (285),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 49/60 (82%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG N CGVD+MVSTV A +T
Sbjct  301  LLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  360



>ref|XP_008444769.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=373

 Score =   114 bits (285),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 48/61 (79%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAG+APIR KEKPYWIIKNSWGE+WGE GYY IC+G+N CG +SMVS+VAA  T
Sbjct  312  LLVGYGSAGFAPIRFKEKPYWIIKNSWGENWGENGYYFICKGKNVCGSESMVSSVAAAAT  371

Query  183  P  185
            P
Sbjct  372  P  372



>ref|XP_011083631.1| PREDICTED: cysteine proteinase 15A-like [Sesamum indicum]
Length=371

 Score =   114 bits (284),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVN-  179
            LLVGYG+AGYAPIRLKEKPYWIIKNSWGE+WGE GYYKICRG N CGV SMVSTV A + 
Sbjct  309  LLVGYGAAGYAPIRLKEKPYWIIKNSWGENWGENGYYKICRGHNVCGVASMVSTVTAAHV  368

Query  180  TP  185
            TP
Sbjct  369  TP  370



>ref|XP_009405542.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=366

 Score =   114 bits (284),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAV  176
            LLVGYGSAGYAP R KEK YWIIKNSWGE+WGE GYYKICRGRN CGVDSMVS+V A+
Sbjct  307  LLVGYGSAGYAPARFKEKSYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSSVTAI  364



>gb|KHN12668.1| Cysteine proteinase 15A [Glycine soja]
Length=156

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAV  176
            LLVGYG   YAPIR K KPYWIIKNSWGESWGE GYYKICRGRN CGVDSMVSTVAA+
Sbjct  94   LLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAI  151



>emb|CDY71205.1| BnaCnng71840D [Brassica napus]
Length=368

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKICRGRN CGVDS+VSTV A  +
Sbjct  305  LLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEDGFYKICRGRNVCGVDSLVSTVTATVS  364

Query  183  PTS  191
            P +
Sbjct  365  PAA  367



>gb|AAL60581.1|AF454959_1 senescence-associated cysteine protease [Brassica oleracea]
Length=368

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKICRGRN CGVDS+VSTV A  +
Sbjct  305  LLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEDGFYKICRGRNVCGVDSLVSTVTATVS  364

Query  183  PTS  191
            P +
Sbjct  365  PAA  367



>ref|XP_004952477.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=374

 Score =   114 bits (284),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 3/62 (5%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNTCGVDSMVSTVAA  173
            LLVGYG+AG+APIRLKEKPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV+A
Sbjct  308  LLVGYGAAGFAPIRLKEKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSA  367

Query  174  VN  179
            ++
Sbjct  368  IH  369



>ref|XP_006653265.1| PREDICTED: cysteine proteinase 1-like, partial [Oryza brachyantha]
Length=366

 Score =   114 bits (284),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 52/63 (83%), Positives = 56/63 (89%), Gaps = 3/63 (5%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNTCGVDSMVSTVAA  173
            LLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVSTV A
Sbjct  300  LLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGPHVQNKCGVDSMVSTVTA  359

Query  174  VNT  182
            ++T
Sbjct  360  IHT  362



>ref|XP_010943608.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=371

 Score =   114 bits (284),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 50/60 (83%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAPIR K+KPYWIIKNSWG +WGE GYYKICRG+N CGV+SMVSTV AV T
Sbjct  311  LLVGYGSAGYAPIRFKDKPYWIIKNSWGGNWGEDGYYKICRGQNICGVESMVSTVTAVRT  370



>gb|EPS70818.1| cysteine proteinase, partial [Genlisea aurea]
Length=355

 Score =   114 bits (284),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 47/60 (78%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            L+VGYGS+GYAPIRLK KPYWI+KNSWG++WGEKGYYKICRG N CGV+SMVSTV A+++
Sbjct  296  LMVGYGSSGYAPIRLKNKPYWIVKNSWGKNWGEKGYYKICRGSNICGVESMVSTVTAIHS  355



>dbj|BAA92495.1| cysteine protease [Vigna mungo]
Length=364

 Score =   114 bits (284),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 48/58 (83%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +3

Query  6    LVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVN  179
            +VGYG +GYAPIR KEKPYWIIKNSWGESWGE GYYKICRG+N CGVDSMVSTV A++
Sbjct  303  IVGYGESGYAPIRFKEKPYWIIKNSWGESWGENGYYKICRGQNACGVDSMVSTVGAIH  360



>ref|NP_001266121.1| uncharacterized protein LOC101501911 precursor [Cicer arietinum]
 emb|CAA08906.1| cysteine proteinase [Cicer arietinum]
Length=362

 Score =   113 bits (283),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 50/59 (85%), Positives = 57/59 (97%), Gaps = 1/59 (2%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVN  179
            LLVG+G+ G+APIRLKEKPYWIIKNSWG++WGE+GYYKICRGRN CGVDSMVSTVAAV+
Sbjct  301  LLVGFGN-GFAPIRLKEKPYWIIKNSWGQNWGEEGYYKICRGRNICGVDSMVSTVAAVH  358



>gb|EMS53996.1| Cysteine proteinase 1 [Triticum urartu]
Length=405

 Score =   114 bits (284),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 51/63 (81%), Positives = 56/63 (89%), Gaps = 3/63 (5%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNTCGVDSMVSTVAA  173
            LLVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVSTV A
Sbjct  339  LLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKICRGPHVKNKCGVDSMVSTVTA  398

Query  174  VNT  182
            ++T
Sbjct  399  IHT  401



>emb|CAQ00101.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=381

 Score =   113 bits (283),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 50/63 (79%), Positives = 55/63 (87%), Gaps = 3/63 (5%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNTCGVDSMVSTVAA  173
             LVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVSTV A
Sbjct  315  FLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKICRGPHVKNKCGVDSMVSTVTA  374

Query  174  VNT  182
            ++T
Sbjct  375  IHT  377



>ref|XP_009776238.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana sylvestris]
Length=365

 Score =   113 bits (283),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 49/60 (82%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG N CGVD+MVSTV A +T
Sbjct  301  LLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  360



>gb|AJA74415.1| cysteine protease [Cicer arietinum]
Length=358

 Score =   113 bits (283),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 50/59 (85%), Positives = 57/59 (97%), Gaps = 1/59 (2%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVN  179
            LLVG+G+ G+APIRLKEKPYWIIKNSWG++WGE+GYYKICRGRN CGVDSMVSTVAAV+
Sbjct  297  LLVGFGN-GFAPIRLKEKPYWIIKNSWGQNWGEEGYYKICRGRNICGVDSMVSTVAAVH  354



>ref|XP_010431862.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score =   113 bits (283),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAA  173
            LLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRN CGVDS+VSTV+A
Sbjct  304  LLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVSA  360



>emb|CAB17075.1| cysteine proteinase precursor [Phaseolus vulgaris]
Length=365

 Score =   113 bits (283),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 49/62 (79%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG   YAPIR KEKPYWIIKNSWGE+WG  GYYKICRGRN CGVDSMVSTV A++ 
Sbjct  303  LLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGGNGYYKICRGRNVCGVDSMVSTVGAIHA  362

Query  183  PT  188
             T
Sbjct  363  ST  364



>ref|XP_006414378.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
 gb|ESQ55831.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
Length=367

 Score =   113 bits (282),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 50/63 (79%), Positives = 55/63 (87%), Gaps = 1/63 (2%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-RNTCGVDSMVSTVAAVN  179
            LLVG+GS+GY+PIRLKEKPYWIIKNSWG  WGE GYYKICRG  N CG+D+MVSTVAAV 
Sbjct  304  LLVGFGSSGYSPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGSHNICGMDTMVSTVAAVQ  363

Query  180  TPT  188
            T T
Sbjct  364  TST  366



>ref|XP_006828787.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
 gb|ERM96203.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
Length=365

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            L+VGYGSAGYAPIRLK+K YWIIKNSWGE+WGEKGYYKICRG N CGVDSMVSTVA++ +
Sbjct  306  LIVGYGSAGYAPIRLKDKAYWIIKNSWGETWGEKGYYKICRGHNICGVDSMVSTVASIQS  365



>emb|CAA78403.1| pre-pro-cysteine proteinase [Solanum lycopersicum]
Length=361

 Score =   112 bits (281),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 47/60 (78%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS G+APIRLK KPYWIIKNSWG++WGE GYYKICRG + CGVD+MVSTV A +T
Sbjct  297  LLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEHGYYKICRGHHICGVDAMVSTVTATHT  356



>gb|ACM80348.1| cysteine proteinase [Solanum lycopersicum]
Length=368

 Score =   113 bits (282),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKI RGRN CGVDSMVSTVAAV+T
Sbjct  308  LLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGESGYYKIRRGRNVCGVDSMVSTVAAVST  366

Query  183  PT  188
             +
Sbjct  367  SS  368



>dbj|BAF03553.1| cysteine proteinase CP2 [Phaseolus vulgaris]
Length=365

 Score =   112 bits (281),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG   YAPIR KEKPYWIIKNSWGE+WGE GYYKICRGRN CGVDSMVSTV A++ 
Sbjct  303  LLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVGAIHA  362

Query  183  PTS  191
             T 
Sbjct  363  STQ  365



>ref|XP_004975256.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=388

 Score =   113 bits (282),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 3/62 (5%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNTCGVDSMVSTVAA  173
            LLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYK+CRG   +N CGVDSMVSTV A
Sbjct  322  LLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGENGYYKLCRGPFVKNKCGVDSMVSTVTA  381

Query  174  VN  179
            ++
Sbjct  382  IH  383



>ref|NP_567489.1| papain family cysteine protease [Arabidopsis thaliana]
 emb|CAB10398.1| cysteine proteinase like protein [Arabidopsis thaliana]
 emb|CAB78661.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AAK62611.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM91059.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM96982.1| cysteine proteinase [Arabidopsis thaliana]
 gb|AAN31875.1| putative cysteine proteinase [Arabidopsis thaliana]
 dbj|BAE98514.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AEE83713.1| papain family cysteine protease [Arabidopsis thaliana]
Length=373

 Score =   112 bits (281),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 50/61 (82%), Positives = 55/61 (90%), Gaps = 1/61 (2%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-RNTCGVDSMVSTVAAVN  179
            LLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  N CG+D+MVSTVAAV+
Sbjct  310  LLVGFGSSGYAPIRLKEKPYWIIKNSWGAMWGEHGYYKICRGPHNMCGMDTMVSTVAAVH  369

Query  180  T  182
            T
Sbjct  370  T  370



>dbj|BAG16515.1| putative cysteine proteinase [Capsicum chinense]
Length=367

 Score =   112 bits (281),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 50/61 (82%), Positives = 54/61 (89%), Gaps = 1/61 (2%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR-NTCGVDSMVSTVAAVN  179
            LLVGYGSAG+APIRLK KPYWIIKNSWGE WGE GYYKICRG+ N CGVD+MVSTV A +
Sbjct  302  LLVGYGSAGFAPIRLKAKPYWIIKNSWGEHWGEHGYYKICRGQHNICGVDAMVSTVTAAH  361

Query  180  T  182
            T
Sbjct  362  T  362



>ref|NP_568052.1| cysteine proteinase RD19a [Arabidopsis thaliana]
 sp|P43296.1|RD19A_ARATH RecName: Full=Cysteine proteinase RD19a; Short=RD19; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA02373.1| thiol protease [Arabidopsis thaliana]
 emb|CAB38829.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 emb|CAB80572.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AAL85009.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 gb|AAM91778.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 dbj|BAE98545.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AEE87016.1| cysteine proteinase RD19a [Arabidopsis thaliana]
Length=368

 Score =   112 bits (280),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+AGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRN CGVDSMVSTVAA  +
Sbjct  305  LLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSMVSTVAATVS  364

Query  183  PTS  191
             T+
Sbjct  365  TTA  367



>ref|XP_002870174.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46433.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
Length=373

 Score =   112 bits (280),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 50/61 (82%), Positives = 55/61 (90%), Gaps = 1/61 (2%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG-RNTCGVDSMVSTVAAVN  179
            LLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE GYYKICRG  N CG+D+MVSTVAAV+
Sbjct  310  LLVGFGSSGYAPIRLKEKPYWIIKNSWGAMWGEHGYYKICRGPHNMCGMDTMVSTVAAVH  369

Query  180  T  182
            T
Sbjct  370  T  370



>gb|ABK24153.1| unknown [Picea sitchensis]
Length=394

 Score =   112 bits (281),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+AGYAP RLK KP+WIIKNSWG  WGE GYYK+CRG N CG+++MVSTVAA N 
Sbjct  330  LLVGYGAAGYAPGRLKNKPFWIIKNSWGPDWGEDGYYKLCRGHNVCGINTMVSTVAAANI  389

Query  183  PTSD  194
             T D
Sbjct  390  QTDD  393



>ref|NP_001105685.1| cysteine proteinase 1 precursor [Zea mays]
 sp|Q10716.1|CYSP1_MAIZE RecName: Full=Cysteine proteinase 1; Flags: Precursor [Zea mays]
 dbj|BAA08244.1| cysteine proteinase [Zea mays]
Length=371

 Score =   112 bits (279),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 57/62 (92%), Gaps = 3/62 (5%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNTCGVDSMVSTVAA  173
            LLVGYG++G+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV+A
Sbjct  306  LLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSA  365

Query  174  VN  179
            V+
Sbjct  366  VH  367



>ref|XP_006411706.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
 dbj|BAJ33785.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53159.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
Length=373

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAP R KEKPYWIIKNSWGESWGE G+YKIC+GRN CGVDS+VSTV+A  +
Sbjct  310  LLVGYGSAGYAPARFKEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSLVSTVSATVS  369

Query  183  PTS  191
             T+
Sbjct  370  TTA  372



>gb|KFK30492.1| hypothetical protein AALP_AA7G268600 [Arabis alpina]
Length=367

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRN CGVDS+VSTVAA  +
Sbjct  304  LLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVAATVS  363

Query  183  PTS  191
             T+
Sbjct  364  TTA  366



>gb|ACF86683.1| unknown [Zea mays]
 gb|AFW71402.1| cysteine protease1 [Zea mays]
Length=371

 Score =   112 bits (279),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 57/62 (92%), Gaps = 3/62 (5%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNTCGVDSMVSTVAA  173
            LLVGYG++G+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV+A
Sbjct  306  LLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSA  365

Query  174  VN  179
            V+
Sbjct  366  VH  367



>gb|KFK24413.1| hypothetical protein AALP_AAs58848U000200 [Arabis alpina]
Length=372

 Score =   111 bits (278),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 51/63 (81%), Positives = 56/63 (89%), Gaps = 2/63 (3%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGR-NTCGVDSMVSTVAAVN  179
            LLVG+G +GYAPIRLKEKPYWIIKNSWG+ WGE GYYKICRGR N CG+D+MVSTVAAV 
Sbjct  309  LLVGFGESGYAPIRLKEKPYWIIKNSWGKMWGEHGYYKICRGRHNICGMDTMVSTVAAVQ  368

Query  180  -TP  185
             TP
Sbjct  369  ITP  371



>ref|NP_001052440.1| Os04g0311400 [Oryza sativa Japonica Group]
 dbj|BAF14354.1| Os04g0311400, partial [Oryza sativa Japonica Group]
Length=384

 Score =   111 bits (278),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 3/63 (5%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNTCGVDSMVSTVAA  173
            LLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYKICRG   +N CGVDSMVS+V A
Sbjct  317  LLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKICRGPHDKNKCGVDSMVSSVTA  376

Query  174  VNT  182
            ++T
Sbjct  377  IHT  379



>ref|XP_006665032.1| PREDICTED: cysteine proteinase 1-like [Oryza brachyantha]
Length=191

 Score =   108 bits (270),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 57/63 (90%), Gaps = 3/63 (5%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNTCGVDSMVSTVAA  173
            LLVGYGS+G+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG   R+ CGVDSMVSTV A
Sbjct  126  LLVGYGSSGFAPIRLKDKPYWIIKNSWGENWGEHGYYKICRGSNVRDKCGVDSMVSTVTA  185

Query  174  VNT  182
            ++T
Sbjct  186  IHT  188



>ref|XP_003574963.1| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=377

 Score =   111 bits (278),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 50/63 (79%), Positives = 56/63 (89%), Gaps = 3/63 (5%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNTCGVDSMVSTVAA  173
            LLVGYG++G+AP RLK KPYW+IKNSWGE+WGEKGYYKICRG   RN CGVDSMVSTVAA
Sbjct  311  LLVGYGASGFAPSRLKNKPYWVIKNSWGENWGEKGYYKICRGSNVRNKCGVDSMVSTVAA  370

Query  174  VNT  182
             +T
Sbjct  371  AHT  373



>ref|XP_002279862.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI19784.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   111 bits (277),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGY+PIR KEKPYWI+KNSW + WGE GYY+ICRG+N CGVDSMVS+V A   
Sbjct  305  LLVGYGSAGYSPIRFKEKPYWILKNSWSKYWGEHGYYRICRGQNMCGVDSMVSSVVAAIQ  364

Query  183  PTS  191
             TS
Sbjct  365  TTS  367



>ref|XP_004152668.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004167370.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN62647.1| Cysteine protease [Cucumis sativus]
Length=371

 Score =   111 bits (277),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAV  176
            LLVGYG+AG+APIRLKEKPYWIIKNSWGE+WGE GYY IC+G+N CG +SMVS+VAA+
Sbjct  312  LLVGYGAAGFAPIRLKEKPYWIIKNSWGENWGENGYYFICKGKNICGSESMVSSVAAI  369



>ref|XP_002452058.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
 gb|EES05034.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
Length=371

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 3/63 (5%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNTCGVDSMVSTVAA  173
            LLVGYG+AG+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV+A
Sbjct  306  LLVGYGAAGFAPIRLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSA  365

Query  174  VNT  182
            V T
Sbjct  366  VRT  368



>ref|XP_006404590.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
 gb|ESQ46043.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
Length=363

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 47/56 (84%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVA  170
            LLVGYGSAG+A  RLK+KPYWIIKNSWGE+WGE GYYK+CRGRN CGVDS+VSTVA
Sbjct  305  LLVGYGSAGFAQARLKKKPYWIIKNSWGETWGENGYYKLCRGRNICGVDSLVSTVA  360



>gb|AGS43121.1| cysteine protease 1, partial [Zea mays]
Length=90

 Score =   105 bits (261),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 57/63 (90%), Gaps = 3/63 (5%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNTCGVDSMVSTVAA  173
            LLVGYG++G+APIRLK+KPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV+A
Sbjct  25   LLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSA  84

Query  174  VNT  182
            V+ 
Sbjct  85   VHA  87



>ref|XP_002868883.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45142.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRN CGVDS+VSTV A  +
Sbjct  305  LLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVTAAVS  364

Query  183  PTS  191
             T+
Sbjct  365  TTA  367



>ref|XP_003545051.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=367

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAV  176
            L+VGYG   YAPIR K KPYWIIKNSWGESWGE GYYKICRGRN CGVDSMVSTVAA+
Sbjct  305  LIVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAI  362



>emb|CDY41960.1| BnaA01g05320D [Brassica napus]
Length=367

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRN CGVDS+VSTV A  +
Sbjct  304  LLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVTAAVS  363

Query  183  PTS  191
             T+
Sbjct  364  TTA  366



>gb|EPS65881.1| cysteine proteinase, partial [Genlisea aurea]
Length=335

 Score =   110 bits (274),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 45/57 (79%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAA  173
            L+VGYG++GYAPIRLKEKPYWI+KNSWGE+WGE+GYYKIC+G N CGV+S+VSTV A
Sbjct  279  LIVGYGASGYAPIRLKEKPYWIVKNSWGENWGEQGYYKICKGHNVCGVESLVSTVTA  335



>ref|XP_002880378.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56637.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score =   110 bits (274),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 47/60 (78%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LL+GYGS+GY+  RLKEKPYWIIKNSWGESWGE G+YKIC+GRN CGVDS+VSTVAA  +
Sbjct  301  LLMGYGSSGYSQARLKEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSLVSTVAAATS  360



>ref|XP_010446443.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAV  176
            LLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRN CGVDS+VSTV+A 
Sbjct  304  LLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVSAT  361



>ref|XP_010437007.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=368

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAV  176
            LLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+GRN CGVDS+VSTV+A 
Sbjct  305  LLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVSAT  362



>emb|CAA57675.1| cysteine proteinase [Zea mays]
Length=145

 Score =   105 bits (263),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 57/63 (90%), Gaps = 3/63 (5%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNTCGVDSMVSTVAA  173
            LLVGYG++G+AP+RLK+KPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV+A
Sbjct  80   LLVGYGASGFAPMRLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSA  139

Query  174  VNT  182
            V+ 
Sbjct  140  VHA  142



>dbj|BAD10859.1| cysteine protease [Aster tripolium]
Length=363

 Score =   109 bits (273),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAP+R KEKPYWIIKNSWGE WGE GYYK+C G N CG+D+MVS V + NT
Sbjct  304  LLVGYGSAGYAPLRFKEKPYWIIKNSWGEDWGEDGYYKLCSGYNACGMDTMVSAVVSTNT  363



>ref|XP_003607110.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89307.1| papain family cysteine protease [Medicago truncatula]
Length=331

 Score =   109 bits (272),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 48/62 (77%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS   A ++ KEKPYWI+KNSWGE+WGE GYYKICRGRN CGVDSMVSTVAA +T
Sbjct  269  LLVGYGSGAGADMKEKEKPYWIVKNSWGETWGENGYYKICRGRNICGVDSMVSTVAAAHT  328

Query  183  PT  188
             T
Sbjct  329  TT  330



>emb|CDX99593.1| BnaC04g33500D [Brassica napus]
Length=343

 Score =   109 bits (273),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAA  173
            LLVGYGSAG++  R KEKPYWIIKNSWGE+WGE G+YK+C+GRN CGVDSMVSTVAA
Sbjct  285  LLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENGFYKLCKGRNVCGVDSMVSTVAA  341



>emb|CDY15894.1| BnaA04g12170D [Brassica napus]
Length=362

 Score =   109 bits (273),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAA  173
            LLVGYGSAG++  R KEKPYWIIKNSWGE+WGE G+YK+C+GRN CG+DSMVSTVAA
Sbjct  304  LLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENGFYKLCKGRNVCGIDSMVSTVAA  360



>gb|EYU27644.1| hypothetical protein MIMGU_mgv1a008452mg [Erythranthe guttata]
Length=373

 Score =   109 bits (273),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 46/63 (73%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+AGY+ IRLK KPYWI+KNSWGESWGE+GYYKIC+G N CGV+SMVS+V A++T
Sbjct  311  LLVGYGAAGYSTIRLKNKPYWIVKNSWGESWGEEGYYKICKGHNVCGVESMVSSVNAIHT  370

Query  183  PTS  191
             ++
Sbjct  371  TSA  373



>ref|XP_009140277.1| PREDICTED: probable cysteine proteinase A494 [Brassica rapa]
Length=362

 Score =   109 bits (272),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAA  173
            LLVGYGSAG++  R KEKPYWIIKNSWGE+WGE G+YK+C+GRN CG+DSMVSTVAA
Sbjct  304  LLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENGFYKLCKGRNVCGIDSMVSTVAA  360



>ref|XP_009150026.1| PREDICTED: cysteine proteinase RD19a [Brassica rapa]
Length=367

 Score =   109 bits (272),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAP R KE+PYWIIKNSWGE+WGE G+YKIC+GRN CGVDS+VSTV A  +
Sbjct  304  LLVGYGSAGYAPARFKERPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVTAAVS  363

Query  183  PTS  191
             T+
Sbjct  364  TTA  366



>gb|AAZ32411.1| cysteine proteinase glycinain type [Nicotiana benthamiana]
Length=355

 Score =   109 bits (272),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 47/55 (85%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTV  167
            LLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICRG N CGVD+MVSTV
Sbjct  301  LLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTV  355



>ref|NP_001046828.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAD19579.1| putative cysteine proteinase 1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF08742.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAG92750.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93804.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94031.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83204.1| hypothetical protein OsI_28465 [Oryza sativa Indica Group]
 gb|EEE56967.1| hypothetical protein OsJ_06681 [Oryza sativa Japonica Group]
Length=373

 Score =   109 bits (272),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 49/63 (78%), Positives = 57/63 (90%), Gaps = 3/63 (5%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNTCGVDSMVSTVAA  173
            LLVGYG++G+APIRLK+K YWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV+A
Sbjct  308  LLVGYGASGFAPIRLKDKAYWIIKNSWGENWGEHGYYKICRGSNVRNKCGVDSMVSTVSA  367

Query  174  VNT  182
            ++T
Sbjct  368  IHT  370



>gb|EMT10192.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=369

 Score =   108 bits (270),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 48/62 (77%), Positives = 55/62 (89%), Gaps = 3/62 (5%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNTCGVDSMVSTVAA  173
            LLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYKICRG   RN CGVDSMVSTV+A
Sbjct  303  LLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSA  362

Query  174  VN  179
             +
Sbjct  363  TH  364



>gb|ABK21238.1| unknown [Picea sitchensis]
 gb|ABR16087.1| unknown [Picea sitchensis]
 gb|ABR17330.1| unknown [Picea sitchensis]
 gb|ABR17545.1| unknown [Picea sitchensis]
 gb|ACN40765.1| unknown [Picea sitchensis]
Length=366

 Score =   108 bits (270),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAV  176
            LLVGYG+A +APIR+K+KPYW+IKNSWG +WGE GYYK+CRG N CG+++MVSTVAA+
Sbjct  309  LLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENGYYKLCRGHNVCGINNMVSTVAAI  366



>tpe|CAD66657.1| TPA: putative cysteine proteinase precursor [Hordeum vulgare 
subsp. vulgare]
 dbj|BAJ94057.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   108 bits (270),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/63 (76%), Positives = 56/63 (89%), Gaps = 3/63 (5%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNTCGVDSMVSTVAA  173
            LLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYKICRG   RN CGVDSMVSTV+A
Sbjct  311  LLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSA  370

Query  174  VNT  182
             ++
Sbjct  371  THS  373



>gb|ABK24688.1| unknown [Picea sitchensis]
 gb|ACN39791.1| unknown [Picea sitchensis]
 gb|ACN40241.1| unknown [Picea sitchensis]
Length=366

 Score =   108 bits (269),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAV  176
            LLVGYG+A +APIR+K+KPYW+IKNSWG +WGE GYYK+CRG N CG+++MVSTVAA+
Sbjct  309  LLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENGYYKLCRGHNVCGINNMVSTVAAI  366



>dbj|BAD43619.1| putative cysteine proteinase [Arabidopsis thaliana]
Length=361

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAG++  RLKEKPYWIIKNSWGESWGE G+YKIC+GRN CGVDS+VSTVAA  +
Sbjct  302  LLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSLVSTVAATTS  361



>ref|NP_565512.1| Papain family cysteine protease [Arabidopsis thaliana]
 sp|P43295.2|A494_ARATH RecName: Full=Probable cysteine proteinase A494; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD23687.1| cysteine proteinase [Arabidopsis thaliana]
 gb|ABJ98563.1| At2g21430 [Arabidopsis thaliana]
 gb|AEC07177.1| Papain family cysteine protease [Arabidopsis thaliana]
Length=361

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAG++  RLKEKPYWIIKNSWGESWGE G+YKIC+GRN CGVDS+VSTVAA  +
Sbjct  302  LLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSLVSTVAATTS  361



>emb|CAA52403.1| putative thiol protease [Arabidopsis thaliana]
Length=313

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAG++  RLKEKPYWIIKNSWGESWGE G+YKIC+GRN CGVDS+VSTVAA  +
Sbjct  254  LLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSLVSTVAATTS  313



>gb|ACN40679.1| unknown [Picea sitchensis]
Length=366

 Score =   108 bits (269),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAV  176
            LLVGYG+A +APIR+K+KPYW+IKNSWG +WGE GYYK+CRG N CG+++MVSTVAA+
Sbjct  309  LLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENGYYKLCRGHNVCGINNMVSTVAAI  366



>gb|AAW21813.1| cysteine protease [Triticum aestivum]
Length=377

 Score =   107 bits (268),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/62 (77%), Positives = 55/62 (89%), Gaps = 3/62 (5%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNTCGVDSMVSTVAA  173
            LLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYKICRG   RN CGVDSMVSTV+A
Sbjct  311  LLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSA  370

Query  174  VN  179
             +
Sbjct  371  TH  372



>gb|AEX97108.1| cysteine proteinase, partial [Malus domestica]
Length=128

 Score =   103 bits (256),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAA  173
            LLVGYGSAG+APIR KEKPYWIIKNSWG++WGE GYY IC+GRN CG +SMVS+VAA
Sbjct  31   LLVGYGSAGFAPIRFKEKPYWIIKNSWGQNWGENGYYLICKGRNICGSESMVSSVAA  87



>gb|AAB16996.1| thiol protease isoform B, partial [Glycine max]
Length=319

 Score =   105 bits (263),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAV  176
            LLVGYG   YAPIR K KPYWIIKNSWGESWGE GY +ICRGRN CGVDSMVSTVAA+
Sbjct  257  LLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYDEICRGRNVCGVDSMVSTVAAI  314



>gb|KEH30505.1| papain family cysteine protease [Medicago truncatula]
Length=330

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS   A ++ KEKPYWI+KNSWGE+WGE GYYKICRGRN CGVDSMVSTVAA +T
Sbjct  268  LLVGYGSGAGADMKEKEKPYWIVKNSWGETWGENGYYKICRGRNICGVDSMVSTVAAAHT  327

Query  183  PTS  191
             T 
Sbjct  328  NTQ  330



>gb|EMS64962.1| Cysteine proteinase 1 [Triticum urartu]
Length=302

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 55/62 (89%), Gaps = 3/62 (5%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRG---RNTCGVDSMVSTVAA  173
            LLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYKICRG   RN CGVDSMVSTV+A
Sbjct  236  LLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSA  295

Query  174  VN  179
             +
Sbjct  296  TH  297



>emb|CAH59428.1| cysteine protease 2 [Plantago major]
Length=245

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 55/63 (87%), Gaps = 1/63 (2%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            L+VGYG+ GYAP+RLK KPYWIIKNSWGESWGE GYYKICRGRN CGV+SMVS+V A + 
Sbjct  184  LIVGYGT-GYAPVRLKNKPYWIIKNSWGESWGESGYYKICRGRNVCGVESMVSSVTAAHF  242

Query  183  PTS  191
             T+
Sbjct  243  TTT  245



>ref|XP_002969223.1| hypothetical protein SELMODRAFT_91274 [Selaginella moellendorffii]
 gb|EFJ29311.1| hypothetical protein SELMODRAFT_91274 [Selaginella moellendorffii]
Length=367

 Score =   104 bits (259),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVA  170
            LLVGYG+ GYAPIR  EKPYWIIKNSWG +WGE+GYYKICRG   CG+++MVSTVA
Sbjct  312  LLVGYGAKGYAPIRFTEKPYWIIKNSWGATWGEQGYYKICRGHGMCGMNTMVSTVA  367



>ref|XP_009786000.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana sylvestris]
Length=370

 Score =   102 bits (255),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 43/51 (84%), Positives = 47/51 (92%), Gaps = 1/51 (2%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSM  155
            LLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKICRGRN CGVDSM
Sbjct  309  LLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGENGYYKICRGRNVCGVDSM  358



>dbj|BAC57957.1| thiol protease [Aster tripolium]
Length=188

 Score = 99.8 bits (247),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGYAP RLKEKPYWIIKNSWG  WGE GYYKIC G N CG+D+MVS V + + 
Sbjct  129  LLVGYGSAGYAPSRLKEKPYWIIKNSWGPDWGEDGYYKICSGHNLCGMDTMVSAVVSTSA  188



>gb|AAB53103.1| cysteine protease, partial [Brassica napus]
Length=85

 Score = 96.3 bits (238),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMV  158
            LLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKICRGRN CGVD  V
Sbjct  34   LLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICRGRNVCGVDMSV  85



>ref|XP_010690815.1| PREDICTED: cysteine proteinase RD19a [Beta vulgaris subsp. vulgaris]
Length=403

 Score =   100 bits (249),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 53/61 (87%), Gaps = 2/61 (3%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGSAGY+ +R +EKPYWIIKNSWGE WGE GYY++CRG + CGV+++VSTVA  +T
Sbjct  344  LLVGYGSAGYSDMRKEEKPYWIIKNSWGEYWGENGYYRLCRGYDLCGVNTLVSTVA--DT  401

Query  183  P  185
            P
Sbjct  402  P  402



>gb|AAB16997.1| thiol protease isoform A, partial [Glycine max]
Length=318

 Score =   100 bits (248),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 50/59 (85%), Gaps = 1/59 (2%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK-GYYKICRGRNTCGVDSMVSTVAAV  176
            LLVGYG   YAPIR K KPYWIIKNSWGESWGE  GY +ICRGRN CGVD+MVSTVAA+
Sbjct  255  LLVGYGEGRYAPIRFKNKPYWIIKNSWGESWGENDGYDEICRGRNVCGVDAMVSTVAAI  313



>ref|XP_002960585.1| hypothetical protein SELMODRAFT_266583 [Selaginella moellendorffii]
 gb|EFJ38124.1| hypothetical protein SELMODRAFT_266583 [Selaginella moellendorffii]
Length=330

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVA  170
            LLVGYG+ GYAPIR  EKPYWIIKNSWG +WGE+GYYKICRG   CG+++MVSTVA
Sbjct  275  LLVGYGAKGYAPIRFTEKPYWIIKNSWGATWGEQGYYKICRGHGMCGMNTMVSTVA  330



>gb|AES89347.2| papain family cysteine protease [Medicago truncatula]
Length=327

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 50/62 (81%), Gaps = 4/62 (6%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS  Y     KEKPYWI+K+SWGE+WGE GYYKICRGRN CGVDSMVSTVAA  T
Sbjct  269  LLVGYGSGAYT----KEKPYWIVKSSWGETWGENGYYKICRGRNICGVDSMVSTVAAAQT  324

Query  183  PT  188
             T
Sbjct  325  TT  326



>ref|XP_003607150.1| Cysteine proteinase [Medicago truncatula]
Length=326

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 50/62 (81%), Gaps = 4/62 (6%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYGS  Y     KEKPYWI+K+SWGE+WGE GYYKICRGRN CGVDSMVSTVAA  T
Sbjct  268  LLVGYGSGAYT----KEKPYWIVKSSWGETWGENGYYKICRGRNICGVDSMVSTVAAAQT  323

Query  183  PT  188
             T
Sbjct  324  TT  325



>ref|NP_001059639.1| Os07g0480900 [Oryza sativa Japonica Group]
 dbj|BAC45132.1| putative cysteine proteinase [Oryza sativa Japonica Group]
 dbj|BAF21553.1| Os07g0480900 [Oryza sativa Japonica Group]
 dbj|BAG88694.1| unnamed protein product [Oryza sativa Japonica Group]
Length=376

 Score = 97.8 bits (242),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG  G+A +RL  +PYWIIKNSWG++WGE+GYY++CRGRN CGVD+MVS VA    
Sbjct  315  LLVGYGERGFAALRLGHRPYWIIKNSWGKAWGEQGYYRLCRGRNVCGVDTMVSAVAVAPP  374

Query  183  P  185
            P
Sbjct  375  P  375



>ref|XP_002460693.1| hypothetical protein SORBIDRAFT_02g033270 [Sorghum bicolor]
 gb|EER97214.1| hypothetical protein SORBIDRAFT_02g033270 [Sorghum bicolor]
Length=373

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVNT  182
            LLVGYG+ G+A +RL  +PYWIIKNSWGE WGE+GYY++CRG N CGVDSMVS VA    
Sbjct  313  LLVGYGARGFAALRLGYRPYWIIKNSWGERWGEQGYYRLCRGSNVCGVDSMVSAVAVAPV  372

Query  183  P  185
            P
Sbjct  373  P  373



>ref|XP_009404192.1| PREDICTED: cysteine proteinase 15A [Musa acuminata subsp. malaccensis]
Length=361

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 40/59 (68%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVAAVN  179
            LLVGYG+ GY+ +RL  +PYWIIKNSWG+ WGE+GYY++CRG N CG+DSMVS VAA +
Sbjct  303  LLVGYGARGYSILRLGYRPYWIIKNSWGKQWGEQGYYRLCRGHNICGIDSMVSAVAAAS  361



>ref|XP_006658557.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase 15A-like 
[Oryza brachyantha]
Length=346

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 40/56 (71%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVA  170
            LLVGYG  G++ +RL  +PYWIIKNSWG++WGE+GYY++CRGRN CGVDSMVS VA
Sbjct  287  LLVGYGERGFSALRLGYRPYWIIKNSWGKAWGEQGYYRLCRGRNVCGVDSMVSAVA  342



>ref|XP_006293095.1| hypothetical protein CARUB_v10019394mg [Capsella rubella]
 gb|EOA25993.1| hypothetical protein CARUB_v10019394mg [Capsella rubella]
Length=367

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVA  170
            LLVGYGS G++ +RL  KPYWIIKNSWG+ WGE GYYK+CRG + CG++SMVS VA
Sbjct  307  LLVGYGSKGFSILRLSNKPYWIIKNSWGKKWGEDGYYKLCRGHDICGINSMVSAVA  362



>ref|XP_004959670.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=374

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVA  170
            LLVGYG+ G+A +RL  +PYW+IKNSWGE WGEKGYY++CRG N CGVD+MVS VA
Sbjct  311  LLVGYGARGFAALRLGYRPYWVIKNSWGEQWGEKGYYRLCRGSNVCGVDTMVSAVA  366



>gb|KFK34737.1| hypothetical protein AALP_AA5G186400 [Arabis alpina]
Length=369

 Score = 95.1 bits (235),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVA  170
            LLVGYGS G++ +RL  KPYWIIKNSWG+ WGE GYYK+CRG + CG++SMVS VA
Sbjct  309  LLVGYGSKGFSLLRLSNKPYWIIKNSWGKKWGENGYYKLCRGHDMCGINSMVSAVA  364



>gb|EMS59778.1| Cysteine proteinase 15A [Triticum urartu]
Length=195

 Score = 93.2 bits (230),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVA  170
            LLVGYG+ G++ +RL  +PYW+IKNSWG+ WGE GYYK+CRGRN CGVDSMVS VA
Sbjct  137  LLVGYGARGFSALRLGYRPYWLIKNSWGQQWGEGGYYKLCRGRNVCGVDSMVSAVA  192



>tpg|DAA40800.1| TPA: putative cysteine protease family protein [Zea mays]
Length=381

 Score = 95.1 bits (235),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVA  170
            LLVGYG+ G+A +RL  +PYWIIKNSWG+ WGE+GYY++CRG N CGVDSMVS VA
Sbjct  321  LLVGYGARGFAALRLGYRPYWIIKNSWGKQWGEQGYYRLCRGSNVCGVDSMVSAVA  376



>emb|CAQ00102.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=368

 Score = 94.7 bits (234),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 40/56 (71%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    LLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICRGRNTCGVDSMVSTVA  170
            LLVGYG+ G++ +RL  +PYW+IKNSWG  WGE GYYK+CRGRN CGVDSMVS VA
Sbjct  310  LLVGYGARGFSALRLGYRPYWLIKNSWGAQWGEGGYYKLCRGRNVCGVDSMVSAVA  365



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564723838400