BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP010C01 655 bp,

Length=627
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009622620.1|  PREDICTED: myosin-1-like                           313   9e-96   Nicotiana tomentosiformis
ref|XP_009783184.1|  PREDICTED: myosin-1-like                           313   9e-96   Nicotiana sylvestris
gb|ABJ53200.1|  myosin VIII-1                                           313   1e-95   Nicotiana benthamiana
gb|ABK94124.1|  unknown                                                 290   2e-95   Populus trichocarpa [western balsam poplar]
ref|XP_006345301.1|  PREDICTED: myosin-1-like                           310   2e-94   Solanum tuberosum [potatoes]
ref|XP_004231522.1|  PREDICTED: myosin-1                                310   2e-94   Solanum lycopersicum
ref|XP_010067014.1|  PREDICTED: myosin-1                                308   7e-94   Eucalyptus grandis [rose gum]
emb|CDP18554.1|  unnamed protein product                                305   7e-93   Coffea canephora [robusta coffee]
gb|KDO69897.1|  hypothetical protein CISIN_1g0010671mg                  298   1e-92   Citrus sinensis [Valencia orange]
ref|XP_007043232.1|  Myosin 1 isoform 2                                 301   1e-92   Theobroma cacao [chocolate]
gb|KDO69895.1|  hypothetical protein CISIN_1g0010671mg                  298   2e-92   Citrus sinensis [Valencia orange]
ref|XP_008445889.1|  PREDICTED: myosin-1-like                           303   5e-92   Cucumis melo [Oriental melon]
ref|XP_004147135.1|  PREDICTED: myosin-J heavy chain-like               302   8e-92   Cucumis sativus [cucumbers]
emb|CBI35399.3|  unnamed protein product                                302   1e-91   Vitis vinifera
gb|KDO69889.1|  hypothetical protein CISIN_1g0010671mg                  299   1e-91   Citrus sinensis [Valencia orange]
gb|KDO69891.1|  hypothetical protein CISIN_1g0010671mg                  299   1e-91   Citrus sinensis [Valencia orange]
ref|XP_002273898.1|  PREDICTED: myosin-1                                302   1e-91   Vitis vinifera
ref|XP_007043231.1|  Myosin 1 isoform 1                                 301   1e-91   Theobroma cacao [chocolate]
ref|XP_007142759.1|  hypothetical protein PHAVU_007G014600g             295   2e-91   Phaseolus vulgaris [French bean]
emb|CAN82090.1|  hypothetical protein VITISV_032704                     301   3e-91   Vitis vinifera
gb|KHF99826.1|  Unconventional myosin-Va                                301   3e-91   Gossypium arboreum [tree cotton]
ref|XP_006605841.1|  PREDICTED: myosin-1-like isoform X3                298   1e-90   
ref|XP_008389065.1|  PREDICTED: myosin-1-like                           299   1e-90   Malus domestica [apple tree]
gb|KHN23106.1|  Unconventional myosin-Va                                296   1e-90   Glycine soja [wild soybean]
ref|XP_006437635.1|  hypothetical protein CICLE_v10030552mg             299   1e-90   Citrus clementina
ref|XP_008340434.1|  PREDICTED: myosin-1 isoform X2                     298   2e-90   
ref|XP_008340433.1|  PREDICTED: myosin-1 isoform X1                     298   2e-90   Malus domestica [apple tree]
ref|XP_011022005.1|  PREDICTED: myosin-1-like isoform X1                298   2e-90   Populus euphratica
ref|XP_006484499.1|  PREDICTED: myosin-1-like                           298   2e-90   Citrus sinensis [Valencia orange]
gb|KJB31871.1|  hypothetical protein B456_005G212100                    298   3e-90   Gossypium raimondii
ref|XP_004497240.1|  PREDICTED: myosin-J heavy chain-like isoform X1    298   3e-90   Cicer arietinum [garbanzo]
ref|XP_010103613.1|  Myosin-2 heavy chain                               298   3e-90   Morus notabilis
ref|XP_009351748.1|  PREDICTED: myosin-1-like isoform X1                298   3e-90   Pyrus x bretschneideri [bai li]
ref|XP_009351750.1|  PREDICTED: myosin-1-like isoform X2                298   3e-90   Pyrus x bretschneideri [bai li]
ref|XP_006605839.1|  PREDICTED: myosin-1-like isoform X1                298   3e-90   Glycine max [soybeans]
ref|XP_011022009.1|  PREDICTED: myosin-1-like isoform X2                298   3e-90   Populus euphratica
ref|XP_004497241.1|  PREDICTED: myosin-J heavy chain-like isoform X2    298   3e-90   
ref|XP_006589741.1|  PREDICTED: myosin-1-like isoform X2                297   4e-90   
gb|KHN46512.1|  Myosin-J heavy chain                                    296   5e-90   Glycine soja [wild soybean]
ref|XP_002307152.1|  myosin-related family protein                      297   6e-90   Populus trichocarpa [western balsam poplar]
ref|XP_008221075.1|  PREDICTED: myosin-1                                297   6e-90   Prunus mume [ume]
ref|XP_011012312.1|  PREDICTED: myosin-1-like isoform X2                297   8e-90   Populus euphratica
ref|XP_011012313.1|  PREDICTED: myosin-1-like isoform X3                297   8e-90   Populus euphratica
ref|XP_011012310.1|  PREDICTED: myosin-1-like isoform X1                297   9e-90   Populus euphratica
gb|KJB31872.1|  hypothetical protein B456_005G212100                    296   9e-90   Gossypium raimondii
gb|KJB79824.1|  hypothetical protein B456_013G068300                    293   1e-89   Gossypium raimondii
ref|XP_003536741.2|  PREDICTED: myosin-1-like isoform X1                296   1e-89   Glycine max [soybeans]
ref|XP_003533701.1|  PREDICTED: myosin-1-like isoform X1                296   1e-89   
ref|XP_007225432.1|  hypothetical protein PRUPE_ppa000435mg             296   2e-89   Prunus persica
gb|KJB79817.1|  hypothetical protein B456_013G068300                    293   2e-89   Gossypium raimondii
gb|KDP37497.1|  hypothetical protein JCGZ_05936                         293   2e-89   Jatropha curcas
gb|KHN37364.1|  Myosin-J heavy chain                                    295   3e-89   Glycine soja [wild soybean]
ref|XP_003556592.1|  PREDICTED: myosin-1-like                           295   4e-89   Glycine max [soybeans]
gb|KHM99077.1|  Myosin-J heavy chain                                    295   4e-89   Glycine soja [wild soybean]
ref|XP_002523758.1|  myosin vIII, putative                              295   5e-89   
ref|XP_007142760.1|  hypothetical protein PHAVU_007G014600g             295   6e-89   Phaseolus vulgaris [French bean]
ref|XP_004297721.1|  PREDICTED: myosin-1-like                           294   1e-88   Fragaria vesca subsp. vesca
gb|KJB79823.1|  hypothetical protein B456_013G068300                    293   2e-88   Gossypium raimondii
ref|XP_003592738.1|  Myosin-like protein                                292   3e-88   Medicago truncatula
ref|XP_002310637.2|  hypothetical protein POPTR_0007s07320g             292   3e-88   Populus trichocarpa [western balsam poplar]
gb|KJB79818.1|  hypothetical protein B456_013G068300                    292   4e-88   Gossypium raimondii
gb|KJB79819.1|  hypothetical protein B456_013G068300                    292   4e-88   Gossypium raimondii
gb|KJB49958.1|  hypothetical protein B456_008G147000                    291   1e-87   Gossypium raimondii
gb|KJB79821.1|  hypothetical protein B456_013G068300                    290   4e-87   Gossypium raimondii
gb|KJB79822.1|  hypothetical protein B456_013G068300                    289   4e-87   Gossypium raimondii
ref|XP_007153036.1|  hypothetical protein PHAVU_003G002200g             288   1e-86   Phaseolus vulgaris [French bean]
ref|XP_003589756.1|  LRR receptor-like protein kinase                   280   2e-86   
ref|XP_004498109.1|  PREDICTED: myosin-J heavy chain-like               285   1e-85   Cicer arietinum [garbanzo]
ref|XP_011070461.1|  PREDICTED: myosin-1                                283   8e-85   Sesamum indicum [beniseed]
gb|KEH40947.1|  P-loop nucleoside triphosphate hydrolase superfam...    282   2e-84   Medicago truncatula
gb|AAB71526.1|  unconventional myosin                                   279   2e-83   Helianthus annuus
ref|XP_010279450.1|  PREDICTED: myosin-1-like                           278   8e-83   Nelumbo nucifera [Indian lotus]
ref|XP_010688651.1|  PREDICTED: myosin-1-like                           276   2e-82   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_002883217.1|  hypothetical protein ARALYDRAFT_479514             273   2e-81   Arabidopsis lyrata subsp. lyrata
ref|XP_010249396.1|  PREDICTED: myosin-1-like                           273   4e-81   Nelumbo nucifera [Indian lotus]
ref|XP_006296853.1|  hypothetical protein CARUB_v10012840mg             272   6e-81   Capsella rubella
ref|XP_010508266.1|  PREDICTED: myosin-1-like                           272   6e-81   Camelina sativa [gold-of-pleasure]
ref|XP_010487954.1|  PREDICTED: myosin-1-like                           272   7e-81   Camelina sativa [gold-of-pleasure]
ref|XP_006406435.1|  hypothetical protein EUTSA_v10019925mg             272   7e-81   Eutrema salsugineum
ref|XP_010466165.1|  PREDICTED: myosin-1                                271   8e-81   Camelina sativa [gold-of-pleasure]
emb|CAB61875.1|  myosin                                                 270   2e-80   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188630.1|  myosin 1                                              270   2e-80   Arabidopsis thaliana [mouse-ear cress]
gb|AAM14075.1|  putative myosin                                         270   2e-80   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001154628.2|  myosin 1                                           270   2e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010523208.1|  PREDICTED: myosin-1-like                           268   1e-79   Tarenaya hassleriana [spider flower]
ref|XP_009135657.1|  PREDICTED: myosin-1-like                           266   4e-79   Brassica rapa
emb|CDX82270.1|  BnaA03g35510D                                          267   5e-79   Brassica napus [oilseed rape]
ref|XP_010557555.1|  PREDICTED: myosin-1-like                           266   5e-79   Tarenaya hassleriana [spider flower]
emb|CDY36068.1|  BnaC03g41300D                                          265   2e-78   Brassica napus [oilseed rape]
emb|CDY25361.1|  BnaA05g19230D                                          266   5e-78   Brassica napus [oilseed rape]
emb|CDY24591.1|  BnaC05g32750D                                          263   7e-78   Brassica napus [oilseed rape]
ref|XP_009145709.1|  PREDICTED: myosin-1 isoform X2                     262   1e-77   Brassica rapa
ref|XP_009145706.1|  PREDICTED: myosin-1 isoform X1                     262   2e-77   Brassica rapa
gb|EYU39409.1|  hypothetical protein MIMGU_mgv1a000419mg                253   3e-74   Erythranthe guttata [common monkey flower]
ref|XP_002891568.1|  hypothetical protein ARALYDRAFT_474163             252   7e-74   Arabidopsis lyrata subsp. lyrata
ref|XP_006306608.1|  hypothetical protein CARUB_v10008120mg             252   1e-73   Capsella rubella
ref|XP_010500596.1|  PREDICTED: myosin-3                                250   4e-73   Camelina sativa [gold-of-pleasure]
gb|EYU35564.1|  hypothetical protein MIMGU_mgv1a000458mg                248   1e-72   Erythranthe guttata [common monkey flower]
dbj|BAD93813.1|  myosin                                                 247   6e-72   Arabidopsis thaliana [mouse-ear cress]
gb|AAD50052.1|AC007980_17  Highly similar to myosin                     247   6e-72   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175453.2|  myosin VIIIA                                          246   6e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010479488.1|  PREDICTED: myosin-3-like                           245   3e-71   Camelina sativa [gold-of-pleasure]
gb|EPS68761.1|  hypothetical protein M569_06006                         242   1e-70   Genlisea aurea
ref|XP_006393159.1|  hypothetical protein EUTSA_v10011193mg             243   2e-70   Eutrema salsugineum
emb|CDY42506.1|  BnaC06g03520D                                          239   2e-69   Brassica napus [oilseed rape]
gb|ACN26349.1|  unknown                                                 224   3e-67   Zea mays [maize]
ref|XP_009124542.1|  PREDICTED: myosin-3-like                           230   8e-66   Brassica rapa
emb|CDY29324.1|  BnaA05g15910D                                          229   8e-66   Brassica napus [oilseed rape]
emb|CDY53932.1|  BnaCnng25790D                                          227   1e-64   Brassica napus [oilseed rape]
ref|XP_009147843.1|  PREDICTED: myosin-3                                226   3e-64   Brassica rapa
emb|CDY22791.1|  BnaA06g02860D                                          225   3e-64   Brassica napus [oilseed rape]
ref|XP_008664832.1|  PREDICTED: myosin-1                                225   4e-64   Zea mays [maize]
gb|AAD31926.1|AF147738_1  myosin VIII ZMM3                              224   4e-64   Zea mays [maize]
ref|XP_008802972.1|  PREDICTED: myosin-1-like                           225   4e-64   Phoenix dactylifera
ref|XP_010933291.1|  PREDICTED: myosin-1-like                           225   4e-64   Elaeis guineensis
ref|XP_008812673.1|  PREDICTED: myosin-1-like isoform X4                223   1e-63   Phoenix dactylifera
ref|NP_001064913.1|  Os10g0488800                                       222   2e-63   
gb|ABB47808.1|  Myosin head family protein, expressed                   222   2e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008812670.1|  PREDICTED: myosin-1-like isoform X1                223   2e-63   Phoenix dactylifera
ref|XP_008812671.1|  PREDICTED: myosin-1-like isoform X2                223   2e-63   Phoenix dactylifera
ref|XP_008812672.1|  PREDICTED: myosin-1-like isoform X3                223   2e-63   Phoenix dactylifera
ref|XP_002467046.1|  hypothetical protein SORBIDRAFT_01g018770          222   5e-63   Sorghum bicolor [broomcorn]
ref|XP_004982777.1|  PREDICTED: myosin-J heavy chain-like isoform X1    222   6e-63   
ref|XP_004982778.1|  PREDICTED: myosin-J heavy chain-like isoform X2    222   6e-63   Setaria italica
gb|AAL31066.1|AC090120_12  putative myosin                              222   6e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006661886.1|  PREDICTED: myosin-1-like                           222   8e-63   Oryza brachyantha
gb|EEC67214.1|  hypothetical protein OsI_34110                          221   9e-63   Oryza sativa Indica Group [Indian rice]
gb|AFW68522.1|  hypothetical protein ZEAMMB73_631881                    221   1e-62   Zea mays [maize]
dbj|BAK01852.1|  predicted protein                                      207   1e-62   Hordeum vulgare subsp. vulgare [barley]
ref|XP_009406771.1|  PREDICTED: myosin-1-like                           221   1e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010935561.1|  PREDICTED: myosin-1-like                           219   4e-62   Elaeis guineensis
ref|XP_003574095.1|  PREDICTED: myosin-1-like                           219   4e-62   Brachypodium distachyon [annual false brome]
ref|XP_008797209.1|  PREDICTED: LOW QUALITY PROTEIN: myosin-1-like      219   1e-61   Phoenix dactylifera
gb|EMT12170.1|  Myosin-J heavy chain                                    215   3e-60   Aegilops tauschii
ref|XP_010918414.1|  PREDICTED: myosin-1-like                           212   2e-59   Elaeis guineensis
ref|XP_009389227.1|  PREDICTED: myosin-1-like                           207   9e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003589382.1|  Unconventional myosin                              187   8e-56   Medicago truncatula
ref|XP_006847798.1|  hypothetical protein AMTR_s00029p00027850          194   3e-53   
ref|XP_010463346.1|  PREDICTED: myosin-3-like                           187   1e-50   Camelina sativa [gold-of-pleasure]
ref|XP_006841789.1|  hypothetical protein AMTR_s00003p00267250          184   2e-49   
dbj|BAD94297.1|  myosin                                                 167   1e-48   Arabidopsis thaliana [mouse-ear cress]
emb|CDY71633.1|  BnaCnng73730D                                          158   3e-45   Brassica napus [oilseed rape]
ref|XP_002975651.1|  hypothetical protein SELMODRAFT_103418             162   5e-42   Selaginella moellendorffii
ref|XP_002978834.1|  hypothetical protein SELMODRAFT_109322             162   8e-42   Selaginella moellendorffii
ref|XP_008800396.1|  PREDICTED: myosin-1-like                           160   3e-41   Phoenix dactylifera
ref|XP_003562871.1|  PREDICTED: myosin-3                                160   3e-41   Brachypodium distachyon [annual false brome]
gb|ACL52804.1|  unknown                                                 147   5e-41   Zea mays [maize]
gb|EMT14738.1|  Myosin-2 heavy chain                                    159   6e-41   Aegilops tauschii
ref|XP_001755337.1|  predicted protein                                  159   9e-41   Physcomitrella patens
dbj|BAJ99526.1|  predicted protein                                      159   1e-40   Hordeum vulgare subsp. vulgare [barley]
gb|EMS56234.1|  Myosin-2 heavy chain                                    157   4e-40   Triticum urartu
gb|EEC82270.1|  hypothetical protein OsI_26483                          156   8e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_006370337.1|  hypothetical protein POPTR_0001s41770g             155   2e-39   Populus trichocarpa [western balsam poplar]
gb|EEE67412.1|  hypothetical protein OsJ_24744                          155   3e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001774306.1|  predicted protein                                  154   4e-39   Physcomitrella patens
ref|XP_009342450.1|  PREDICTED: myosin-2 isoform X2                     154   4e-39   Pyrus x bretschneideri [bai li]
ref|XP_009342451.1|  PREDICTED: myosin-2 isoform X3                     154   4e-39   Pyrus x bretschneideri [bai li]
ref|XP_009342449.1|  PREDICTED: myosin-2 isoform X1                     154   5e-39   Pyrus x bretschneideri [bai li]
ref|XP_009342454.1|  PREDICTED: myosin-2 isoform X5                     154   6e-39   Pyrus x bretschneideri [bai li]
ref|XP_008345271.1|  PREDICTED: myosin-2-like isoform X3                154   6e-39   Malus domestica [apple tree]
ref|XP_008345269.1|  PREDICTED: myosin-2-like isoform X1                154   6e-39   Malus domestica [apple tree]
ref|XP_006657835.1|  PREDICTED: myosin-2-like                           154   6e-39   Oryza brachyantha
ref|XP_008345270.1|  PREDICTED: myosin-2-like isoform X2                154   6e-39   Malus domestica [apple tree]
ref|XP_002281748.1|  PREDICTED: myosin-2                                154   8e-39   Vitis vinifera
emb|CBI20376.3|  unnamed protein product                                153   9e-39   Vitis vinifera
gb|KHM98905.1|  hypothetical protein glysoja_039075                     140   2e-38   Glycine soja [wild soybean]
ref|XP_009412435.1|  PREDICTED: myosin-1-like                           152   3e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001777862.1|  predicted protein                                  152   3e-38   Physcomitrella patens
gb|AEM05968.1|  myosin VIII D                                           152   4e-38   Physcomitrella patens
ref|XP_010905572.1|  PREDICTED: myosin-1-like                           149   2e-37   Elaeis guineensis
ref|XP_001768683.1|  predicted protein                                  149   2e-37   Physcomitrella patens
ref|XP_008366419.1|  PREDICTED: myosin-2 isoform X2                     149   3e-37   Malus domestica [apple tree]
ref|XP_008366425.1|  PREDICTED: myosin-2 isoform X3                     149   3e-37   Malus domestica [apple tree]
ref|XP_008366413.1|  PREDICTED: myosin-2 isoform X1                     149   3e-37   Malus domestica [apple tree]
ref|XP_009334584.1|  PREDICTED: myosin-2 isoform X1                     149   3e-37   Pyrus x bretschneideri [bai li]
ref|XP_009334585.1|  PREDICTED: myosin-2 isoform X2                     149   3e-37   Pyrus x bretschneideri [bai li]
ref|XP_009334586.1|  PREDICTED: myosin-2 isoform X3                     149   3e-37   Pyrus x bretschneideri [bai li]
ref|XP_011044539.1|  PREDICTED: myosin-2                                149   4e-37   Populus euphratica
gb|AEM05969.1|  myosin VIII E                                           149   4e-37   Physcomitrella patens
ref|XP_007021261.1|  Myosin 2 isoform 1                                 148   5e-37   Theobroma cacao [chocolate]
ref|XP_007021262.1|  Myosin 2 isoform 2                                 148   6e-37   Theobroma cacao [chocolate]
gb|KJB13459.1|  hypothetical protein B456_002G076300                    147   6e-37   Gossypium raimondii
gb|KJB13460.1|  hypothetical protein B456_002G076300                    147   7e-37   Gossypium raimondii
gb|KJB13461.1|  hypothetical protein B456_002G076300                    147   7e-37   Gossypium raimondii
ref|XP_008226710.1|  PREDICTED: myosin-2 isoform X1                     148   7e-37   Prunus mume [ume]
ref|XP_010268832.1|  PREDICTED: myosin-2                                148   8e-37   Nelumbo nucifera [Indian lotus]
ref|XP_007212835.1|  hypothetical protein PRUPE_ppa020758mg             147   8e-37   Prunus persica
gb|KJB13457.1|  hypothetical protein B456_002G076300                    147   1e-36   Gossypium raimondii
gb|KJB13453.1|  hypothetical protein B456_002G076300                    147   1e-36   Gossypium raimondii
gb|KJB13454.1|  hypothetical protein B456_002G076300                    147   1e-36   Gossypium raimondii
ref|XP_010905050.1|  PREDICTED: myosin-1                                147   2e-36   Elaeis guineensis
ref|XP_008806763.1|  PREDICTED: myosin-1-like                           144   1e-35   Phoenix dactylifera
ref|XP_010062907.1|  PREDICTED: myosin-2                                144   2e-35   Eucalyptus grandis [rose gum]
tpg|DAA63129.1|  TPA: hypothetical protein ZEAMMB73_109792              142   5e-35   Zea mays [maize]
ref|XP_008654108.1|  PREDICTED: myosin-1-like                           142   6e-35   Zea mays [maize]
gb|KDO74222.1|  hypothetical protein CISIN_1g000931mg                   142   8e-35   Citrus sinensis [Valencia orange]
ref|XP_006464677.1|  PREDICTED: myosin-2-like isoform X6                142   8e-35   Citrus sinensis [Valencia orange]
ref|XP_006451994.1|  hypothetical protein CICLE_v10007271mg             142   9e-35   Citrus clementina
ref|XP_002316933.2|  hypothetical protein POPTR_0011s12670g             141   1e-34   Populus trichocarpa [western balsam poplar]
ref|XP_011029402.1|  PREDICTED: myosin-2-like                           140   3e-34   Populus euphratica
ref|XP_006584303.1|  PREDICTED: probable inactive leucine-rich re...    133   6e-34   Glycine max [soybeans]
ref|XP_009420769.1|  PREDICTED: myosin-2-like isoform X2                135   9e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009420767.1|  PREDICTED: myosin-2-like isoform X1                135   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEM05967.1|  myosin VIII B                                           138   2e-33   Physcomitrella patens
gb|KHG13556.1|  Myosin-2 heavy chain                                    137   3e-33   Gossypium arboreum [tree cotton]
gb|KHG19058.1|  Myosin-2 heavy chain                                    137   3e-33   Gossypium arboreum [tree cotton]
ref|XP_006451996.1|  hypothetical protein CICLE_v10007271mg             137   4e-33   Citrus clementina
gb|KDO74218.1|  hypothetical protein CISIN_1g000931mg                   137   4e-33   Citrus sinensis [Valencia orange]
gb|KDO74224.1|  hypothetical protein CISIN_1g000931mg                   137   4e-33   Citrus sinensis [Valencia orange]
ref|XP_006464672.1|  PREDICTED: myosin-2-like isoform X1                137   4e-33   Citrus sinensis [Valencia orange]
ref|XP_010278387.1|  PREDICTED: myosin-1 isoform X3                     136   5e-33   Nelumbo nucifera [Indian lotus]
ref|XP_010278386.1|  PREDICTED: myosin-2 isoform X2                     136   6e-33   Nelumbo nucifera [Indian lotus]
ref|XP_010278385.1|  PREDICTED: myosin-2 isoform X1                     136   6e-33   Nelumbo nucifera [Indian lotus]
ref|XP_001775964.1|  predicted protein                                  136   7e-33   Physcomitrella patens
ref|XP_002525757.1|  myosin vIII, putative                              135   2e-32   Ricinus communis
gb|KJB62696.1|  hypothetical protein B456_009G430900                    134   4e-32   Gossypium raimondii
ref|XP_004294488.1|  PREDICTED: myosin-2                                134   5e-32   Fragaria vesca subsp. vesca
dbj|BAL60532.2|  myosin VIII                                            134   5e-32   Marchantia polymorpha
ref|XP_010324344.1|  PREDICTED: myosin-2-like isoform X2                132   1e-31   Solanum lycopersicum
ref|XP_006362934.1|  PREDICTED: myosin-2-like isoform X1                132   2e-31   Solanum tuberosum [potatoes]
ref|XP_006362935.1|  PREDICTED: myosin-2-like isoform X2                132   2e-31   Solanum tuberosum [potatoes]
ref|XP_010324342.1|  PREDICTED: myosin-2-like isoform X1                131   4e-31   Solanum lycopersicum
gb|EMS67686.1|  Myosin-J heavy chain                                    131   4e-31   Triticum urartu
ref|XP_006279905.1|  hypothetical protein CARUB_v10025758mg             131   6e-31   Capsella rubella
gb|EYU19161.1|  hypothetical protein MIMGU_mgv1a000383mg                130   9e-31   Erythranthe guttata [common monkey flower]
ref|XP_006401589.1|  hypothetical protein EUTSA_v10012475mg             130   1e-30   Eutrema salsugineum
ref|XP_006592898.1|  PREDICTED: myosin-2-like isoform X3                129   1e-30   Glycine max [soybeans]
ref|XP_003539582.1|  PREDICTED: myosin-2-like isoform X1                129   2e-30   Glycine max [soybeans]
ref|XP_006592897.1|  PREDICTED: myosin-2-like isoform X2                129   2e-30   Glycine max [soybeans]
ref|XP_011098363.1|  PREDICTED: myosin-2-like                           129   2e-30   Sesamum indicum [beniseed]
ref|XP_010443003.1|  PREDICTED: myosin-2                                129   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010101784.1|  Myosin-2 heavy chain                               129   2e-30   Morus notabilis
ref|XP_010446745.1|  PREDICTED: myosin-2-like                           129   3e-30   Camelina sativa [gold-of-pleasure]
ref|XP_009792547.1|  PREDICTED: myosin-2-like isoform X1                129   3e-30   Nicotiana sylvestris
ref|XP_009792549.1|  PREDICTED: myosin-2-like isoform X2                129   3e-30   Nicotiana sylvestris
emb|CDP05853.1|  unnamed protein product                                128   4e-30   Coffea canephora [robusta coffee]
gb|KHN28019.1|  Myosin-J heavy chain                                    128   5e-30   Glycine soja [wild soybean]
ref|XP_002866036.1|  predicted protein                                  128   6e-30   Arabidopsis lyrata subsp. lyrata
ref|XP_009589781.1|  PREDICTED: myosin-2-like isoform X2                127   7e-30   Nicotiana tomentosiformis
ref|XP_009589778.1|  PREDICTED: myosin-2-like isoform X1                127   7e-30   Nicotiana tomentosiformis
ref|XP_009773271.1|  PREDICTED: myosin-2-like isoform X2                127   7e-30   Nicotiana sylvestris
ref|XP_010482837.1|  PREDICTED: myosin-2-like                           127   9e-30   Camelina sativa [gold-of-pleasure]
ref|XP_009773270.1|  PREDICTED: myosin-2-like isoform X1                127   1e-29   Nicotiana sylvestris
ref|NP_001059992.1|  Os07g0562800                                       127   1e-29   
ref|NP_001078755.1|  myosin 2                                           127   1e-29   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01329.1|  myosin heavy chain                                     127   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568806.3|  myosin 2                                              127   1e-29   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10751.1|  myosin heavy chain                                     127   1e-29   Arabidopsis thaliana [mouse-ear cress]
emb|CAA84065.1|  myosin                                                 126   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008454630.1|  PREDICTED: myosin-2-like                           125   4e-29   Cucumis melo [Oriental melon]
ref|XP_007149632.1|  hypothetical protein PHAVU_005G085900g             124   6e-29   Phaseolus vulgaris [French bean]
emb|CDY14319.1|  BnaA10g07360D                                          125   6e-29   Brassica napus [oilseed rape]
ref|XP_009603975.1|  PREDICTED: myosin-2-like isoform X2                125   7e-29   Nicotiana tomentosiformis
ref|XP_003541859.1|  PREDICTED: myosin-2-like                           125   7e-29   Glycine max [soybeans]
ref|XP_009119961.1|  PREDICTED: myosin-2-like                           125   7e-29   Brassica rapa
ref|XP_009603974.1|  PREDICTED: myosin-2-like isoform X1                124   1e-28   Nicotiana tomentosiformis
ref|XP_007149634.1|  hypothetical protein PHAVU_005G085900g             124   1e-28   Phaseolus vulgaris [French bean]
ref|XP_007149633.1|  hypothetical protein PHAVU_005G085900g             124   1e-28   Phaseolus vulgaris [French bean]
ref|XP_010694427.1|  PREDICTED: myosin-2 isoform X2                     124   1e-28   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010694426.1|  PREDICTED: myosin-2 isoform X1                     124   1e-28   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010520892.1|  PREDICTED: myosin-2-like                           124   1e-28   Tarenaya hassleriana [spider flower]
gb|ABJ53201.1|  myosin VIII-2                                           124   1e-28   Nicotiana benthamiana
emb|CDY18321.1|  BnaC09g30710D                                          122   5e-28   Brassica napus [oilseed rape]
emb|CDY28777.1|  BnaA02g09690D                                          122   6e-28   Brassica napus [oilseed rape]
ref|XP_004487658.1|  PREDICTED: myosin-J heavy chain-like isoform X1    122   6e-28   Cicer arietinum [garbanzo]
ref|XP_004487659.1|  PREDICTED: myosin-J heavy chain-like isoform X2    122   8e-28   
ref|XP_010922002.1|  PREDICTED: myosin-1-like                           121   1e-27   Elaeis guineensis
ref|XP_011095261.1|  PREDICTED: LOW QUALITY PROTEIN: myosin-2-like      121   1e-27   Sesamum indicum [beniseed]
ref|XP_002993349.1|  hypothetical protein SELMODRAFT_137032             121   1e-27   Selaginella moellendorffii
ref|XP_009127101.1|  PREDICTED: myosin-2                                121   2e-27   Brassica rapa
ref|XP_008805849.1|  PREDICTED: myosin-1-like                           120   2e-27   Phoenix dactylifera
ref|XP_002972734.1|  hypothetical protein SELMODRAFT_98074              120   2e-27   Selaginella moellendorffii
gb|ABJ53202.1|  myosin VIII-B                                           120   3e-27   Nicotiana benthamiana
emb|CDY52239.1|  BnaC02g44600D                                          120   3e-27   Brassica napus [oilseed rape]
ref|XP_004958024.1|  PREDICTED: unconventional myosin-Va-like           119   5e-27   
gb|AES66739.2|  P-loop nucleoside triphosphate hydrolase superfam...    119   9e-27   Medicago truncatula
ref|XP_003596488.1|  Myosin-like protein                                118   1e-26   
ref|XP_004146844.1|  PREDICTED: myosin-2 heavy chain-like               117   3e-26   Cucumis sativus [cucumbers]
ref|XP_010536993.1|  PREDICTED: myosin-2-like isoform X1                117   3e-26   Tarenaya hassleriana [spider flower]
ref|XP_010536994.1|  PREDICTED: myosin-2-like isoform X2                117   3e-26   
ref|XP_010327147.1|  PREDICTED: myosin-2-like isoform X2                115   9e-26   
ref|XP_004248278.1|  PREDICTED: myosin-2-like isoform X1                115   9e-26   
gb|EYU33558.1|  hypothetical protein MIMGU_mgv1a000433mg                114   4e-25   
ref|XP_009402609.1|  PREDICTED: myosin-2-like                           108   9e-25   
gb|KDP38945.1|  hypothetical protein JCGZ_00702                         109   1e-23   
gb|KHN46956.1|  Myosin-J heavy chain                                    108   4e-23   
ref|XP_006582193.1|  PREDICTED: myosin-2-like isoform X2                108   4e-23   
ref|XP_003526112.1|  PREDICTED: myosin-2-like isoform X1                108   4e-23   
gb|AAG49341.1|  myosin subfamily VIII heavy chain                       105   2e-22   
ref|XP_009420533.1|  PREDICTED: myosin-2-like                           101   5e-22   
gb|KEH19592.1|  P-loop nucleoside triphosphate hydrolase superfam...    104   6e-22   
ref|NP_194467.5|  myosin heavy chain-like protein                       103   2e-21   
emb|CAA19731.1|  myosin heavy chain-like protein                        103   2e-21   
ref|XP_003541108.1|  PREDICTED: myosin-2-like                           103   2e-21   
emb|CAB81387.1|  myosin heavy chain-like protein                        102   2e-21   
ref|XP_009385074.1|  PREDICTED: myosin-2-like                         99.4    3e-21   
ref|XP_007133144.1|  hypothetical protein PHAVU_011G155300g             102   3e-21   
ref|XP_004510018.1|  PREDICTED: unconventional myosin-Va-like           101   1e-20   
ref|XP_002867507.1|  hypothetical protein ARALYDRAFT_492062           99.8    3e-20   
ref|XP_010448147.1|  PREDICTED: myosin-4-like                         97.8    2e-19   
ref|XP_006283030.1|  hypothetical protein CARUB_v10004022mg           97.4    2e-19   
ref|XP_010438625.1|  PREDICTED: myosin-4-like                         96.7    3e-19   
gb|EPS62979.1|  hypothetical protein M569_11810                       89.4    4e-18   
gb|KHF97725.1|  Membrane antigen containing repeating peptides        86.7    6e-17   
gb|KFK29251.1|  hypothetical protein AALP_AA7G109000                  89.7    7e-17   
gb|KFK29252.1|  hypothetical protein AALP_AA7G109000                  89.7    7e-17   
ref|XP_009382696.1|  PREDICTED: myosin-2-like                         88.2    9e-17   
ref|XP_003057663.1|  predicted protein                                84.3    4e-15   
ref|XP_006413084.1|  hypothetical protein EUTSA_v10024254mg           82.8    1e-14   
gb|KJB81876.1|  hypothetical protein B456_013G166000                  82.0    2e-14   
gb|KJB81873.1|  hypothetical protein B456_013G166000                  82.0    2e-14   
gb|KJB81875.1|  hypothetical protein B456_013G166000                  82.0    2e-14   
gb|KJB81874.1|  hypothetical protein B456_013G166000                  82.0    3e-14   
ref|XP_002501869.1|  predicted protein                                80.9    6e-14   
gb|EPS70501.1|  hypothetical protein M569_04240                       79.7    2e-13   
ref|XP_011096207.1|  PREDICTED: myosin-2-like                         77.8    2e-13   
emb|CDO99630.1|  unnamed protein product                              74.3    1e-12   
ref|XP_009143365.1|  PREDICTED: myosin-4                              75.5    3e-12   
ref|XP_006663390.1|  PREDICTED: myosin-1-like                         69.7    1e-10   
dbj|BAK06656.1|  predicted protein                                    68.6    3e-10   
ref|XP_002451578.1|  hypothetical protein SORBIDRAFT_04g004170        67.0    3e-10   
gb|KJB13456.1|  hypothetical protein B456_002G076300                  65.5    6e-09   
gb|KDO74223.1|  hypothetical protein CISIN_1g000931mg                 65.1    6e-09   
gb|KJB13458.1|  hypothetical protein B456_002G076300                  64.7    8e-09   
gb|EAY86343.1|  hypothetical protein OsI_07720                        63.2    1e-08   
ref|NP_001130272.1|  hypothetical protein                             63.2    2e-08   
gb|EEC75625.1|  hypothetical protein OsI_12352                        58.5    2e-08   
ref|XP_002463024.1|  hypothetical protein SORBIDRAFT_02g036390        63.5    2e-08   
ref|NP_001067772.1|  Os11g0424400                                     62.4    3e-08   
ref|XP_003576065.2|  PREDICTED: myosin-2-like                         60.8    7e-08   
ref|XP_002956099.1|  type VIII myosin heavy chain MyoC                59.7    4e-07   
ref|XP_002459709.1|  hypothetical protein SORBIDRAFT_02g009180        57.8    6e-07   
gb|EPS65807.1|  hypothetical protein M569_08970                       57.8    2e-06   
ref|XP_009105704.1|  PREDICTED: LOW QUALITY PROTEIN: myosin-4-like    55.8    7e-06   
ref|XP_009617838.1|  PREDICTED: myosin-2-like                         54.7    1e-05   
ref|XP_009801337.1|  PREDICTED: myosin-2-like                         54.7    1e-05   
gb|AFW66465.1|  hypothetical protein ZEAMMB73_255645                  52.8    5e-05   
ref|XP_008680901.1|  PREDICTED: myosin-1-like                         52.4    6e-05   
ref|XP_010316685.1|  PREDICTED: myosin-3-like isoform X2              52.4    7e-05   
ref|XP_004233819.1|  PREDICTED: myosin-3-like isoform X1              52.4    7e-05   
emb|CDX98429.1|  BnaC05g39460D                                        51.6    8e-05   
ref|XP_010236277.1|  PREDICTED: myosin-1-like                         51.2    2e-04   
gb|EMT05903.1|  hypothetical protein F775_23349                       49.7    6e-04   
gb|EMS49466.1|  hypothetical protein TRIUR3_09739                     48.1    7e-04   



>ref|XP_009622620.1| PREDICTED: myosin-1-like [Nicotiana tomentosiformis]
Length=1151

 Score =   313 bits (802),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 166/198 (84%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             LRAEAALREK+EENDILHQRLQQYENRWSEYELKMKSMEE+WQKQMRSLQSSLSIAK+SL
Sbjct  954   LRAEAALREKEEENDILHQRLQQYENRWSEYELKMKSMEEIWQKQMRSLQSSLSIAKRSL  1013

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
              LDDS RNSDASVN +D+K S+W+ G+N  A E+NG RP+ AGLSVI +LAEEFEQRSQV
Sbjct  1014  TLDDSRRNSDASVNPTDEKESSWETGSNHRARESNGARPMSAGLSVISRLAEEFEQRSQV  1073

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETKVIL+KLGS+EGA
Sbjct  1074  FGDDAKFLVEVKSGQVEANLNPDRELRRLKQMFEAWKKDYGSRLRETKVILNKLGSDEGA  1133

Query  542   SDKMKKKWWGRRNSSRFN  595
             SDKMKKKWWGRRNS+RFN
Sbjct  1134  SDKMKKKWWGRRNSTRFN  1151



>ref|XP_009783184.1| PREDICTED: myosin-1-like [Nicotiana sylvestris]
Length=1151

 Score =   313 bits (802),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 166/198 (84%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             LRAEAALREK+EENDILHQRLQQYENRWSEYELKMKSMEE+WQKQMRSLQSSLSIAK+SL
Sbjct  954   LRAEAALREKEEENDILHQRLQQYENRWSEYELKMKSMEEIWQKQMRSLQSSLSIAKRSL  1013

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
              LDDS RNSDASVN +D+K S+W+ G+N  A E+NG RP+ AGLSVI +LAEEFEQRSQV
Sbjct  1014  TLDDSRRNSDASVNPTDEKESSWETGSNHRARESNGARPMSAGLSVISRLAEEFEQRSQV  1073

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETKVIL+KLGS+EGA
Sbjct  1074  FGDDAKFLVEVKSGQVEANLNPDRELRRLKQMFEAWKKDYGSRLRETKVILNKLGSDEGA  1133

Query  542   SDKMKKKWWGRRNSSRFN  595
             SDKMKKKWWGRRNS+RFN
Sbjct  1134  SDKMKKKWWGRRNSTRFN  1151



>gb|ABJ53200.1| myosin VIII-1 [Nicotiana benthamiana]
Length=1150

 Score =   313 bits (801),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 167/198 (84%), Positives = 182/198 (92%), Gaps = 1/198 (1%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             LRAEAALREK+EENDILHQRLQQYENRWSEYELKMKSMEE+WQKQMRSLQSSLSIAK+SL
Sbjct  954   LRAEAALREKEEENDILHQRLQQYENRWSEYELKMKSMEEIWQKQMRSLQSSLSIAKRSL  1013

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
              LDDS RNSDASVN +D+K S+W+ G+N  A E+NG RP+ AGLSVI +LAEEFEQRSQV
Sbjct  1014  TLDDS-RNSDASVNPTDEKESSWETGSNHRARESNGARPMNAGLSVISRLAEEFEQRSQV  1072

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EANLNPDHELRRLK MFE+WKKDYG RL+ETKVIL KLGS+EGA
Sbjct  1073  FGDDAKFLVEVKSGQVEANLNPDHELRRLKQMFEAWKKDYGSRLRETKVILSKLGSDEGA  1132

Query  542   SDKMKKKWWGRRNSSRFN  595
             SDKMKKKWWGRRNS+RFN
Sbjct  1133  SDKMKKKWWGRRNSTRFN  1150



>gb|ABK94124.1| unknown [Populus trichocarpa]
Length=252

 Score =   290 bits (742),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
            L+AEAALREK+EENDILHQRLQQYE+RWSEYELKMKSMEE+WQKQMRSLQSSLSIAKKSL
Sbjct  55   LKAEAALREKEEENDILHQRLQQYESRWSEYELKMKSMEEMWQKQMRSLQSSLSIAKKSL  114

Query  182  alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
            ++DDS RNSDASVNAS+++  +WD G+N    ENNGVRP+ AGLSVI +LAEEFEQRSQV
Sbjct  115  SVDDSERNSDASVNASEERDFSWDTGSNHRGQENNGVRPISAGLSVISRLAEEFEQRSQV  174

Query  362  FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
            FGDDAKFLVEVKSG  +A++N D ELRRLK MFE+WKKDYG RL+ETK+IL+KLG++EGA
Sbjct  175  FGDDAKFLVEVKSGQVDASMNADRELRRLKQMFEAWKKDYGSRLRETKLILNKLGTDEGA  234

Query  542  SDKMKKKWWGRRNSSRFN  595
             D++KKKWWG+RNS+R++
Sbjct  235  LDRVKKKWWGKRNSTRYS  252



>ref|XP_006345301.1| PREDICTED: myosin-1-like [Solanum tuberosum]
Length=1157

 Score =   310 bits (793),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 165/198 (83%), Positives = 183/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             LRAEAALREK+EENDILHQRLQQYENRWSEYELKMKSMEE+WQKQMRSLQSSLSIAK+SL
Sbjct  960   LRAEAALREKEEENDILHQRLQQYENRWSEYELKMKSMEEIWQKQMRSLQSSLSIAKRSL  1019

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             ALDDS RNSDASVN +D+K S+W+ G+N+ A E+NGVRP+ AGLSVI +LAEEFEQRSQV
Sbjct  1020  ALDDSRRNSDASVNPTDEKESSWETGSNQRARESNGVRPMSAGLSVISRLAEEFEQRSQV  1079

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EANL+PD ELRRLK MFE+WKKDYG RL+ETKVIL+KLGS+EG 
Sbjct  1080  FGDDAKFLVEVKSGQVEANLSPDRELRRLKQMFEAWKKDYGSRLRETKVILNKLGSDEGG  1139

Query  542   SDKMKKKWWGRRNSSRFN  595
             SDKMKKKWWGRRNS+R N
Sbjct  1140  SDKMKKKWWGRRNSTRLN  1157



>ref|XP_004231522.1| PREDICTED: myosin-1 [Solanum lycopersicum]
Length=1157

 Score =   310 bits (793),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 165/198 (83%), Positives = 183/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             LRAEAALREK+EENDILHQRLQQYENRWSEYELKMKSMEE+WQKQMRSLQSSLSIAK+SL
Sbjct  960   LRAEAALREKEEENDILHQRLQQYENRWSEYELKMKSMEEIWQKQMRSLQSSLSIAKRSL  1019

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             ALDDS RNSDASVN +D+K S+W+ G+N+ A E+NGVRP+ AGLSVI +LAEEFEQRSQV
Sbjct  1020  ALDDSRRNSDASVNPTDEKESSWETGSNQRARESNGVRPMSAGLSVISRLAEEFEQRSQV  1079

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EANL+PD ELRRLK MFE+WKKDYG RL+ETKVIL+KLGS+EG 
Sbjct  1080  FGDDAKFLVEVKSGQVEANLSPDRELRRLKQMFEAWKKDYGSRLRETKVILNKLGSDEGG  1139

Query  542   SDKMKKKWWGRRNSSRFN  595
             SDKMKKKWWGRRNS+R N
Sbjct  1140  SDKMKKKWWGRRNSTRLN  1157



>ref|XP_010067014.1| PREDICTED: myosin-1 [Eucalyptus grandis]
 ref|XP_010067015.1| PREDICTED: myosin-1 [Eucalyptus grandis]
 gb|KCW65077.1| hypothetical protein EUGRSUZ_G02585 [Eucalyptus grandis]
Length=1175

 Score =   308 bits (789),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             LRAEAALREK+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  978   LRAEAALREKEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1037

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDSARNSDASVN SDD+ S WD G++    ++NG+RP+ AGLSVI +LAEEFEQRSQV
Sbjct  1038  AIDDSARNSDASVNNSDDRDSNWDTGSSYKGQDSNGMRPMNAGLSVISRLAEEFEQRSQV  1097

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  +A+LNPD ELRRLK MFE+WKKDYGVRL+ETKVILHKLGS+EGA
Sbjct  1098  FGDDAKFLVEVKSGQVDASLNPDRELRRLKQMFEAWKKDYGVRLRETKVILHKLGSDEGA  1157

Query  542   SDKMKKKWWGRRNSSRFN  595
             +D+ KKKWWGRRNSSR N
Sbjct  1158  ADRAKKKWWGRRNSSRIN  1175



>emb|CDP18554.1| unnamed protein product [Coffea canephora]
Length=1129

 Score =   305 bits (781),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  932   LKAEAALREKEEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  991

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             ALDDS RNSDASVNASDD+ ++WD G+N    ++NG+RP+ AGLSVI +LAEEFEQRSQV
Sbjct  992   ALDDSHRNSDASVNASDDRETSWDAGSNFRVSDSNGMRPMNAGLSVISRLAEEFEQRSQV  1051

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EANL+PD ELRRLK MFE+WKKDYG RL+ETKVILHKLGS+EG+
Sbjct  1052  FGDDAKFLVEVKSGQAEANLDPDRELRRLKQMFEAWKKDYGSRLRETKVILHKLGSDEGS  1111

Query  542   SDKMKKKWWGRRNSSRFN  595
              DK +KKWWGRRNSSR N
Sbjct  1112  GDKGRKKWWGRRNSSRIN  1129



>gb|KDO69897.1| hypothetical protein CISIN_1g0010671mg [Citrus sinensis]
 gb|KDO69898.1| hypothetical protein CISIN_1g0010671mg [Citrus sinensis]
Length=745

 Score =   298 bits (763),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
            L+AEAALREK+EENDILHQRLQQYE+RWSEYE KMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  548  LKAEAALREKEEENDILHQRLQQYESRWSEYEQKMKSMEEVWQKQMRSLQSSLSIAKKSL  607

Query  182  alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
            A+DDS RNSDASVNASD+   +WD G+N    E+NGVRP+ AGLSVI +LAEEF+QRSQV
Sbjct  608  AIDDSERNSDASVNASDEVEYSWDTGSNCKGQESNGVRPMSAGLSVISRLAEEFDQRSQV  667

Query  362  FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
            FGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVIL+KLGSEEGA
Sbjct  668  FGDDAKFLVEVKSGQVEASLNPDKELRRLKQMFEAWKKDYGSRLRETKVILNKLGSEEGA  727

Query  542  SDKMKKKWWGRRNSSRFN  595
             D++KKKWWGRRNS+R N
Sbjct  728  IDRVKKKWWGRRNSTRIN  745



>ref|XP_007043232.1| Myosin 1 isoform 2 [Theobroma cacao]
 gb|EOX99063.1| Myosin 1 isoform 2 [Theobroma cacao]
Length=920

 Score =   301 bits (772),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
            L+AEAALREK+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  723  LKAEAALREKEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  782

Query  182  alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
            A+D+S RNSDASVNASDD+  +WD G+N    E+NG+RP+ AGLSVI +LAEEFEQRSQV
Sbjct  783  AVDESERNSDASVNASDDREYSWDTGSNHKGPESNGLRPMSAGLSVISRLAEEFEQRSQV  842

Query  362  FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
            FGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDY  RL+ETKVIL+KLG+EEGA
Sbjct  843  FGDDAKFLVEVKSGQVEASLNPDRELRRLKQMFETWKKDYASRLRETKVILNKLGNEEGA  902

Query  542  SDKMKKKWWGRRNSSRFN  595
             D++KKKWWGRRNSSR+N
Sbjct  903  LDRVKKKWWGRRNSSRYN  920



>gb|KDO69895.1| hypothetical protein CISIN_1g0010671mg [Citrus sinensis]
 gb|KDO69896.1| hypothetical protein CISIN_1g0010671mg [Citrus sinensis]
Length=793

 Score =   298 bits (764),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
            L+AEAALREK+EENDILHQRLQQYE+RWSEYE KMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  596  LKAEAALREKEEENDILHQRLQQYESRWSEYEQKMKSMEEVWQKQMRSLQSSLSIAKKSL  655

Query  182  alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
            A+DDS RNSDASVNASD+   +WD G+N    E+NGVRP+ AGLSVI +LAEEF+QRSQV
Sbjct  656  AIDDSERNSDASVNASDEVEYSWDTGSNCKGQESNGVRPMSAGLSVISRLAEEFDQRSQV  715

Query  362  FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
            FGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVIL+KLGSEEGA
Sbjct  716  FGDDAKFLVEVKSGQVEASLNPDKELRRLKQMFEAWKKDYGSRLRETKVILNKLGSEEGA  775

Query  542  SDKMKKKWWGRRNSSRFN  595
             D++KKKWWGRRNS+R N
Sbjct  776  IDRVKKKWWGRRNSTRIN  793



>ref|XP_008445889.1| PREDICTED: myosin-1-like [Cucumis melo]
Length=1175

 Score =   303 bits (776),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 185/198 (93%), Gaps = 1/198 (1%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYENRWSEYELKMKSMEEVWQ+QMRSLQSSLSIAKKSL
Sbjct  979   LKAEAALREKEEENDILHQRLQQYENRWSEYELKMKSMEEVWQRQMRSLQSSLSIAKKSL  1038

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNASDD+G +W++G+N TA E+NGVRP+ AGLSVI +LAEEFEQRSQV
Sbjct  1039  AVDDSERNSDASVNASDDRGYSWEVGSNNTANESNGVRPMNAGLSVISRLAEEFEQRSQV  1098

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EA+L+PD ELRRLK MFE+WKKDYG RL+ETKVIL+KLG+ EGA
Sbjct  1099  FGDDAKFLVEVKSGQVEASLDPDRELRRLKQMFEAWKKDYGGRLRETKVILNKLGN-EGA  1157

Query  542   SDKMKKKWWGRRNSSRFN  595
              D++KKKWWGRRNS+R++
Sbjct  1158  MDRVKKKWWGRRNSTRYS  1175



>ref|XP_004147135.1| PREDICTED: myosin-J heavy chain-like [Cucumis sativus]
 ref|XP_004162042.1| PREDICTED: myosin-J heavy chain-like [Cucumis sativus]
 gb|KGN51557.1| hypothetical protein Csa_5G577960 [Cucumis sativus]
Length=1175

 Score =   302 bits (774),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 184/198 (93%), Gaps = 1/198 (1%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYENRWSEYELKMKSMEEVWQ+QMRSLQSSLSIAKKSL
Sbjct  979   LKAEAALREKEEENDILHQRLQQYENRWSEYELKMKSMEEVWQRQMRSLQSSLSIAKKSL  1038

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNASDD+G +W++G+N TA E+NGVRP+ AGLSVI +LAEEFEQRSQV
Sbjct  1039  AVDDSERNSDASVNASDDRGYSWEVGSNNTANESNGVRPMNAGLSVISRLAEEFEQRSQV  1098

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EA+L+PD ELRRLK MFE+WKKDYG RL+ETKVIL KLG+ EGA
Sbjct  1099  FGDDAKFLVEVKSGQVEASLDPDRELRRLKQMFEAWKKDYGGRLRETKVILTKLGN-EGA  1157

Query  542   SDKMKKKWWGRRNSSRFN  595
              D++KKKWWGRRNS+R++
Sbjct  1158  MDRVKKKWWGRRNSTRYS  1175



>emb|CBI35399.3| unnamed protein product [Vitis vinifera]
Length=1135

 Score =   302 bits (773),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  938   LKAEAALREKEEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  997

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVN +DD+ S+WD G+N    E+NG+RP+ AGL+VI ++AEEFEQRSQV
Sbjct  998   AMDDSRRNSDASVNLTDDRDSSWDTGSNFRGQESNGMRPMSAGLTVISRMAEEFEQRSQV  1057

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG TEA+LNPD ELRRLK MFE+WKKDYG RL+ETKVIL KLG+EEG+
Sbjct  1058  FGDDAKFLVEVKSGQTEASLNPDRELRRLKQMFEAWKKDYGSRLRETKVILQKLGNEEGS  1117

Query  542   SDKMKKKWWGRRNSSRFN  595
              DK +KKWW RRNSSRFN
Sbjct  1118  GDKARKKWWVRRNSSRFN  1135



>gb|KDO69889.1| hypothetical protein CISIN_1g0010671mg, partial [Citrus sinensis]
 gb|KDO69890.1| hypothetical protein CISIN_1g0010671mg, partial [Citrus sinensis]
Length=907

 Score =   299 bits (765),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
            L+AEAALREK+EENDILHQRLQQYE+RWSEYE KMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  710  LKAEAALREKEEENDILHQRLQQYESRWSEYEQKMKSMEEVWQKQMRSLQSSLSIAKKSL  769

Query  182  alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
            A+DDS RNSDASVNASD+   +WD G+N    E+NGVRP+ AGLSVI +LAEEF+QRSQV
Sbjct  770  AIDDSERNSDASVNASDEVEYSWDTGSNCKGQESNGVRPMSAGLSVISRLAEEFDQRSQV  829

Query  362  FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
            FGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVIL+KLGSEEGA
Sbjct  830  FGDDAKFLVEVKSGQVEASLNPDKELRRLKQMFEAWKKDYGSRLRETKVILNKLGSEEGA  889

Query  542  SDKMKKKWWGRRNSSRFN  595
             D++KKKWWGRRNS+R N
Sbjct  890  IDRVKKKWWGRRNSTRIN  907



>gb|KDO69891.1| hypothetical protein CISIN_1g0010671mg, partial [Citrus sinensis]
Length=906

 Score =   299 bits (765),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
            L+AEAALREK+EENDILHQRLQQYE+RWSEYE KMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  709  LKAEAALREKEEENDILHQRLQQYESRWSEYEQKMKSMEEVWQKQMRSLQSSLSIAKKSL  768

Query  182  alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
            A+DDS RNSDASVNASD+   +WD G+N    E+NGVRP+ AGLSVI +LAEEF+QRSQV
Sbjct  769  AIDDSERNSDASVNASDEVEYSWDTGSNCKGQESNGVRPMSAGLSVISRLAEEFDQRSQV  828

Query  362  FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
            FGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVIL+KLGSEEGA
Sbjct  829  FGDDAKFLVEVKSGQVEASLNPDKELRRLKQMFEAWKKDYGSRLRETKVILNKLGSEEGA  888

Query  542  SDKMKKKWWGRRNSSRFN  595
             D++KKKWWGRRNS+R N
Sbjct  889  IDRVKKKWWGRRNSTRIN  906



>ref|XP_002273898.1| PREDICTED: myosin-1 [Vitis vinifera]
 ref|XP_010656029.1| PREDICTED: myosin-1 [Vitis vinifera]
 ref|XP_010656030.1| PREDICTED: myosin-1 [Vitis vinifera]
 ref|XP_010656031.1| PREDICTED: myosin-1 [Vitis vinifera]
Length=1197

 Score =   302 bits (773),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  1000  LKAEAALREKEEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1059

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVN +DD+ S+WD G+N    E+NG+RP+ AGL+VI ++AEEFEQRSQV
Sbjct  1060  AMDDSRRNSDASVNLTDDRDSSWDTGSNFRGQESNGMRPMSAGLTVISRMAEEFEQRSQV  1119

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG TEA+LNPD ELRRLK MFE+WKKDYG RL+ETKVIL KLG+EEG+
Sbjct  1120  FGDDAKFLVEVKSGQTEASLNPDRELRRLKQMFEAWKKDYGSRLRETKVILQKLGNEEGS  1179

Query  542   SDKMKKKWWGRRNSSRFN  595
              DK +KKWW RRNSSRFN
Sbjct  1180  GDKARKKWWVRRNSSRFN  1197



>ref|XP_007043231.1| Myosin 1 isoform 1 [Theobroma cacao]
 gb|EOX99062.1| Myosin 1 isoform 1 [Theobroma cacao]
Length=1153

 Score =   301 bits (772),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  956   LKAEAALREKEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1015

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+D+S RNSDASVNASDD+  +WD G+N    E+NG+RP+ AGLSVI +LAEEFEQRSQV
Sbjct  1016  AVDESERNSDASVNASDDREYSWDTGSNHKGPESNGLRPMSAGLSVISRLAEEFEQRSQV  1075

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDY  RL+ETKVIL+KLG+EEGA
Sbjct  1076  FGDDAKFLVEVKSGQVEASLNPDRELRRLKQMFETWKKDYASRLRETKVILNKLGNEEGA  1135

Query  542   SDKMKKKWWGRRNSSRFN  595
              D++KKKWWGRRNSSR+N
Sbjct  1136  LDRVKKKWWGRRNSSRYN  1153



>ref|XP_007142759.1| hypothetical protein PHAVU_007G014600g [Phaseolus vulgaris]
 gb|ESW14753.1| hypothetical protein PHAVU_007G014600g [Phaseolus vulgaris]
Length=745

 Score =   295 bits (754),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
            L+AEAALREK+EENDILHQRLQQY++RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  548  LKAEAALREKEEENDILHQRLQQYDSRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  607

Query  182  alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
            A+DDS RNSDASVNASD++  +WD+G N    E+NGVR + AGLSVI +LAEEFEQRSQV
Sbjct  608  AMDDSERNSDASVNASDERDFSWDVGTNHRRQESNGVRSMSAGLSVISRLAEEFEQRSQV  667

Query  362  FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
            FGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDY  RL+ETKVILHKLGSE+G+
Sbjct  668  FGDDAKFLVEVKSGQVEASLNPDRELRRLKQMFEAWKKDYNARLRETKVILHKLGSEDGS  727

Query  542  SDKMKKKWWGRRNSSRFN  595
             DK+KK WWGRRNS+R +
Sbjct  728  IDKVKKSWWGRRNSTRLS  745



>emb|CAN82090.1| hypothetical protein VITISV_032704 [Vitis vinifera]
Length=1161

 Score =   301 bits (771),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  964   LKAEAALREKEEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1023

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVN +DD+ S+WD G+N    E+NG+RP+ AGL+VI ++AEEFEQRSQV
Sbjct  1024  AMDDSRRNSDASVNLTDDRDSSWDTGSNFRGQESNGMRPMSAGLTVISRMAEEFEQRSQV  1083

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG TEA+LNPD ELRRLK MFE+WKKDYG RL+ETKVIL KLG+EEG+
Sbjct  1084  FGDDAKFLVEVKSGQTEASLNPDRELRRLKQMFEAWKKDYGSRLRETKVILQKLGNEEGS  1143

Query  542   SDKMKKKWWGRRNSSRFN  595
              DK +KKWW RRNSSRFN
Sbjct  1144  GDKARKKWWVRRNSSRFN  1161



>gb|KHF99826.1| Unconventional myosin-Va [Gossypium arboreum]
Length=1179

 Score =   301 bits (770),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 162/199 (81%), Positives = 179/199 (90%), Gaps = 1/199 (1%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             LRAEAALREK+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  981   LRAEAALREKEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1040

Query  182   alDDSARNSDASVN-ASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQ  358
             A+DDS RNSDASVN ASDD+  +WD G N    E+NG+RP  AGLSVI +LAEEFEQRSQ
Sbjct  1041  AVDDSERNSDASVNNASDDREYSWDTGTNHNGPESNGLRPTSAGLSVISRLAEEFEQRSQ  1100

Query  359   VFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEG  538
             VFGDDAKFLVEVKSG  EANLNPD ELRRLK MFE+WKKDY VRL+ETKV+L+KLG+EEG
Sbjct  1101  VFGDDAKFLVEVKSGQVEANLNPDRELRRLKQMFETWKKDYSVRLRETKVVLNKLGNEEG  1160

Query  539   ASDKMKKKWWGRRNSSRFN  595
             A D++KKKWWGRRNS+R+ 
Sbjct  1161  ALDRVKKKWWGRRNSTRYT  1179



>ref|XP_006605841.1| PREDICTED: myosin-1-like isoform X3 [Glycine max]
Length=1059

 Score =   298 bits (764),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA+LREK+EENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  862   LKAEASLREKEEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  921

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNASDD+  +WD+G N    E+NG R + AGLSVI +LAEEFEQRSQV
Sbjct  922   AMDDSERNSDASVNASDDRDFSWDVGTNHRRQESNGARSMSAGLSVISRLAEEFEQRSQV  981

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVILHKLGSE+G+
Sbjct  982   FGDDAKFLVEVKSGQVEASLNPDRELRRLKQMFEAWKKDYGARLRETKVILHKLGSEDGS  1041

Query  542   SDKMKKKWWGRRNSSRFN  595
              +K+KK WWGRRNS+R +
Sbjct  1042  IEKVKKSWWGRRNSTRIS  1059



>ref|XP_008389065.1| PREDICTED: myosin-1-like [Malus domestica]
Length=1175

 Score =   299 bits (766),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 159/199 (80%), Positives = 180/199 (90%), Gaps = 1/199 (1%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  977   LKAEAALREKEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1036

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNASDD+  +WD G+N    ++NGVRP+ AGLSVI +L EEF+QRSQV
Sbjct  1037  AIDDSGRNSDASVNASDDRDQSWDTGSNHRGQDSNGVRPLSAGLSVISRLTEEFDQRSQV  1096

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETK+I+HK+G+EEG 
Sbjct  1097  FGDDAKFLVEVKSGKVEASLNPDQELRRLKQMFEAWKKDYGARLRETKLIMHKIGNEEGG  1156

Query  542   S-DKMKKKWWGRRNSSRFN  595
             S D++KKKWWGRRNSSR N
Sbjct  1157  SADRVKKKWWGRRNSSRIN  1175



>gb|KHN23106.1| Unconventional myosin-Va [Glycine soja]
Length=947

 Score =   296 bits (759),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
            L+AEA+LREK+EENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  750  LKAEASLREKEEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  809

Query  182  alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
            A+DDS RNSDASVNASDD+  +WD+G N    E+NG R + AGLSVI +LAEEFEQRSQV
Sbjct  810  AMDDSERNSDASVNASDDRDFSWDVGTNHRRQESNGARSMSAGLSVISRLAEEFEQRSQV  869

Query  362  FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
            FGDD+KFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVILHKLGSE+G+
Sbjct  870  FGDDSKFLVEVKSGQVEASLNPDRELRRLKQMFEAWKKDYGARLRETKVILHKLGSEDGS  929

Query  542  SDKMKKKWWGRRNSSRFN  595
             +K+KK WWGRRNS+R +
Sbjct  930  IEKVKKSWWGRRNSTRIS  947



>ref|XP_006437635.1| hypothetical protein CICLE_v10030552mg [Citrus clementina]
 gb|ESR50875.1| hypothetical protein CICLE_v10030552mg [Citrus clementina]
Length=1168

 Score =   299 bits (766),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYE+RWSEYE KMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  971   LKAEAALREKEEENDILHQRLQQYESRWSEYEQKMKSMEEVWQKQMRSLQSSLSIAKKSL  1030

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNASD+   +WD G+N    E+NGVRP+ AGLSVI +LAEEF+QRSQV
Sbjct  1031  AIDDSERNSDASVNASDEVEYSWDTGSNCKGQESNGVRPMSAGLSVISRLAEEFDQRSQV  1090

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVIL+KLGSEEGA
Sbjct  1091  FGDDAKFLVEVKSGQVEASLNPDKELRRLKQMFEAWKKDYGSRLRETKVILNKLGSEEGA  1150

Query  542   SDKMKKKWWGRRNSSRFN  595
              D++KKKWWGRRNS+R N
Sbjct  1151  IDRVKKKWWGRRNSTRIN  1168



>ref|XP_008340434.1| PREDICTED: myosin-1 isoform X2 [Malus domestica]
Length=1165

 Score =   298 bits (764),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 179/199 (90%), Gaps = 1/199 (1%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  967   LKAEAALREKEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1026

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNASDD+   WD G+N    ++NGVRP+ AGLSVI +L EEF+QRSQV
Sbjct  1027  AIDDSERNSDASVNASDDREYGWDTGSNHRGQDSNGVRPMSAGLSVISRLTEEFDQRSQV  1086

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVILHK+G+EEG 
Sbjct  1087  FGDDAKFLVEVKSGQVEASLNPDRELRRLKQMFEAWKKDYGTRLRETKVILHKIGNEEGG  1146

Query  542   S-DKMKKKWWGRRNSSRFN  595
             S D++KKKWWGRRNSSR N
Sbjct  1147  SADRVKKKWWGRRNSSRIN  1165



>ref|XP_008340433.1| PREDICTED: myosin-1 isoform X1 [Malus domestica]
Length=1166

 Score =   298 bits (764),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 179/199 (90%), Gaps = 1/199 (1%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  968   LKAEAALREKEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1027

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNASDD+   WD G+N    ++NGVRP+ AGLSVI +L EEF+QRSQV
Sbjct  1028  AIDDSERNSDASVNASDDREYGWDTGSNHRGQDSNGVRPMSAGLSVISRLTEEFDQRSQV  1087

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVILHK+G+EEG 
Sbjct  1088  FGDDAKFLVEVKSGQVEASLNPDRELRRLKQMFEAWKKDYGTRLRETKVILHKIGNEEGG  1147

Query  542   S-DKMKKKWWGRRNSSRFN  595
             S D++KKKWWGRRNSSR N
Sbjct  1148  SADRVKKKWWGRRNSSRIN  1166



>ref|XP_011022005.1| PREDICTED: myosin-1-like isoform X1 [Populus euphratica]
 ref|XP_011022006.1| PREDICTED: myosin-1-like isoform X1 [Populus euphratica]
 ref|XP_011022007.1| PREDICTED: myosin-1-like isoform X1 [Populus euphratica]
 ref|XP_011022008.1| PREDICTED: myosin-1-like isoform X1 [Populus euphratica]
Length=1173

 Score =   298 bits (764),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EEND+LHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  976   LKAEAALREKEEENDVLHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1035

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNASD++  +WD G+N    E+N  RP+ AGLSVI ++AEEFEQRSQV
Sbjct  1036  AIDDSERNSDASVNASDERECSWDTGSNHRGQESNSARPMSAGLSVISRMAEEFEQRSQV  1095

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVIL+KLG+EEGA
Sbjct  1096  FGDDAKFLVEVKSGQVEASLNPDRELRRLKQMFEAWKKDYGSRLRETKVILNKLGTEEGA  1155

Query  542   SDKMKKKWWGRRNSSRFN  595
              D++K+KWWGRRNS+R+ 
Sbjct  1156  LDRVKRKWWGRRNSTRYT  1173



>ref|XP_006484499.1| PREDICTED: myosin-1-like [Citrus sinensis]
Length=1167

 Score =   298 bits (764),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYE+RWSEYE KMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  970   LKAEAALREKEEENDILHQRLQQYESRWSEYEQKMKSMEEVWQKQMRSLQSSLSIAKKSL  1029

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNASD+   +WD G+N    E+NGVRP+ AGLSVI +LAEEF+QRSQV
Sbjct  1030  AIDDSERNSDASVNASDEVEYSWDTGSNCKGQESNGVRPMSAGLSVISRLAEEFDQRSQV  1089

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVIL+KLGSEEGA
Sbjct  1090  FGDDAKFLVEVKSGQVEASLNPDKELRRLKQMFEAWKKDYGSRLRETKVILNKLGSEEGA  1149

Query  542   SDKMKKKWWGRRNSSRFN  595
              D++KKKWWGRRNS+R N
Sbjct  1150  IDRVKKKWWGRRNSTRIN  1167



>gb|KJB31871.1| hypothetical protein B456_005G212100 [Gossypium raimondii]
 gb|KJB31873.1| hypothetical protein B456_005G212100 [Gossypium raimondii]
Length=1145

 Score =   298 bits (763),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 178/199 (89%), Gaps = 1/199 (1%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             LRAEAALREK+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  947   LRAEAALREKEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1006

Query  182   alDDSARNSDASVN-ASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQ  358
             A+DD+ RNSDASVN ASDD+  +WD G N    E+NG+RP  AGLSVI +LAEEFEQRSQ
Sbjct  1007  AVDDTERNSDASVNNASDDREYSWDTGTNHKGPESNGLRPTSAGLSVISRLAEEFEQRSQ  1066

Query  359   VFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEG  538
             VFGDDAKFLVEVKSG  EANLNPD ELRRLK MFE+WKKDY  RL+ETKV+L+KLG+EEG
Sbjct  1067  VFGDDAKFLVEVKSGQVEANLNPDRELRRLKQMFETWKKDYAARLRETKVVLNKLGNEEG  1126

Query  539   ASDKMKKKWWGRRNSSRFN  595
             A D++KKKWWGRRNS+R+ 
Sbjct  1127  ALDRVKKKWWGRRNSTRYT  1145



>ref|XP_004497240.1| PREDICTED: myosin-J heavy chain-like isoform X1 [Cicer arietinum]
Length=1176

 Score =   298 bits (763),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREKDEENDILHQRLQQY+NRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  979   LKAEAALREKDEENDILHQRLQQYDNRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1038

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNASDDK  +WDIGN+    E++G R + AGLSVI +LAEEFEQRSQV
Sbjct  1039  AMDDSERNSDASVNASDDKEYSWDIGNHHRRQESSGTRSMSAGLSVISRLAEEFEQRSQV  1098

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EA+LNPD EL RLK MFE+WKKDYG RL+ETKVILHKLGSE G+
Sbjct  1099  FGDDAKFLVEVKSGQVEASLNPDRELGRLKQMFEAWKKDYGSRLRETKVILHKLGSENGS  1158

Query  542   SDKMKKKWWGRRNSSRFN  595
              +K KKKWWGRRNS+R N
Sbjct  1159  VEKAKKKWWGRRNSTRIN  1176



>ref|XP_010103613.1| Myosin-2 heavy chain [Morus notabilis]
 gb|EXB96390.1| Myosin-2 heavy chain [Morus notabilis]
Length=1149

 Score =   298 bits (763),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 179/198 (90%), Gaps = 1/198 (1%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  953   LKAEAALREKEEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1012

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNAS+D+  +WD G+++   E+NGVRP+ AGLSVI +LAEEFEQRSQV
Sbjct  1013  AIDDSERNSDASVNASEDREYSWDTGSHK-GQESNGVRPMSAGLSVISRLAEEFEQRSQV  1071

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  +A+LNPD ELRRLK MFE+WKKDYG RL+ETKVILHKLGSEEG 
Sbjct  1072  FGDDAKFLVEVKSGQVDASLNPDKELRRLKQMFEAWKKDYGGRLRETKVILHKLGSEEGP  1131

Query  542   SDKMKKKWWGRRNSSRFN  595
              D+ KKKWW RRNS+R N
Sbjct  1132  VDRAKKKWWARRNSTRIN  1149



>ref|XP_009351748.1| PREDICTED: myosin-1-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009351749.1| PREDICTED: myosin-1-like isoform X1 [Pyrus x bretschneideri]
Length=1175

 Score =   298 bits (763),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 179/199 (90%), Gaps = 1/199 (1%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA LREK+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  977   LKAEAGLREKEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1036

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNASDD+  +WD G+N    ++NGVRP+ AGLSVI +L EEF+QRSQV
Sbjct  1037  AIDDSERNSDASVNASDDREYSWDTGSNHRGQDSNGVRPMSAGLSVISRLTEEFDQRSQV  1096

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVILHK+G+EEG 
Sbjct  1097  FGDDAKFLVEVKSGQVEASLNPDRELRRLKQMFEAWKKDYGTRLRETKVILHKIGNEEGG  1156

Query  542   S-DKMKKKWWGRRNSSRFN  595
             S D++KKKWWGRRNSSR N
Sbjct  1157  SADRVKKKWWGRRNSSRIN  1175



>ref|XP_009351750.1| PREDICTED: myosin-1-like isoform X2 [Pyrus x bretschneideri]
Length=1163

 Score =   298 bits (763),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 179/199 (90%), Gaps = 1/199 (1%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA LREK+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  965   LKAEAGLREKEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1024

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNASDD+  +WD G+N    ++NGVRP+ AGLSVI +L EEF+QRSQV
Sbjct  1025  AIDDSERNSDASVNASDDREYSWDTGSNHRGQDSNGVRPMSAGLSVISRLTEEFDQRSQV  1084

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVILHK+G+EEG 
Sbjct  1085  FGDDAKFLVEVKSGQVEASLNPDRELRRLKQMFEAWKKDYGTRLRETKVILHKIGNEEGG  1144

Query  542   S-DKMKKKWWGRRNSSRFN  595
             S D++KKKWWGRRNSSR N
Sbjct  1145  SADRVKKKWWGRRNSSRIN  1163



>ref|XP_006605839.1| PREDICTED: myosin-1-like isoform X1 [Glycine max]
 ref|XP_006605840.1| PREDICTED: myosin-1-like isoform X2 [Glycine max]
Length=1170

 Score =   298 bits (763),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA+LREK+EENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  973   LKAEASLREKEEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1032

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNASDD+  +WD+G N    E+NG R + AGLSVI +LAEEFEQRSQV
Sbjct  1033  AMDDSERNSDASVNASDDRDFSWDVGTNHRRQESNGARSMSAGLSVISRLAEEFEQRSQV  1092

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVILHKLGSE+G+
Sbjct  1093  FGDDAKFLVEVKSGQVEASLNPDRELRRLKQMFEAWKKDYGARLRETKVILHKLGSEDGS  1152

Query  542   SDKMKKKWWGRRNSSRFN  595
              +K+KK WWGRRNS+R +
Sbjct  1153  IEKVKKSWWGRRNSTRIS  1170



>ref|XP_011022009.1| PREDICTED: myosin-1-like isoform X2 [Populus euphratica]
Length=1118

 Score =   298 bits (762),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EEND+LHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  921   LKAEAALREKEEENDVLHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  980

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNASD++  +WD G+N    E+N  RP+ AGLSVI ++AEEFEQRSQV
Sbjct  981   AIDDSERNSDASVNASDERECSWDTGSNHRGQESNSARPMSAGLSVISRMAEEFEQRSQV  1040

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVIL+KLG+EEGA
Sbjct  1041  FGDDAKFLVEVKSGQVEASLNPDRELRRLKQMFEAWKKDYGSRLRETKVILNKLGTEEGA  1100

Query  542   SDKMKKKWWGRRNSSRFN  595
              D++K+KWWGRRNS+R+ 
Sbjct  1101  LDRVKRKWWGRRNSTRYT  1118



>ref|XP_004497241.1| PREDICTED: myosin-J heavy chain-like isoform X2 [Cicer arietinum]
Length=1159

 Score =   298 bits (762),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREKDEENDILHQRLQQY+NRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  962   LKAEAALREKDEENDILHQRLQQYDNRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1021

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNASDDK  +WDIGN+    E++G R + AGLSVI +LAEEFEQRSQV
Sbjct  1022  AMDDSERNSDASVNASDDKEYSWDIGNHHRRQESSGTRSMSAGLSVISRLAEEFEQRSQV  1081

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EA+LNPD EL RLK MFE+WKKDYG RL+ETKVILHKLGSE G+
Sbjct  1082  FGDDAKFLVEVKSGQVEASLNPDRELGRLKQMFEAWKKDYGSRLRETKVILHKLGSENGS  1141

Query  542   SDKMKKKWWGRRNSSRFN  595
              +K KKKWWGRRNS+R N
Sbjct  1142  VEKAKKKWWGRRNSTRIN  1159



>ref|XP_006589741.1| PREDICTED: myosin-1-like isoform X2 [Glycine max]
Length=1059

 Score =   297 bits (760),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  862   LKAEAALREKEEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  921

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNASDD+  +WD+G N    E+NG + + AGLSVI +LAEEFEQRSQV
Sbjct  922   AMDDSERNSDASVNASDDRDFSWDVGTNHRRQESNGAKSMSAGLSVISRLAEEFEQRSQV  981

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDD+KFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVILHKLGSE+G+
Sbjct  982   FGDDSKFLVEVKSGQVEASLNPDRELRRLKQMFEAWKKDYGARLRETKVILHKLGSEDGS  1041

Query  542   SDKMKKKWWGRRNSSRFN  595
              +K+KK WWGRRNS+R +
Sbjct  1042  IEKVKKSWWGRRNSTRIS  1059



>gb|KHN46512.1| Myosin-J heavy chain, partial [Glycine soja]
Length=1049

 Score =   296 bits (758),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  852   LKAEAALREKEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  911

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNASD++  +WD+G N    E+NG R   AGLSVI +LAEEFE RSQV
Sbjct  912   AIDDSERNSDASVNASDERDYSWDVGGNHKRQESNGARSTSAGLSVISRLAEEFEHRSQV  971

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI++KLGSE+GA
Sbjct  972   FGDDAKFLVEVKSGQVEASLNPDQELRRLKQMFEAWKKDYGARLRETKVIINKLGSEDGA  1031

Query  542   SDKMKKKWWGRRNSSRFN  595
              +KMKKKWWGRRNS+R N
Sbjct  1032  LEKMKKKWWGRRNSTRIN  1049



>ref|XP_002307152.1| myosin-related family protein [Populus trichocarpa]
 gb|EEE94148.1| myosin-related family protein [Populus trichocarpa]
Length=1173

 Score =   297 bits (761),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EEND+LHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  976   LKAEAALREKEEENDVLHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1035

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNASD++  +WD G+N    E+N  RP+ AGLSVI ++AEEFEQRSQV
Sbjct  1036  AIDDSERNSDASVNASDEREFSWDTGSNHRGQESNSARPMSAGLSVISRMAEEFEQRSQV  1095

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVIL+KLG+EEGA
Sbjct  1096  FGDDAKFLVEVKSGQVEASLNPDRELRRLKQMFEAWKKDYGSRLRETKVILNKLGTEEGA  1155

Query  542   SDKMKKKWWGRRNSSRFN  595
              D++K+KWWGRRNS+R+ 
Sbjct  1156  LDRVKRKWWGRRNSTRYT  1173



>ref|XP_008221075.1| PREDICTED: myosin-1 [Prunus mume]
 ref|XP_008221076.1| PREDICTED: myosin-1 [Prunus mume]
Length=1182

 Score =   297 bits (761),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  985   LKAEAALREKEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1044

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNASDD   +WD G+N    ++NG RP+ AGLSVI +L EEF+QRSQV
Sbjct  1045  AVDDSERNSDASVNASDDHDYSWDTGSNHRRQDSNGARPMSAGLSVISRLTEEFDQRSQV  1104

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETK+ILHK+G+EEG 
Sbjct  1105  FGDDAKFLVEVKSGQVEASLNPDRELRRLKQMFEAWKKDYGARLRETKLILHKIGNEEGT  1164

Query  542   SDKMKKKWWGRRNSSRFN  595
              D++KKKWWGRRNSSR N
Sbjct  1165  VDRVKKKWWGRRNSSRIN  1182



>ref|XP_011012312.1| PREDICTED: myosin-1-like isoform X2 [Populus euphratica]
Length=1187

 Score =   297 bits (760),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  990   LKAEAALREKEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1049

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             ++DDS RNSDASVNASD++  +WD G+N    ENNGVRP+ AG SVI +LAEEFEQRSQV
Sbjct  1050  SVDDSGRNSDASVNASDERDVSWDTGSNHRGQENNGVRPISAGFSVISRLAEEFEQRSQV  1109

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  +A++N D ELRRLK MFE+WKKDYG RL+ETK+IL+KLG++EGA
Sbjct  1110  FGDDAKFLVEVKSGQVDASMNADRELRRLKQMFEAWKKDYGSRLRETKLILNKLGTDEGA  1169

Query  542   SDKMKKKWWGRRNSSRFN  595
              D++KKKWWGRRNS+R++
Sbjct  1170  LDRVKKKWWGRRNSTRYS  1187



>ref|XP_011012313.1| PREDICTED: myosin-1-like isoform X3 [Populus euphratica]
Length=1185

 Score =   297 bits (760),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  988   LKAEAALREKEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1047

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             ++DDS RNSDASVNASD++  +WD G+N    ENNGVRP+ AG SVI +LAEEFEQRSQV
Sbjct  1048  SVDDSGRNSDASVNASDERDVSWDTGSNHRGQENNGVRPISAGFSVISRLAEEFEQRSQV  1107

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  +A++N D ELRRLK MFE+WKKDYG RL+ETK+IL+KLG++EGA
Sbjct  1108  FGDDAKFLVEVKSGQVDASMNADRELRRLKQMFEAWKKDYGSRLRETKLILNKLGTDEGA  1167

Query  542   SDKMKKKWWGRRNSSRFN  595
              D++KKKWWGRRNS+R++
Sbjct  1168  LDRVKKKWWGRRNSTRYS  1185



>ref|XP_011012310.1| PREDICTED: myosin-1-like isoform X1 [Populus euphratica]
 ref|XP_011012311.1| PREDICTED: myosin-1-like isoform X1 [Populus euphratica]
Length=1198

 Score =   297 bits (760),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  1001  LKAEAALREKEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1060

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             ++DDS RNSDASVNASD++  +WD G+N    ENNGVRP+ AG SVI +LAEEFEQRSQV
Sbjct  1061  SVDDSGRNSDASVNASDERDVSWDTGSNHRGQENNGVRPISAGFSVISRLAEEFEQRSQV  1120

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  +A++N D ELRRLK MFE+WKKDYG RL+ETK+IL+KLG++EGA
Sbjct  1121  FGDDAKFLVEVKSGQVDASMNADRELRRLKQMFEAWKKDYGSRLRETKLILNKLGTDEGA  1180

Query  542   SDKMKKKWWGRRNSSRFN  595
              D++KKKWWGRRNS+R++
Sbjct  1181  LDRVKKKWWGRRNSTRYS  1198



>gb|KJB31872.1| hypothetical protein B456_005G212100 [Gossypium raimondii]
Length=1147

 Score =   296 bits (759),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 160/197 (81%), Positives = 177/197 (90%), Gaps = 1/197 (1%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             LRAEAALREK+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  947   LRAEAALREKEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1006

Query  182   alDDSARNSDASVN-ASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQ  358
             A+DD+ RNSDASVN ASDD+  +WD G N    E+NG+RP  AGLSVI +LAEEFEQRSQ
Sbjct  1007  AVDDTERNSDASVNNASDDREYSWDTGTNHKGPESNGLRPTSAGLSVISRLAEEFEQRSQ  1066

Query  359   VFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEG  538
             VFGDDAKFLVEVKSG  EANLNPD ELRRLK MFE+WKKDY  RL+ETKV+L+KLG+EEG
Sbjct  1067  VFGDDAKFLVEVKSGQVEANLNPDRELRRLKQMFETWKKDYAARLRETKVVLNKLGNEEG  1126

Query  539   ASDKMKKKWWGRRNSSR  589
             A D++KKKWWGRRNS+R
Sbjct  1127  ALDRVKKKWWGRRNSTR  1143



>gb|KJB79824.1| hypothetical protein B456_013G068300 [Gossypium raimondii]
Length=892

 Score =   293 bits (751),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
            L+AEAALREK+EENDILHQRL QYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  695  LKAEAALREKEEENDILHQRLLQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  754

Query  182  alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
            A+D+S R+SDAS+N SDD+   WD GNN    E+NG+RP+ AGLSVI +LAEEFEQRSQV
Sbjct  755  AVDESERSSDASINTSDDREYCWDTGNNLKVPESNGLRPMSAGLSVISRLAEEFEQRSQV  814

Query  362  FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
            FGDDAKFLVEVKSG  +A+LNPD ELRRLK MFE+WKKDY  RL+ETKV+L+KLG+E+GA
Sbjct  815  FGDDAKFLVEVKSGQVDASLNPDRELRRLKQMFETWKKDYATRLRETKVVLNKLGNEDGA  874

Query  542  SDKMKKKWWGRRNSSRFN  595
             DK+KKK+WGRRNS+R+N
Sbjct  875  LDKVKKKFWGRRNSTRYN  892



>ref|XP_003536741.2| PREDICTED: myosin-1-like isoform X1 [Glycine max]
Length=1176

 Score =   296 bits (759),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  979   LKAEAALREKEEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1038

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNASDD+  +WD+G N    E+NG + + AGLSVI +LAEEFEQRSQV
Sbjct  1039  AMDDSERNSDASVNASDDRDFSWDVGTNHRRQESNGAKSMSAGLSVISRLAEEFEQRSQV  1098

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDD+KFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVILHKLGSE+G+
Sbjct  1099  FGDDSKFLVEVKSGQVEASLNPDRELRRLKQMFEAWKKDYGARLRETKVILHKLGSEDGS  1158

Query  542   SDKMKKKWWGRRNSSRFN  595
              +K+KK WWGRRNS+R +
Sbjct  1159  IEKVKKSWWGRRNSTRIS  1176



>ref|XP_003533701.1| PREDICTED: myosin-1-like isoform X1 [Glycine max]
 ref|XP_006587966.1| PREDICTED: myosin-1-like isoform X2 [Glycine max]
 ref|XP_006587967.1| PREDICTED: myosin-1-like isoform X3 [Glycine max]
Length=1177

 Score =   296 bits (759),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  980   LKAEAALREKEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1039

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNASD++  +WD+G N    E+NG R   AGLSVI +LAEEFE RSQV
Sbjct  1040  AIDDSERNSDASVNASDERDYSWDVGGNHKRQESNGARSTSAGLSVISRLAEEFEHRSQV  1099

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI++KLGSE+GA
Sbjct  1100  FGDDAKFLVEVKSGQVEASLNPDQELRRLKQMFEAWKKDYGARLRETKVIINKLGSEDGA  1159

Query  542   SDKMKKKWWGRRNSSRFN  595
              +KMKKKWWGRRNS+R N
Sbjct  1160  LEKMKKKWWGRRNSTRIN  1177



>ref|XP_007225432.1| hypothetical protein PRUPE_ppa000435mg [Prunus persica]
 gb|EMJ26631.1| hypothetical protein PRUPE_ppa000435mg [Prunus persica]
Length=1185

 Score =   296 bits (758),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  988   LKAEAALREKEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1047

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNASDD   +WD G+N    ++NG RP+ AGLSVI +L EEF+QRSQV
Sbjct  1048  AVDDSERNSDASVNASDDHDYSWDTGSNHRRQDSNGARPMSAGLSVISRLTEEFDQRSQV  1107

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETK+ILHK+G++EG 
Sbjct  1108  FGDDAKFLVEVKSGQVEASLNPDRELRRLKQMFEAWKKDYGARLRETKLILHKIGNDEGT  1167

Query  542   SDKMKKKWWGRRNSSRFN  595
              D++KKKWWGRRNSSR N
Sbjct  1168  VDRVKKKWWGRRNSSRIN  1185



>gb|KJB79817.1| hypothetical protein B456_013G068300 [Gossypium raimondii]
Length=924

 Score =   293 bits (750),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = +2

Query  2    LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
            L+AEAALREK+EENDILHQRL QYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  726  LKAEAALREKEEENDILHQRLLQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  785

Query  182  alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
            A+D+S R+SDAS+N SDD+   WD GNN    E+NG+RP+ AGLSVI +LAEEFEQRSQV
Sbjct  786  AVDESERSSDASINTSDDREYCWDTGNNLKVPESNGLRPMSAGLSVISRLAEEFEQRSQV  845

Query  362  FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
            FGDDAKFLVEVKSG  +A+LNPD ELRRLK MFE+WKKDY  RL+ETKV+L+KLG+E+GA
Sbjct  846  FGDDAKFLVEVKSGQVDASLNPDRELRRLKQMFETWKKDYATRLRETKVVLNKLGNEDGA  905

Query  542  SDKMKKKWWGRRNSSRF  592
             DK+KKK+WGRRNS+RF
Sbjct  906  LDKVKKKFWGRRNSTRF  922



>gb|KDP37497.1| hypothetical protein JCGZ_05936 [Jatropha curcas]
Length=923

 Score =   293 bits (750),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 181/201 (90%), Gaps = 3/201 (1%)
 Frame = +2

Query  2    LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
            L+AEAALREK+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  723  LKAEAALREKEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  782

Query  182  alDDSARNSDASVNA-SDDKGSTWDIGNNRTALENNG--VRPVRAGLSVIGQLAEEFEQR  352
            A+DDS RNSDASVNA SD++  +WD G+N    E+NG  V+P+ AGLSVI +LAEEFEQR
Sbjct  783  AIDDSERNSDASVNAPSDERDYSWDTGSNNRGQESNGHGVKPMSAGLSVISRLAEEFEQR  842

Query  353  SQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSE  532
            SQVFGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVIL+KLG+E
Sbjct  843  SQVFGDDAKFLVEVKSGQVEASLNPDRELRRLKQMFEAWKKDYGARLRETKVILNKLGNE  902

Query  533  EGASDKMKKKWWGRRNSSRFN  595
            EGA D++KKKWWGRRNS+RF 
Sbjct  903  EGALDRVKKKWWGRRNSARFT  923



>gb|KHN37364.1| Myosin-J heavy chain [Glycine soja]
Length=1176

 Score =   295 bits (755),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  979   LKAEAALREKEEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1038

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNASDD+  +WD+G N    E+NG + + AGLSVI +LAEEFEQRSQV
Sbjct  1039  AMDDSERNSDASVNASDDRDFSWDVGTNHRRQESNGAKSMSAGLSVISRLAEEFEQRSQV  1098

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDD+KFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVILHKLGSE+G+
Sbjct  1099  FGDDSKFLVEVKSGQVEASLNPDRELRRLKQMFEAWKKDYGARLRETKVILHKLGSEDGS  1158

Query  542   SDKMKKKWWGRRNSSRFN  595
              +K+KK WWGRRNS R +
Sbjct  1159  IEKVKKSWWGRRNSIRIS  1176



>ref|XP_003556592.1| PREDICTED: myosin-1-like [Glycine max]
Length=1176

 Score =   295 bits (755),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 176/198 (89%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  979   LKAEAALREKEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1038

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSD SVNASD++  +WD+G N    E+NG R   AGLSVI +LAEEFE RSQV
Sbjct  1039  AIDDSERNSDTSVNASDERDYSWDVGGNHRRQESNGARSTSAGLSVISRLAEEFEHRSQV  1098

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI++KLGSE+GA
Sbjct  1099  FGDDAKFLVEVKSGQVEASLNPDQELRRLKQMFEAWKKDYGARLRETKVIINKLGSEDGA  1158

Query  542   SDKMKKKWWGRRNSSRFN  595
              +KMKKKWWGRRNS+R N
Sbjct  1159  LEKMKKKWWGRRNSTRIN  1176



>gb|KHM99077.1| Myosin-J heavy chain [Glycine soja]
Length=1150

 Score =   295 bits (754),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 176/198 (89%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  953   LKAEAALREKEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1012

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSD SVNASD++  +WD+G N    E+NG R   AGLSVI +LAEEFE RSQV
Sbjct  1013  AIDDSERNSDTSVNASDERDYSWDVGGNHRRQESNGARSTSAGLSVISRLAEEFEHRSQV  1072

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI++KLGSE+GA
Sbjct  1073  FGDDAKFLVEVKSGQVEASLNPDQELRRLKQMFEAWKKDYGARLRETKVIINKLGSEDGA  1132

Query  542   SDKMKKKWWGRRNSSRFN  595
              +KMKKKWWGRRNS+R N
Sbjct  1133  LEKMKKKWWGRRNSTRIN  1150



>ref|XP_002523758.1| myosin vIII, putative [Ricinus communis]
 gb|EEF38607.1| myosin vIII, putative [Ricinus communis]
Length=1181

 Score =   295 bits (754),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 180/200 (90%), Gaps = 4/200 (2%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDIL QRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  984   LKAEAALREKEEENDILQQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1043

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNG--VRPVRAGLSVIGQLAEEFEQRS  355
             A+DDS RNSDASVNASD++   WD GNN    E+NG  VRP+ AGLSVI +LAEEFEQRS
Sbjct  1044  AIDDSERNSDASVNASDER--DWDTGNNYRGQESNGHSVRPMSAGLSVISRLAEEFEQRS  1101

Query  356   QVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEE  535
             QVFGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYGVRL+ETKVIL+KLG+EE
Sbjct  1102  QVFGDDAKFLVEVKSGQVEASLNPDRELRRLKQMFEAWKKDYGVRLRETKVILNKLGNEE  1161

Query  536   GASDKMKKKWWGRRNSSRFN  595
             GA D++KKKWWGRRNS+RF 
Sbjct  1162  GALDRVKKKWWGRRNSARFT  1181



>ref|XP_007142760.1| hypothetical protein PHAVU_007G014600g [Phaseolus vulgaris]
 gb|ESW14754.1| hypothetical protein PHAVU_007G014600g [Phaseolus vulgaris]
Length=1177

 Score =   295 bits (754),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQY++RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  980   LKAEAALREKEEENDILHQRLQQYDSRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1039

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNASD++  +WD+G N    E+NGVR + AGLSVI +LAEEFEQRSQV
Sbjct  1040  AMDDSERNSDASVNASDERDFSWDVGTNHRRQESNGVRSMSAGLSVISRLAEEFEQRSQV  1099

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDY  RL+ETKVILHKLGSE+G+
Sbjct  1100  FGDDAKFLVEVKSGQVEASLNPDRELRRLKQMFEAWKKDYNARLRETKVILHKLGSEDGS  1159

Query  542   SDKMKKKWWGRRNSSRFN  595
              DK+KK WWGRRNS+R +
Sbjct  1160  IDKVKKSWWGRRNSTRLS  1177



>ref|XP_004297721.1| PREDICTED: myosin-1-like [Fragaria vesca subsp. vesca]
Length=1168

 Score =   294 bits (752),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 175/198 (88%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  971   LKAEAALREKEEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1030

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNASDD+  +WD G+N    ++NG RP+ AGLSVI +L EEF+QRSQV
Sbjct  1031  AIDDSERNSDASVNASDDRDYSWDTGSNHRGQDSNGGRPMSAGLSVISRLTEEFDQRSQV  1090

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             F DDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKV+L KLG+EEG 
Sbjct  1091  FADDAKFLVEVKSGQVEASLNPDRELRRLKQMFEAWKKDYGARLRETKVVLTKLGNEEGN  1150

Query  542   SDKMKKKWWGRRNSSRFN  595
              D+ KKKWWGRRNSSR N
Sbjct  1151  IDRAKKKWWGRRNSSRIN  1168



>gb|KJB79823.1| hypothetical protein B456_013G068300 [Gossypium raimondii]
Length=1151

 Score =   293 bits (750),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRL QYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  954   LKAEAALREKEEENDILHQRLLQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1013

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+D+S R+SDAS+N SDD+   WD GNN    E+NG+RP+ AGLSVI +LAEEFEQRSQV
Sbjct  1014  AVDESERSSDASINTSDDREYCWDTGNNLKVPESNGLRPMSAGLSVISRLAEEFEQRSQV  1073

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  +A+LNPD ELRRLK MFE+WKKDY  RL+ETKV+L+KLG+E+GA
Sbjct  1074  FGDDAKFLVEVKSGQVDASLNPDRELRRLKQMFETWKKDYATRLRETKVVLNKLGNEDGA  1133

Query  542   SDKMKKKWWGRRNSSRFN  595
              DK+KKK+WGRRNS+R+N
Sbjct  1134  LDKVKKKFWGRRNSTRYN  1151



>ref|XP_003592738.1| Myosin-like protein [Medicago truncatula]
 gb|AES62989.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=1159

 Score =   292 bits (748),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 176/198 (89%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA LREKDEENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  962   LKAEAGLREKDEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1021

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNASDDK  +WD+GNN    E++G R + AGLSVI +LAEEFEQRSQV
Sbjct  1022  AMDDSERNSDASVNASDDKEYSWDMGNNHRRQESSGTRSMSAGLSVISRLAEEFEQRSQV  1081

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE WKKDY  RL+ETKVIL+KLGSE+G+
Sbjct  1082  FGDDAKFLVEVKSGQIEASLNPDRELRRLKQMFEGWKKDYAARLRETKVILNKLGSEDGS  1141

Query  542   SDKMKKKWWGRRNSSRFN  595
              +K KKKWWGRRNS+R +
Sbjct  1142  IEKAKKKWWGRRNSTRMS  1159



>ref|XP_002310637.2| hypothetical protein POPTR_0007s07320g [Populus trichocarpa]
 gb|EEE91087.2| hypothetical protein POPTR_0007s07320g [Populus trichocarpa]
Length=1174

 Score =   292 bits (748),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYE+RWSEYELKMKSMEE+WQKQMRSLQSSLSIAKKSL
Sbjct  977   LKAEAALREKEEENDILHQRLQQYESRWSEYELKMKSMEEMWQKQMRSLQSSLSIAKKSL  1036

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             ++DDS RNSDASVNAS+++  +WD G+N    ENNGVRP+ AGLSVI +LAEEFEQRSQV
Sbjct  1037  SVDDSERNSDASVNASEERDFSWDTGSNHRGQENNGVRPISAGLSVISRLAEEFEQRSQV  1096

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  +A++N D ELRRLK MFE+WKKDYG RL+ETK+IL+KLG++EGA
Sbjct  1097  FGDDAKFLVEVKSGQVDASMNADRELRRLKQMFEAWKKDYGSRLRETKLILNKLGTDEGA  1156

Query  542   SDKMKKKWWGRRNSSRFN  595
              D++KKKWWG+RNS+R++
Sbjct  1157  LDRVKKKWWGKRNSTRYS  1174



>gb|KJB79818.1| hypothetical protein B456_013G068300 [Gossypium raimondii]
 gb|KJB79820.1| hypothetical protein B456_013G068300 [Gossypium raimondii]
Length=1176

 Score =   292 bits (748),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRL QYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  978   LKAEAALREKEEENDILHQRLLQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1037

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+D+S R+SDAS+N SDD+   WD GNN    E+NG+RP+ AGLSVI +LAEEFEQRSQV
Sbjct  1038  AVDESERSSDASINTSDDREYCWDTGNNLKVPESNGLRPMSAGLSVISRLAEEFEQRSQV  1097

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  +A+LNPD ELRRLK MFE+WKKDY  RL+ETKV+L+KLG+E+GA
Sbjct  1098  FGDDAKFLVEVKSGQVDASLNPDRELRRLKQMFETWKKDYATRLRETKVVLNKLGNEDGA  1157

Query  542   SDKMKKKWWGRRNSSRF  592
              DK+KKK+WGRRNS+RF
Sbjct  1158  LDKVKKKFWGRRNSTRF  1174



>gb|KJB79819.1| hypothetical protein B456_013G068300 [Gossypium raimondii]
Length=1175

 Score =   292 bits (747),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRL QYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  977   LKAEAALREKEEENDILHQRLLQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1036

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+D+S R+SDAS+N SDD+   WD GNN    E+NG+RP+ AGLSVI +LAEEFEQRSQV
Sbjct  1037  AVDESERSSDASINTSDDREYCWDTGNNLKVPESNGLRPMSAGLSVISRLAEEFEQRSQV  1096

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  +A+LNPD ELRRLK MFE+WKKDY  RL+ETKV+L+KLG+E+GA
Sbjct  1097  FGDDAKFLVEVKSGQVDASLNPDRELRRLKQMFETWKKDYATRLRETKVVLNKLGNEDGA  1156

Query  542   SDKMKKKWWGRRNSSRF  592
              DK+KKK+WGRRNS+RF
Sbjct  1157  LDKVKKKFWGRRNSTRF  1173



>gb|KJB49958.1| hypothetical protein B456_008G147000 [Gossypium raimondii]
Length=1152

 Score =   291 bits (744),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQ+LQQYE+RWSEYE+KMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  955   LKAEAALREKEEENDILHQQLQQYESRWSEYEVKMKSMEEVWQKQMRSLQSSLSIAKKSL  1014

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+D+S RNSDASVN SD++   WD G+N    E+NG+RP+ AGLSVI +LAEEFEQRSQV
Sbjct  1015  AVDESERNSDASVNTSDEREYCWDTGSNHKGPESNGLRPMSAGLSVISRLAEEFEQRSQV  1074

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WKKDY VRL+ETKV+L+KLG+EEGA
Sbjct  1075  FGDDAKFLVEVKSGQGEASLNPDRELRRLKQMFETWKKDYAVRLRETKVVLNKLGNEEGA  1134

Query  542   SDKMKKKWWGRRNSSR  589
              D++KKKWWGRRNS+R
Sbjct  1135  LDRVKKKWWGRRNSTR  1150



>gb|KJB79821.1| hypothetical protein B456_013G068300 [Gossypium raimondii]
Length=1199

 Score =   290 bits (741),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRL QYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  978   LKAEAALREKEEENDILHQRLLQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1037

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+D+S R+SDAS+N SDD+   WD GNN    E+NG+RP+ AGLSVI +LAEEFEQRSQV
Sbjct  1038  AVDESERSSDASINTSDDREYCWDTGNNLKVPESNGLRPMSAGLSVISRLAEEFEQRSQV  1097

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  +A+LNPD ELRRLK MFE+WKKDY  RL+ETKV+L+KLG+E+GA
Sbjct  1098  FGDDAKFLVEVKSGQVDASLNPDRELRRLKQMFETWKKDYATRLRETKVVLNKLGNEDGA  1157

Query  542   SDKMKKKWWGRRNSSR  589
              DK+KKK+WGRRNS+R
Sbjct  1158  LDKVKKKFWGRRNSTR  1173



>gb|KJB79822.1| hypothetical protein B456_013G068300 [Gossypium raimondii]
Length=1198

 Score =   289 bits (740),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRL QYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  977   LKAEAALREKEEENDILHQRLLQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1036

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+D+S R+SDAS+N SDD+   WD GNN    E+NG+RP+ AGLSVI +LAEEFEQRSQV
Sbjct  1037  AVDESERSSDASINTSDDREYCWDTGNNLKVPESNGLRPMSAGLSVISRLAEEFEQRSQV  1096

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  +A+LNPD ELRRLK MFE+WKKDY  RL+ETKV+L+KLG+E+GA
Sbjct  1097  FGDDAKFLVEVKSGQVDASLNPDRELRRLKQMFETWKKDYATRLRETKVVLNKLGNEDGA  1156

Query  542   SDKMKKKWWGRRNSSR  589
              DK+KKK+WGRRNS+R
Sbjct  1157  LDKVKKKFWGRRNSTR  1172



>ref|XP_007153036.1| hypothetical protein PHAVU_003G002200g [Phaseolus vulgaris]
 ref|XP_007153037.1| hypothetical protein PHAVU_003G002200g [Phaseolus vulgaris]
 gb|ESW25030.1| hypothetical protein PHAVU_003G002200g [Phaseolus vulgaris]
 gb|ESW25031.1| hypothetical protein PHAVU_003G002200g [Phaseolus vulgaris]
Length=1194

 Score =   288 bits (737),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 176/198 (89%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK++ENDI+ QRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  997   LKAEAALREKEDENDIIRQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1056

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNASD++  +WD+G N    E+NG R   AGLSVI +LAEEFE RSQV
Sbjct  1057  AIDDSERNSDASVNASDERDYSWDVGGNHRRQESNGARSTSAGLSVISRLAEEFEHRSQV  1116

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EA+L+PD ELRRLK MFE+WKKDYG RL+ETKVIL+KLG+E+GA
Sbjct  1117  FGDDAKFLVEVKSGQVEASLSPDQELRRLKQMFEAWKKDYGTRLRETKVILNKLGNEDGA  1176

Query  542   SDKMKKKWWGRRNSSRFN  595
              +KMKKKWWGRRNS+R N
Sbjct  1177  LEKMKKKWWGRRNSTRIN  1194



>ref|XP_003589756.1| LRR receptor-like protein kinase [Medicago truncatula]
Length=671

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 154/199 (77%), Positives = 176/199 (88%), Gaps = 1/199 (1%)
 Frame = +2

Query  2    LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
            L+AEAALREKDEENDIL+QR+QQYENRWSEYELKMKSME+VWQKQMRSLQSSLSIAKKSL
Sbjct  473  LKAEAALREKDEENDILNQRIQQYENRWSEYELKMKSMEDVWQKQMRSLQSSLSIAKKSL  532

Query  182  alDDSARNSDASVN-ASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQ  358
            A+DDS RNSDASVN ASD++  +WD G+N    E+NG R   A LSVI +LAEEFEQRSQ
Sbjct  533  AIDDSDRNSDASVNNASDERDYSWDAGSNHRRQESNGTRSTSASLSVISRLAEEFEQRSQ  592

Query  359  VFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEG  538
            VFGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WK+DYG RL+ETK+I++KLG+E+ 
Sbjct  593  VFGDDAKFLVEVKSGQAEASLNPDQELRRLKQMFEAWKRDYGARLRETKLIINKLGTEDS  652

Query  539  ASDKMKKKWWGRRNSSRFN  595
            A +KMKKKWWGRRNS+R N
Sbjct  653  ALEKMKKKWWGRRNSTRIN  671



>ref|XP_004498109.1| PREDICTED: myosin-J heavy chain-like [Cicer arietinum]
Length=1174

 Score =   285 bits (730),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDIL+QR+QQYE+RWSEYELKM+SMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  977   LKAEAALREKEEENDILNQRIQQYESRWSEYELKMQSMEEVWQKQMRSLQSSLSIAKKSL  1036

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             A+DDS RNSDASVNASD++  +W++G+N    E+NG R   A LSVI +LAEEFEQRSQV
Sbjct  1037  AIDDSERNSDASVNASDERDYSWEVGSNHRRQESNGTRSTSASLSVISRLAEEFEQRSQV  1096

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             F DDAKFLVEVKSG  EA+LNPD ELRRLK MFESWK+DYG RL+ETK+I++KLGSE+GA
Sbjct  1097  FSDDAKFLVEVKSGQAEASLNPDQELRRLKQMFESWKRDYGARLRETKLIINKLGSEDGA  1156

Query  542   SDKMKKKWWGRRNSSRFN  595
              +KMKKKWWGRRNS+R N
Sbjct  1157  LEKMKKKWWGRRNSTRIN  1174



>ref|XP_011070461.1| PREDICTED: myosin-1 [Sesamum indicum]
Length=1163

 Score =   283 bits (723),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 178/199 (89%), Gaps = 1/199 (1%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             LRAEA+LREK+EENDILHQRLQQYENRWSEYELKM+SMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  965   LRAEASLREKEEENDILHQRLQQYENRWSEYELKMRSMEEVWQKQMRSLQSSLSIAKKSL  1024

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             ALDDS RNSDASVN +D+K ++W+  NN    ENN  R + AG+SVI +LAEEFEQRSQV
Sbjct  1025  ALDDSQRNSDASVNGNDEKETSWETHNNFRLHENNRGRSMSAGISVITRLAEEFEQRSQV  1084

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA  541
             FGDDAKFLVEVKSG  EA+L+PD ELRRLK MFE+WKKDYG RL+ETKVIL+KLG+EEG+
Sbjct  1085  FGDDAKFLVEVKSGQAEASLDPDSELRRLKQMFEAWKKDYGARLRETKVILNKLGNEEGS  1144

Query  542   S-DKMKKKWWGRRNSSRFN  595
             S DK++KKWWGRRNS+R N
Sbjct  1145  SADKVRKKWWGRRNSTRMN  1163



>gb|KEH40947.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=1169

 Score =   282 bits (721),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 154/199 (77%), Positives = 176/199 (88%), Gaps = 1/199 (1%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREKDEENDIL+QR+QQYENRWSEYELKMKSME+VWQKQMRSLQSSLSIAKKSL
Sbjct  971   LKAEAALREKDEENDILNQRIQQYENRWSEYELKMKSMEDVWQKQMRSLQSSLSIAKKSL  1030

Query  182   alDDSARNSDASVN-ASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQ  358
             A+DDS RNSDASVN ASD++  +WD G+N    E+NG R   A LSVI +LAEEFEQRSQ
Sbjct  1031  AIDDSDRNSDASVNNASDERDYSWDAGSNHRRQESNGTRSTSASLSVISRLAEEFEQRSQ  1090

Query  359   VFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEG  538
             VFGDDAKFLVEVKSG  EA+LNPD ELRRLK MFE+WK+DYG RL+ETK+I++KLG+E+ 
Sbjct  1091  VFGDDAKFLVEVKSGQAEASLNPDQELRRLKQMFEAWKRDYGARLRETKLIINKLGTEDS  1150

Query  539   ASDKMKKKWWGRRNSSRFN  595
             A +KMKKKWWGRRNS+R N
Sbjct  1151  ALEKMKKKWWGRRNSTRIN  1169



>gb|AAB71526.1| unconventional myosin [Helianthus annuus]
Length=1120

 Score =   279 bits (713),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 170/201 (85%), Gaps = 5/201 (2%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA LREK+EENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  922   LKAEAGLREKEEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  981

Query  182   alDDSARNSDASVN-ASDDKGSTWDIGNN--RTALENNGVRPVRAGLSVIGQLAEEFEQR  352
             + DDS RNSDAS+N A+D+    WD   N  R  +EN  VRP+ AGLSVI +LAEEFEQR
Sbjct  982   SYDDSERNSDASINTANDETNPPWDAATNGRRNGVEN--VRPMSAGLSVISRLAEEFEQR  1039

Query  353   SQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSE  532
             SQVFGDDAKFLVEVKSG  EANLNPDHELRRLK MFE WKKDY  RL+ETKVIL+KLG E
Sbjct  1040  SQVFGDDAKFLVEVKSGQVEANLNPDHELRRLKQMFEGWKKDYTARLRETKVILNKLGHE  1099

Query  533   EGASDKMKKKWWGRRNSSRFN  595
             +G  +K KKKWWGR NSSR N
Sbjct  1100  DGDGEKGKKKWWGRLNSSRVN  1120



>ref|XP_010279450.1| PREDICTED: myosin-1-like [Nelumbo nucifera]
Length=1327

 Score =   278 bits (711),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 177/207 (86%), Gaps = 9/207 (4%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQM SLQSSLSIAKKSL
Sbjct  1121  LKAEAALREKEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMSSLQSSLSIAKKSL  1180

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRT-ALENNGVRP--------VRAGLSVIGQLA  334
              +DD+ R SDASVNA+DD+   WD+GNN +   ENNG+RP        + AGLSVI +LA
Sbjct  1181  VIDDAERKSDASVNATDDREHNWDLGNNNSKGQENNGLRPGPQILDREMSAGLSVISRLA  1240

Query  335   EEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVIL  514
             EEFEQRSQVFGDDAKFLVEVKSG  EA++NPD ELRRLK +FE+WKKDYG RL+ETKVIL
Sbjct  1241  EEFEQRSQVFGDDAKFLVEVKSGQAEASINPDRELRRLKQIFEAWKKDYGARLRETKVIL  1300

Query  515   HKLGSEEGASDKMKKKWWGRRNSSRFN  595
             HKLG+  G+++K +KKWWGRRNSSR N
Sbjct  1301  HKLGNGAGSAEKGRKKWWGRRNSSRIN  1327



>ref|XP_010688651.1| PREDICTED: myosin-1-like [Beta vulgaris subsp. vulgaris]
Length=1178

 Score =   276 bits (706),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 176/200 (88%), Gaps = 2/200 (1%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EEN+ILHQRL+QYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  979   LKAEAALREKEEENEILHQRLRQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1038

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRT--ALENNGVRPVRAGLSVIGQLAEEFEQRS  355
             A+DDSARNSDASVNAS+++  + D G N T  + E+NGVRP+ A LSVI ++AEEFEQR 
Sbjct  1039  AVDDSARNSDASVNASEEREYSGDTGGNITLRSHESNGVRPMSASLSVISRMAEEFEQRK  1098

Query  356   QVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEE  535
             QVFGDDAKFLVEVKSG  +A+LNPD ELRRLK MFE+WKKDYG RL+ETKVIL+KL +EE
Sbjct  1099  QVFGDDAKFLVEVKSGQVDASLNPDRELRRLKQMFETWKKDYGTRLRETKVILNKLDNEE  1158

Query  536   GASDKMKKKWWGRRNSSRFN  595
                +K+KKKWW RRNS+R +
Sbjct  1159  KVGEKLKKKWWTRRNSTRLS  1178



>ref|XP_002883217.1| hypothetical protein ARALYDRAFT_479514 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59476.1| hypothetical protein ARALYDRAFT_479514 [Arabidopsis lyrata subsp. 
lyrata]
Length=1166

 Score =   273 bits (699),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 177/204 (87%), Gaps = 9/204 (4%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSL
Sbjct  965   LKAEAALREKEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSL  1024

Query  182   alDDSARNSDASVNASDDKGSTWDIGNN--RTALENNG---VRPVRAGLSVIGQLAEEFE  346
             A++DSARNSDASVNASD   + WD  +N  R+   N G   ++P+ AGLSVIG+LAEEFE
Sbjct  1025  AVEDSARNSDASVNASD--ATDWDSSSNQFRSQTSNGGGPRLQPMSAGLSVIGRLAEEFE  1082

Query  347   QRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLG  526
             QR+QVFGDDAKFLVEVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+IL KLG
Sbjct  1083  QRAQVFGDDAKFLVEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKLILSKLG  1142

Query  527   SEE--GASDKMKKKWWGRRNSSRF  592
             SEE  G+ +K+K+KWWGRRNS+R+
Sbjct  1143  SEESSGSMEKVKRKWWGRRNSTRY  1166



>ref|XP_010249396.1| PREDICTED: myosin-1-like [Nelumbo nucifera]
Length=1280

 Score =   273 bits (698),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 174/206 (84%), Gaps = 9/206 (4%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAA REK+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLS+A+KSL
Sbjct  1074  LKAEAAFREKEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSVARKSL  1133

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRT-ALENNGVR--------PVRAGLSVIGQLA  334
             A+DD+ R+S +SV  + D+  +WD+G+N     EN+G+R         + AGLSVI +LA
Sbjct  1134  AVDDTERSSGSSVTVAHDRAYSWDLGSNSNKGRENSGLRLGSRFLEREMSAGLSVISRLA  1193

Query  335   EEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVIL  514
             EEFEQRSQVFGDDAKFLVEVKSG  EA+LNPD ELRRLK +FE+WKKDYG RL+ETKVIL
Sbjct  1194  EEFEQRSQVFGDDAKFLVEVKSGQAEASLNPDQELRRLKQIFEAWKKDYGARLRETKVIL  1253

Query  515   HKLGSEEGASDKMKKKWWGRRNSSRF  592
             HKLGSEEG ++K KKKWWGRRNSSR 
Sbjct  1254  HKLGSEEGNNEKAKKKWWGRRNSSRI  1279



>ref|XP_006296853.1| hypothetical protein CARUB_v10012840mg [Capsella rubella]
 gb|EOA29751.1| hypothetical protein CARUB_v10012840mg [Capsella rubella]
Length=1182

 Score =   272 bits (695),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 176/204 (86%), Gaps = 9/204 (4%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSL
Sbjct  981   LKAEAALREKEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSL  1040

Query  182   alDDSARNSDASVNASDDKGSTWDIGNN--RTALENNG---VRPVRAGLSVIGQLAEEFE  346
             A++DSARNSDASVNASD   + WD  +N  R+   N G   ++P+ AGLSVIG+LAEEFE
Sbjct  1041  AVEDSARNSDASVNASD--ATDWDSSSNQFRSQTSNGGGSRLQPMSAGLSVIGRLAEEFE  1098

Query  347   QRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLG  526
             QR+QVFGDD KFLVEVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+IL KLG
Sbjct  1099  QRAQVFGDDVKFLVEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKLILSKLG  1158

Query  527   SEE--GASDKMKKKWWGRRNSSRF  592
             SEE  G+ +K+K+KWWGRRNS+R+
Sbjct  1159  SEESSGSMEKVKRKWWGRRNSTRY  1182



>ref|XP_010508266.1| PREDICTED: myosin-1-like [Camelina sativa]
 ref|XP_010508273.1| PREDICTED: myosin-1-like [Camelina sativa]
 ref|XP_010508281.1| PREDICTED: myosin-1-like [Camelina sativa]
 ref|XP_010508289.1| PREDICTED: myosin-1-like [Camelina sativa]
Length=1168

 Score =   272 bits (695),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 176/204 (86%), Gaps = 9/204 (4%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSL
Sbjct  967   LKAEAALREKEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSL  1026

Query  182   alDDSARNSDASVNASDDKGSTWDIGNN--RTALENNG---VRPVRAGLSVIGQLAEEFE  346
             A++DSARNSDASVNASD   + WD  +N  R+   N G   ++P+ AGLSVIG+LAEEFE
Sbjct  1027  AVEDSARNSDASVNASD--ATDWDSSSNQFRSQTSNGGGSRLQPMSAGLSVIGRLAEEFE  1084

Query  347   QRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLG  526
             QR+QVFGDD KFLVEVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+IL KLG
Sbjct  1085  QRAQVFGDDVKFLVEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKLILSKLG  1144

Query  527   SEE--GASDKMKKKWWGRRNSSRF  592
             SEE  G+ +K+K+KWWGRRNS+R+
Sbjct  1145  SEESSGSMEKVKRKWWGRRNSTRY  1168



>ref|XP_010487954.1| PREDICTED: myosin-1-like [Camelina sativa]
Length=1168

 Score =   272 bits (695),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 176/204 (86%), Gaps = 9/204 (4%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSL
Sbjct  967   LKAEAALREKEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSL  1026

Query  182   alDDSARNSDASVNASDDKGSTWDIGNN--RTALENNG---VRPVRAGLSVIGQLAEEFE  346
             A++DSARNSDASVNASD   + WD  +N  R+   N G   ++P+ AGLSVIG+LAEEFE
Sbjct  1027  AVEDSARNSDASVNASD--ATDWDSSSNQFRSQTSNGGGSRLQPMSAGLSVIGRLAEEFE  1084

Query  347   QRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLG  526
             QR+QVFGDD KFLVEVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+IL KLG
Sbjct  1085  QRAQVFGDDVKFLVEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKLILSKLG  1144

Query  527   SEE--GASDKMKKKWWGRRNSSRF  592
             SEE  G+ +K+K+KWWGRRNS+R+
Sbjct  1145  SEESSGSMEKVKRKWWGRRNSTRY  1168



>ref|XP_006406435.1| hypothetical protein EUTSA_v10019925mg [Eutrema salsugineum]
 gb|ESQ47888.1| hypothetical protein EUTSA_v10019925mg [Eutrema salsugineum]
Length=1205

 Score =   272 bits (695),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 176/205 (86%), Gaps = 10/205 (5%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSL
Sbjct  1003  LKAEAALREKEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSL  1062

Query  182   alDDSARNSDASVNASDDKGSTWDIGNN--RTALENNG----VRPVRAGLSVIGQLAEEF  343
             A++DSARNSDASVNASD   + WD  +N  R+   N G     +P+ AGLSVIG+LAEEF
Sbjct  1063  AVEDSARNSDASVNASD--ATDWDSSSNHFRSQTSNGGGSRQQQPMSAGLSVIGRLAEEF  1120

Query  344   EQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKL  523
             EQR+QVFGDDAKFLVEVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+IL KL
Sbjct  1121  EQRAQVFGDDAKFLVEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKLILSKL  1180

Query  524   GSEEGAS--DKMKKKWWGRRNSSRF  592
             GSEEG+   +K+K+KWWGRRNS+R+
Sbjct  1181  GSEEGSGSMEKVKRKWWGRRNSTRY  1205



>ref|XP_010466165.1| PREDICTED: myosin-1 [Camelina sativa]
Length=1166

 Score =   271 bits (694),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 176/204 (86%), Gaps = 9/204 (4%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSL
Sbjct  965   LKAEAALREKEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSL  1024

Query  182   alDDSARNSDASVNASDDKGSTWDIGNN--RTALENNG---VRPVRAGLSVIGQLAEEFE  346
             A++DSARNSDASVNASD   + WD  +N  R+   N G   ++P+ AGLSVIG+LAEEFE
Sbjct  1025  AVEDSARNSDASVNASD--ATDWDSSSNQFRSQASNGGGSRLQPMSAGLSVIGRLAEEFE  1082

Query  347   QRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLG  526
             QR+QVFGDD KFLVEVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+IL KLG
Sbjct  1083  QRAQVFGDDVKFLVEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKLILSKLG  1142

Query  527   SEE--GASDKMKKKWWGRRNSSRF  592
             SEE  G+ +K+K+KWWGRRNS+R+
Sbjct  1143  SEESSGSMEKVKRKWWGRRNSTRY  1166



>emb|CAB61875.1| myosin [Arabidopsis thaliana]
Length=1166

 Score =   270 bits (691),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 178/204 (87%), Gaps = 9/204 (4%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSL
Sbjct  965   LKAEAALREKEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSL  1024

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRT-ALENNGV----RPVRAGLSVIGQLAEEFE  346
             A++DSARNSDASVNASD   + WD  +N+  +  +NGV    +P+ AGLSVIG+LAEEFE
Sbjct  1025  AVEDSARNSDASVNASD--ATDWDSSSNQFRSQTSNGVGSRLQPMSAGLSVIGRLAEEFE  1082

Query  347   QRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLG  526
             QR+QVFGDDAKFLVEVKSG  EANL+PD ELRRLK MFE+WKKDYG RL+ETK+IL KLG
Sbjct  1083  QRAQVFGDDAKFLVEVKSGQVEANLDPDRELRRLKQMFETWKKDYGGRLRETKLILSKLG  1142

Query  527   SEE--GASDKMKKKWWGRRNSSRF  592
             SEE  G+ +K+K+KWWGRRNS+R+
Sbjct  1143  SEESSGSMEKVKRKWWGRRNSTRY  1166



>ref|NP_188630.1| myosin 1 [Arabidopsis thaliana]
 sp|Q9LHE9.1|MYO1_ARATH RecName: Full=Myosin-1; AltName: Full=AtATM1 [Arabidopsis thaliana]
 dbj|BAB03161.1| myosin-like protein [Arabidopsis thaliana]
 gb|AAN71940.1| putative myosin [Arabidopsis thaliana]
 gb|AEE76312.1| myosin 1 [Arabidopsis thaliana]
Length=1166

 Score =   270 bits (691),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 178/204 (87%), Gaps = 9/204 (4%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSL
Sbjct  965   LKAEAALREKEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSL  1024

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRT-ALENNGV----RPVRAGLSVIGQLAEEFE  346
             A++DSARNSDASVNASD   + WD  +N+  +  +NGV    +P+ AGLSVIG+LAEEFE
Sbjct  1025  AVEDSARNSDASVNASD--ATDWDSSSNQFRSQTSNGVGSRLQPMSAGLSVIGRLAEEFE  1082

Query  347   QRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLG  526
             QR+QVFGDDAKFLVEVKSG  EANL+PD ELRRLK MFE+WKKDYG RL+ETK+IL KLG
Sbjct  1083  QRAQVFGDDAKFLVEVKSGQVEANLDPDRELRRLKQMFETWKKDYGGRLRETKLILSKLG  1142

Query  527   SEE--GASDKMKKKWWGRRNSSRF  592
             SEE  G+ +K+K+KWWGRRNS+R+
Sbjct  1143  SEESSGSMEKVKRKWWGRRNSTRY  1166



>gb|AAM14075.1| putative myosin [Arabidopsis thaliana]
Length=1166

 Score =   270 bits (691),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 178/204 (87%), Gaps = 9/204 (4%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSL
Sbjct  965   LKAEAALREKEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSL  1024

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRT-ALENNGV----RPVRAGLSVIGQLAEEFE  346
             A++DSARNSDASVNASD   + WD  +N+  +  +NGV    +P+ AGLSVIG+LAEEFE
Sbjct  1025  AVEDSARNSDASVNASD--ATDWDSSSNQFRSQTSNGVGSRLQPMSAGLSVIGRLAEEFE  1082

Query  347   QRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLG  526
             QR+QVFGDDAKFLVEVKSG  EANL+PD ELRRLK MFE+WKKDYG RL+ETK+IL KLG
Sbjct  1083  QRAQVFGDDAKFLVEVKSGQVEANLDPDRELRRLKQMFETWKKDYGGRLRETKLILSKLG  1142

Query  527   SEE--GASDKMKKKWWGRRNSSRF  592
             SEE  G+ +K+K+KWWGRRNS+R+
Sbjct  1143  SEESSGSMEKVKRKWWGRRNSTRY  1166



>ref|NP_001154628.2| myosin 1 [Arabidopsis thaliana]
 gb|AEE76313.1| myosin 1 [Arabidopsis thaliana]
Length=1176

 Score =   270 bits (691),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 178/204 (87%), Gaps = 9/204 (4%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSL
Sbjct  975   LKAEAALREKEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSL  1034

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRT-ALENNGV----RPVRAGLSVIGQLAEEFE  346
             A++DSARNSDASVNASD   + WD  +N+  +  +NGV    +P+ AGLSVIG+LAEEFE
Sbjct  1035  AVEDSARNSDASVNASD--ATDWDSSSNQFRSQTSNGVGSRLQPMSAGLSVIGRLAEEFE  1092

Query  347   QRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLG  526
             QR+QVFGDDAKFLVEVKSG  EANL+PD ELRRLK MFE+WKKDYG RL+ETK+IL KLG
Sbjct  1093  QRAQVFGDDAKFLVEVKSGQVEANLDPDRELRRLKQMFETWKKDYGGRLRETKLILSKLG  1152

Query  527   SEE--GASDKMKKKWWGRRNSSRF  592
             SEE  G+ +K+K+KWWGRRNS+R+
Sbjct  1153  SEESSGSMEKVKRKWWGRRNSTRY  1176



>ref|XP_010523208.1| PREDICTED: myosin-1-like [Tarenaya hassleriana]
Length=1176

 Score =   268 bits (685),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 151/201 (75%), Positives = 172/201 (86%), Gaps = 6/201 (3%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAK+SL
Sbjct  977   LKAEAALREKEEENDILKQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKRSL  1036

Query  182   a-lDDSARNSDASVNASDDKGSTWD-IGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRS  355
                +DS RNSDASVNASD  G+ WD  GN R+   N G RP+ AGLSVI +LAEEFEQR+
Sbjct  1037  GGANDSERNSDASVNASD--GTDWDSAGNFRSQTSNGGTRPMSAGLSVISRLAEEFEQRA  1094

Query  356   QVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEE  535
             QVFGDDAKFLVEVKSG  EANL PD ELRRLK MFE WKKDYG RL+ETKVIL+KLG++E
Sbjct  1095  QVFGDDAKFLVEVKSGQVEANLYPDRELRRLKEMFEKWKKDYGTRLRETKVILNKLGNDE  1154

Query  536   --GASDKMKKKWWGRRNSSRF  592
               G+ +++K+KWWGRRNS+R+
Sbjct  1155  SGGSLERVKRKWWGRRNSTRY  1175



>ref|XP_009135657.1| PREDICTED: myosin-1-like [Brassica rapa]
Length=1136

 Score =   266 bits (681),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 174/203 (86%), Gaps = 8/203 (4%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L++EAALREK+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSL
Sbjct  936   LKSEAALREKEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSL  995

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNR----TALENNGVRPVRAGLSVIGQLAEEFEQ  349
             A++DSARNSDASVNASD   + WD  +N+       +    RP+ AGLSVIG+LAEEFEQ
Sbjct  996   AVEDSARNSDASVNASD--ATDWDSSSNQFKGGGGRQQQQQRPMSAGLSVIGRLAEEFEQ  1053

Query  350   RSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGS  529
             R+QVFGDDAKFLVEVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+IL KLGS
Sbjct  1054  RAQVFGDDAKFLVEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKMILSKLGS  1113

Query  530   EE--GASDKMKKKWWGRRNSSRF  592
             EE  G+ +K+K+KWWGRRNS+R+
Sbjct  1114  EESGGSMEKVKRKWWGRRNSTRY  1136



>emb|CDX82270.1| BnaA03g35510D [Brassica napus]
Length=1196

 Score =   267 bits (682),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 174/203 (86%), Gaps = 8/203 (4%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L++EAALREK+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSL
Sbjct  996   LKSEAALREKEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSL  1055

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNR----TALENNGVRPVRAGLSVIGQLAEEFEQ  349
             A++DSARNSDASVNASD   + WD  +N+       +    RP+ AGLSVIG+LAEEFEQ
Sbjct  1056  AVEDSARNSDASVNASD--ATDWDSSSNQFKGGGGRQQQQQRPMSAGLSVIGRLAEEFEQ  1113

Query  350   RSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGS  529
             R+QVFGDDAKFLVEVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+IL KLGS
Sbjct  1114  RAQVFGDDAKFLVEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKMILSKLGS  1173

Query  530   EE--GASDKMKKKWWGRRNSSRF  592
             EE  G+ +K+K+KWWGRRNS+R+
Sbjct  1174  EESGGSMEKVKRKWWGRRNSTRY  1196



>ref|XP_010557555.1| PREDICTED: myosin-1-like [Tarenaya hassleriana]
 ref|XP_010557556.1| PREDICTED: myosin-1-like [Tarenaya hassleriana]
Length=1171

 Score =   266 bits (681),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 150/201 (75%), Positives = 169/201 (84%), Gaps = 6/201 (3%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA LREK+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAK+ L
Sbjct  972   LKAEAGLREKEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKRGL  1031

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNG--VRPVRAGLSVIGQLAEEFEQRS  355
             A DDS RNSDASVNASD  G+  D  +N  A  +NG   RP+ AGLSVIG++AEEF QRS
Sbjct  1032  AADDSERNSDASVNASD--GTDLDSASNFRAQTSNGGGTRPMSAGLSVIGRMAEEFGQRS  1089

Query  356   QVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEE  535
             QVF DDAKFLVEVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+IL KLG+EE
Sbjct  1090  QVFSDDAKFLVEVKSGQVEANLNPDMELRRLKQMFEAWKKDYGARLRETKLILGKLGNEE  1149

Query  536   GAS--DKMKKKWWGRRNSSRF  592
               S  +K+K+KWWGRRNS+R+
Sbjct  1150  SGSSVEKVKRKWWGRRNSTRY  1170



>emb|CDY36068.1| BnaC03g41300D [Brassica napus]
Length=1133

 Score =   265 bits (676),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 152/209 (73%), Positives = 175/209 (84%), Gaps = 17/209 (8%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L++EAALREK+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSL
Sbjct  930   LKSEAALREKEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSL  989

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENN----------GVRPVRAGLSVIGQL  331
             A+++SARNSDASVNASD     WD G+N+   + +            RP+ AGLSVIG+L
Sbjct  990   AVENSARNSDASVNASD-----WDSGSNQLKSQTSKGGGGERQQQQQRPMSAGLSVIGRL  1044

Query  332   AEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVI  511
             AEEFEQR+QVFGDDAKFLVEVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+I
Sbjct  1045  AEEFEQRAQVFGDDAKFLVEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKMI  1104

Query  512   LHKLGSEE--GASDKMKKKWWGRRNSSRF  592
             L KLGSEE  G+ +K+K+KWWGRRNS+R+
Sbjct  1105  LSKLGSEESGGSMEKVKRKWWGRRNSTRY  1133



>emb|CDY25361.1| BnaA05g19230D [Brassica napus]
Length=1549

 Score =   266 bits (679),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 174/206 (84%), Gaps = 11/206 (5%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L++EAALREK+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSL
Sbjct  1346  LKSEAALREKEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSL  1405

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVR-------PVRAGLSVIGQLAEE  340
             A++DSARNSDASVNASD   + WD  +N+   + +          P+ AGLSVIG+LAEE
Sbjct  1406  AVEDSARNSDASVNASD--ATDWDSSSNQFKSQASNGGGGRQQQQPMSAGLSVIGRLAEE  1463

Query  341   FEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHK  520
             FEQR+QVFGDDAKFLVEVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+IL K
Sbjct  1464  FEQRAQVFGDDAKFLVEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKMILSK  1523

Query  521   LGSEE--GASDKMKKKWWGRRNSSRF  592
             LGSEE  G+ +K+K+KWWGRRNS+R+
Sbjct  1524  LGSEESSGSMEKVKRKWWGRRNSTRY  1549


 Score =   169 bits (429),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 119/141 (84%), Gaps = 9/141 (6%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L++EAALREK+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSL
Sbjct  956   LKSEAALREKEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSL  1015

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNG-------VRPVRAGLSVIGQLAEE  340
             A++DSARNSDASVNASD   + WD  +N+   + +         +P+ AGLSVIG+LAEE
Sbjct  1016  AVEDSARNSDASVNASD--ATDWDSSSNQFKSQASNGGGGRQQQQPMSAGLSVIGRLAEE  1073

Query  341   FEQRSQVFGDDAKFLVEVKSG  403
             FEQR+QVFGDDAKFLVEVKSG
Sbjct  1074  FEQRAQVFGDDAKFLVEVKSG  1094



>emb|CDY24591.1| BnaC05g32750D [Brassica napus]
Length=1159

 Score =   263 bits (673),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 174/206 (84%), Gaps = 11/206 (5%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L++EAALREK+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSL
Sbjct  956   LKSEAALREKEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSL  1015

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVR-------PVRAGLSVIGQLAEE  340
             A++DSARNSDASVNASD   + WD  +N+   + +          P+ AGLSVIG+LAEE
Sbjct  1016  AVEDSARNSDASVNASD--ATDWDSSSNQFKSQASNGGGGRQQQQPMSAGLSVIGRLAEE  1073

Query  341   FEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHK  520
             FEQR+QVFGDDAKFLVEVKSG  EANLNP+ ELRRLK MFE+WKKDYG RL+ETK+IL K
Sbjct  1074  FEQRAQVFGDDAKFLVEVKSGQVEANLNPERELRRLKQMFETWKKDYGGRLRETKMILSK  1133

Query  521   LGSEE--GASDKMKKKWWGRRNSSRF  592
             LGSEE  G+ +K+K+KWWGRRNS+R+
Sbjct  1134  LGSEESGGSMEKVKRKWWGRRNSTRY  1159



>ref|XP_009145709.1| PREDICTED: myosin-1 isoform X2 [Brassica rapa]
Length=1146

 Score =   262 bits (670),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 172/206 (83%), Gaps = 11/206 (5%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L++EAALREK+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSL
Sbjct  943   LKSEAALREKEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSL  1002

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVR-------PVRAGLSVIGQLAEE  340
             A +DSAR SDASVNASD   + WD  +N+   + +          P+ AGLSVIG+LAEE
Sbjct  1003  AFEDSARYSDASVNASD--ATDWDSSSNQFKSQASNGGGGRQQQQPMSAGLSVIGRLAEE  1060

Query  341   FEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHK  520
             FEQR+QVFGDDAKFLVEVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+IL K
Sbjct  1061  FEQRAQVFGDDAKFLVEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKMILSK  1120

Query  521   LGSEE--GASDKMKKKWWGRRNSSRF  592
             LGSEE  G+ +K+K+KWWGRRNS+R+
Sbjct  1121  LGSEESSGSMEKVKRKWWGRRNSTRY  1146



>ref|XP_009145706.1| PREDICTED: myosin-1 isoform X1 [Brassica rapa]
 ref|XP_009145708.1| PREDICTED: myosin-1 isoform X1 [Brassica rapa]
Length=1180

 Score =   262 bits (670),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 172/206 (83%), Gaps = 11/206 (5%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L++EAALREK+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSL
Sbjct  977   LKSEAALREKEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSL  1036

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVR-------PVRAGLSVIGQLAEE  340
             A +DSAR SDASVNASD   + WD  +N+   + +          P+ AGLSVIG+LAEE
Sbjct  1037  AFEDSARYSDASVNASD--ATDWDSSSNQFKSQASNGGGGRQQQQPMSAGLSVIGRLAEE  1094

Query  341   FEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHK  520
             FEQR+QVFGDDAKFLVEVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+IL K
Sbjct  1095  FEQRAQVFGDDAKFLVEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKMILSK  1154

Query  521   LGSEE--GASDKMKKKWWGRRNSSRF  592
             LGSEE  G+ +K+K+KWWGRRNS+R+
Sbjct  1155  LGSEESSGSMEKVKRKWWGRRNSTRY  1180



>gb|EYU39409.1| hypothetical protein MIMGU_mgv1a000419mg [Erythranthe guttata]
Length=1168

 Score =   253 bits (646),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 170/205 (83%), Gaps = 7/205 (3%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             LRAEAALR K+EENDILHQRLQQY+NRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  964   LRAEAALRVKEEENDILHQRLQQYDNRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL  1023

Query  182   alDD-SARNSDASVNASDDK---GSTWDIGNN-RTALENNGVRPVRA-GLSVIGQLAEEF  343
             + DD S RNSDASVN ++D+    S+WD G   R    +NG R   + GL+VI +LA+EF
Sbjct  1024  SFDDNSHRNSDASVNGNNDERDSSSSWDTGGILRIHQSSNGGRSAASPGLTVISRLAQEF  1083

Query  344   EQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKL  523
             EQRSQ+FGDDAKFLVEVKSG TEA+L+PD ELRRLK MFE WKKDYG RL+ETK+IL+KL
Sbjct  1084  EQRSQIFGDDAKFLVEVKSGQTEASLDPDRELRRLKQMFEGWKKDYGSRLRETKLILNKL  1143

Query  524   GSEEGAS-DKMKKKWWGRRNSSRFN  595
             GSE G+S  K + KWWGR NSSR N
Sbjct  1144  GSENGSSAGKPRNKWWGRMNSSRMN  1168



>ref|XP_002891568.1| hypothetical protein ARALYDRAFT_474163 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67827.1| hypothetical protein ARALYDRAFT_474163 [Arabidopsis lyrata subsp. 
lyrata]
Length=1153

 Score =   252 bits (643),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 166/204 (81%), Gaps = 14/204 (7%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             LR EAALREK+EENDIL QRLQQY+NRWSEYE KMKSMEE+WQ+QM+SLQSSLSIAKKSL
Sbjct  957   LRTEAALREKEEENDILRQRLQQYDNRWSEYETKMKSMEEIWQRQMKSLQSSLSIAKKSL  1016

Query  182   alDDSARNSDASVNASD-----DKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFE  346
              +DDSARNSDASVNASD       GS + +G+ R+       R V  GLSVI +LAEEF 
Sbjct  1017  EVDDSARNSDASVNASDATDLDSGGSHYQMGHGRS-------RSVGVGLSVISRLAEEFG  1069

Query  347   QRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLG  526
             QR+QVFGDD KFL+EVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+IL KLG
Sbjct  1070  QRAQVFGDDRKFLMEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKLILSKLG  1129

Query  527   SEE--GASDKMKKKWWGRRNSSRF  592
             SEE  G+++K+K KWWGR  S+RF
Sbjct  1130  SEETGGSAEKVKMKWWGRLKSTRF  1153



>ref|XP_006306608.1| hypothetical protein CARUB_v10008120mg [Capsella rubella]
 gb|EOA39506.1| hypothetical protein CARUB_v10008120mg [Capsella rubella]
Length=1192

 Score =   252 bits (643),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 165/199 (83%), Gaps = 4/199 (2%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+ EAALREK+EENDIL QRLQQY+NRWSEYE KMKSMEE+WQKQM+SLQSSLSIAKKSL
Sbjct  996   LKTEAALREKEEENDILRQRLQQYDNRWSEYETKMKSMEEIWQKQMKSLQSSLSIAKKSL  1055

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
              ++DSARNSDASVNASD  G+  D G N   + +   R V  GLSVI +LAEEF QR+QV
Sbjct  1056  EVEDSARNSDASVNASD--GTDLDSGGNHFQMGHGRSRSVGVGLSVISRLAEEFGQRAQV  1113

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEE--  535
             FGDD KFL+EVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+IL KLGSEE  
Sbjct  1114  FGDDRKFLMEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKLILSKLGSEETG  1173

Query  536   GASDKMKKKWWGRRNSSRF  592
             G+++K+K KWWGR  S+R+
Sbjct  1174  GSAEKVKMKWWGRLKSTRY  1192



>ref|XP_010500596.1| PREDICTED: myosin-3 [Camelina sativa]
Length=1154

 Score =   250 bits (638),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 165/199 (83%), Gaps = 4/199 (2%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+ EAALREK+EENDIL QRLQQY+NRWSEYE KMKSMEE+WQKQM+SLQSSLSIAKKSL
Sbjct  958   LKTEAALREKEEENDILRQRLQQYDNRWSEYETKMKSMEEIWQKQMKSLQSSLSIAKKSL  1017

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
              ++DSARNSDASVNASD  G+  D G +   + +   R V  GLSVI +LAEEF QR+QV
Sbjct  1018  EVEDSARNSDASVNASD--GTDLDSGGSHFQMGHGRSRSVGVGLSVISRLAEEFGQRAQV  1075

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEE--  535
             FGDD KFL+EVKSG  EANLNPD ELRRLK MF++WKKDYG RL+ETK+IL KLGSEE  
Sbjct  1076  FGDDRKFLMEVKSGQVEANLNPDRELRRLKQMFDTWKKDYGGRLRETKLILSKLGSEETG  1135

Query  536   GASDKMKKKWWGRRNSSRF  592
             G+++K+K KWWGR  S+RF
Sbjct  1136  GSAEKVKMKWWGRLKSTRF  1154



>gb|EYU35564.1| hypothetical protein MIMGU_mgv1a000458mg [Erythranthe guttata]
Length=1138

 Score =   248 bits (634),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 163/200 (82%), Gaps = 11/200 (6%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             LRAEA LREK+EEN+IL QRLQQYENRWSEYELKM SME+VWQKQMRSLQSSLSIAKKSL
Sbjct  944   LRAEATLREKEEENEILSQRLQQYENRWSEYELKMNSMEQVWQKQMRSLQSSLSIAKKSL  1003

Query  182   a--lDDSARNSDASVNASDDKGST-WDIGNNRTALENNGVRP-VRAGLSVIGQLAEEFEQ  349
             A   D S RNSDASVN +DD+ ST W+      A E NGVR    AG  VIG+LAEEFEQ
Sbjct  1004  AFESDYSQRNSDASVNENDDQESTIWET----KAHEINGVRSSTSAGTGVIGRLAEEFEQ  1059

Query  350   RSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGS  529
             RSQVFGDDAKFLVEVKSG  EA L+PD ELRRLK MFE WKKDYG RL+ETKVILHKLG+
Sbjct  1060  RSQVFGDDAKFLVEVKSGQVEAGLDPDSELRRLKQMFEGWKKDYGARLRETKVILHKLGN  1119

Query  530   EEGASDKMKKKWWGRRNSSR  589
             EE   +  +KKWWGRRNS+R
Sbjct  1120  EE---EPTRKKWWGRRNSTR  1136



>dbj|BAD93813.1| myosin [Arabidopsis thaliana]
 dbj|BAD94158.1| myosin [Arabidopsis thaliana]
 dbj|BAD94177.1| myosin [Arabidopsis thaliana]
Length=1153

 Score =   247 bits (630),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 165/204 (81%), Gaps = 14/204 (7%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             LR EAALREK+EENDIL QR+QQY+NRWSEYE KMKSMEE+WQKQM+SLQSSLSIAKKSL
Sbjct  957   LRTEAALREKEEENDILRQRVQQYDNRWSEYETKMKSMEEIWQKQMKSLQSSLSIAKKSL  1016

Query  182   alDDSARNSDASVNASD-----DKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFE  346
              ++DSARNSDASVNASD       GS + +G+ R+       R V  GLSVI +LAEEF 
Sbjct  1017  EVEDSARNSDASVNASDATDLDSGGSHYQMGHGRS-------RSVGVGLSVISRLAEEFG  1069

Query  347   QRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLG  526
             QR+QVFGDD KFL+EVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+IL KLG
Sbjct  1070  QRAQVFGDDRKFLMEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKLILSKLG  1129

Query  527   SEE--GASDKMKKKWWGRRNSSRF  592
             SEE  G+++K+K  WWGR  S+R+
Sbjct  1130  SEETGGSAEKVKMNWWGRLRSTRY  1153



>gb|AAD50052.1|AC007980_17 Highly similar to myosin [Arabidopsis thaliana]
Length=1155

 Score =   247 bits (630),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 165/204 (81%), Gaps = 14/204 (7%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             LR EAALREK+EENDIL QR+QQY+NRWSEYE KMKSMEE+WQKQM+SLQSSLSIAKKSL
Sbjct  959   LRTEAALREKEEENDILRQRVQQYDNRWSEYETKMKSMEEIWQKQMKSLQSSLSIAKKSL  1018

Query  182   alDDSARNSDASVNASD-----DKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFE  346
              ++DSARNSDASVNASD       GS + +G+ R+       R V  GLSVI +LAEEF 
Sbjct  1019  EVEDSARNSDASVNASDATDLDSGGSHYQMGHGRS-------RSVGVGLSVISRLAEEFG  1071

Query  347   QRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLG  526
             QR+QVFGDD KFL+EVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+IL KLG
Sbjct  1072  QRAQVFGDDRKFLMEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKLILSKLG  1131

Query  527   SEE--GASDKMKKKWWGRRNSSRF  592
             SEE  G+++K+K  WWGR  S+R+
Sbjct  1132  SEETGGSAEKVKMNWWGRLRSTRY  1155



>ref|NP_175453.2| myosin VIIIA [Arabidopsis thaliana]
 sp|F4I507.1|MYO3_ARATH RecName: Full=Myosin-3; AltName: Full=Myosin VIII A; Short=AtVIIIA 
[Arabidopsis thaliana]
 gb|AEE32540.1| myosin VIIIA [Arabidopsis thaliana]
Length=1153

 Score =   246 bits (629),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 165/204 (81%), Gaps = 14/204 (7%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             LR EAALREK+EENDIL QR+QQY+NRWSEYE KMKSMEE+WQKQM+SLQSSLSIAKKSL
Sbjct  957   LRTEAALREKEEENDILRQRVQQYDNRWSEYETKMKSMEEIWQKQMKSLQSSLSIAKKSL  1016

Query  182   alDDSARNSDASVNASD-----DKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFE  346
              ++DSARNSDASVNASD       GS + +G+ R+       R V  GLSVI +LAEEF 
Sbjct  1017  EVEDSARNSDASVNASDATDLDSGGSHYQMGHGRS-------RSVGVGLSVISRLAEEFG  1069

Query  347   QRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLG  526
             QR+QVFGDD KFL+EVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+IL KLG
Sbjct  1070  QRAQVFGDDRKFLMEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKLILSKLG  1129

Query  527   SEE--GASDKMKKKWWGRRNSSRF  592
             SEE  G+++K+K  WWGR  S+R+
Sbjct  1130  SEETGGSAEKVKMNWWGRLRSTRY  1153



>ref|XP_010479488.1| PREDICTED: myosin-3-like [Camelina sativa]
Length=1153

 Score =   245 bits (625),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 164/203 (81%), Gaps = 13/203 (6%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+ EAALREK+EEN IL QRLQQY+NRWSEYE KMKSMEE+WQKQM+SLQSSLSIAKKSL
Sbjct  958   LKTEAALREKEEENYILRQRLQQYDNRWSEYETKMKSMEEIWQKQMKSLQSSLSIAKKSL  1017

Query  182   alDDSARNSDASVNASDDK----GSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQ  349
              ++DSARNSDASVNASD      GS + +G+ R+       R V  GLSVI +LAEEF Q
Sbjct  1018  EVEDSARNSDASVNASDGTVDSGGSHFQMGHGRS-------RSVGVGLSVISRLAEEFGQ  1070

Query  350   RSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGS  529
             R+QVFGDD KFL+EVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+IL KLGS
Sbjct  1071  RAQVFGDDRKFLMEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKLILSKLGS  1130

Query  530   EE--GASDKMKKKWWGRRNSSRF  592
             EE  G+++K+K  WWGR  S+RF
Sbjct  1131  EETGGSAEKVKMNWWGRLKSTRF  1153



>gb|EPS68761.1| hypothetical protein M569_06006, partial [Genlisea aurea]
Length=1053

 Score =   242 bits (618),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 171/201 (85%), Gaps = 7/201 (3%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             LRAEA+LR+K+EENDIL QRLQQY++RWSEYELKMKSMEE+WQKQMRSLQSSLSIAK+SL
Sbjct  854   LRAEASLRDKEEENDILFQRLQQYDSRWSEYELKMKSMEEIWQKQMRSLQSSLSIAKRSL  913

Query  182   alDDSARNSDASVNASDDKGSTWDIGNN--RTALENNGVRP---VRAGLSVIGQLAEEFE  346
             A DDS RNSDASVN   ++ S W+ G+N  RT  E+NG R       G+SVI +LA+EF+
Sbjct  914   AFDDSHRNSDASVNGGGNEES-WETGSNPARTQ-ESNGARTSGGGGTGISVISRLAQEFD  971

Query  347   QRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLG  526
             QRSQVFGDDAKFLVEVKSG  EA+L+PD ELRRLKHMFE+WKKDYG RL+ETK+IL K+G
Sbjct  972   QRSQVFGDDAKFLVEVKSGQVEASLDPDQELRRLKHMFEAWKKDYGSRLRETKMILSKIG  1031

Query  527   SEEGASDKMKKKWWGRRNSSR  589
             +++ + ++ +KKWWGR++S+R
Sbjct  1032  NDDSSGERGRKKWWGRKSSAR  1052



>ref|XP_006393159.1| hypothetical protein EUTSA_v10011193mg [Eutrema salsugineum]
 gb|ESQ30445.1| hypothetical protein EUTSA_v10011193mg [Eutrema salsugineum]
Length=1148

 Score =   243 bits (619),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 160/199 (80%), Gaps = 4/199 (2%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L++EAALREK+EENDIL QRLQQY+NRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSL
Sbjct  952   LKSEAALREKEEENDILRQRLQQYDNRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSL  1011

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
              ++DSARNSDASVNA  D       G+ RT      V  V  GLSVI +LAEEF QR+QV
Sbjct  1012  EVEDSARNSDASVNAFSDATDLSGSGDFRTHGRTRSVGVV--GLSVISRLAEEFGQRAQV  1069

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEE--  535
             FGDD KFL+EVKSG  EANLNP+ ELRRLK MFE+WKKDYG RLKETK+IL KLGSEE  
Sbjct  1070  FGDDTKFLMEVKSGQVEANLNPERELRRLKQMFETWKKDYGGRLKETKLILSKLGSEETG  1129

Query  536   GASDKMKKKWWGRRNSSRF  592
             G+ +K K KWWGR  S+R+
Sbjct  1130  GSVEKPKMKWWGRLRSTRY  1148



>emb|CDY42506.1| BnaC06g03520D [Brassica napus]
Length=1149

 Score =   239 bits (611),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 164/199 (82%), Gaps = 5/199 (3%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L++EAALREK+EENDIL QRLQQY+NRWSEYE KMKSMEE+WQKQMRSLQS+LSIAKKSL
Sbjct  954   LKSEAALREKEEENDILRQRLQQYDNRWSEYETKMKSMEEIWQKQMRSLQSNLSIAKKSL  1013

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
              ++DSARNSDASVNASD    +   G+ RT   +   R V  GLSVI +LAEEF QR+QV
Sbjct  1014  EVEDSARNSDASVNASDATELSGSGGDFRT---HGRTRSVGVGLSVISRLAEEFGQRAQV  1070

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEE--  535
             FGDD KFL+EVKSG  EA+L+P+ ELRRLK MF++WKKDYG RL+ETK+IL KLGS E  
Sbjct  1071  FGDDTKFLMEVKSGQVEASLDPERELRRLKQMFDTWKKDYGGRLRETKLILGKLGSGESG  1130

Query  536   GASDKMKKKWWGRRNSSRF  592
             G+++++K KWWGR  S+RF
Sbjct  1131  GSAERVKMKWWGRLKSTRF  1149



>gb|ACN26349.1| unknown [Zea mays]
Length=456

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 160/199 (80%), Gaps = 1/199 (1%)
 Frame = +2

Query  2    LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
            L+AEA +REKDEEN++LHQRLQQYENRW EYE KMK+MEE+WQKQMRSLQSSLS+AKKSL
Sbjct  258  LKAEATVREKDEENEMLHQRLQQYENRWLEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSL  317

Query  182  alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             LD++ R SD+SV+ S +      + +    + + G R + AGLSVI +LAEEFEQRSQV
Sbjct  318  VLDETPRMSDSSVDQSWESNGNHHVSSGSQLVPHTGGREMNAGLSVISRLAEEFEQRSQV  377

Query  362  FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGS-EEG  538
            F DDAKFLVEVKSG  +A+LNPD ELRRLK  F+SWKKD+  R++ETKVIL+KLG+  E 
Sbjct  378  FADDAKFLVEVKSGQADASLNPDMELRRLKQNFDSWKKDFSGRMRETKVILNKLGNGNES  437

Query  539  ASDKMKKKWWGRRNSSRFN  595
            + + +K+KWWGR N+S+F+
Sbjct  438  SPNSVKRKWWGRLNTSKFS  456



>ref|XP_009124542.1| PREDICTED: myosin-3-like [Brassica rapa]
 ref|XP_009124543.1| PREDICTED: myosin-3-like [Brassica rapa]
Length=1148

 Score =   230 bits (586),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 161/202 (80%), Gaps = 12/202 (6%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             LR EAALREK+EENDIL QRLQQY+NRWSEYE+KMKSMEE+WQKQMRSLQSSLSIAK+SL
Sbjct  954   LRTEAALREKEEENDILRQRLQQYDNRWSEYEMKMKSMEEIWQKQMRSLQSSLSIAKRSL  1013

Query  182   alDDSARNSDASVNASDDKGSTWDI-GNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQ  358
              ++ S R SDASVNASD   S + + G+ RT   +  V     GLSVI +LAEEF QR+Q
Sbjct  1014  DVEGSPRYSDASVNASD--ASDFSVSGDFRTPGRSGSV-----GLSVISRLAEEFGQRAQ  1066

Query  359   VFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEE-  535
             VFGDD KFL+EVKSG  EANL+P+ ELRRLK MFE+WKKDYG RL+ETK IL +LG+EE 
Sbjct  1067  VFGDDTKFLMEVKSGKVEANLSPERELRRLKQMFETWKKDYGGRLRETKTILSRLGNEET  1126

Query  536   GAS---DKMKKKWWGRRNSSRF  592
             G S   +++K KWWGR  S+RF
Sbjct  1127  GGSPLVERVKTKWWGRLRSTRF  1148



>emb|CDY29324.1| BnaA05g15910D [Brassica napus]
Length=1148

 Score =   229 bits (585),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 161/202 (80%), Gaps = 12/202 (6%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             LR EAALREK+EENDIL QRLQQY+NRWSEYE+KMKSMEE+WQKQMRSLQSSLSIAK+SL
Sbjct  954   LRTEAALREKEEENDILRQRLQQYDNRWSEYEMKMKSMEEIWQKQMRSLQSSLSIAKRSL  1013

Query  182   alDDSARNSDASVNASDDKGSTWDI-GNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQ  358
              ++ S R SDASVNASD   S + + G+ RT   +  V     GLSVI +LAEEF QR+Q
Sbjct  1014  DVEGSPRYSDASVNASD--ASDFSVSGDFRTPGRSGSV-----GLSVISRLAEEFGQRAQ  1066

Query  359   VFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEE-  535
             VFGDD KFL+EVKSG  EANL+P+ ELRRLK MFE+WKKDYG RL+ETK IL +LG+EE 
Sbjct  1067  VFGDDTKFLMEVKSGKVEANLSPERELRRLKQMFETWKKDYGGRLRETKTILSRLGNEET  1126

Query  536   GAS---DKMKKKWWGRRNSSRF  592
             G S   +++K KWWGR  S+RF
Sbjct  1127  GGSPLVERVKTKWWGRLRSTRF  1148



>emb|CDY53932.1| BnaCnng25790D [Brassica napus]
Length=1181

 Score =   227 bits (578),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 160/202 (79%), Gaps = 12/202 (6%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             LR EAALREK+EENDIL QRLQQY+NRWSEYE KMKSMEE+WQKQ+RSLQSSLSIAK+SL
Sbjct  987   LRTEAALREKEEENDILRQRLQQYDNRWSEYETKMKSMEEIWQKQIRSLQSSLSIAKRSL  1046

Query  182   alDDSARNSDASVNASDDKGSTWDI-GNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQ  358
              ++ S R SDASVNASD   S + + G+ RT   +  V     GLSVI +LAEEF QR+Q
Sbjct  1047  NVEGSPRYSDASVNASD--ASDFSVSGDFRTPGRSGSV-----GLSVISRLAEEFGQRAQ  1099

Query  359   VFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEE-  535
             VFGDD KFL+EVKSG  EANL+P+ ELRRLK MFE+WKKDYG RL+ETK IL +LG+EE 
Sbjct  1100  VFGDDTKFLMEVKSGKVEANLSPERELRRLKQMFETWKKDYGRRLRETKTILSRLGNEET  1159

Query  536   GAS---DKMKKKWWGRRNSSRF  592
             G S   +++K KWWGR  S+RF
Sbjct  1160  GGSPLVERVKTKWWGRLRSTRF  1181



>ref|XP_009147843.1| PREDICTED: myosin-3 [Brassica rapa]
Length=1152

 Score =   226 bits (575),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 158/199 (79%), Gaps = 5/199 (3%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L++EAALREK+EENDIL QRLQQY+NRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSL
Sbjct  957   LKSEAALREKEEENDILRQRLQQYDNRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSL  1016

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
              ++DSARNSDASVNASD    +   G+ RT   +   R V  GLSVI +LAEEF QR+QV
Sbjct  1017  EVEDSARNSDASVNASDATELSGSGGDFRT---HGRTRSVGVGLSVISRLAEEFGQRAQV  1073

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVI--LHKLGSEE  535
             FGDD KFL+EVKSG  EANL+P+ ELRRLK MF++WKKDYG RL+ETK+I          
Sbjct  1074  FGDDTKFLMEVKSGQVEANLDPERELRRLKQMFDTWKKDYGGRLRETKLILGKLGSEGGG  1133

Query  536   GASDKMKKKWWGRRNSSRF  592
             G+++++K KWWGR  S+RF
Sbjct  1134  GSAERVKMKWWGRLKSTRF  1152



>emb|CDY22791.1| BnaA06g02860D [Brassica napus]
Length=1157

 Score =   225 bits (574),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 158/199 (79%), Gaps = 5/199 (3%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L++EAALREK+EENDIL QRLQQY+NRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSL
Sbjct  962   LKSEAALREKEEENDILRQRLQQYDNRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSL  1021

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
              ++DSARNSDASVNASD    +   G+ RT   +   R V  GLSVI +LAEEF QR+QV
Sbjct  1022  EVEDSARNSDASVNASDATELSGSGGDFRT---HGRTRSVGVGLSVISRLAEEFGQRAQV  1078

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVI--LHKLGSEE  535
             FGDD KFL+EVKSG  EANL+P+ ELRRLK MF++WKKDYG RL+ETK+I          
Sbjct  1079  FGDDTKFLMEVKSGQVEANLDPERELRRLKQMFDTWKKDYGGRLRETKLILGKLGSEGGG  1138

Query  536   GASDKMKKKWWGRRNSSRF  592
             G+++++K KWWGR  S+RF
Sbjct  1139  GSAERVKMKWWGRLKSTRF  1157



>ref|XP_008664832.1| PREDICTED: myosin-1 [Zea mays]
 tpg|DAA49540.1| TPA: myosin VIII ZMM3 [Zea mays]
Length=1191

 Score =   225 bits (574),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 160/199 (80%), Gaps = 1/199 (1%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA +REKDEEN++LHQRLQQYENRW EYE KMK+MEE+WQKQMRSLQSSLS+AKKSL
Sbjct  993   LKAEATVREKDEENEMLHQRLQQYENRWLEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSL  1052

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
              LD++ R SD+SV+ S +      + +    + + G R + AGLSVI +LAEEFEQRSQV
Sbjct  1053  VLDETPRMSDSSVDQSWESNGNHHVSSGSQLVPHTGGREMNAGLSVISRLAEEFEQRSQV  1112

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGS-EEG  538
             F DDAKFLVEVKSG  +A+LNPD ELRRLK  F+SWKKD+  R++ETKVIL+KLG+  E 
Sbjct  1113  FADDAKFLVEVKSGQADASLNPDMELRRLKQNFDSWKKDFSGRMRETKVILNKLGNGNES  1172

Query  539   ASDKMKKKWWGRRNSSRFN  595
             + + +K+KWWGR N+S+F+
Sbjct  1173  SPNSVKRKWWGRLNTSKFS  1191



>gb|AAD31926.1|AF147738_1 myosin VIII ZMM3 [Zea mays]
Length=1099

 Score =   224 bits (572),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 160/199 (80%), Gaps = 1/199 (1%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA +REKDEEN++LHQRLQQYENRW EYE KMK+MEE+WQKQMRSLQSSLS+AKKSL
Sbjct  901   LKAEATVREKDEENEMLHQRLQQYENRWLEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSL  960

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
              LD++ R SD+SV+ S +      + +    + + G R + AGLSVI +LAEEFEQR+QV
Sbjct  961   VLDETPRMSDSSVDQSWESNGNHHVSSGSQLVPHTGGREMNAGLSVISRLAEEFEQRTQV  1020

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGS-EEG  538
             F DDAKFLVEVKSG  +A+LNPD ELRRLK  F+SWKKD+  R++ETKVIL+KLG+  E 
Sbjct  1021  FADDAKFLVEVKSGQADASLNPDMELRRLKQNFDSWKKDFSGRMRETKVILNKLGNGNES  1080

Query  539   ASDKMKKKWWGRRNSSRFN  595
             + + +K+KWWGR N+S+F+
Sbjct  1081  SPNSVKRKWWGRLNTSKFS  1099



>ref|XP_008802972.1| PREDICTED: myosin-1-like [Phoenix dactylifera]
Length=1166

 Score =   225 bits (573),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 160/207 (77%), Gaps = 17/207 (8%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AE+ALREKDEEND+LHQRLQQYE+RWS+YE KM+SMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  964   LKAESALREKDEENDMLHQRLQQYESRWSDYEQKMRSMEEVWQKQMRSLQSSLSIAKKSL  1023

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTA---LENNGV--------RPVRAGLSVIGQ  328
             ALD    NSD S + S      +    N T    LEN G         R + A L++I +
Sbjct  1024  ALDGVDGNSDGSTDQS------FCTNGNLTGTEGLENKGPPLGSRLTGREMSASLNIISR  1077

Query  329   LAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKV  508
             LAEEFEQRSQVF DDAKFLVEVKSG  EA+LNPD ELR+LK  FE+W+KDY +RL+ETKV
Sbjct  1078  LAEEFEQRSQVFLDDAKFLVEVKSGQAEASLNPDRELRKLKQTFETWRKDYNLRLRETKV  1137

Query  509   ILHKLGSEEGASDKMKKKWWGRRNSSR  589
             I+HKLG++E  +DK+KKKWWGR N++R
Sbjct  1138  IIHKLGNDEIKADKVKKKWWGRLNNTR  1164



>ref|XP_010933291.1| PREDICTED: myosin-1-like [Elaeis guineensis]
Length=1211

 Score =   225 bits (574),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 159/208 (76%), Gaps = 17/208 (8%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYE+RWSEYE KM SMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  1009  LKAEAALREKEEENDILHQRLQQYESRWSEYEHKMISMEEVWQKQMRSLQSSLSIAKKSL  1068

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTAL---ENNGVR--------PVRAGLSVIGQ  328
             A DD+AR SDASV+ S      WD   N       E + VR         + AGL VI +
Sbjct  1069  ATDDAARRSDASVDQS------WDGNGNHIGTRGREESHVRLGSRVLDRDMSAGLGVISR  1122

Query  329   LAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKV  508
             LAEEFEQRSQVF DD KFLVEVKSG  EANLNP+ ELRRLK  FESWKK++ +RL+E+KV
Sbjct  1123  LAEEFEQRSQVFADDVKFLVEVKSGQAEANLNPEKELRRLKQNFESWKKEFSMRLRESKV  1182

Query  509   ILHKLGSEEGASDKMKKKWWGRRNSSRF  592
             +++KLG+++  SDK K+KWW R NS++ 
Sbjct  1183  MINKLGADDANSDKAKRKWWPRLNSAKI  1210



>ref|XP_008812673.1| PREDICTED: myosin-1-like isoform X4 [Phoenix dactylifera]
Length=1064

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 157/202 (78%), Gaps = 5/202 (2%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYENRWSEYE KM+SMEEVWQKQMRSLQSSLS+AKKSL
Sbjct  862   LKAEAALREKEEENDILHQRLQQYENRWSEYEQKMRSMEEVWQKQMRSLQSSLSVAKKSL  921

Query  182   alDDSARNSDASVNASDDK-----GSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFE  346
             A DD+ R SDASV+ S D      G+ W   + +        R + AGL+VI  LAEEFE
Sbjct  922   ATDDAERRSDASVDQSWDSNGNHIGTKWGEESGKRVGSRVLHRDMSAGLNVISCLAEEFE  981

Query  347   QRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLG  526
             Q+SQVF DD  FLVEVKSG  EA+LNP+ ELRRLK  FESWKKD+ +RL+E+KVI++KL 
Sbjct  982   QQSQVFADDVNFLVEVKSGHAEASLNPEKELRRLKQNFESWKKDFSLRLRESKVIINKLR  1041

Query  527   SEEGASDKMKKKWWGRRNSSRF  592
             +++  SDK K+KWW R NS+R 
Sbjct  1042  TDDANSDKAKRKWWTRLNSTRI  1063



>ref|NP_001064913.1| Os10g0488800 [Oryza sativa Japonica Group]
 dbj|BAF26827.1| Os10g0488800, partial [Oryza sativa Japonica Group]
Length=950

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 160/199 (80%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
            L+AEA +REKDEEN++L QRLQQYENRWSEYE KMK+MEE+WQKQMRSLQSSLS+AKKSL
Sbjct  753  LKAEATVREKDEENEMLQQRLQQYENRWSEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSL  812

Query  182  alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
            ALD++ R SD+SV+ S +      IG+    +     R + A +SVI +LAEEFEQRSQV
Sbjct  813  ALDETPRMSDSSVDQSWESNGV-HIGSASQLVPRTVGREMNASISVISRLAEEFEQRSQV  871

Query  362  FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGS-EEG  538
            F DDAKFLVEVKSG  +A+LNPD ELRRLK  F+SWKKD+G R++ETKVIL+KLGS  E 
Sbjct  872  FADDAKFLVEVKSGQADASLNPDMELRRLKQNFDSWKKDFGSRIRETKVILNKLGSGNES  931

Query  539  ASDKMKKKWWGRRNSSRFN  595
            + + +K+KWWGR N+S+F+
Sbjct  932  SPNSVKRKWWGRLNTSKFS  950



>gb|ABB47808.1| Myosin head family protein, expressed [Oryza sativa Japonica 
Group]
Length=995

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 160/199 (80%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
            L+AEA +REKDEEN++L QRLQQYENRWSEYE KMK+MEE+WQKQMRSLQSSLS+AKKSL
Sbjct  798  LKAEATVREKDEENEMLQQRLQQYENRWSEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSL  857

Query  182  alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
            ALD++ R SD+SV+ S +      IG+    +     R + A +SVI +LAEEFEQRSQV
Sbjct  858  ALDETPRMSDSSVDQSWESNGV-HIGSASQLVPRTVGREMNASISVISRLAEEFEQRSQV  916

Query  362  FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGS-EEG  538
            F DDAKFLVEVKSG  +A+LNPD ELRRLK  F+SWKKD+G R++ETKVIL+KLGS  E 
Sbjct  917  FADDAKFLVEVKSGQADASLNPDMELRRLKQNFDSWKKDFGSRIRETKVILNKLGSGNES  976

Query  539  ASDKMKKKWWGRRNSSRFN  595
            + + +K+KWWGR N+S+F+
Sbjct  977  SPNSVKRKWWGRLNTSKFS  995



>ref|XP_008812670.1| PREDICTED: myosin-1-like isoform X1 [Phoenix dactylifera]
Length=1197

 Score =   223 bits (569),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 157/202 (78%), Gaps = 5/202 (2%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYENRWSEYE KM+SMEEVWQKQMRSLQSSLS+AKKSL
Sbjct  995   LKAEAALREKEEENDILHQRLQQYENRWSEYEQKMRSMEEVWQKQMRSLQSSLSVAKKSL  1054

Query  182   alDDSARNSDASVNASDDK-----GSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFE  346
             A DD+ R SDASV+ S D      G+ W   + +        R + AGL+VI  LAEEFE
Sbjct  1055  ATDDAERRSDASVDQSWDSNGNHIGTKWGEESGKRVGSRVLHRDMSAGLNVISCLAEEFE  1114

Query  347   QRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLG  526
             Q+SQVF DD  FLVEVKSG  EA+LNP+ ELRRLK  FESWKKD+ +RL+E+KVI++KL 
Sbjct  1115  QQSQVFADDVNFLVEVKSGHAEASLNPEKELRRLKQNFESWKKDFSLRLRESKVIINKLR  1174

Query  527   SEEGASDKMKKKWWGRRNSSRF  592
             +++  SDK K+KWW R NS+R 
Sbjct  1175  TDDANSDKAKRKWWTRLNSTRI  1196



>ref|XP_008812671.1| PREDICTED: myosin-1-like isoform X2 [Phoenix dactylifera]
Length=1196

 Score =   223 bits (569),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 157/202 (78%), Gaps = 5/202 (2%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYENRWSEYE KM+SMEEVWQKQMRSLQSSLS+AKKSL
Sbjct  994   LKAEAALREKEEENDILHQRLQQYENRWSEYEQKMRSMEEVWQKQMRSLQSSLSVAKKSL  1053

Query  182   alDDSARNSDASVNASDDK-----GSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFE  346
             A DD+ R SDASV+ S D      G+ W   + +        R + AGL+VI  LAEEFE
Sbjct  1054  ATDDAERRSDASVDQSWDSNGNHIGTKWGEESGKRVGSRVLHRDMSAGLNVISCLAEEFE  1113

Query  347   QRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLG  526
             Q+SQVF DD  FLVEVKSG  EA+LNP+ ELRRLK  FESWKKD+ +RL+E+KVI++KL 
Sbjct  1114  QQSQVFADDVNFLVEVKSGHAEASLNPEKELRRLKQNFESWKKDFSLRLRESKVIINKLR  1173

Query  527   SEEGASDKMKKKWWGRRNSSRF  592
             +++  SDK K+KWW R NS+R 
Sbjct  1174  TDDANSDKAKRKWWTRLNSTRI  1195



>ref|XP_008812672.1| PREDICTED: myosin-1-like isoform X3 [Phoenix dactylifera]
Length=1191

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 157/202 (78%), Gaps = 5/202 (2%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EENDILHQRLQQYENRWSEYE KM+SMEEVWQKQMRSLQSSLS+AKKSL
Sbjct  989   LKAEAALREKEEENDILHQRLQQYENRWSEYEQKMRSMEEVWQKQMRSLQSSLSVAKKSL  1048

Query  182   alDDSARNSDASVNASDDK-----GSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFE  346
             A DD+ R SDASV+ S D      G+ W   + +        R + AGL+VI  LAEEFE
Sbjct  1049  ATDDAERRSDASVDQSWDSNGNHIGTKWGEESGKRVGSRVLHRDMSAGLNVISCLAEEFE  1108

Query  347   QRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLG  526
             Q+SQVF DD  FLVEVKSG  EA+LNP+ ELRRLK  FESWKKD+ +RL+E+KVI++KL 
Sbjct  1109  QQSQVFADDVNFLVEVKSGHAEASLNPEKELRRLKQNFESWKKDFSLRLRESKVIINKLR  1168

Query  527   SEEGASDKMKKKWWGRRNSSRF  592
             +++  SDK K+KWW R NS+R 
Sbjct  1169  TDDANSDKAKRKWWTRLNSTRI  1190



>ref|XP_002467046.1| hypothetical protein SORBIDRAFT_01g018770 [Sorghum bicolor]
 gb|EER94044.1| hypothetical protein SORBIDRAFT_01g018770 [Sorghum bicolor]
Length=1196

 Score =   222 bits (566),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 161/204 (79%), Gaps = 12/204 (6%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA +REKDEEN++LHQRLQQYENRW EYE KMK+MEE+WQKQMRSLQSSLS+AKKSL
Sbjct  999   LKAEATVREKDEENEMLHQRLQQYENRWLEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSL  1058

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTA-----LENNGVRPVRAGLSVIGQLAEEFE  346
             ALD++ R SD+SV+ S      W+   N  +     +   G R + AGLSVIG+L EEFE
Sbjct  1059  ALDETPRMSDSSVDQS------WESNGNHVSSGSQLVPRTGGREMNAGLSVIGRLNEEFE  1112

Query  347   QRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLG  526
             QRSQVF DDAKFLVEVKSG  +A+LNPD ELRRLK  F+SWKKD+  R++ETKVIL+KLG
Sbjct  1113  QRSQVFADDAKFLVEVKSGQADASLNPDMELRRLKQNFDSWKKDFSGRIRETKVILNKLG  1172

Query  527   S-EEGASDKMKKKWWGRRNSSRFN  595
             +  E + + +K+KWWGR N+S+F+
Sbjct  1173  NGNESSPNSVKRKWWGRLNTSKFS  1196



>ref|XP_004982777.1| PREDICTED: myosin-J heavy chain-like isoform X1 [Setaria italica]
Length=1233

 Score =   222 bits (566),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 160/204 (78%), Gaps = 12/204 (6%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA +REKDEEN++LHQRLQQYENRW EYE KMK+MEE+WQKQMRSLQSSLS+AKKSL
Sbjct  1036  LKAEATVREKDEENEMLHQRLQQYENRWLEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSL  1095

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGV-----RPVRAGLSVIGQLAEEFE  346
             ALD++ R SD+SV+ S      W+I  N     +  V     R + AGLSVI +L EEFE
Sbjct  1096  ALDETPRMSDSSVDQS------WEINGNHVGSGSQLVPRTTGREMNAGLSVINRLTEEFE  1149

Query  347   QRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLG  526
             QRSQVF DDA F+VEVKSG  +A+LNPD ELRRLK  F+SWKKD+G R++ETKVIL+KLG
Sbjct  1150  QRSQVFADDATFIVEVKSGQADASLNPDMELRRLKQNFDSWKKDFGGRIRETKVILNKLG  1209

Query  527   S-EEGASDKMKKKWWGRRNSSRFN  595
             S  E + + +K+KWWGR N+S+F+
Sbjct  1210  SGNESSPNSVKRKWWGRLNTSKFS  1233



>ref|XP_004982778.1| PREDICTED: myosin-J heavy chain-like isoform X2 [Setaria italica]
Length=1194

 Score =   222 bits (566),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 160/204 (78%), Gaps = 12/204 (6%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA +REKDEEN++LHQRLQQYENRW EYE KMK+MEE+WQKQMRSLQSSLS+AKKSL
Sbjct  997   LKAEATVREKDEENEMLHQRLQQYENRWLEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSL  1056

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGV-----RPVRAGLSVIGQLAEEFE  346
             ALD++ R SD+SV+ S      W+I  N     +  V     R + AGLSVI +L EEFE
Sbjct  1057  ALDETPRMSDSSVDQS------WEINGNHVGSGSQLVPRTTGREMNAGLSVINRLTEEFE  1110

Query  347   QRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLG  526
             QRSQVF DDA F+VEVKSG  +A+LNPD ELRRLK  F+SWKKD+G R++ETKVIL+KLG
Sbjct  1111  QRSQVFADDATFIVEVKSGQADASLNPDMELRRLKQNFDSWKKDFGGRIRETKVILNKLG  1170

Query  527   S-EEGASDKMKKKWWGRRNSSRFN  595
             S  E + + +K+KWWGR N+S+F+
Sbjct  1171  SGNESSPNSVKRKWWGRLNTSKFS  1194



>gb|AAL31066.1|AC090120_12 putative myosin [Oryza sativa Japonica Group]
 gb|EEE51178.1| hypothetical protein OsJ_31968 [Oryza sativa Japonica Group]
Length=1200

 Score =   222 bits (566),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 160/199 (80%), Gaps = 2/199 (1%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA +REKDEEN++L QRLQQYENRWSEYE KMK+MEE+WQKQMRSLQSSLS+AKKSL
Sbjct  1003  LKAEATVREKDEENEMLQQRLQQYENRWSEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSL  1062

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             ALD++ R SD+SV+ S +      IG+    +     R + A +SVI +LAEEFEQRSQV
Sbjct  1063  ALDETPRMSDSSVDQSWESNGV-HIGSASQLVPRTVGREMNASISVISRLAEEFEQRSQV  1121

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGS-EEG  538
             F DDAKFLVEVKSG  +A+LNPD ELRRLK  F+SWKKD+G R++ETKVIL+KLGS  E 
Sbjct  1122  FADDAKFLVEVKSGQADASLNPDMELRRLKQNFDSWKKDFGSRIRETKVILNKLGSGNES  1181

Query  539   ASDKMKKKWWGRRNSSRFN  595
             + + +K+KWWGR N+S+F+
Sbjct  1182  SPNSVKRKWWGRLNTSKFS  1200



>ref|XP_006661886.1| PREDICTED: myosin-1-like [Oryza brachyantha]
Length=1195

 Score =   222 bits (565),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 162/200 (81%), Gaps = 4/200 (2%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA +REKDEEN++L QRLQQYENRWSEYE KMK+MEE+WQKQMRSLQSSLS+AKKSL
Sbjct  998   LKAEATVREKDEENEMLQQRLQQYENRWSEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSL  1057

Query  182   alDDSARNSDASVNAS-DDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQ  358
             ALD++ R SD+SV+ S +  G+   IG+    +     R + A +SVI +LAEEFEQRSQ
Sbjct  1058  ALDETPRMSDSSVDQSWESNGN--HIGSASQLVPRTIGREMNASISVISRLAEEFEQRSQ  1115

Query  359   VFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGS-EE  535
             VF DDAKFLVEVKSG  +A+LNPD ELRRLK  F+SWKKD+G R++ETKVIL+KLGS  E
Sbjct  1116  VFADDAKFLVEVKSGQADASLNPDMELRRLKQNFDSWKKDFGSRIRETKVILNKLGSGNE  1175

Query  536   GASDKMKKKWWGRRNSSRFN  595
              + + +K+KWWGR N+S+F+
Sbjct  1176  SSPNSVKRKWWGRLNTSKFS  1195



>gb|EEC67214.1| hypothetical protein OsI_34110 [Oryza sativa Indica Group]
Length=1184

 Score =   221 bits (564),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 160/199 (80%), Gaps = 2/199 (1%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA +REKDEEN++L QRLQQYENRWSEYE KMK+MEE+WQKQMRSLQSSLS+AKKSL
Sbjct  987   LKAEATVREKDEENEMLQQRLQQYENRWSEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSL  1046

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             ALD++ R SD+SV+ S +      IG+    +     R + A +SVI +LAEEFEQRSQV
Sbjct  1047  ALDETPRMSDSSVDQSWESNGV-HIGSASQLVPRTVGREMNASISVISRLAEEFEQRSQV  1105

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGS-EEG  538
             F DDAKFLVEVKSG  +A+LNPD ELRRLK  F+SWKKD+G R++ETKVIL+KLGS  E 
Sbjct  1106  FADDAKFLVEVKSGQADASLNPDMELRRLKQNFDSWKKDFGSRIRETKVILNKLGSGNES  1165

Query  539   ASDKMKKKWWGRRNSSRFN  595
             + + +K+KWWGR N+S+F+
Sbjct  1166  SPNSVKRKWWGRLNTSKFS  1184



>gb|AFW68522.1| hypothetical protein ZEAMMB73_631881 [Zea mays]
Length=1194

 Score =   221 bits (564),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 161/204 (79%), Gaps = 12/204 (6%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA +REK+EEN+ LHQRLQQYENRW EYE KMK+MEE+WQKQMRSLQSSLS+AKKSL
Sbjct  997   LKAEATVREKEEENETLHQRLQQYENRWLEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSL  1056

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTA-----LENNGVRPVRAGLSVIGQLAEEFE  346
             AL ++ R SD+SV+ S      W+   N  +     +   G R + AGLSVIG+LAEEFE
Sbjct  1057  ALHETPRMSDSSVDQS------WESNGNHVSSGSQLVPRTGGREMSAGLSVIGRLAEEFE  1110

Query  347   QRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLG  526
             QRSQVF DDAKFLVEVKSG  +A+LNPD ELRRLKH F+SWKKD+  R++ETK+IL+KLG
Sbjct  1111  QRSQVFADDAKFLVEVKSGQADASLNPDMELRRLKHNFDSWKKDFSGRIRETKMILNKLG  1170

Query  527   S-EEGASDKMKKKWWGRRNSSRFN  595
             +  E + + +K+KWWGR N+S+F+
Sbjct  1171  NGNESSPNSVKRKWWGRLNTSKFS  1194



>dbj|BAK01852.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=268

 Score =   207 bits (527),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 159/210 (76%), Gaps = 12/210 (6%)
 Frame = +2

Query  2    LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
            LRAEA +REKDEEN++LHQRLQQYENRW EYE KMK+MEE+WQKQMRSLQSSLS+AKKSL
Sbjct  59   LRAEATVREKDEENEMLHQRLQQYENRWLEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSL  118

Query  182  alDDSARNSDASVNAS-DDKGSTWDIGNNRTALENNGVR----PVRAGLSVIGQLAEEFE  346
            ALD++ R SD+SV  S +  G+    G++   L     R     + A +SVIG+LAEE E
Sbjct  119  ALDETPRMSDSSVEQSWESNGNHVGGGSHSQQLAAAAPRITGREMNASMSVIGRLAEELE  178

Query  347  QRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKL-  523
            QRSQVF DDAKFLVEVKSG  +A+LNPD ELRRLK  F+SWKKD+G R++ETKVIL+KL 
Sbjct  179  QRSQVFADDAKFLVEVKSGQADASLNPDVELRRLKQNFDSWKKDFGSRIRETKVILNKLS  238

Query  524  ------GSEEGASDKMKKKWWGRRNSSRFN  595
                  G  E + +  K+KWWGR N+S+F+
Sbjct  239  SGGGSAGGNESSPNSAKRKWWGRLNTSKFS  268



>ref|XP_009406771.1| PREDICTED: myosin-1-like [Musa acuminata subsp. malaccensis]
Length=1222

 Score =   221 bits (564),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 161/208 (77%), Gaps = 17/208 (8%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALR+K+EENDILHQRLQQYE+RWSEYE KM+SMEEVWQKQM SLQSSLS+AKKSL
Sbjct  1020  LKAEAALRDKEEENDILHQRLQQYESRWSEYEQKMRSMEEVWQKQMMSLQSSLSVAKKSL  1079

Query  182   alDDSARNSDASVNASDDKGSTWDIGNN-RT-ALENNGV---------RPVRAGLSVIGQ  328
             A+DD  R+SDASV+ S      W    + RT   E NG          R + AGLSVI +
Sbjct  1080  AIDDVERSSDASVDHS------WGSAEHVRTKGREENGTPRLVSRVLDREMSAGLSVISR  1133

Query  329   LAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKV  508
             LAEEF+QR+QVF DDAKFLVEVKSG ++A+LNPD ELRRLK  FE WKKD+  RL+ETKV
Sbjct  1134  LAEEFDQRTQVFADDAKFLVEVKSGQSDASLNPDKELRRLKQNFELWKKDFSSRLRETKV  1193

Query  509   ILHKLGSEEGASDKMKKKWWGRRNSSRF  592
             I++KLG+++  SDK K+KWW R NS+R 
Sbjct  1194  IINKLGTDDAGSDKGKRKWWVRLNSARI  1221



>ref|XP_010935561.1| PREDICTED: myosin-1-like [Elaeis guineensis]
Length=1166

 Score =   219 bits (559),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 159/204 (78%), Gaps = 11/204 (5%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AE+ALREK+EEND+LHQRLQQY++RWS+YE KM+SMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  964   LKAESALREKEEENDMLHQRLQQYDSRWSDYEQKMRSMEEVWQKQMRSLQSSLSIAKKSL  1023

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGV--------RPVRAGLSVIGQLAE  337
             ALD    NSD S++ S      +        LEN G         R + A L++I +LAE
Sbjct  1024  ALDGVDVNSDGSMDQSICTNGNY---TGTEGLENKGPSVGSRLTGREMSASLNIISRLAE  1080

Query  338   EFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILH  517
             EFEQRSQVF DDAKFLVEVKSG  EA+LNP+ ELR+LK  FE+W+KDY +RL+ETKVI+H
Sbjct  1081  EFEQRSQVFIDDAKFLVEVKSGQAEASLNPERELRKLKQTFETWRKDYNLRLRETKVIIH  1140

Query  518   KLGSEEGASDKMKKKWWGRRNSSR  589
             KLG++E  +DK+KKKWWG+ N++R
Sbjct  1141  KLGNDEIKADKVKKKWWGKLNNAR  1164



>ref|XP_003574095.1| PREDICTED: myosin-1-like [Brachypodium distachyon]
Length=1190

 Score =   219 bits (559),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 157/200 (79%), Gaps = 3/200 (2%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             LRAEA +REKDEEN++LHQRLQQYENRW EYE KMK+MEE+WQKQMRSLQSSLS+AKKSL
Sbjct  992   LRAEATVREKDEENEMLHQRLQQYENRWLEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSL  1051

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  361
             ALD++ R SD+SV  S +       G ++      G R + A +SVIG+LAEEFEQRSQV
Sbjct  1052  ALDETPRMSDSSVEQSWESNGNHVGGGSQLVPRITG-REMNASISVIGRLAEEFEQRSQV  1110

Query  362   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKL--GSEE  535
             F DDAKFLVEVKSG  +A+LNPD ELRRLK  F+SWKKD+  R++ETKVIL+KL  G  E
Sbjct  1111  FADDAKFLVEVKSGQADASLNPDMELRRLKQNFDSWKKDFSSRIRETKVILNKLASGGNE  1170

Query  536   GASDKMKKKWWGRRNSSRFN  595
              + +  K+KWWGR N+S+F+
Sbjct  1171  SSPNSAKRKWWGRLNTSKFS  1190



>ref|XP_008797209.1| PREDICTED: LOW QUALITY PROTEIN: myosin-1-like [Phoenix dactylifera]
Length=1193

 Score =   219 bits (557),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 158/205 (77%), Gaps = 10/205 (5%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALR K+EENDILHQRLQQYE+RW EYE KM+SMEEVWQKQMRSLQSSLSIAKKSL
Sbjct  990   LKAEAALRVKEEENDILHQRLQQYESRWLEYEQKMRSMEEVWQKQMRSLQSSLSIAKKSL  1049

Query  182   alDDSARNSDASVNAS-DDKGSTWDIGN-----NRTALENNGV-RPVRAGLSVIGQLAEE  340
             A DD+AR SDASV+ S D  G+   IG      + T L +  + R + AGL  I +LAEE
Sbjct  1050  AADDAARRSDASVDQSWDSNGN--HIGTRGREGSHTRLGSRVLDRDMSAGLGAISRLAEE  1107

Query  341   FEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHK  520
             FEQRSQVF DD KFLVEVKSG  EANLNP+ ELRRLK  FESWKKD+ +RL+ETK I HK
Sbjct  1108  FEQRSQVFADDVKFLVEVKSGQAEANLNPEKELRRLKQNFESWKKDFSMRLRETKSIAHK  1167

Query  521   LGSEEGA-SDKMKKKWWGRRNSSRF  592
             L ++  A SDK K+KWW R NS++ 
Sbjct  1168  LEADGAASSDKAKRKWWARLNSTKI  1192



>gb|EMT12170.1| Myosin-J heavy chain [Aegilops tauschii]
Length=1293

 Score =   215 bits (547),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 160/207 (77%), Gaps = 9/207 (4%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             LRAEA +REKDEEN++LHQRLQQYENRW EYE KMK+MEE+WQKQMRSLQSSLS+AKKSL
Sbjct  1087  LRAEATVREKDEENEMLHQRLQQYENRWLEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSL  1146

Query  182   alDDSARNSDASVNAS-DDKGSTWDIGNNR--TALENNGVRPVRAGLSVIGQLAEEFEQR  352
             ALD++ R SD+SV  S +  G+    G+++   A      R + A +SVIG+LAEE EQR
Sbjct  1147  ALDETPRMSDSSVEQSWESNGNHVGGGSSQQLAAAPRITGREMNASMSVIGRLAEELEQR  1206

Query  353   SQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSE  532
             SQVF DDAKFLVEVKSG  +A+LNPD ELRRLK  F+SWKKD+G R++ETKVIL+KL S 
Sbjct  1207  SQVFADDAKFLVEVKSGQADASLNPDVELRRLKQNFDSWKKDFGSRIRETKVILNKLASG  1266

Query  533   ------EGASDKMKKKWWGRRNSSRFN  595
                   E + +  K+KWWGR N+S+F+
Sbjct  1267  GGGGGNESSPNSAKRKWWGRLNTSKFS  1293



>ref|XP_010918414.1| PREDICTED: myosin-1-like [Elaeis guineensis]
Length=1195

 Score =   212 bits (540),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 154/208 (74%), Gaps = 17/208 (8%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALREK+EEN+ILHQRLQQYENRWSEYE KM SMEEVWQKQMRSLQSSLS+AKKSL
Sbjct  993   LKAEAALREKEEENEILHQRLQQYENRWSEYEQKMSSMEEVWQKQMRSLQSSLSVAKKSL  1052

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVR-----------AGLSVIGQ  328
             A DD+ R SDAS++ S      WD   N  A +    R  R           +GL+VI +
Sbjct  1053  ATDDAERRSDASMDQS------WDSNGNHIATKGQDERGKRLGSRVLDRDMSSGLNVISR  1106

Query  329   LAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKV  508
             LAEEFEQ+SQVF DD  FLVEVKS   EA+LNP+ EL+ LK  FESWKKD+ +RL+E+KV
Sbjct  1107  LAEEFEQQSQVFADDVNFLVEVKSRQAEASLNPEKELKSLKQNFESWKKDFSLRLRESKV  1166

Query  509   ILHKLGSEEGASDKMKKKWWGRRNSSRF  592
             I++KL +++  SDK K+KWW R NS+R 
Sbjct  1167  IINKLRTDDANSDKAKRKWWTRLNSTRI  1194



>ref|XP_009389227.1| PREDICTED: myosin-1-like [Musa acuminata subsp. malaccensis]
Length=1277

 Score =   207 bits (528),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 155/202 (77%), Gaps = 7/202 (3%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALR+K+EEN+ILHQRLQQYE+RWSEYE KM+SMEEVWQKQM SLQSSLS+AK S 
Sbjct  1077  LKAEAALRDKEEENNILHQRLQQYESRWSEYEQKMESMEEVWQKQMASLQSSLSVAKNSF  1136

Query  182   alDDSARNSDASVNAS-----DDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFE  346
             A+DD  R+S AS++ S       +   W+ G    +   N  R + +GLSVI +L+EEFE
Sbjct  1137  AIDDIERHSVASLDQSWSSTDPIRAKGWENGKRSVSRAIN--RDMSSGLSVISRLSEEFE  1194

Query  347   QRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLG  526
             QR+QVF DDAKFL+EVKSG +EA+LNP+ ELRRLK  FE WKKD+  RL+E K++++KLG
Sbjct  1195  QRTQVFADDAKFLMEVKSGKSEASLNPERELRRLKQDFELWKKDFNSRLREAKMVINKLG  1254

Query  527   SEEGASDKMKKKWWGRRNSSRF  592
             +++  SDK K+KWW R NS R 
Sbjct  1255  TDDAGSDKGKRKWWVRLNSRRI  1276



>ref|XP_003589382.1| Unconventional myosin [Medicago truncatula]
 gb|AES59633.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=210

 Score =   187 bits (476),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 141/191 (74%), Gaps = 28/191 (15%)
 Frame = +2

Query  2    LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
            L+AEAALREKDEENDIL+QR+QQYENRWSEYELKMKSME++W KQMRSLQSSLSIAKKSL
Sbjct  47   LKAEAALREKDEENDILNQRIQQYENRWSEYELKMKSMEDLWLKQMRSLQSSLSIAKKSL  106

Query  182  alDDSARNSDASV-NASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQ  358
            A+DDS RNSDASV NASD++  +W++G+N  + E+NG R   A LSVI +LAE F + S 
Sbjct  107  AIDDSDRNSDASVNNASDERDYSWEVGSNHRSQESNGTRSTTASLSVISRLAEAFAKESS  166

Query  359  VFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEG  538
            ++                           LK MFE+WK+DY  RL+ETK+I++KLG+E+ 
Sbjct  167  IW---------------------------LKQMFEAWKRDYRARLRETKLIINKLGTEDS  199

Query  539  ASDKMKKKWWG  571
            A +KMKKKWWG
Sbjct  200  ALEKMKKKWWG  210



>ref|XP_006847798.1| hypothetical protein AMTR_s00029p00027850 [Amborella trichopoda]
 gb|ERN09379.1| hypothetical protein AMTR_s00029p00027850 [Amborella trichopoda]
Length=1164

 Score =   194 bits (494),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 136/202 (67%), Gaps = 23/202 (11%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             +RAEA+LREKDEEN++LHQ+L QYE+RWSEYE KMKSMEEVWQ QM              
Sbjct  978   VRAEASLREKDEENELLHQKLHQYESRWSEYESKMKSMEEVWQNQM--------------  1023

Query  182   alDDSARNSDASVNASDDKGSTWDIG------NNRTALENNGVRPVRAGLSVIGQLAEEF  343
                 S + + AS   S +    W+ G          A   +  R + AGLSVI +LAEEF
Sbjct  1024  ---GSLQTTLASAKRSLEGDEGWNFGISPGQKKEEAAGSRHLEREMSAGLSVIERLAEEF  1080

Query  344   EQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKL  523
             E R +VFGDDA FLVEVKSG  EA L+PD ELR+LK +F++WKKDY  RL+ETK +LHKL
Sbjct  1081  EGRRRVFGDDADFLVEVKSGRAEAGLDPDIELRKLKRLFDAWKKDYNSRLRETKSVLHKL  1140

Query  524   GSEEGASDKMKKKWWGRRNSSR  589
             G+EE  ++K +++WW RR++SR
Sbjct  1141  GNEEAQAEKARRRWWLRRSNSR  1162



>ref|XP_010463346.1| PREDICTED: myosin-3-like [Camelina sativa]
Length=1075

 Score =   187 bits (475),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 137/183 (75%), Gaps = 14/183 (8%)
 Frame = +2

Query  65    QQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNSDASVNAS-----  229
             +QY+       +   +MEE+WQKQM+SLQSSLSIAKKSL ++DSARNSDASVNAS     
Sbjct  900   RQYKATVDASVVIQSAMEEIWQKQMKSLQSSLSIAKKSLEVEDSARNSDASVNASNGTDL  959

Query  230   DDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLT  409
             D  GS + +G+ R+       R V  GLSVI +LAEEF QR+QVFGDD KFL+EVKSG  
Sbjct  960   DSGGSHFQMGHGRS-------RSVGVGLSVISRLAEEFGQRAQVFGDDRKFLMEVKSGQV  1012

Query  410   EANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEE--GASDKMKKKWWGRRNS  583
             EANLNPD ELRRLK MFE+WKKDYG RL+ETK+IL KLGSEE  G+++K K KWWGR  S
Sbjct  1013  EANLNPDRELRRLKQMFETWKKDYGGRLRETKLILSKLGSEETGGSAEKAKMKWWGRLKS  1072

Query  584   SRF  592
             +RF
Sbjct  1073  TRF  1075



>ref|XP_006841789.1| hypothetical protein AMTR_s00003p00267250 [Amborella trichopoda]
 gb|ERN03464.1| hypothetical protein AMTR_s00003p00267250 [Amborella trichopoda]
Length=1232

 Score =   184 bits (467),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 143/201 (71%), Gaps = 11/201 (5%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAALR K+E+N +L+Q+LQQYE RWSEYE +M+SMEE WQKQM SLQ SL+ AK+SL
Sbjct  1033  LKAEAALRNKEEDNLVLNQQLQQYEKRWSEYETRMRSMEETWQKQMTSLQMSLAAAKRSL  1092

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNRTALENNGV-------RPVRAGLSVIGQLAEE  340
             A DD+ R   + +  S D   +  IG  RT     G        RP  A + V+G++A+E
Sbjct  1093  AADDAVRLDASPLAHSYDSEESTSIGT-RTPDYIGGTPSKPTVGRPSEATV-VVGRMAKE  1150

Query  341   FEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHK  520
             F+QR+QVF DDA F+VEVKSG +EA+LNP+ ELR+LK  FE WKKDY VRL+ETK  LHK
Sbjct  1151  FDQRAQVFNDDAGFIVEVKSGHSEASLNPEDELRKLKLRFEGWKKDYKVRLRETKATLHK  1210

Query  521   LGSEEGASDKMKKKWWGRRNS  583
             LG  +   +K KKKWWG+R +
Sbjct  1211  LG--DSNVEKSKKKWWGKRTT  1229



>dbj|BAD94297.1| myosin [Arabidopsis thaliana]
Length=147

 Score =   167 bits (424),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 107/142 (75%), Gaps = 14/142 (10%)
 Frame = +2

Query  188  DDSARNSDASVNASD-----DKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQR  352
            +DSARNSDASVNASD       GS + +G+ R+       R V  GLSVI +LAEEF QR
Sbjct  13   EDSARNSDASVNASDATDLDSGGSHYQMGHGRS-------RSVGVGLSVISRLAEEFGQR  65

Query  353  SQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSE  532
            +QVFGDD KFL+EVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+IL KLGSE
Sbjct  66   AQVFGDDRKFLMEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKLILSKLGSE  125

Query  533  E--GASDKMKKKWWGRRNSSRF  592
            E  G+++K+K  WWGR  S+R+
Sbjct  126  ETGGSAEKVKMNWWGRLRSTRY  147



>emb|CDY71633.1| BnaCnng73730D [Brassica napus]
Length=151

 Score =   158 bits (400),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 104/137 (76%), Gaps = 5/137 (4%)
 Frame = +2

Query  188  DDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFG  367
            +DSARNSDASVNASD    +   G+ RT   +   R V  GLSVI +LAEEF QR+QVFG
Sbjct  18   EDSARNSDASVNASDAAELSGSGGDFRT---HGRTRSVGVGLSVISRLAEEFGQRAQVFG  74

Query  368  DDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEE--GA  541
            DD KFL+EVKSG  EANL+P+ ELRRLK MF++WKKDYG R +ETK+IL K+GS E  G+
Sbjct  75   DDTKFLMEVKSGQVEANLDPERELRRLKQMFDTWKKDYGGRSRETKLILGKIGSGESGGS  134

Query  542  SDKMKKKWWGRRNSSRF  592
            ++++K KWWGR  S+RF
Sbjct  135  AERVKMKWWGRLKSTRF  151



>ref|XP_002975651.1| hypothetical protein SELMODRAFT_103418 [Selaginella moellendorffii]
 gb|EFJ23280.1| hypothetical protein SELMODRAFT_103418 [Selaginella moellendorffii]
Length=1045

 Score =   162 bits (410),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 131/199 (66%), Gaps = 3/199 (2%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L AE A+ +KD EN  +  +LQQYE RWSEYE +M +MEEVWQKQM SLQ SL+ AK+SL
Sbjct  847   LVAEQAVWDKDVENAAMAHKLQQYEQRWSEYEARMNAMEEVWQKQMTSLQQSLAAAKRSL  906

Query  182   alDDSARNSDASVNASDD-KGSTWDIGNNRTALEN--NGVRPVRAGLSVIGQLAEEFEQR  352
               +D    S  SV        ++    +N+T+ +N  N  R   AG SV+GQL +E+E R
Sbjct  907   TSEDPVPESATSVTPEPGFITASTTATSNQTSSDNHSNFPRDFDAGKSVVGQLVKEYEHR  966

Query  353   SQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSE  532
             +QVF DDA FLVEVKSG  EANL+P+ EL++LKH F+ WKKD+  RL+ETKVIL KL   
Sbjct  967   TQVFNDDADFLVEVKSGQVEANLSPEDELKKLKHRFDVWKKDFKGRLRETKVILQKLSHV  1026

Query  533   EGASDKMKKKWWGRRNSSR  589
             +    +  K WW  R +++
Sbjct  1027  DEERSRKHKSWWSSRRANQ  1045



>ref|XP_002978834.1| hypothetical protein SELMODRAFT_109322 [Selaginella moellendorffii]
 gb|EFJ20281.1| hypothetical protein SELMODRAFT_109322 [Selaginella moellendorffii]
Length=1052

 Score =   162 bits (409),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 131/199 (66%), Gaps = 3/199 (2%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L AE A+ +KD EN  +  +LQQYE RWSEYE +M +MEEVWQKQM SLQ SL+ AK+SL
Sbjct  854   LVAEQAVWDKDVENAAMVHKLQQYEQRWSEYEARMNAMEEVWQKQMTSLQQSLAAAKRSL  913

Query  182   alDDSARNSDASVNASDD-KGSTWDIGNNRTALEN--NGVRPVRAGLSVIGQLAEEFEQR  352
               +D    S  SV        ++    +N+T+ +N  N  R   AG SV+GQL +E+E R
Sbjct  914   TSEDPVPESATSVTPEPGFITASTTATSNQTSSDNHSNFPRDFDAGKSVVGQLVKEYEHR  973

Query  353   SQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSE  532
             +QVF DDA FLVEVKSG  EANL+P+ EL++LKH F+ WKKD+  RL+ETKVIL KL   
Sbjct  974   TQVFNDDADFLVEVKSGQVEANLSPEDELKKLKHRFDVWKKDFKGRLRETKVILQKLSHV  1033

Query  533   EGASDKMKKKWWGRRNSSR  589
             +    +  K WW  R +++
Sbjct  1034  DEERSRKHKSWWSSRRANQ  1052



>ref|XP_008800396.1| PREDICTED: myosin-1-like [Phoenix dactylifera]
Length=1247

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 138/224 (62%), Gaps = 37/224 (17%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA+LREK+EEN IL Q+LQQYE RWSEYE KMKSMEE WQKQ+ SLQ SL+ AKKSL
Sbjct  1022  LKAEASLREKEEENAILKQQLQQYETRWSEYEAKMKSMEETWQKQLTSLQVSLAAAKKSL  1081

Query  182   alDDSARNS---DAS-VNASDDKGSTWDIGN------------------------NRTAL  277
             A DD A +    DAS V  S D   T   G                          R+A+
Sbjct  1082  AADDMASHHGRLDASPVQHSYDSEDTLSAGTRTPEGTPAKKFHACDAGLGRNSNGTRSAV  1141

Query  278   ------ENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHEL  439
                   +   VR      S +  L +EFEQ++QVF DDA FLVEVKS  + +++NPD EL
Sbjct  1142  RHLDASDGGLVRYSNGAHSAVSNLVKEFEQQTQVFEDDAAFLVEVKSRQSGSSINPDEEL  1201

Query  440   RRLKHMFESWKKDYGVRLKETKVILHKLGSEEGASDKMKKKWWG  571
             ++LK  F +WKKDY VRL+ETK+ L KLGS E   +KM+K+WWG
Sbjct  1202  QKLKGRFGTWKKDYKVRLRETKIALQKLGSPE---EKMRKRWWG  1242



>ref|XP_003562871.1| PREDICTED: myosin-3 [Brachypodium distachyon]
Length=1251

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 134/214 (63%), Gaps = 28/214 (13%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L++K+EEN +L Q+L+QYEN+WSEYE KMKSMEE W+KQ+ SLQ SL  AKKSL
Sbjct  1045  LKAEALLQDKEEENAMLKQQLEQYENKWSEYEAKMKSMEEAWKKQLSSLQLSLVAAKKSL  1104

Query  182   alDD----SARNSDASVNASDDKGSTWDIGNN----------------RTALENNGVRPV  301
               DD    +AR      +A  D   T   G +                R A  N+  R  
Sbjct  1105  TSDDMATRAARTDTIPTHAQYDSEDTMSTGTHTPEAAELKYQNHNPEARVATGNSDRR--  1162

Query  302   RAGLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDY  481
                ++V+  LA+EFE R QVF DDA FLV VKSG   +N+NPD ELR+LK  F +WKKDY
Sbjct  1163  ---INVVNHLAKEFEDRRQVFDDDAGFLVAVKSGQIGSNMNPDDELRKLKDRFATWKKDY  1219

Query  482   GVRLKETKVILHKLGSEEGASDKMKKKWWGRRNS  583
               RLKETKV L K+G   G  +K +K+WWG+++S
Sbjct  1220  KSRLKETKVNLQKVG---GHDEKSRKRWWGKKSS  1250



>gb|ACL52804.1| unknown [Zea mays]
Length=148

 Score =   147 bits (372),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = +2

Query  47   ILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNSDASVNA  226
            +LHQRLQQYENRW EYE KMK+MEE+WQKQMRSLQSSLS+AKKSL LD++ R SD+SV+ 
Sbjct  1    MLHQRLQQYENRWLEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSLVLDETPRMSDSSVDQ  60

Query  227  SDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGL  406
            S +      + +    + + G R + AGLSVI +LAEEFEQRSQVF DDAKFLVEVKSG 
Sbjct  61   SWESNGNHHVSSGSQLVPHTGGREMNAGLSVISRLAEEFEQRSQVFADDAKFLVEVKSGQ  120

Query  407  TEANLNPDHELRRL  448
             +A+LNPD ELRRL
Sbjct  121  ADASLNPDMELRRL  134



>gb|EMT14738.1| Myosin-2 heavy chain [Aegilops tauschii]
Length=1237

 Score =   159 bits (403),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 133/208 (64%), Gaps = 18/208 (9%)
 Frame = +2

Query  5     RAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksla  184
             +AEA LR+K+EEN +L Q+L+QYEN+WSEYE KMK MEE W+KQ+ SLQ SL  AKKSLA
Sbjct  1032  KAEALLRDKEEENAMLKQQLEQYENKWSEYETKMKVMEEAWKKQLSSLQLSLVAAKKSLA  1091

Query  185   lDD----SARNSDASVNASDDKGSTWDIGNNRT-----ALENNGVRPVRAG------LSV  319
              DD    +AR      +A  D   T   G +         +N+   P  A       ++ 
Sbjct  1092  ADDMVTRAARTDTTPTHAQYDSEDTMSTGTHTPEGTELKYQNHNPEPRLATGNSDRRINA  1151

Query  320   IGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKE  499
             +  LA+EFE R QVF DDA FLV VKSG   +N+NPD ELR+LK  F +WKKDY  RLKE
Sbjct  1152  VNHLAKEFEDRRQVFDDDAGFLVAVKSGQIGSNMNPDDELRKLKDRFATWKKDYKSRLKE  1211

Query  500   TKVILHKLGSEEGASDKMKKKWWGRRNS  583
             TKV L K+GS +   +K +K+WWG+++S
Sbjct  1212  TKVNLQKVGSHD---EKSRKRWWGKKSS  1236



>ref|XP_001755337.1| predicted protein [Physcomitrella patens]
 gb|EDQ79817.1| predicted protein [Physcomitrella patens]
Length=1060

 Score =   159 bits (401),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 134/208 (64%), Gaps = 18/208 (9%)
 Frame = +2

Query  8     AEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslal  187
             AE ALREK+E+N +L QRL  YE RW EYE KM SMEE+WQKQM SLQ S++ AK+SLA 
Sbjct  856   AEKALREKEEDNAVLRQRLLHYEARWMEYEAKMSSMEEMWQKQMSSLQLSIAAAKQSLAT  915

Query  188   DDSARNS---------DASVNAS---DDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQL  331
             D+    +         DA+ N +   D   + + +  +  +     V   R   SV+  L
Sbjct  916   DEHPLQTPVKDDNDWDDAATNGTRSPDQFTNKYLVTGSEYSTPRGDVDAAR---SVVNHL  972

Query  332   AEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVI  511
               E++ R+QVF DD  FLVEVKSGLTEA+LNP+ ELR+LK  F++WKKD+ VRL+ETK++
Sbjct  973   MREYDHRTQVFNDDVDFLVEVKSGLTEAHLNPEDELRKLKVRFDTWKKDFKVRLRETKLV  1032

Query  512   LHKLGSEEGA---SDKMKKKWWGRRNSS  586
             L+KL + + A    D+ ++ WWG+R + 
Sbjct  1033  LNKLCAMDSAEKEKDRTRRNWWGKRTTP  1060



>dbj|BAJ99526.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1257

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 133/207 (64%), Gaps = 18/207 (9%)
 Frame = +2

Query  8     AEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslal  187
             AEA LR+K+EEN +L Q+L+QYEN+WSEYE KMK MEE W+KQ+ SLQ SL  AKKSLA 
Sbjct  1053  AEALLRDKEEENAMLKQQLEQYENKWSEYEAKMKVMEEAWKKQLSSLQLSLVAAKKSLAS  1112

Query  188   DD----SARNSDASVNASDDKGSTWDIGNNRT-----ALENNGVRP-VRAG-----LSVI  322
             DD    +AR      +A  D   T   G +         +N+   P V  G     ++V+
Sbjct  1113  DDMVIRAARTDTTPTHAQYDSEDTMSTGTHTPEGTELKFQNHNPEPRVVTGNSDRRINVV  1172

Query  323   GQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKET  502
               LA+EFE R QVF DDA FLV VKSG   +N+NPD ELR+LK  F +WKKDY  RLKET
Sbjct  1173  NHLAKEFEDRRQVFDDDAGFLVAVKSGQIGSNMNPDDELRKLKDRFATWKKDYKSRLKET  1232

Query  503   KVILHKLGSEEGASDKMKKKWWGRRNS  583
             KV L K+ S +   +K +K+WWG+++S
Sbjct  1233  KVNLQKVSSHD---EKSRKRWWGKKSS  1256



>gb|EMS56234.1| Myosin-2 heavy chain [Triticum urartu]
Length=1124

 Score =   157 bits (397),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 133/208 (64%), Gaps = 18/208 (9%)
 Frame = +2

Query  5     RAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksla  184
             +AEA LR+K+EEN +L Q+L+QYEN+WSEYE KMK MEE W+KQ+ SLQ SL  AKKSLA
Sbjct  919   KAEALLRDKEEENAMLKQQLEQYENKWSEYETKMKVMEEAWKKQLSSLQLSLVAAKKSLA  978

Query  185   lDD----SARNSDASVNASDDKGSTWDIGNNRT-----ALENNGVRP-VRAG-----LSV  319
              DD    +AR      +A  D   T   G +         +N+   P V  G     ++ 
Sbjct  979   ADDMVTRAARTDTTPTHAQYDSEDTMSTGTHTPEGTELKYQNHNPEPRVVTGNSDRRINA  1038

Query  320   IGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKE  499
             +  LA+EFE R QVF DDA FLV VKSG   +N+NPD ELR+LK  F +WKKDY  RLKE
Sbjct  1039  VNHLAKEFEDRRQVFDDDAGFLVAVKSGQIGSNMNPDDELRKLKDRFATWKKDYKSRLKE  1098

Query  500   TKVILHKLGSEEGASDKMKKKWWGRRNS  583
             TKV L K+ S +   +K +K+WWG+++S
Sbjct  1099  TKVNLQKVSSHD---EKSRKRWWGKKSS  1123



>gb|EEC82270.1| hypothetical protein OsI_26483 [Oryza sativa Indica Group]
Length=1245

 Score =   156 bits (395),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 105/212 (50%), Positives = 136/212 (64%), Gaps = 29/212 (14%)
 Frame = +2

Query  5     RAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksla  184
             +AEAALR+K+EEN+IL Q+L QYE +WSEYE KMKSMEE W+KQ+ SLQ SL  AKKSL 
Sbjct  1043  KAEAALRDKEEENEILKQQLDQYEKKWSEYEAKMKSMEEAWKKQLSSLQLSLVAAKKSLT  1102

Query  185   lDD----SARNSDASVNASDD-----------KGSTWDIGNN----RTALENNGVRPVRA  307
              +D    +AR   A ++A  D           +G+ +   N+    R A  N+  R    
Sbjct  1103  AEDVASRAARTDAAPMHAHYDSEDTSTGTHTPEGTEFKYQNHNSEARVAAPNSDRR----  1158

Query  308   GLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGV  487
              ++ +  LA+EFE R QVF DDA FLV VKSG   +N+NPD ELR+LK  F +WKKDY  
Sbjct  1159  -INAVNHLAKEFEDRRQVFEDDAGFLVAVKSGQVGSNMNPDDELRKLKDRFATWKKDYKS  1217

Query  488   RLKETKVILHKLGSEEGASDKMKKKWWGRRNS  583
             RLKETKV L K+G E     K +K+WWG+++S
Sbjct  1218  RLKETKVNLQKVGEE-----KSRKRWWGKKSS  1244



>ref|XP_006370337.1| hypothetical protein POPTR_0001s41770g [Populus trichocarpa]
 gb|ERP66906.1| hypothetical protein POPTR_0001s41770g [Populus trichocarpa]
Length=1192

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 139/212 (66%), Gaps = 29/212 (14%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             ++AEA + +K+EEN  L ++LQQYE RWS+YE KMK+MEE+WQ QM SLQ+SL+ A+KSL
Sbjct  989   VKAEATIGQKEEENAALQEQLQQYEKRWSDYEAKMKAMEEMWQMQMLSLQTSLAAARKSL  1048

Query  182   alDDSA------------RNSDASVNASDDK----GSTWDIGNN-----RTALENNGVRP  298
             A D++A            R+ D+  N S +     G+T +I  N     R   ENNG   
Sbjct  1049  AADNTAAQPGKLDSSTSPRDYDSEDNVSMESRTPGGNTPNIFANAFPDLRAGRENNG---  1105

Query  299   VRAGLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKD  478
                 ++V+  LA+EFE + Q F DDAK LVEV++G + +N+NPD ELRRLK  FE+WKKD
Sbjct  1106  ---SVNVVNTLAKEFELQKQNFDDDAKALVEVRAGQSASNMNPDEELRRLKLKFETWKKD  1162

Query  479   YGVRLKETKVILHKLGSEEGASDKMKKKWWGR  574
             Y VRL+ETK  LHKLG   G  D+ ++KWW R
Sbjct  1163  YKVRLRETKARLHKLG--HGEVDRNRRKWWRR  1192



>gb|EEE67412.1| hypothetical protein OsJ_24744 [Oryza sativa Japonica Group]
Length=1256

 Score =   155 bits (391),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 136/212 (64%), Gaps = 29/212 (14%)
 Frame = +2

Query  5     RAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksla  184
             +AEAALR+K+EEN++L Q+L QYE +WSEYE KMKSMEE W+KQ+ SLQ SL  AKKSL 
Sbjct  1054  KAEAALRDKEEENEMLKQQLDQYEKKWSEYEAKMKSMEEAWKKQLSSLQLSLVAAKKSLT  1113

Query  185   lDD----SARNSDASVNASDD-----------KGSTWDIGNN----RTALENNGVRPVRA  307
              +D    +AR   A ++A  D           +G+ +   N+    R A  N+  R    
Sbjct  1114  AEDVASRAARTDAAPMHAHYDSEDTSTGTHTPEGTEFKYQNHNSEARVAAPNSDRR----  1169

Query  308   GLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGV  487
              ++ +  LA+EFE R QVF DDA FLV VKSG   +N+NPD ELR+LK  F +WKKDY  
Sbjct  1170  -INAVNHLAKEFEDRRQVFEDDAGFLVAVKSGQVGSNMNPDDELRKLKDRFATWKKDYKS  1228

Query  488   RLKETKVILHKLGSEEGASDKMKKKWWGRRNS  583
             RLKETKV L K+G E     K +K+WWG+++S
Sbjct  1229  RLKETKVNLQKVGEE-----KSRKRWWGKKSS  1255



>ref|XP_001774306.1| predicted protein [Physcomitrella patens]
 gb|EDQ60942.1| predicted protein [Physcomitrella patens]
Length=1019

 Score =   154 bits (389),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 128/197 (65%), Gaps = 12/197 (6%)
 Frame = +2

Query  8     AEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslal  187
             AE ALREK+EEN  + Q++  YE RW EYE KM SMEE+WQKQM SLQ SLS AK+SLA 
Sbjct  831   AEKALREKEEENASMRQKILHYEARWMEYEAKMTSMEEMWQKQMSSLQLSLSAAKRSLAT  890

Query  188   DDSARNSDASVNASDDKGSTWDIGNNRTALENNGVRP---VRAGLSVIGQLAEEFEQRSQ  358
             DD +         + D  S     N+R +       P   V A  SV+  L  EF+ R+Q
Sbjct  891   DDYSMLQ----TPTKDHDSI----NDRFSAGRECSTPRGDVDAARSVVNHLVREFDHRTQ  942

Query  359   VFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEG  538
             VF DDA FL+EVKSGLTEA L+P+ ELR+L+  F++WKKD+  RL+ETK++L +L + + 
Sbjct  943   VFNDDADFLIEVKSGLTEAPLDPEEELRKLRMRFDTWKKDFKTRLRETKLVLQRLCNVDS  1002

Query  539   A-SDKMKKKWWGRRNSS  586
             A  +K +KKWW +R + 
Sbjct  1003  AEKEKTRKKWWSKRTTP  1019



>ref|XP_009342450.1| PREDICTED: myosin-2 isoform X2 [Pyrus x bretschneideri]
Length=1089

 Score =   154 bits (389),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 129/202 (64%), Gaps = 21/202 (10%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L  K+EEN  L ++LQQ+E RWSE+E KMKSM++VWQKQM SLQ+SL+      
Sbjct  898   LQAEATLVRKEEENAELQEQLQQFETRWSEHESKMKSMQDVWQKQMASLQTSLA------  951

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNR------TALENNGV-RPVRAGLSVIGQLAEE  340
                 +ARNS AS N +   G    + + R      T++  NG  R      + +  L +E
Sbjct  952   ----AARNSLASDNTAGQPGRLGSVSSPRYDSEEATSMGFNGAGREANGSSNAVSSLVKE  1007

Query  341   FEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHK  520
             FEQR Q F DDAK LVEVK G + AN+NP+ +LR+LKH FESWKK+Y  RL+ETK  LHK
Sbjct  1008  FEQRRQTFNDDAKALVEVKPGQSAANMNPEEDLRKLKHRFESWKKEYKARLRETKTKLHK  1067

Query  521   L-GSEEGASDKMKKKWWGRRNS  583
             +  SEE   +K ++KWW +  S
Sbjct  1068  IWHSEE---EKRQRKWWAKIGS  1086



>ref|XP_009342451.1| PREDICTED: myosin-2 isoform X3 [Pyrus x bretschneideri]
Length=1089

 Score =   154 bits (389),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 129/202 (64%), Gaps = 21/202 (10%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L  K+EEN  L ++LQQ+E RWSE+E KMKSM++VWQKQM SLQ+SL+      
Sbjct  898   LQAEATLVRKEEENAELQEQLQQFETRWSEHESKMKSMQDVWQKQMASLQTSLA------  951

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNR------TALENNGV-RPVRAGLSVIGQLAEE  340
                 +ARNS AS N +   G    + + R      T++  NG  R      + +  L +E
Sbjct  952   ----AARNSLASDNTAGQPGRLGSVSSPRYDSEEATSMGFNGAGREANGSSNAVSSLVKE  1007

Query  341   FEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHK  520
             FEQR Q F DDAK LVEVK G + AN+NP+ +LR+LKH FESWKK+Y  RL+ETK  LHK
Sbjct  1008  FEQRRQTFNDDAKALVEVKPGQSAANMNPEEDLRKLKHRFESWKKEYKARLRETKTKLHK  1067

Query  521   L-GSEEGASDKMKKKWWGRRNS  583
             +  SEE   +K ++KWW +  S
Sbjct  1068  IWHSEE---EKRQRKWWAKIGS  1086



>ref|XP_009342449.1| PREDICTED: myosin-2 isoform X1 [Pyrus x bretschneideri]
Length=1090

 Score =   154 bits (389),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 129/202 (64%), Gaps = 21/202 (10%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L  K+EEN  L ++LQQ+E RWSE+E KMKSM++VWQKQM SLQ+SL+      
Sbjct  899   LQAEATLVRKEEENAELQEQLQQFETRWSEHESKMKSMQDVWQKQMASLQTSLA------  952

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNR------TALENNGV-RPVRAGLSVIGQLAEE  340
                 +ARNS AS N +   G    + + R      T++  NG  R      + +  L +E
Sbjct  953   ----AARNSLASDNTAGQPGRLGSVSSPRYDSEEATSMGFNGAGREANGSSNAVSSLVKE  1008

Query  341   FEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHK  520
             FEQR Q F DDAK LVEVK G + AN+NP+ +LR+LKH FESWKK+Y  RL+ETK  LHK
Sbjct  1009  FEQRRQTFNDDAKALVEVKPGQSAANMNPEEDLRKLKHRFESWKKEYKARLRETKTKLHK  1068

Query  521   L-GSEEGASDKMKKKWWGRRNS  583
             +  SEE   +K ++KWW +  S
Sbjct  1069  IWHSEE---EKRQRKWWAKIGS  1087



>ref|XP_009342454.1| PREDICTED: myosin-2 isoform X5 [Pyrus x bretschneideri]
Length=1145

 Score =   154 bits (388),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 129/202 (64%), Gaps = 21/202 (10%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L  K+EEN  L ++LQQ+E RWSE+E KMKSM++VWQKQM SLQ+SL+      
Sbjct  954   LQAEATLVRKEEENAELQEQLQQFETRWSEHESKMKSMQDVWQKQMASLQTSLA------  1007

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNR------TALENNGV-RPVRAGLSVIGQLAEE  340
                 +ARNS AS N +   G    + + R      T++  NG  R      + +  L +E
Sbjct  1008  ----AARNSLASDNTAGQPGRLGSVSSPRYDSEEATSMGFNGAGREANGSSNAVSSLVKE  1063

Query  341   FEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHK  520
             FEQR Q F DDAK LVEVK G + AN+NP+ +LR+LKH FESWKK+Y  RL+ETK  LHK
Sbjct  1064  FEQRRQTFNDDAKALVEVKPGQSAANMNPEEDLRKLKHRFESWKKEYKARLRETKTKLHK  1123

Query  521   L-GSEEGASDKMKKKWWGRRNS  583
             +  SEE   +K ++KWW +  S
Sbjct  1124  IWHSEE---EKRQRKWWAKIGS  1142



>ref|XP_008345271.1| PREDICTED: myosin-2-like isoform X3 [Malus domestica]
Length=1143

 Score =   154 bits (388),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 133/199 (67%), Gaps = 15/199 (8%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L  K+EEN  L ++LQQ+E RWSEYE KMKSM++VWQKQM SLQ+SL+ A+KSL
Sbjct  952   LQAEATLVRKEEENAELQEQLQQFETRWSEYESKMKSMQDVWQKQMASLQTSLAAARKSL  1011

Query  182   alDDSA----RNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQ  349
             A D++A    R    S    D + +T  +G N   LE NG     +GL       +EFEQ
Sbjct  1012  ASDNTAGQPGRLGSVSSPRYDSEEAT-SMGFNGAGLEANGSSNAVSGL------VKEFEQ  1064

Query  350   RSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKL-G  526
             R Q F DDAK LVEVK G + AN+NP+ +LR+LKH FESWKK+Y  RL+ETK  LHK+  
Sbjct  1065  RRQTFDDDAKALVEVKPGQSAANMNPEEDLRKLKHRFESWKKEYKARLRETKTKLHKIWH  1124

Query  527   SEEGASDKMKKKWWGRRNS  583
             SEE   +K ++KWW +  S
Sbjct  1125  SEE---EKRQRKWWAKIGS  1140



>ref|XP_008345269.1| PREDICTED: myosin-2-like isoform X1 [Malus domestica]
Length=1145

 Score =   154 bits (388),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 133/199 (67%), Gaps = 15/199 (8%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L  K+EEN  L ++LQQ+E RWSEYE KMKSM++VWQKQM SLQ+SL+ A+KSL
Sbjct  954   LQAEATLVRKEEENAELQEQLQQFETRWSEYESKMKSMQDVWQKQMASLQTSLAAARKSL  1013

Query  182   alDDSA----RNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQ  349
             A D++A    R    S    D + +T  +G N   LE NG     +GL       +EFEQ
Sbjct  1014  ASDNTAGQPGRLGSVSSPRYDSEEAT-SMGFNGAGLEANGSSNAVSGL------VKEFEQ  1066

Query  350   RSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKL-G  526
             R Q F DDAK LVEVK G + AN+NP+ +LR+LKH FESWKK+Y  RL+ETK  LHK+  
Sbjct  1067  RRQTFDDDAKALVEVKPGQSAANMNPEEDLRKLKHRFESWKKEYKARLRETKTKLHKIWH  1126

Query  527   SEEGASDKMKKKWWGRRNS  583
             SEE   +K ++KWW +  S
Sbjct  1127  SEE---EKRQRKWWAKIGS  1142



>ref|XP_006657835.1| PREDICTED: myosin-2-like [Oryza brachyantha]
Length=1235

 Score =   154 bits (388),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 132/212 (62%), Gaps = 27/212 (13%)
 Frame = +2

Query  5     RAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksla  184
             +AEAALR+K+EEN +L Q+L QYE +WSEYE KMKSMEE W+KQ+ SLQ SL  AKKSL 
Sbjct  1031  KAEAALRDKEEENAMLKQQLDQYEKKWSEYEAKMKSMEEAWKKQLSSLQLSLVAAKKSLT  1090

Query  185   lDDSAR---------------NSDASVNASDDKGSTWDIGNN----RTALENNGVRPVRA  307
              DD A                + D S      +G+ +    +    R A  N+  R    
Sbjct  1091  SDDVATRAARTDAAPTHAHYDSEDTSTGTHTPEGTEFKYQTHNPEARVAAPNSDRR----  1146

Query  308   GLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGV  487
              L+ +  LA+EFE R QVF DDA FLV VKSG   +N+NPD ELR+LK  F +WKKDY  
Sbjct  1147  -LNAVNHLAKEFEDRRQVFEDDAGFLVAVKSGQVGSNMNPDDELRKLKDRFATWKKDYKS  1205

Query  488   RLKETKVILHKLGSEEGASDKMKKKWWGRRNS  583
             RLKETKV L K+G+ E   +K +K+WWG+++S
Sbjct  1206  RLKETKVNLQKVGNHE---EKSRKRWWGKKSS  1234



>ref|XP_008345270.1| PREDICTED: myosin-2-like isoform X2 [Malus domestica]
Length=1143

 Score =   154 bits (388),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 133/199 (67%), Gaps = 15/199 (8%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L  K+EEN  L ++LQQ+E RWSEYE KMKSM++VWQKQM SLQ+SL+ A+KSL
Sbjct  952   LQAEATLVRKEEENAELQEQLQQFETRWSEYESKMKSMQDVWQKQMASLQTSLAAARKSL  1011

Query  182   alDDSA----RNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQ  349
             A D++A    R    S    D + +T  +G N   LE NG     +GL       +EFEQ
Sbjct  1012  ASDNTAGQPGRLGSVSSPRYDSEEAT-SMGFNGAGLEANGSSNAVSGL------VKEFEQ  1064

Query  350   RSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKL-G  526
             R Q F DDAK LVEVK G + AN+NP+ +LR+LKH FESWKK+Y  RL+ETK  LHK+  
Sbjct  1065  RRQTFDDDAKALVEVKPGQSAANMNPEEDLRKLKHRFESWKKEYKARLRETKTKLHKIWH  1124

Query  527   SEEGASDKMKKKWWGRRNS  583
             SEE   +K ++KWW +  S
Sbjct  1125  SEE---EKRQRKWWAKIGS  1140



>ref|XP_002281748.1| PREDICTED: myosin-2 [Vitis vinifera]
Length=1229

 Score =   154 bits (388),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 133/201 (66%), Gaps = 10/201 (5%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L +K+EEN  L ++L+Q E +WSEYE KMK+MEE WQKQM SLQ SL+ AKK+ 
Sbjct  1029  LKAEATLGQKEEENAALREQLKQSEAKWSEYEAKMKAMEETWQKQMASLQMSLAAAKKNH  1088

Query  182   alDDSAR-NSDASVNASDDKGS----TWDIG-NNRTALENNGV-RPVRAGLSVIGQLAEE  340
             A     R ++ +S    D +G+    T   G N    L N G  R     L+ +  LA+E
Sbjct  1089  AAGQDGRLDTPSSPGYYDSEGTPSMETRTPGANTPVKLSNVGAGRESNGNLNTVSHLAKE  1148

Query  341   FEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHK  520
             FEQR Q F DDAK LVEVKSG   +N+N D EL++LK  FE+WKKDY VRL+ETK  LHK
Sbjct  1149  FEQRKQSFDDDAKTLVEVKSGQPSSNMNHD-ELKKLKQRFEAWKKDYKVRLRETKARLHK  1207

Query  521   LGSEEGASDKMKKKWWGRRNS  583
             LG  EG  +++++KWWG+R S
Sbjct  1208  LGHSEG--ERIRRKWWGKRIS  1226



>emb|CBI20376.3| unnamed protein product [Vitis vinifera]
Length=1197

 Score =   153 bits (387),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 133/201 (66%), Gaps = 10/201 (5%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L +K+EEN  L ++L+Q E +WSEYE KMK+MEE WQKQM SLQ SL+ AKK+ 
Sbjct  997   LKAEATLGQKEEENAALREQLKQSEAKWSEYEAKMKAMEETWQKQMASLQMSLAAAKKNH  1056

Query  182   alDDSAR-NSDASVNASDDKGS----TWDIG-NNRTALENNGV-RPVRAGLSVIGQLAEE  340
             A     R ++ +S    D +G+    T   G N    L N G  R     L+ +  LA+E
Sbjct  1057  AAGQDGRLDTPSSPGYYDSEGTPSMETRTPGANTPVKLSNVGAGRESNGNLNTVSHLAKE  1116

Query  341   FEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHK  520
             FEQR Q F DDAK LVEVKSG   +N+N D EL++LK  FE+WKKDY VRL+ETK  LHK
Sbjct  1117  FEQRKQSFDDDAKTLVEVKSGQPSSNMNHD-ELKKLKQRFEAWKKDYKVRLRETKARLHK  1175

Query  521   LGSEEGASDKMKKKWWGRRNS  583
             LG  EG  +++++KWWG+R S
Sbjct  1176  LGHSEG--ERIRRKWWGKRIS  1194



>gb|KHM98905.1| hypothetical protein glysoja_039075 [Glycine soja]
Length=123

 Score =   140 bits (353),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = +2

Query  104  MKSMEEVWQKQMRslqsslsiakkslalDDSARNSDASVNASDDKGSTWDIGNNRTALEN  283
            MKSMEEVWQKQMR +QSSLSIAKKSLA+DDS RNS+AS+NASDD+  +WD+G N    E+
Sbjct  1    MKSMEEVWQKQMRYVQSSLSIAKKSLAMDDSERNSNASINASDDRDFSWDVGTNHQRQES  60

Query  284  NGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELR  442
            NG R + A LSVI +LAEEFEQRSQVFGDDAKFLVEVKSG  EA+LNP+ E++
Sbjct  61   NGARLMSATLSVISRLAEEFEQRSQVFGDDAKFLVEVKSGQVEASLNPNREVK  113



>ref|XP_009412435.1| PREDICTED: myosin-1-like [Musa acuminata subsp. malaccensis]
Length=1225

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 133/203 (66%), Gaps = 15/203 (7%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             LRAEAALR+K+EEN IL QRL+ Y+ RWSEYELKMKSME+ WQKQ+ SLQS+L+ A+KSL
Sbjct  1027  LRAEAALRKKEEENAILQQRLKHYDTRWSEYELKMKSMEQTWQKQLTSLQSTLAAARKSL  1086

Query  182   alDDSARNSDASVNA------SDDKGSTWD-IGNNRTALENNGVRPVRAG----LSVIGQ  328
               D + R    +++A      S+D  ST +    +  A ++ G   VR+     ++VI  
Sbjct  1087  TSDMANRPGQLNMSAVNNCYDSEDTISTVNQTPEDTPAKQSIGAEEVRSNDSKEIAVI-H  1145

Query  329   LAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKV  508
             L  EFEQ+ QVF DDA F+VE KSG + + +NPD EL+ LK  F +WKK Y +RL+ETK 
Sbjct  1146  LVNEFEQQRQVFEDDAGFIVEAKSGQSSSKINPDEELQNLKARFSTWKKVYKLRLRETKA  1205

Query  509   ILHKLGSEEGASDKMKKKWWGRR  577
              L K G+ E   +K  KKWW  R
Sbjct  1206  SLQKFGNPE---EKASKKWWSIR  1225



>ref|XP_001777862.1| predicted protein [Physcomitrella patens]
 gb|EDQ57290.1| predicted protein [Physcomitrella patens]
Length=1057

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 100/221 (45%), Positives = 134/221 (61%), Gaps = 28/221 (13%)
 Frame = +2

Query  8     AEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslal  187
             AE ALREK+E+N +L QRL  YE RW EYE KM SME++WQKQM SLQ SL+ AKKSLA 
Sbjct  831   AEKALREKEEDNAMLRQRLLHYEARWMEYEAKMSSMEDMWQKQMSSLQLSLAAAKKSLAT  890

Query  188   DDSARNSDASVN--------ASDDKGSTWDIGNNR--TALENNGVR-PVRAGLSVIGQLA  334
             D+    +    +        A++   S  D  N    T   N   R  V A  SV+  L 
Sbjct  891   DEFLPQTPGKHDNEFDWDDVATNGMKSPDDFTNKYLVTGSGNGASRGDVEAARSVVSHLT  950

Query  335   EEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVIL  514
              E++ R+QVF DD  FL+EVKSGLTEANLNP+ ELR+LK  F++W++D+  RL+ET+++L
Sbjct  951   REYDHRTQVFNDDVDFLIEVKSGLTEANLNPEEELRKLKVRFDTWRRDFKARLRETRLVL  1010

Query  515   HKLGSEEGA-----------------SDKMKKKWWGRRNSS  586
             +KL S + A                  D+ +KKWWG++ +S
Sbjct  1011  NKLCSLDSAEKDGDRMLCALDSLEKEGDRTRKKWWGKKTTS  1051



>gb|AEM05968.1| myosin VIII D [Physcomitrella patens]
Length=1365

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 100/233 (43%), Positives = 130/233 (56%), Gaps = 44/233 (19%)
 Frame = +2

Query  8     AEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslal  187
             AE ALREK+E+N +L QRL  YE RW EYE KM SMEE+WQKQM SLQ S++ AK+SLA 
Sbjct  1137  AEKALREKEEDNAVLRQRLLHYEARWMEYEAKMSSMEEMWQKQMSSLQLSIAAAKQSLAT  1196

Query  188   DDSARNSDASVNASDDKGSTWDIGNNRTA----------------LENNGVRP-------  298
             D+    +       DD G        R                     NG R        
Sbjct  1197  DEHPLQTPVK----DDNGCISIEKQQRITKRQLLPPGDEQLDWDDAATNGTRSPDQFTNK  1252

Query  299   --------------VRAGLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHE  436
                           V A  SV+  L  E++ R+QVF DD  FLVEVKSGLTEA+LNP+ E
Sbjct  1253  YLVTGSEYSTPRGDVDAARSVVNHLMREYDHRTQVFNDDVDFLVEVKSGLTEAHLNPEDE  1312

Query  437   LRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA---SDKMKKKWWGRRNSS  586
             LR+LK  F++WKKD+ VRL+ETK++L+KL + + A    D+ ++ WWG+R + 
Sbjct  1313  LRKLKVRFDTWKKDFKVRLRETKLVLNKLCAMDSAEKEKDRTRRNWWGKRTTP  1365



>ref|XP_010905572.1| PREDICTED: myosin-1-like [Elaeis guineensis]
Length=1243

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 105/224 (47%), Positives = 134/224 (60%), Gaps = 38/224 (17%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA LREK+EEN IL Q+LQQYE RWSEYE KMK MEE WQKQ+ SLQ SL+ A+KSL
Sbjct  1019  LKAEALLREKEEENAILKQQLQQYEMRWSEYEAKMKFMEETWQKQLSSLQVSLAAARKSL  1078

Query  182   alDDSARNS---DASV--------------------------NASD-----DKGSTWDIG  259
             A DD A +    DAS                           +A D     +   TW   
Sbjct  1079  ADDDMASHQGKLDASPVQHSYDSEDAISAGTRTPEGTPAKRSHACDAGVVRNSNGTWSAV  1138

Query  260   NNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHEL  439
              +  A +   +R      S +  L +EFEQ++QVF DDA FLVEVKS   ++++NPD EL
Sbjct  1139  KHLDASDAGLIRYSNGTQSAVSHLVKEFEQQTQVFEDDAVFLVEVKSR-QDSSINPDEEL  1197

Query  440   RRLKHMFESWKKDYGVRLKETKVILHKLGSEEGASDKMKKKWWG  571
             ++LK  F +WKKDY VRLKETK+ L KLG+ E   ++ +K+WWG
Sbjct  1198  QKLKARFVTWKKDYKVRLKETKIALQKLGNPE---ERTRKRWWG  1238



>ref|XP_001768683.1| predicted protein [Physcomitrella patens]
 gb|EDQ66621.1| predicted protein [Physcomitrella patens]
Length=1028

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 128/193 (66%), Gaps = 8/193 (4%)
 Frame = +2

Query  8     AEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslal  187
             AE  L EK+E+N +L QR+Q YEN+W EYE KM SMEE+WQKQM +LQ SL+ AKKS+A 
Sbjct  826   AERTLLEKEEDNALLRQRIQHYENQWVEYEAKMSSMEEMWQKQMSTLQLSLAAAKKSIAT  885

Query  188   DDSARNSDASVNASDDKGSTWDIGNNRTALENNGVR------PVRAGLSVIGQLAEEFEQ  349
             ++SA    +S + S+D+ +  ++ NN     + G         V AG S + QL  EF+ 
Sbjct  886   EESATLQTSSKDGSEDQKT--NVENNSNKFLHAGSELGSSQGEVAAGHSYVTQLDREFDH  943

Query  350   RSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGS  529
             R QVF DD  FLVEVKSG T A+L+P+ ELR+LK  F++WKKD+ VRL+ETK +L KLG 
Sbjct  944   RKQVFTDDIDFLVEVKSGQTTAHLSPEDELRKLKTRFDAWKKDFKVRLRETKAVLSKLGH  1003

Query  530   EEGASDKMKKKWW  568
              + +   ++ K W
Sbjct  1004  TDSSDKWIRGKKW  1016



>ref|XP_008366419.1| PREDICTED: myosin-2 isoform X2 [Malus domestica]
Length=1153

 Score =   149 bits (376),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 97/212 (46%), Positives = 127/212 (60%), Gaps = 32/212 (15%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L  K+EEN  L ++LQQ+E RWSEYE KMKSM++VWQKQM SLQ+SL+      
Sbjct  953   LQAEATLVRKEEENAELQEQLQQFETRWSEYESKMKSMQDVWQKQMVSLQTSLA------  1006

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNR-----------------TALENNGVRPVRAG  310
                 +AR S  S N +    +   + + R                 T L   G R     
Sbjct  1007  ----AARKSLGSANTAGQPVTLGSVSSARYDSEEATSMGSRTPGASTPLNGAG-REANGS  1061

Query  311   LSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVR  490
              + +  L +EFEQR Q+F DDAK LVEVK G + AN+NP+ +LR+LKH FESWKK+Y  R
Sbjct  1062  SNAVSNLLKEFEQRRQIFDDDAKALVEVKPGQSAANMNPEEDLRKLKHRFESWKKEYKAR  1121

Query  491   LKETKVILHKL-GSEEGASDKMKKKWWGRRNS  583
             L+ETK  LHK+  SEE   +K ++KWWG+  S
Sbjct  1122  LRETKTKLHKIWHSEE---EKRRRKWWGKIGS  1150



>ref|XP_008366425.1| PREDICTED: myosin-2 isoform X3 [Malus domestica]
Length=1153

 Score =   149 bits (376),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 97/212 (46%), Positives = 127/212 (60%), Gaps = 32/212 (15%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L  K+EEN  L ++LQQ+E RWSEYE KMKSM++VWQKQM SLQ+SL+      
Sbjct  953   LQAEATLVRKEEENAELQEQLQQFETRWSEYESKMKSMQDVWQKQMVSLQTSLA------  1006

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNR-----------------TALENNGVRPVRAG  310
                 +AR S  S N +    +   + + R                 T L   G R     
Sbjct  1007  ----AARKSLGSANTAGQPVTLGSVSSARYDSEEATSMGSRTPGASTPLNGAG-REANGS  1061

Query  311   LSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVR  490
              + +  L +EFEQR Q+F DDAK LVEVK G + AN+NP+ +LR+LKH FESWKK+Y  R
Sbjct  1062  SNAVSNLLKEFEQRRQIFDDDAKALVEVKPGQSAANMNPEEDLRKLKHRFESWKKEYKAR  1121

Query  491   LKETKVILHKL-GSEEGASDKMKKKWWGRRNS  583
             L+ETK  LHK+  SEE   +K ++KWWG+  S
Sbjct  1122  LRETKTKLHKIWHSEE---EKRRRKWWGKIGS  1150



>ref|XP_008366413.1| PREDICTED: myosin-2 isoform X1 [Malus domestica]
Length=1155

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 97/212 (46%), Positives = 127/212 (60%), Gaps = 32/212 (15%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L  K+EEN  L ++LQQ+E RWSEYE KMKSM++VWQKQM SLQ+SL+      
Sbjct  955   LQAEATLVRKEEENAELQEQLQQFETRWSEYESKMKSMQDVWQKQMVSLQTSLA------  1008

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNR-----------------TALENNGVRPVRAG  310
                 +AR S  S N +    +   + + R                 T L   G R     
Sbjct  1009  ----AARKSLGSANTAGQPVTLGSVSSARYDSEEATSMGSRTPGASTPLNGAG-REANGS  1063

Query  311   LSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVR  490
              + +  L +EFEQR Q+F DDAK LVEVK G + AN+NP+ +LR+LKH FESWKK+Y  R
Sbjct  1064  SNAVSNLLKEFEQRRQIFDDDAKALVEVKPGQSAANMNPEEDLRKLKHRFESWKKEYKAR  1123

Query  491   LKETKVILHKL-GSEEGASDKMKKKWWGRRNS  583
             L+ETK  LHK+  SEE   +K ++KWWG+  S
Sbjct  1124  LRETKTKLHKIWHSEE---EKRRRKWWGKIGS  1152



>ref|XP_009334584.1| PREDICTED: myosin-2 isoform X1 [Pyrus x bretschneideri]
Length=1155

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 97/212 (46%), Positives = 127/212 (60%), Gaps = 32/212 (15%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L  K+EEN  L ++LQQ+E RWSEYE KMKSM++VWQKQM SLQ+SL+      
Sbjct  955   LQAEATLVRKEEENAELQEQLQQFETRWSEYESKMKSMQDVWQKQMVSLQTSLA------  1008

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNR-----------------TALENNGVRPVRAG  310
                 +AR S  S N +    +   + + R                 T L   G R     
Sbjct  1009  ----AARKSLGSANTAGQPVTLGSVSSARYDSEEATSMGSRTPGASTPLNGAG-REANGS  1063

Query  311   LSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVR  490
              + +  L +EFEQR Q+F DDAK LVEVK G + AN+NP+ +LR+LKH FESWKK+Y  R
Sbjct  1064  SNAVSTLLKEFEQRRQIFDDDAKALVEVKPGQSAANMNPEEDLRKLKHRFESWKKEYKAR  1123

Query  491   LKETKVILHKL-GSEEGASDKMKKKWWGRRNS  583
             L+ETK  LHK+  SEE   +K ++KWWG+  S
Sbjct  1124  LRETKTKLHKIWHSEE---EKRRRKWWGKIGS  1152



>ref|XP_009334585.1| PREDICTED: myosin-2 isoform X2 [Pyrus x bretschneideri]
Length=1153

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 97/212 (46%), Positives = 127/212 (60%), Gaps = 32/212 (15%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L  K+EEN  L ++LQQ+E RWSEYE KMKSM++VWQKQM SLQ+SL+      
Sbjct  953   LQAEATLVRKEEENAELQEQLQQFETRWSEYESKMKSMQDVWQKQMVSLQTSLA------  1006

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNR-----------------TALENNGVRPVRAG  310
                 +AR S  S N +    +   + + R                 T L   G R     
Sbjct  1007  ----AARKSLGSANTAGQPVTLGSVSSARYDSEEATSMGSRTPGASTPLNGAG-REANGS  1061

Query  311   LSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVR  490
              + +  L +EFEQR Q+F DDAK LVEVK G + AN+NP+ +LR+LKH FESWKK+Y  R
Sbjct  1062  SNAVSTLLKEFEQRRQIFDDDAKALVEVKPGQSAANMNPEEDLRKLKHRFESWKKEYKAR  1121

Query  491   LKETKVILHKL-GSEEGASDKMKKKWWGRRNS  583
             L+ETK  LHK+  SEE   +K ++KWWG+  S
Sbjct  1122  LRETKTKLHKIWHSEE---EKRRRKWWGKIGS  1150



>ref|XP_009334586.1| PREDICTED: myosin-2 isoform X3 [Pyrus x bretschneideri]
Length=1153

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 97/212 (46%), Positives = 127/212 (60%), Gaps = 32/212 (15%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L  K+EEN  L ++LQQ+E RWSEYE KMKSM++VWQKQM SLQ+SL+      
Sbjct  953   LQAEATLVRKEEENAELQEQLQQFETRWSEYESKMKSMQDVWQKQMVSLQTSLA------  1006

Query  182   alDDSARNSDASVNASDDKGSTWDIGNNR-----------------TALENNGVRPVRAG  310
                 +AR S  S N +    +   + + R                 T L   G R     
Sbjct  1007  ----AARKSLGSANTAGQPVTLGSVSSARYDSEEATSMGSRTPGASTPLNGAG-REANGS  1061

Query  311   LSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVR  490
              + +  L +EFEQR Q+F DDAK LVEVK G + AN+NP+ +LR+LKH FESWKK+Y  R
Sbjct  1062  SNAVSTLLKEFEQRRQIFDDDAKALVEVKPGQSAANMNPEEDLRKLKHRFESWKKEYKAR  1121

Query  491   LKETKVILHKL-GSEEGASDKMKKKWWGRRNS  583
             L+ETK  LHK+  SEE   +K ++KWWG+  S
Sbjct  1122  LRETKTKLHKIWHSEE---EKRRRKWWGKIGS  1150



>ref|XP_011044539.1| PREDICTED: myosin-2 [Populus euphratica]
 ref|XP_011044540.1| PREDICTED: myosin-2 [Populus euphratica]
 ref|XP_011044541.1| PREDICTED: myosin-2 [Populus euphratica]
 ref|XP_011044543.1| PREDICTED: myosin-2 [Populus euphratica]
Length=1197

 Score =   149 bits (375),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 138/206 (67%), Gaps = 17/206 (8%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             ++AEA + +K+EEN  L ++LQQYE RWS+YE KMK+MEE+WQ QM SLQ+SL+ A+KSL
Sbjct  994   VKAEATIGKKEEENAALQEQLQQYEKRWSDYEAKMKAMEEMWQMQMLSLQTSLAAARKSL  1053

Query  182   alDDSARNS---DASVNA----SDDKGS--TWDIGNNRTALENNGVRPVRAG------LS  316
             A D++A      D+S +     S+D  S  +   G N   +  N    +RAG      ++
Sbjct  1054  AADNTAAQPGKLDSSTSPRDYDSEDNVSMESRTPGGNTPNIFANAFPDLRAGRENNGPVN  1113

Query  317   VIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLK  496
             V+  LA+EFE + Q F DDAK LVEV++G + +N+NPD ELRRLK  FE+WKKDY VRL+
Sbjct  1114  VVNNLAKEFELQKQNFDDDAKALVEVRAGQSASNMNPDEELRRLKLKFETWKKDYKVRLR  1173

Query  497   ETKVILHKLGSEEGASDKMKKKWWGR  574
             ETK  LHKLG   G  D+ ++KWW R
Sbjct  1174  ETKTRLHKLG--HGEVDRNRRKWWRR  1197



>gb|AEM05969.1| myosin VIII E [Physcomitrella patens]
Length=1369

 Score =   149 bits (376),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 130/231 (56%), Gaps = 38/231 (16%)
 Frame = +2

Query  8     AEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslal  187
             AE ALREK+EEN  + Q++  YE RW EYE KM SMEE+WQKQM SLQ SLS AK+SLA 
Sbjct  1139  AEKALREKEEENASMRQKILHYEARWMEYEAKMTSMEEMWQKQMSSLQLSLSAAKRSLAT  1198

Query  188   DDSA----------------------RNSDASVNASDDKGSTWDIGN-----------NR  268
             DD +                      R     +   DD+   WD              NR
Sbjct  1199  DDYSMLQTPTKDHDSINDRFSAGKHQRTKRQLLPPPDDEEFDWDDATTNGTRSPDQFYNR  1258

Query  269   TALENNGVRPVR----AGLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHE  436
               L        R    A  SV+  L  EF+ R+QVF DDA FL+EVKSGLTEA L+P+ E
Sbjct  1259  YLLPGRECSTPRGDVDAARSVVNHLVREFDHRTQVFNDDADFLIEVKSGLTEAPLDPEEE  1318

Query  437   LRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGA-SDKMKKKWWGRRNSS  586
             LR+L+  F++WKKD+  RL+ETK++L +L + + A  +K +KKWW +R + 
Sbjct  1319  LRKLRMRFDTWKKDFKTRLRETKLVLQRLCNVDSAEKEKTRKKWWSKRTTP  1369



>ref|XP_007021261.1| Myosin 2 isoform 1 [Theobroma cacao]
 gb|EOY12786.1| Myosin 2 isoform 1 [Theobroma cacao]
Length=1221

 Score =   148 bits (374),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 130/208 (63%), Gaps = 18/208 (9%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L +K++EN  L ++LQQYE RW EYE KMKSMEE+WQKQM SLQSSL+ A+KSL
Sbjct  1016  LKAEATLGQKEQENATLREQLQQYEARWLEYESKMKSMEEMWQKQMASLQSSLAAARKSL  1075

Query  182   alDDSA----RNSDASVNASDDK----GSTWDIGNNRTALENNGVRPVRAG------LSV  319
             A D +     R   AS    D +    GS    GN  T +  +G  P   G      L+ 
Sbjct  1076  AADSTTGQLGRVDVASPRCYDSEDMSMGSRTPGGN--TPVLYSGAMPDFVGGRENGSLNA  1133

Query  320   IGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKE  499
             +  L +E EQR Q F DDAK L+EV++    +  NPD ELRRLK  FE+WKKDY  RL+E
Sbjct  1134  VSNLVKELEQRKQTFDDDAKSLIEVRTANPGSVTNPDDELRRLKLRFETWKKDYKTRLRE  1193

Query  500   TKVILHKLGSEEGASDKMKKKWWGRRNS  583
             TK  LHK G  E  SDK ++KWWG+ +S
Sbjct  1194  TKARLHKRGHPE--SDKARRKWWGKLSS  1219



>ref|XP_007021262.1| Myosin 2 isoform 2 [Theobroma cacao]
 gb|EOY12787.1| Myosin 2 isoform 2 [Theobroma cacao]
Length=1220

 Score =   148 bits (374),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 130/208 (63%), Gaps = 18/208 (9%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L +K++EN  L ++LQQYE RW EYE KMKSMEE+WQKQM SLQSSL+ A+KSL
Sbjct  1015  LKAEATLGQKEQENATLREQLQQYEARWLEYESKMKSMEEMWQKQMASLQSSLAAARKSL  1074

Query  182   alDDSA----RNSDASVNASDDK----GSTWDIGNNRTALENNGVRPVRAG------LSV  319
             A D +     R   AS    D +    GS    GN  T +  +G  P   G      L+ 
Sbjct  1075  AADSTTGQLGRVDVASPRCYDSEDMSMGSRTPGGN--TPVLYSGAMPDFVGGRENGSLNA  1132

Query  320   IGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKE  499
             +  L +E EQR Q F DDAK L+EV++    +  NPD ELRRLK  FE+WKKDY  RL+E
Sbjct  1133  VSNLVKELEQRKQTFDDDAKSLIEVRTANPGSVTNPDDELRRLKLRFETWKKDYKTRLRE  1192

Query  500   TKVILHKLGSEEGASDKMKKKWWGRRNS  583
             TK  LHK G  E  SDK ++KWWG+ +S
Sbjct  1193  TKARLHKRGHPE--SDKARRKWWGKLSS  1218



>gb|KJB13459.1| hypothetical protein B456_002G076300 [Gossypium raimondii]
Length=781

 Score =   147 bits (370),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 127/201 (63%), Gaps = 23/201 (11%)
 Frame = +2

Query  2    LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
            L+AEA L +K++EN  L ++LQQYE RW EYE KMKSME++WQKQM SLQ+SL+ A+KSL
Sbjct  585  LKAEAILGQKEQENATLREQLQQYEARWLEYEAKMKSMEDMWQKQMASLQTSLAAARKSL  644

Query  182  alDDSA----------RNSDASVNASDDKGSTWDIGNNRTAL--ENNGVRPVRAGLSVIG  325
            A D +A          R  D+  N S   GS   +GN    +    NG       L+ +G
Sbjct  645  AADSNAGQRRGDVVSPRYYDSEDNVS--MGSRTPVGNMPDVVGGRENG------SLNAVG  696

Query  326  QLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETK  505
             L +EFEQR Q F DDAK L E++     +N+NPD E RRLK  FE+WKK+Y +RLKETK
Sbjct  697  NLLKEFEQRRQTFDDDAKSLAEIRMAQPTSNVNPDDEFRRLKRRFETWKKEYKLRLKETK  756

Query  506  VILHKLGSEEGASDKMKKKWW  568
              LHK G E   SDK ++KWW
Sbjct  757  ARLHKRGYE---SDKTRRKWW  774



>gb|KJB13460.1| hypothetical protein B456_002G076300 [Gossypium raimondii]
Length=797

 Score =   147 bits (370),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 127/201 (63%), Gaps = 23/201 (11%)
 Frame = +2

Query  2    LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
            L+AEA L +K++EN  L ++LQQYE RW EYE KMKSME++WQKQM SLQ+SL+ A+KSL
Sbjct  601  LKAEAILGQKEQENATLREQLQQYEARWLEYEAKMKSMEDMWQKQMASLQTSLAAARKSL  660

Query  182  alDDSA----------RNSDASVNASDDKGSTWDIGNNRTAL--ENNGVRPVRAGLSVIG  325
            A D +A          R  D+  N S   GS   +GN    +    NG       L+ +G
Sbjct  661  AADSNAGQRRGDVVSPRYYDSEDNVS--MGSRTPVGNMPDVVGGRENG------SLNAVG  712

Query  326  QLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETK  505
             L +EFEQR Q F DDAK L E++     +N+NPD E RRLK  FE+WKK+Y +RLKETK
Sbjct  713  NLLKEFEQRRQTFDDDAKSLAEIRMAQPTSNVNPDDEFRRLKRRFETWKKEYKLRLKETK  772

Query  506  VILHKLGSEEGASDKMKKKWW  568
              LHK G E   SDK ++KWW
Sbjct  773  ARLHKRGYE---SDKTRRKWW  790



>gb|KJB13461.1| hypothetical protein B456_002G076300 [Gossypium raimondii]
Length=790

 Score =   147 bits (370),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 127/201 (63%), Gaps = 23/201 (11%)
 Frame = +2

Query  2    LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
            L+AEA L +K++EN  L ++LQQYE RW EYE KMKSME++WQKQM SLQ+SL+ A+KSL
Sbjct  594  LKAEAILGQKEQENATLREQLQQYEARWLEYEAKMKSMEDMWQKQMASLQTSLAAARKSL  653

Query  182  alDDSA----------RNSDASVNASDDKGSTWDIGNNRTAL--ENNGVRPVRAGLSVIG  325
            A D +A          R  D+  N S   GS   +GN    +    NG       L+ +G
Sbjct  654  AADSNAGQRRGDVVSPRYYDSEDNVS--MGSRTPVGNMPDVVGGRENG------SLNAVG  705

Query  326  QLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETK  505
             L +EFEQR Q F DDAK L E++     +N+NPD E RRLK  FE+WKK+Y +RLKETK
Sbjct  706  NLLKEFEQRRQTFDDDAKSLAEIRMAQPTSNVNPDDEFRRLKRRFETWKKEYKLRLKETK  765

Query  506  VILHKLGSEEGASDKMKKKWW  568
              LHK G E   SDK ++KWW
Sbjct  766  ARLHKRGYE---SDKTRRKWW  783



>ref|XP_008226710.1| PREDICTED: myosin-2 isoform X1 [Prunus mume]
Length=1144

 Score =   148 bits (373),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 128/201 (64%), Gaps = 9/201 (4%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L  K+EEN  L  +L+Q+E RWSEY+ KMKSM++VWQKQM SLQ+SL+ A+KSL
Sbjct  943   LQAEATLERKEEENAELQGQLRQFETRWSEYDAKMKSMQDVWQKQMASLQTSLAAARKSL  1002

Query  182   alDDSARNSDASVNASD---DKGSTWDIGNNRTALE---NNGVRPVRAGLSVIGQLAEEF  343
             A D++A      V AS    D      +G+         N G R     L  +  L +EF
Sbjct  1003  ASDNTAGQPGRLVVASSPRYDSEEALSMGSRTPGASTPINGGGRETNGTLHAVSNLMKEF  1062

Query  344   EQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKL  523
             EQR Q F DDAK LVEVK G +  N+NP+ ELR+LKH FESWKK+Y  RL+ETK  +HKL
Sbjct  1063  EQRKQHFDDDAKALVEVKPGHSGVNMNPEEELRKLKHRFESWKKEYKARLRETKTKVHKL  1122

Query  524   -GSEEGASDKMKKKWWGRRNS  583
               SEE    +  +KWWG+ +S
Sbjct  1123  WHSEE--EKRRSRKWWGKISS  1141



>ref|XP_010268832.1| PREDICTED: myosin-2 [Nelumbo nucifera]
Length=1223

 Score =   148 bits (373),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 139/210 (66%), Gaps = 19/210 (9%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L AEAAL  K+EEN  L ++LQQ+E RWS+YE KMKSMEE+WQK+M SLQ SL+I K+SL
Sbjct  1014  LMAEAALVRKEEENAALQEQLQQFEKRWSDYEAKMKSMEEMWQKEMTSLQRSLAIVKRSL  1073

Query  182   alDDSARNS---DA--------SVNASDDKGSTWDIG-----NNRTALENNGVRPVRAGL  313
             A DD+A      DA        S + +     T D+      +N T  +N   +   AGL
Sbjct  1074  AADDNAGEPGRPDALPVLHCYDSEDITSPGAHTPDVTTPEKLSNLTP-DNGFGQASDAGL  1132

Query  314   SVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRL  493
             + +  L +EFE+R QVF +DA FLVEVKSG + ++ NP  ELR+LK  FE+WKK+Y ++L
Sbjct  1133  NAVSHLVKEFEKRKQVFEEDAGFLVEVKSGHSASSANPRDELRKLKLRFETWKKEYKLKL  1192

Query  494   KETKVILHKLGSEEGASDKMKKKWWGRRNS  583
             +ETK  LH+LG+ E   +K +++WWG++++
Sbjct  1193  RETKSTLHRLGNSE--VEKTRRRWWGKKST  1220



>ref|XP_007212835.1| hypothetical protein PRUPE_ppa020758mg [Prunus persica]
 gb|EMJ14034.1| hypothetical protein PRUPE_ppa020758mg [Prunus persica]
Length=1127

 Score =   147 bits (372),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 129/201 (64%), Gaps = 9/201 (4%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L+ K+EEN  L  +L+Q+E RWSEY+ KMKSM++VWQKQM SLQ+SL+ A+KSL
Sbjct  926   LQAEATLKRKEEENAELQGQLRQFETRWSEYDAKMKSMQDVWQKQMASLQTSLAAARKSL  985

Query  182   alDDSARNSDASVNASD---DKGSTWDIGN---NRTALENNGVRPVRAGLSVIGQLAEEF  343
             A D++A      V  S    D      +G+     +   N G R     L  +  L +EF
Sbjct  986   ASDNTAGQPGRLVVPSSPRCDSEEALSMGSRTPGASTPNNGGGRETNGTLHAVSNLMKEF  1045

Query  344   EQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKL  523
             EQR Q F DDAK LVEVK G +  N+NP+ ELR+LKH FESWKK+Y  RL+ETK  +HKL
Sbjct  1046  EQRKQHFDDDAKALVEVKPGHSGVNMNPEEELRKLKHRFESWKKEYKARLRETKTKVHKL  1105

Query  524   -GSEEGASDKMKKKWWGRRNS  583
               SEE    +  +KWWG+ +S
Sbjct  1106  WHSEE--EKRRSRKWWGKISS  1124



>gb|KJB13457.1| hypothetical protein B456_002G076300 [Gossypium raimondii]
Length=1188

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 127/201 (63%), Gaps = 23/201 (11%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L +K++EN  L ++LQQYE RW EYE KMKSME++WQKQM SLQ+SL+ A+KSL
Sbjct  992   LKAEAILGQKEQENATLREQLQQYEARWLEYEAKMKSMEDMWQKQMASLQTSLAAARKSL  1051

Query  182   alDDSA----------RNSDASVNASDDKGSTWDIGNNRTAL--ENNGVRPVRAGLSVIG  325
             A D +A          R  D+  N S   GS   +GN    +    NG       L+ +G
Sbjct  1052  AADSNAGQRRGDVVSPRYYDSEDNVS--MGSRTPVGNMPDVVGGRENG------SLNAVG  1103

Query  326   QLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETK  505
              L +EFEQR Q F DDAK L E++     +N+NPD E RRLK  FE+WKK+Y +RLKETK
Sbjct  1104  NLLKEFEQRRQTFDDDAKSLAEIRMAQPTSNVNPDDEFRRLKRRFETWKKEYKLRLKETK  1163

Query  506   VILHKLGSEEGASDKMKKKWW  568
               LHK G E   SDK ++KWW
Sbjct  1164  ARLHKRGYE---SDKTRRKWW  1181



>gb|KJB13453.1| hypothetical protein B456_002G076300 [Gossypium raimondii]
Length=1195

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 127/201 (63%), Gaps = 23/201 (11%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L +K++EN  L ++LQQYE RW EYE KMKSME++WQKQM SLQ+SL+ A+KSL
Sbjct  999   LKAEAILGQKEQENATLREQLQQYEARWLEYEAKMKSMEDMWQKQMASLQTSLAAARKSL  1058

Query  182   alDDSA----------RNSDASVNASDDKGSTWDIGNNRTAL--ENNGVRPVRAGLSVIG  325
             A D +A          R  D+  N S   GS   +GN    +    NG       L+ +G
Sbjct  1059  AADSNAGQRRGDVVSPRYYDSEDNVS--MGSRTPVGNMPDVVGGRENG------SLNAVG  1110

Query  326   QLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETK  505
              L +EFEQR Q F DDAK L E++     +N+NPD E RRLK  FE+WKK+Y +RLKETK
Sbjct  1111  NLLKEFEQRRQTFDDDAKSLAEIRMAQPTSNVNPDDEFRRLKRRFETWKKEYKLRLKETK  1170

Query  506   VILHKLGSEEGASDKMKKKWW  568
               LHK G E   SDK ++KWW
Sbjct  1171  ARLHKRGYE---SDKTRRKWW  1188



>gb|KJB13454.1| hypothetical protein B456_002G076300 [Gossypium raimondii]
Length=1179

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 127/201 (63%), Gaps = 23/201 (11%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L +K++EN  L ++LQQYE RW EYE KMKSME++WQKQM SLQ+SL+ A+KSL
Sbjct  983   LKAEAILGQKEQENATLREQLQQYEARWLEYEAKMKSMEDMWQKQMASLQTSLAAARKSL  1042

Query  182   alDDSA----------RNSDASVNASDDKGSTWDIGNNRTAL--ENNGVRPVRAGLSVIG  325
             A D +A          R  D+  N S   GS   +GN    +    NG       L+ +G
Sbjct  1043  AADSNAGQRRGDVVSPRYYDSEDNVS--MGSRTPVGNMPDVVGGRENG------SLNAVG  1094

Query  326   QLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETK  505
              L +EFEQR Q F DDAK L E++     +N+NPD E RRLK  FE+WKK+Y +RLKETK
Sbjct  1095  NLLKEFEQRRQTFDDDAKSLAEIRMAQPTSNVNPDDEFRRLKRRFETWKKEYKLRLKETK  1154

Query  506   VILHKLGSEEGASDKMKKKWW  568
               LHK G E   SDK ++KWW
Sbjct  1155  ARLHKRGYE---SDKTRRKWW  1172



>ref|XP_010905050.1| PREDICTED: myosin-1 [Elaeis guineensis]
Length=1266

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 133/226 (59%), Gaps = 41/226 (18%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAA REK+EEN IL Q++Q YE RWSEY+ KMKSMEE WQKQ+ SLQ SL+ AKKSL
Sbjct  1041  LKAEAAWREKEEENAILKQQVQHYEMRWSEYDAKMKSMEEKWQKQLTSLQVSLAAAKKSL  1100

Query  182   alDDSA----RNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRA---GL---------  313
             A DD A    R   + +  S D   T   G +    E    +P  A   GL         
Sbjct  1101  AADDLASQQGRLDISPLQYSYDSEDTMSAGTHTP--EGTPAKPSHASDAGLVRNSNGTQS  1158

Query  314   --------------------SVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDH  433
                                   +  L +EFEQ+ QVF DDA+FL++VKSG + +++NP  
Sbjct  1159  AVSHLVASDAGFVRNSDGTHGAVSHLVKEFEQQRQVFEDDARFLLKVKSGHSGSSINPAE  1218

Query  434   ELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGASDKMKKKWWG  571
             EL +LK  F +WKKDY VRL+ETK++LHKLGS E   ++ +K+WWG
Sbjct  1219  ELHKLKARFVTWKKDYKVRLRETKIVLHKLGSPE---ERTRKRWWG  1261



>ref|XP_008806763.1| PREDICTED: myosin-1-like [Phoenix dactylifera]
Length=1252

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 130/226 (58%), Gaps = 41/226 (18%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAA REK+EEN IL Q+LQ YE RWSEYE KMKSMEE W+KQ+ SLQ SL+ AKKSL
Sbjct  1027  LKAEAAWREKEEENAILKQQLQHYEMRWSEYEAKMKSMEETWKKQLTSLQVSLAAAKKSL  1086

Query  182   alDDSA----RNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRA---GL---------  313
               DD A    R   + +  S D   T   G +    E    +P  A   GL         
Sbjct  1087  TADDIASPQGRLDISPLQYSFDSEDTMFAGTHTP--EGTPAKPFHASDAGLVRNSDGTQS  1144

Query  314   --------------------SVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDH  433
                                 S +  L +EFEQ+ QVF DDA FL+EVKSG + ++ NPD 
Sbjct  1145  AASHLDASDAGFARNSNGTQSAVSHLVKEFEQQRQVFEDDAGFLLEVKSGQSGSSRNPDE  1204

Query  434   ELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGASDKMKKKWWG  571
             EL +LK  F +WKKD+ VRL+ETK+ L KLG+ E   ++ +K+WWG
Sbjct  1205  ELHKLKARFVTWKKDFKVRLRETKIALRKLGNPE---ERTRKRWWG  1247



>ref|XP_010062907.1| PREDICTED: myosin-2 [Eucalyptus grandis]
 ref|XP_010062908.1| PREDICTED: myosin-2 [Eucalyptus grandis]
 gb|KCW70053.1| hypothetical protein EUGRSUZ_F03356 [Eucalyptus grandis]
Length=1222

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 132/206 (64%), Gaps = 18/206 (9%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L++K+EEN  L + LQQ+E +WSEYE +MKSMEE WQKQM SLQ SL+ A+KSL
Sbjct  1020  LKAEAMLKQKEEENAALREELQQFETKWSEYESRMKSMEETWQKQMASLQMSLAAARKSL  1079

Query  182   alDDS---ARNSDASVNASD-DKGSTWDIGNNRTALE-----NNGVRPVRAG------LS  316
               DD+    +  D +++  D D   T  +G+           +N V   RAG      L+
Sbjct  1080  MTDDNGGQPKRPDVALSPRDYDSEDTTSMGSRTPGGSMPVKFSNAVTDGRAGRDTNGTLN  1139

Query  317   VIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLK  496
              +  L +EFE R Q F DDA+ LVEV+S L  +N +PD ELR+LK  FESWKK+Y VRL+
Sbjct  1140  AVSDLMKEFEIRKQTFDDDARSLVEVRSELA-SNASPDEELRKLKVRFESWKKEYKVRLR  1198

Query  497   ETKVILHKLGSEEGASDKMKKKWWGR  574
             ETKV L K G  +  +DK ++KWWGR
Sbjct  1199  ETKVRLRKRGHLD--ADKGRRKWWGR  1222



>tpg|DAA63129.1| TPA: hypothetical protein ZEAMMB73_109792 [Zea mays]
Length=1238

 Score =   142 bits (359),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 133/208 (64%), Gaps = 18/208 (9%)
 Frame = +2

Query  5     RAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksla  184
             +AEAALR K+EEN +L Q+L+QYE +WSEYE KMK MEE W++Q+ SLQ SL +AKKSLA
Sbjct  1033  KAEAALRGKEEENVMLKQQLEQYERKWSEYEAKMKCMEEAWKRQLSSLQLSLVVAKKSLA  1092

Query  185   lDDSARNSD----ASVNASDDKGSTWDIGNNRTAL------ENNGVRPVRAG-----LSV  319
              DD+A  +        +A  D   T   G     +       +N    V AG     ++ 
Sbjct  1093  ADDAATRAARTDCTPTHAQYDSEDTLSTGTRTPEVIESKHDNHNPEAKVSAGNSDRRVNA  1152

Query  320   IGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKE  499
             +  LA+EFE R QVF DDA FLV V+SG   +N+NPD ELR+LK  F +WKKDY  RLKE
Sbjct  1153  VNHLAKEFEDRRQVFEDDAGFLVAVRSGQIGSNMNPDEELRKLKDRFATWKKDYKSRLKE  1212

Query  500   TKVILHKLGSEEGASDKMKKKWWGRRNS  583
             TKV L K+G+ +   +K +K+WWG+++S
Sbjct  1213  TKVNLSKVGTHD---EKSRKRWWGKKSS  1237



>ref|XP_008654108.1| PREDICTED: myosin-1-like [Zea mays]
Length=1261

 Score =   142 bits (359),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 133/208 (64%), Gaps = 18/208 (9%)
 Frame = +2

Query  5     RAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksla  184
             +AEAALR K+EEN +L Q+L+QYE +WSEYE KMK MEE W++Q+ SLQ SL +AKKSLA
Sbjct  1056  KAEAALRGKEEENVMLKQQLEQYERKWSEYEAKMKCMEEAWKRQLSSLQLSLVVAKKSLA  1115

Query  185   lDDSARNSD----ASVNASDDKGSTWDIGNNRTAL------ENNGVRPVRAG-----LSV  319
              DD+A  +        +A  D   T   G     +       +N    V AG     ++ 
Sbjct  1116  ADDAATRAARTDCTPTHAQYDSEDTLSTGTRTPEVIESKHDNHNPEAKVSAGNSDRRVNA  1175

Query  320   IGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKE  499
             +  LA+EFE R QVF DDA FLV V+SG   +N+NPD ELR+LK  F +WKKDY  RLKE
Sbjct  1176  VNHLAKEFEDRRQVFEDDAGFLVAVRSGQIGSNMNPDEELRKLKDRFATWKKDYKSRLKE  1235

Query  500   TKVILHKLGSEEGASDKMKKKWWGRRNS  583
             TKV L K+G+ +   +K +K+WWG+++S
Sbjct  1236  TKVNLSKVGTHD---EKSRKRWWGKKSS  1260



>gb|KDO74222.1| hypothetical protein CISIN_1g000931mg [Citrus sinensis]
Length=1193

 Score =   142 bits (357),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 126/196 (64%), Gaps = 19/196 (10%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L +K+EEN  L ++LQQY+ +W EYE KMKSMEE+WQKQM SLQ SL+ A+KSL
Sbjct  1012  LKAEATLGQKEEENAALREQLQQYDAKWLEYEAKMKSMEEMWQKQMASLQMSLAAARKSL  1071

Query  182   alDDSARNSDAS--VNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRS  355
             A D++   S     +N   D GS           E+NG       L+ +  L +EFEQR 
Sbjct  1072  ASDNTPGGSTPMKFLNIVPDAGS---------GRESNG------SLTAVNHLTKEFEQRR  1116

Query  356   QVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEE  535
             Q F DDAK L+E+K+    + ++PD ELR+LK  FE+WKKDY  RL+E KV L+KLG  E
Sbjct  1117  QNFDDDAKALIEIKTTQPASTVHPDVELRKLKMRFETWKKDYKTRLREAKVRLNKLGQSE  1176

Query  536   GASDKMKKKWWGRRNS  583
                +K ++KWW + +S
Sbjct  1177  --VEKTRRKWWEKISS  1190



>ref|XP_006464677.1| PREDICTED: myosin-2-like isoform X6 [Citrus sinensis]
Length=1193

 Score =   142 bits (357),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 126/196 (64%), Gaps = 19/196 (10%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L +K+EEN  L ++LQQY+ +W EYE KMKSMEE+WQKQM SLQ SL+ A+KSL
Sbjct  1012  LKAEATLGQKEEENAALREQLQQYDAKWLEYEAKMKSMEEMWQKQMASLQMSLAAARKSL  1071

Query  182   alDDSARNSDAS--VNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRS  355
             A D++   S     +N   D GS           E+NG       L+ +  L +EFEQR 
Sbjct  1072  ASDNTPGGSTPMKFLNIVPDAGS---------GRESNG------SLTAVNHLTKEFEQRR  1116

Query  356   QVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEE  535
             Q F DDAK L+E+K+    + ++PD ELR+LK  FE+WKKDY  RL+E KV L+KLG  E
Sbjct  1117  QNFDDDAKALIEIKTTQPASTVHPDVELRKLKMRFETWKKDYKTRLREAKVRLNKLGQSE  1176

Query  536   GASDKMKKKWWGRRNS  583
                +K ++KWW + +S
Sbjct  1177  --VEKTRRKWWEKISS  1190



>ref|XP_006451994.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
 ref|XP_006451995.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
 gb|ESR65234.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
 gb|ESR65235.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
Length=1193

 Score =   142 bits (357),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 126/196 (64%), Gaps = 19/196 (10%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L +K+EEN  L ++LQQY+ +W EYE KMKSMEE+WQKQM SLQ SL+ A+KSL
Sbjct  1012  LKAEATLGQKEEENAALREQLQQYDAKWLEYEAKMKSMEEMWQKQMASLQMSLAAARKSL  1071

Query  182   alDDSARNSDAS--VNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRS  355
             A D++   S     +N   D GS           E+NG       L+ +  L +EFEQR 
Sbjct  1072  ASDNTPGGSTPMKFLNIVPDAGS---------GRESNG------SLTAVNHLTKEFEQRR  1116

Query  356   QVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEE  535
             Q F DDAK L+E+K+    + ++PD ELR+LK  FE+WKKDY  RL+E KV L+KLG  E
Sbjct  1117  QNFDDDAKALIEIKTTQPASTVHPDVELRKLKMRFETWKKDYKTRLREAKVRLNKLGQSE  1176

Query  536   GASDKMKKKWWGRRNS  583
                +K ++KWW + +S
Sbjct  1177  --VEKTRRKWWEKISS  1190



>ref|XP_002316933.2| hypothetical protein POPTR_0011s12670g [Populus trichocarpa]
 gb|EEE97545.2| hypothetical protein POPTR_0011s12670g [Populus trichocarpa]
Length=1191

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 133/212 (63%), Gaps = 29/212 (14%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             ++AE  + +K+EEN  L  +LQQ E RW +YE KMK+MEE+WQ QM SLQ+SL+ A+KSL
Sbjct  988   VKAEVTVAQKEEENAALKDQLQQNEKRWLDYEAKMKAMEEMWQVQMASLQTSLAAARKSL  1047

Query  182   alDDSA-----RNSDASVNASDDK-----------GSTWDIGNN-----RTALENNGVRP  298
             A D++A      +S  S +  D +           G+T +I  N     R   ENNG  P
Sbjct  1048  AADNTAGQPGKLDSSTSPHYYDSEDYVSTESRTPGGNTPNIFANTFPDLRAVRENNG--P  1105

Query  299   VRAGLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKD  478
             V A    +  L +EFEQ+ Q F D+ K LVEV++G + +N+NPD ELRRLK  FE+WKKD
Sbjct  1106  VHA----VSNLTKEFEQQKQNFDDNVKALVEVRAGQSASNMNPDEELRRLKLGFETWKKD  1161

Query  479   YGVRLKETKVILHKLGSEEGASDKMKKKWWGR  574
             Y VRL+ETK  LHKLG   G  D+ ++KWW R
Sbjct  1162  YKVRLRETKARLHKLG--HGEVDRNRRKWWRR  1191



>ref|XP_011029402.1| PREDICTED: myosin-2-like [Populus euphratica]
Length=1199

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 128/206 (62%), Gaps = 17/206 (8%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             ++AE  + +K+EEN  L  +LQQ E RW +YE KMK+MEE+WQ QM SLQ+SL+ A+KSL
Sbjct  996   VKAEVTVAQKEEENAALKDQLQQNEKRWLDYEAKMKAMEEMWQVQMASLQTSLAAARKSL  1055

Query  182   alDDSARNS---DASVNA----SDDKGST---WDIGNNRTALENN-----GVRPVRAGLS  316
             A D++A      D+S +     S+D  ST      GN  +   N       VR     L 
Sbjct  1056  AADNTAGQPGKLDSSTSPHYYDSEDYVSTESRTPGGNTPSIFANTFPDLRAVRENNGPLH  1115

Query  317   VIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLK  496
              +  L  EFEQ+ Q F D+ K LVE ++G + +N+NPD ELRRLK  FE+WKKDY VRL+
Sbjct  1116  AVSNLTREFEQQKQNFDDNVKALVEARAGQSASNMNPDEELRRLKLRFETWKKDYKVRLR  1175

Query  497   ETKVILHKLGSEEGASDKMKKKWWGR  574
             ETKV LHKLG   G  D+ ++KWW R
Sbjct  1176  ETKVRLHKLG--HGEVDRNRRKWWRR  1199



>ref|XP_006584303.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690-like [Glycine max]
Length=276

 Score =   133 bits (334),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  113  MEEVWQKQMRslqsslsiakkslalDDSARNSDASVNASDDKGSTWDIGNNRTALENNGV  292
            MEEVWQKQMR +QSSLSIAKKSLA+DDS RNS+AS+NASDD+  +WD+G N    E+NG 
Sbjct  1    MEEVWQKQMRYVQSSLSIAKKSLAMDDSERNSNASINASDDRDFSWDVGTNHQRQESNGA  60

Query  293  RPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELR  442
            R + A LSVI +LAEEFEQRSQVFGDDAKFLVEVKSG  EA+LNP+ E++
Sbjct  61   RLMSATLSVISRLAEEFEQRSQVFGDDAKFLVEVKSGQVEASLNPNREVK  110



>ref|XP_009420769.1| PREDICTED: myosin-2-like isoform X2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 117/211 (55%), Gaps = 26/211 (12%)
 Frame = +2

Query  5    RAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQM----------Rslqs  154
            +AEAALREK+EEN IL Q+LQ YE RWSEYELKMKSMEE WQKQ+          R    
Sbjct  292  KAEAALREKEEENVILKQQLQAYETRWSEYELKMKSMEETWQKQLTALQMSFTAGRKSIV  351

Query  155  slsiakkslalDDSARN------SDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLS  316
               + K+    D S  N       D SV A   + +   + N   A++   VR      +
Sbjct  352  PEEMTKQPGWPDASQTNHYYEAEDDESVGAQTPEDTLAKLPNASDAMQ---VRNNDTACN  408

Query  317  VIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLK  496
             + QL +EF+Q+ QVF  DA  L+EVKSG     +NP  ELR LK  F SWKKDY +RL+
Sbjct  409  AVIQLIKEFDQQRQVFDTDAGLLIEVKSG----AINPYEELRNLKSHFASWKKDYKMRLR  464

Query  497  ETKVILHKLGSEEGASDKMKKKWWGRRNSSR  589
            +TK  L KL + E    +  K+WW    ++R
Sbjct  465  DTKTALLKLVNPE---KRAYKRWWCTTVAAR  492



>ref|XP_009420767.1| PREDICTED: myosin-2-like isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009420768.1| PREDICTED: myosin-2-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=499

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 117/211 (55%), Gaps = 26/211 (12%)
 Frame = +2

Query  5    RAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQM----------Rslqs  154
            +AEAALREK+EEN IL Q+LQ YE RWSEYELKMKSMEE WQKQ+          R    
Sbjct  299  KAEAALREKEEENVILKQQLQAYETRWSEYELKMKSMEETWQKQLTALQMSFTAGRKSIV  358

Query  155  slsiakkslalDDSARN------SDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLS  316
               + K+    D S  N       D SV A   + +   + N   A++   VR      +
Sbjct  359  PEEMTKQPGWPDASQTNHYYEAEDDESVGAQTPEDTLAKLPNASDAMQ---VRNNDTACN  415

Query  317  VIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLK  496
             + QL +EF+Q+ QVF  DA  L+EVKSG     +NP  ELR LK  F SWKKDY +RL+
Sbjct  416  AVIQLIKEFDQQRQVFDTDAGLLIEVKSG----AINPYEELRNLKSHFASWKKDYKMRLR  471

Query  497  ETKVILHKLGSEEGASDKMKKKWWGRRNSSR  589
            +TK  L KL + E    +  K+WW    ++R
Sbjct  472  DTKTALLKLVNPE---KRAYKRWWCTTVAAR  499



>gb|AEM05967.1| myosin VIII B [Physcomitrella patens]
Length=1418

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 96/227 (42%), Positives = 129/227 (57%), Gaps = 40/227 (18%)
 Frame = +2

Query  8     AEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslal  187
             AE  L EK+E+N +L QR+Q YEN+W EYE KM SMEE+WQKQM +LQ SL+ AKKS+A 
Sbjct  1180  AERTLLEKEEDNALLRQRIQHYENQWVEYEAKMSSMEEMWQKQMSTLQLSLAAAKKSIAT  1239

Query  188   DDSARNSDASVNASDDKGSTWDIGNNRTA---------------------------LENN  286
             ++SA    +S + S+D+ +     N  T                            +ENN
Sbjct  1240  EESATLQTSSKDGSEDQKTVAGKHNRNTRPLLPTEEEKFHKVIQDLDDEAAKVPENVENN  1299

Query  287   GVR-------------PVRAGLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNP  427
               +              V AG S + QL  EF+ R QVF DD  FLVEVKSG T A+L+P
Sbjct  1300  SNKFLHAGSELGSSQGEVAAGHSYVTQLDREFDHRKQVFTDDIDFLVEVKSGQTTAHLSP  1359

Query  428   DHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEGASDKMKKKWW  568
             + ELR+LK  F++WKKD+ VRL+ETK +L KLG  + +   ++ K W
Sbjct  1360  EDELRKLKTRFDAWKKDFKVRLRETKAVLSKLGHTDSSDKWIRGKKW  1406



>gb|KHG13556.1| Myosin-2 heavy chain [Gossypium arboreum]
Length=1072

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 128/210 (61%), Gaps = 21/210 (10%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AE  LR+K++EN  L ++LQ+ E RW +YE KMKSMEE+WQKQM SLQ+SL+ A+KSL
Sbjct  866   LKAETNLRQKEQENATLREQLQKSEARWLDYEAKMKSMEEMWQKQMVSLQTSLTAARKSL  925

Query  182   alDDSA-----------RNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAG-----L  313
             A D+ A           R  D+  N S    +T   G N   L +  +  V  G     L
Sbjct  926   AADNGAGQLGRADVLSPRCYDSEDNVSMGSRTT---GGNTPVLFSGAMPDVVGGRENGSL  982

Query  314   SVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRL  493
             + +G L +EFEQR Q F  DAK L++++     +N+NPD ELR L+  FE+WKKDY +RL
Sbjct  983   NALGNLLKEFEQRKQNFDADAKSLIDIRVPQQASNVNPDDELRTLRLRFETWKKDYKLRL  1042

Query  494   KETKVILHKLGSEEGASDKMKKKWWGRRNS  583
             K  K  LHK G  E  SDK ++KWWG+  S
Sbjct  1043  KAAKARLHKRGHPE--SDKARRKWWGKLGS  1070



>gb|KHG19058.1| Myosin-2 heavy chain [Gossypium arboreum]
Length=1038

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 128/210 (61%), Gaps = 21/210 (10%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AE  LR+K++EN  L ++LQ+ E RW +YE KMKSMEE+WQKQM SLQ+SL+ A+KSL
Sbjct  832   LKAETNLRQKEQENATLREQLQKSEARWLDYEAKMKSMEEMWQKQMVSLQTSLTAARKSL  891

Query  182   alDDSA-----------RNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAG-----L  313
             A D+ A           R  D+  N S    +T   G N   L +  +  V  G     L
Sbjct  892   AADNGAGQLGRADVLSPRCYDSEDNVSMGSRTT---GGNTPVLFSGAMPDVVGGRENGSL  948

Query  314   SVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRL  493
             + +G L +EFEQR Q F  DAK L++++     +N+NPD ELR L+  FE+WKKDY +RL
Sbjct  949   NALGNLLKEFEQRKQNFDADAKSLIDIRVPQQASNVNPDDELRTLRLRFETWKKDYKLRL  1008

Query  494   KETKVILHKLGSEEGASDKMKKKWWGRRNS  583
             K  K  LHK G  E  SDK ++KWWG+  S
Sbjct  1009  KAAKARLHKRGHPE--SDKARRKWWGKLGS  1036



>ref|XP_006451996.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
 ref|XP_006451997.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
 gb|ESR65236.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
 gb|ESR65237.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
Length=1221

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 100/218 (46%), Positives = 134/218 (61%), Gaps = 35/218 (16%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L +K+EEN  L ++LQQY+ +W EYE KMKSMEE+WQKQM SLQ SL+ A+KSL
Sbjct  1012  LKAEATLGQKEEENAALREQLQQYDAKWLEYEAKMKSMEEMWQKQMASLQMSLAAARKSL  1071

Query  182   alDDSARNS---DASVNA----SDDK---------GSTW--------DIGNNRTALENNG  289
             A D++       DAS +     S+D          GST         D G+ R   E+NG
Sbjct  1072  ASDNTPGEPGRLDASTSPHLYDSEDTMSMGSRTPGGSTPMKFLNIVPDAGSGR---ESNG  1128

Query  290   VRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESW  469
                    L+ +  L +EFEQR Q F DDAK L+E+K+    + ++PD ELR+LK  FE+W
Sbjct  1129  ------SLTAVNHLTKEFEQRRQNFDDDAKALIEIKTTQPASTVHPDVELRKLKMRFETW  1182

Query  470   KKDYGVRLKETKVILHKLGSEEGASDKMKKKWWGRRNS  583
             KKDY  RL+E KV L+KLG  E   +K ++KWW + +S
Sbjct  1183  KKDYKTRLREAKVRLNKLGQSE--VEKTRRKWWEKISS  1218



>gb|KDO74218.1| hypothetical protein CISIN_1g000931mg [Citrus sinensis]
 gb|KDO74219.1| hypothetical protein CISIN_1g000931mg [Citrus sinensis]
 gb|KDO74220.1| hypothetical protein CISIN_1g000931mg [Citrus sinensis]
 gb|KDO74221.1| hypothetical protein CISIN_1g000931mg [Citrus sinensis]
Length=1221

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 100/218 (46%), Positives = 134/218 (61%), Gaps = 35/218 (16%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L +K+EEN  L ++LQQY+ +W EYE KMKSMEE+WQKQM SLQ SL+ A+KSL
Sbjct  1012  LKAEATLGQKEEENAALREQLQQYDAKWLEYEAKMKSMEEMWQKQMASLQMSLAAARKSL  1071

Query  182   alDDSARNS---DASVNA----SDDK---------GSTW--------DIGNNRTALENNG  289
             A D++       DAS +     S+D          GST         D G+ R   E+NG
Sbjct  1072  ASDNTPGEPGRLDASTSPHLYDSEDTMSMGSRTPGGSTPMKFLNIVPDAGSGR---ESNG  1128

Query  290   VRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESW  469
                    L+ +  L +EFEQR Q F DDAK L+E+K+    + ++PD ELR+LK  FE+W
Sbjct  1129  ------SLTAVNHLTKEFEQRRQNFDDDAKALIEIKTTQPASTVHPDVELRKLKMRFETW  1182

Query  470   KKDYGVRLKETKVILHKLGSEEGASDKMKKKWWGRRNS  583
             KKDY  RL+E KV L+KLG  E   +K ++KWW + +S
Sbjct  1183  KKDYKTRLREAKVRLNKLGQSE--VEKTRRKWWEKISS  1218



>gb|KDO74224.1| hypothetical protein CISIN_1g000931mg [Citrus sinensis]
Length=1048

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 100/218 (46%), Positives = 134/218 (61%), Gaps = 35/218 (16%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L +K+EEN  L ++LQQY+ +W EYE KMKSMEE+WQKQM SLQ SL+ A+KSL
Sbjct  839   LKAEATLGQKEEENAALREQLQQYDAKWLEYEAKMKSMEEMWQKQMASLQMSLAAARKSL  898

Query  182   alDDSARNS---DASVNA----SDDK---------GSTW--------DIGNNRTALENNG  289
             A D++       DAS +     S+D          GST         D G+ R   E+NG
Sbjct  899   ASDNTPGEPGRLDASTSPHLYDSEDTMSMGSRTPGGSTPMKFLNIVPDAGSGR---ESNG  955

Query  290   VRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESW  469
                    L+ +  L +EFEQR Q F DDAK L+E+K+    + ++PD ELR+LK  FE+W
Sbjct  956   ------SLTAVNHLTKEFEQRRQNFDDDAKALIEIKTTQPASTVHPDVELRKLKMRFETW  1009

Query  470   KKDYGVRLKETKVILHKLGSEEGASDKMKKKWWGRRNS  583
             KKDY  RL+E KV L+KLG  E   +K ++KWW + +S
Sbjct  1010  KKDYKTRLREAKVRLNKLGQSE--VEKTRRKWWEKISS  1045



>ref|XP_006464672.1| PREDICTED: myosin-2-like isoform X1 [Citrus sinensis]
 ref|XP_006464673.1| PREDICTED: myosin-2-like isoform X2 [Citrus sinensis]
 ref|XP_006464674.1| PREDICTED: myosin-2-like isoform X3 [Citrus sinensis]
 ref|XP_006464675.1| PREDICTED: myosin-2-like isoform X4 [Citrus sinensis]
 ref|XP_006464676.1| PREDICTED: myosin-2-like isoform X5 [Citrus sinensis]
Length=1221

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 100/218 (46%), Positives = 134/218 (61%), Gaps = 35/218 (16%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L +K+EEN  L ++LQQY+ +W EYE KMKSMEE+WQKQM SLQ SL+ A+KSL
Sbjct  1012  LKAEATLGQKEEENAALREQLQQYDAKWLEYEAKMKSMEEMWQKQMASLQMSLAAARKSL  1071

Query  182   alDDSARNS---DASVNA----SDDK---------GSTW--------DIGNNRTALENNG  289
             A D++       DAS +     S+D          GST         D G+ R   E+NG
Sbjct  1072  ASDNTPGEPGRLDASTSPHLYDSEDTMSMGSRTPGGSTPMKFLNIVPDAGSGR---ESNG  1128

Query  290   VRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESW  469
                    L+ +  L +EFEQR Q F DDAK L+E+K+    + ++PD ELR+LK  FE+W
Sbjct  1129  ------SLTAVNHLTKEFEQRRQNFDDDAKALIEIKTTQPASTVHPDVELRKLKMRFETW  1182

Query  470   KKDYGVRLKETKVILHKLGSEEGASDKMKKKWWGRRNS  583
             KKDY  RL+E KV L+KLG  E   +K ++KWW + +S
Sbjct  1183  KKDYKTRLREAKVRLNKLGQSE--VEKTRRKWWEKISS  1218



>ref|XP_010278387.1| PREDICTED: myosin-1 isoform X3 [Nelumbo nucifera]
Length=1053

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 131/209 (63%), Gaps = 19/209 (9%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAAL +K+EEN  L  +LQQYE RW  YE KMKSMEE+WQKQ+ SLQ SL+ AKKSL
Sbjct  842   LKAEAALAQKEEENAKLQLQLQQYEQRWLHYEAKMKSMEEMWQKQITSLQMSLAAAKKSL  901

Query  182   alDDSA----RNSDASVNASDDKGSTWDIGNN------RTALEN----NGVRPVRA---G  310
               D+ A    R   + V  ++    +  +G        R  L N    +G  P R    G
Sbjct  902   VADEIAGQLGRPVASPVPHNNGYEESMSVGTQNPDDTMRIILPNPLSGSGNVPGRVSDTG  961

Query  311   LSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVR  490
             L  + QL +EFE+R QVF DD + ++EVKSG + +N NPD ELR+LK  F +WKKDY +R
Sbjct  962   LIAVNQLRKEFEKRKQVFDDDLECILEVKSGQSTSNRNPDDELRKLKLRFMAWKKDYKIR  1021

Query  491   LKETKVILHKLGSEEGASDKMKKKWWGRR  577
             L ETK + HKLG+ +   DK  KKWWG++
Sbjct  1022  LWETKAMSHKLGNSD--MDKNHKKWWGKK  1048



>ref|XP_010278386.1| PREDICTED: myosin-2 isoform X2 [Nelumbo nucifera]
Length=1084

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 131/209 (63%), Gaps = 19/209 (9%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAAL +K+EEN  L  +LQQYE RW  YE KMKSMEE+WQKQ+ SLQ SL+ AKKSL
Sbjct  873   LKAEAALAQKEEENAKLQLQLQQYEQRWLHYEAKMKSMEEMWQKQITSLQMSLAAAKKSL  932

Query  182   alDDSA----RNSDASVNASDDKGSTWDIGNN------RTALEN----NGVRPVRA---G  310
               D+ A    R   + V  ++    +  +G        R  L N    +G  P R    G
Sbjct  933   VADEIAGQLGRPVASPVPHNNGYEESMSVGTQNPDDTMRIILPNPLSGSGNVPGRVSDTG  992

Query  311   LSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVR  490
             L  + QL +EFE+R QVF DD + ++EVKSG + +N NPD ELR+LK  F +WKKDY +R
Sbjct  993   LIAVNQLRKEFEKRKQVFDDDLECILEVKSGQSTSNRNPDDELRKLKLRFMAWKKDYKIR  1052

Query  491   LKETKVILHKLGSEEGASDKMKKKWWGRR  577
             L ETK + HKLG+ +   DK  KKWWG++
Sbjct  1053  LWETKAMSHKLGNSD--MDKNHKKWWGKK  1079



>ref|XP_010278385.1| PREDICTED: myosin-2 isoform X1 [Nelumbo nucifera]
Length=1248

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 131/209 (63%), Gaps = 19/209 (9%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEAAL +K+EEN  L  +LQQYE RW  YE KMKSMEE+WQKQ+ SLQ SL+ AKKSL
Sbjct  1037  LKAEAALAQKEEENAKLQLQLQQYEQRWLHYEAKMKSMEEMWQKQITSLQMSLAAAKKSL  1096

Query  182   alDDSA----RNSDASVNASDDKGSTWDIGNN------RTALEN----NGVRPVRA---G  310
               D+ A    R   + V  ++    +  +G        R  L N    +G  P R    G
Sbjct  1097  VADEIAGQLGRPVASPVPHNNGYEESMSVGTQNPDDTMRIILPNPLSGSGNVPGRVSDTG  1156

Query  311   LSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVR  490
             L  + QL +EFE+R QVF DD + ++EVKSG + +N NPD ELR+LK  F +WKKDY +R
Sbjct  1157  LIAVNQLRKEFEKRKQVFDDDLECILEVKSGQSTSNRNPDDELRKLKLRFMAWKKDYKIR  1216

Query  491   LKETKVILHKLGSEEGASDKMKKKWWGRR  577
             L ETK + HKLG+ +   DK  KKWWG++
Sbjct  1217  LWETKAMSHKLGNSD--MDKNHKKWWGKK  1243



>ref|XP_001775964.1| predicted protein [Physcomitrella patens]
 gb|EDQ59156.1| predicted protein [Physcomitrella patens]
Length=1017

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 127/195 (65%), Gaps = 9/195 (5%)
 Frame = +2

Query  8     AEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslal  187
             AE ALREK+EE  +  Q++Q YE +W+EYE K+ SMEE WQKQM +L  SL+ AKKS+A 
Sbjct  818   AEKALREKEEEIVLQRQKIQHYEKQWAEYEAKISSMEEKWQKQMSTLHLSLAAAKKSIAT  877

Query  188   DDSARNSD---ASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQ  358
             +++ +  D   A V    ++ S   +        + G   V AG S + QL  EF+ R Q
Sbjct  878   EENTQELDEESAKVTMDSEQNSNKFLHAGSELGSSQG--EVAAGHSYVVQLDREFDHRKQ  935

Query  359   VFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEEG  538
             VF DD  FLVEVKSG T+A+LNP+ ELR+LK  F+ WK+D+ VRL+ETKV+L+KL S   
Sbjct  936   VFTDDIDFLVEVKSGQTQAHLNPEDELRKLKTRFDGWKRDFKVRLRETKVVLNKL-SHTD  994

Query  539   ASDK--MKKKW-WGR  574
             ++D+    KKW WG+
Sbjct  995   STDRWIRGKKWHWGK  1009



>ref|XP_002525757.1| myosin vIII, putative [Ricinus communis]
 gb|EEF36593.1| myosin vIII, putative [Ricinus communis]
Length=1223

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 128/206 (62%), Gaps = 18/206 (9%)
 Frame = +2

Query  5     RAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksla  184
             +AE AL +K++EN  L ++LQQ+E RWSEYE KMK+ME+ WQ QM SLQ+SL+ A+KSLA
Sbjct  1009  KAEVALLQKEDENASLREQLQQFERRWSEYETKMKTMEQTWQMQMESLQASLAAARKSLA  1068

Query  185   lDDSARN-------SDASVNASDDKGST--WDIGNNRTALENNGVRPVRAG------LSV  319
              D +A         S      S+D  ST     G+N     +  +  V+ G      ++ 
Sbjct  1069  ADSTAGQHGKLESFSSPHYYDSEDNMSTGVQTPGSNTPNKSSIAIPDVKLGRETNGSINA  1128

Query  320   IGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEA-NLNPDHELRRLKHMFESWKKDYGVRLK  496
             +  LA+EFEQ+ Q F D AK L EVK G   A + NPD ELR+LK  FE WKKDY VRL+
Sbjct  1129  VSILAKEFEQQRQNFDDHAKALAEVKLGQQSASDKNPDEELRKLKIRFEDWKKDYKVRLR  1188

Query  497   ETKVILHKLGSEEGASDKMKKKWWGR  574
             ETKV LHK+G  EG  D+  ++WWG+
Sbjct  1189  ETKVRLHKVGRGEG--DRRTRRWWGK  1212



>gb|KJB62696.1| hypothetical protein B456_009G430900 [Gossypium raimondii]
 gb|KJB62697.1| hypothetical protein B456_009G430900 [Gossypium raimondii]
Length=1201

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 127/210 (60%), Gaps = 21/210 (10%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AE  L +K+ EN  L ++LQ+ E RW +YE KMKSMEE+WQKQM SLQ+SL+ A+KSL
Sbjct  995   LKAETNLGQKEHENATLREQLQKSEARWLDYEAKMKSMEEMWQKQMVSLQTSLTAARKSL  1054

Query  182   alDD-----------SARNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAG-----L  313
             A D+           S R  D+  N S    +T   G N   L +  +  V  G     L
Sbjct  1055  AADNGAGQLGRADVLSPRCYDSEDNVSMGSRTT---GGNTPVLFSGAMPDVVGGRENGSL  1111

Query  314   SVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRL  493
             + +G L +EFEQR Q F  DAK L++++     +N+NPD ELR L+  FE+WKKDY +RL
Sbjct  1112  NALGNLLKEFEQRKQNFDADAKSLMDLRVPQQASNMNPDDELRTLRLRFETWKKDYKLRL  1171

Query  494   KETKVILHKLGSEEGASDKMKKKWWGRRNS  583
             KE K  LHK G  E  SDK ++KWWG+  S
Sbjct  1172  KEAKARLHKRGHPE--SDKARRKWWGKLGS  1199



>ref|XP_004294488.1| PREDICTED: myosin-2 [Fragaria vesca subsp. vesca]
Length=1123

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 126/197 (64%), Gaps = 17/197 (9%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L  K+EEN  L ++LQQ+E RWSEYE +MKSM++VWQKQM SLQ SL+ A+KSL
Sbjct  934   LQAEATLERKEEENADLQEQLQQFETRWSEYEARMKSMQDVWQKQMSSLQVSLAAARKSL  993

Query  182   alDDSARNSDASVNASDDKGSTWD---IGNNRTALEN--NGV-RPVRAGLSVIGQLAEEF  343
               +++A      V+AS  +  + D   +G+         NGV R     LS +G L +EF
Sbjct  994   TANNTA-GQPGRVDASSPRYDSEDALSMGSRTPGASTPINGVARETNGSLSAVGNLVKEF  1052

Query  344   EQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETK--VILH  517
             +QR Q F D+ K L+EVK+G      N D EL++LKH FESWKK+Y  RL+ETK  + LH
Sbjct  1053  DQRRQTFDDEVKALIEVKTG------NTDEELKKLKHQFESWKKEYKARLRETKTRLRLH  1106

Query  518   KLGSEEGASDKMKKKWW  568
             + G  +   +K ++KWW
Sbjct  1107  RHGHSD--DEKKRRKWW  1121



>dbj|BAL60532.2| myosin VIII [Marchantia polymorpha]
Length=1365

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 76/91 (84%), Gaps = 1/91 (1%)
 Frame = +2

Query  305   AGLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYG  484
             AG S++G L +EF+QR+QVF DDA FLVEVKSG TEANLNPD ELR+LKH F+ WKKD+ 
Sbjct  1273  AGRSLVGHLVKEFDQRTQVFNDDADFLVEVKSGQTEANLNPDEELRKLKHRFDVWKKDFK  1332

Query  485   VRLKETKVILHKLGSEEGASDKMKKKWWGRR  577
             VRL+ETK +LHKLGS + A +K KKKWWG+R
Sbjct  1333  VRLRETKTVLHKLGSMD-AVEKTKKKWWGKR  1362


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQM  139
             L AE +LREK+E+N +L  RLQQ+E RW E++ KM+SMEE+WQKQM
Sbjct  1136  LAAEKSLREKEEDNALLKHRLQQFEARWLEHQAKMESMEEMWQKQM  1181



>ref|XP_010324344.1| PREDICTED: myosin-2-like isoform X2 [Solanum lycopersicum]
Length=1177

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 122/205 (60%), Gaps = 15/205 (7%)
 Frame = +2

Query  5     RAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksla  184
             +AEA   +K++EN  L +++ Q+E R  EYE+KM+SMEE+WQKQM SLQ SL+ A+ SL 
Sbjct  974   KAEATTEQKEKENAALKEQVNQFETRCLEYEVKMRSMEEMWQKQMTSLQVSLAAARNSLT  1033

Query  185   lDDSA------RNSDASVNASDDKGSTWDIGNNRT--ALENNGV-----RPVRAGLSVIG  325
               D+         S +      D  ++ D    RT  +  NN +     R V  GLS+I 
Sbjct  1034  AADTTGRPGKLEGSPSPQYYDSDDATSMDTPAGRTPVSFSNNSLGVVANREVNGGLSLIS  1093

Query  326   QLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETK  505
              LA EFEQR Q F ++A  +V +K G  ++  NP  E RRLKH FE WKK+Y VRLKETK
Sbjct  1094  HLAMEFEQRKQNFDNEAMAIVHLKPGQLQSTNNPADEYRRLKHRFEEWKKEYKVRLKETK  1153

Query  506   VILHKLGSEEGASDKMKKKWWGRRN  580
               +HKL   +    K ++KWWG+++
Sbjct  1154  SKVHKLVHSKAG--KSRRKWWGKKS  1176



>ref|XP_006362934.1| PREDICTED: myosin-2-like isoform X1 [Solanum tuberosum]
Length=1203

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/209 (41%), Positives = 127/209 (61%), Gaps = 19/209 (9%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L AEA L EK++EN  L +++ Q E+RWS+YE++M+SMEE+WQKQM SLQ+SL  AKKSL
Sbjct  996   LVAEATLEEKEKENAALKEQVNQLESRWSDYEVRMRSMEEMWQKQMASLQASLVSAKKSL  1055

Query  182   alDDSARNSDASVNASDDKG----------------STWDIGNNRTALENNGVRPVRAGL  313
              +D+SA +      +    G                 +  I      ++  G+R +  GL
Sbjct  1056  GVDNSASHPGKPEGSPSPCGYESEDTTTTMGTRTPGGSTPIEYASNGVDFGGIREINGGL  1115

Query  314   SVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRL  493
              V+  L+ EFE R Q F D+A  + ++KSG  ++  +P  + RRL+H F+ WKKDY  RL
Sbjct  1116  CVVNYLSREFELRKQNFDDEAMAISQLKSGQLQST-SPAEDFRRLRHKFDEWKKDYKARL  1174

Query  494   KETKVILHKLGSEEGASDKMKKKWWGRRN  580
             KETK+ +HKLG  E  ++K ++ WWG+++
Sbjct  1175  KETKLKVHKLGYSE--AEKTRRNWWGKKS  1201



>ref|XP_006362935.1| PREDICTED: myosin-2-like isoform X2 [Solanum tuberosum]
Length=1202

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/209 (41%), Positives = 127/209 (61%), Gaps = 19/209 (9%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L AEA L EK++EN  L +++ Q E+RWS+YE++M+SMEE+WQKQM SLQ+SL  AKKSL
Sbjct  995   LVAEATLEEKEKENAALKEQVNQLESRWSDYEVRMRSMEEMWQKQMASLQASLVSAKKSL  1054

Query  182   alDDSARNSDASVNASDDKG----------------STWDIGNNRTALENNGVRPVRAGL  313
              +D+SA +      +    G                 +  I      ++  G+R +  GL
Sbjct  1055  GVDNSASHPGKPEGSPSPCGYESEDTTTTMGTRTPGGSTPIEYASNGVDFGGIREINGGL  1114

Query  314   SVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRL  493
              V+  L+ EFE R Q F D+A  + ++KSG  ++  +P  + RRL+H F+ WKKDY  RL
Sbjct  1115  CVVNYLSREFELRKQNFDDEAMAISQLKSGQLQST-SPAEDFRRLRHKFDEWKKDYKARL  1173

Query  494   KETKVILHKLGSEEGASDKMKKKWWGRRN  580
             KETK+ +HKLG  E  ++K ++ WWG+++
Sbjct  1174  KETKLKVHKLGYSE--AEKTRRNWWGKKS  1200



>ref|XP_010324342.1| PREDICTED: myosin-2-like isoform X1 [Solanum lycopersicum]
Length=1178

 Score =   131 bits (330),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 118/206 (57%), Gaps = 16/206 (8%)
 Frame = +2

Query  5     RAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiak--ks  178
             +AEA   +K++EN  L +++ Q+E R  EYE+KM+SMEE+WQKQM SLQ     A     
Sbjct  974   KAEATTEQKEKENAALKEQVNQFETRCLEYEVKMRSMEEMWQKQMTSLQQVSLAAARNSL  1033

Query  179   lalDDSAR-----NSDASVNASDDKGSTWDIGNNRT--ALENNGV-----RPVRAGLSVI  322
              A D + R      S +      D  ++ D    RT  +  NN +     R V  GLS+I
Sbjct  1034  TAADTTGRPGKLEGSPSPQYYDSDDATSMDTPAGRTPVSFSNNSLGVVANREVNGGLSLI  1093

Query  323   GQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKET  502
               LA EFEQR Q F ++A  +V +K G  ++  NP  E RRLKH FE WKK+Y VRLKET
Sbjct  1094  SHLAMEFEQRKQNFDNEAMAIVHLKPGQLQSTNNPADEYRRLKHRFEEWKKEYKVRLKET  1153

Query  503   KVILHKLGSEEGASDKMKKKWWGRRN  580
             K  +HKL   +    K ++KWWG+++
Sbjct  1154  KSKVHKLVHSKAG--KSRRKWWGKKS  1177



>gb|EMS67686.1| Myosin-J heavy chain [Triticum urartu]
Length=1240

 Score =   131 bits (330),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 106/136 (78%), Gaps = 3/136 (2%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             LRAEA +REKDEEN++LHQRLQQYENRW EYE KMK+MEE+WQKQMRSLQSSLS+AKKSL
Sbjct  1092  LRAEATVREKDEENEMLHQRLQQYENRWLEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSL  1151

Query  182   alDDSARNSDASVNAS-DDKGSTWDIGNNR--TALENNGVRPVRAGLSVIGQLAEEFEQR  352
             ALD++ R SD+SV  S +  G+    G+++   A      R + A +SVIG+LAEE EQR
Sbjct  1152  ALDETPRMSDSSVEQSWESNGNHVGGGSSQQLAAAPRITGRDMNASMSVIGRLAEELEQR  1211

Query  353   SQVFGDDAKFLVEVKS  400
             SQVF DDAKFLV + S
Sbjct  1212  SQVFADDAKFLVCLVS  1227



>ref|XP_006279905.1| hypothetical protein CARUB_v10025758mg [Capsella rubella]
 gb|EOA12803.1| hypothetical protein CARUB_v10025758mg [Capsella rubella]
Length=1215

 Score =   131 bits (329),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 128/213 (60%), Gaps = 25/213 (12%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L++EAAL +K+EEN  L  +L+Q+E RWSEYE+KMKSME+ WQKQM SLQ SL+ A+KSL
Sbjct  1006  LKSEAALAQKEEENTALRDQLRQFEERWSEYEVKMKSMEDTWQKQMSSLQMSLAAARKSL  1065

Query  182   alDD----SARNSDASVNA----SDDKGSTWDIG-NNRTALENNG------VRPVRAGLS  316
             A +     +    D S++     S+D  ST   G    T    NG      +R +   L+
Sbjct  1066  ATESITGQAGGRQDTSISPFGYDSEDTMSTGTPGVRTPTTKFTNGNTPELRIRELNGSLN  1125

Query  317   VIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLN------PDHELRRLKHMFESWKKD  478
              +  LA EF+QR   F +DA+ +VEVK G  +A  N      P+ E RRLK  FE+WKKD
Sbjct  1126  AVNHLAREFDQRRLNFDEDARAIVEVKLGGPQATPNGQQQQHPEDEFRRLKQRFETWKKD  1185

Query  479   YGVRLKETKVILHKLGSEEGASDKMKKKWWGRR  577
             Y  RL++TK  LH++  ++G      +KWWG+R
Sbjct  1186  YKARLRDTKARLHRVDGDKG----RHRKWWGKR  1214



>gb|EYU19161.1| hypothetical protein MIMGU_mgv1a000383mg [Erythranthe guttata]
Length=1199

 Score =   130 bits (327),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 92/206 (45%), Positives = 125/206 (61%), Gaps = 16/206 (8%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L  EAAL  K++EN  L +++QQ+E+RWSEYE KMKSMEE+WQKQM SLQ SL+ AKKSL
Sbjct  1001  LMTEAALGRKEKENAALREQVQQFESRWSEYETKMKSMEEMWQKQMASLQMSLAAAKKSL  1060

Query  182   alDDSARNSDASVNASDDK---------GSTWDIGNNRTALENNGVRPVRAGLSVIGQLA  334
               D++    +    A             G     G+  T + NNG      GL+ I  LA
Sbjct  1061  GTDNTTGQPEKHHGAQSPSFYDSEEMSFGPHTPSGSTPTRILNNGTN-TNGGLNSISTLA  1119

Query  335   EEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVIL  514
              EFEQ  + F  +A+ +VEVKS  T   +N   ++R LK+ FE+WKKD+ VRL+E K   
Sbjct  1120  NEFEQSRRNFDHEAQAIVEVKSADT---VNSVEDIRSLKYKFEAWKKDFKVRLREAKAKA  1176

Query  515   HKLGSEEGASDKMKKKWWGRRNSSRF  592
             H+LG   G ++K ++KWWG+R + RF
Sbjct  1177  HRLGY--GDAEKYRRKWWGKR-TKRF  1199



>ref|XP_006401589.1| hypothetical protein EUTSA_v10012475mg [Eutrema salsugineum]
 gb|ESQ43042.1| hypothetical protein EUTSA_v10012475mg [Eutrema salsugineum]
Length=1217

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 129/213 (61%), Gaps = 26/213 (12%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L++EAAL +K+EEN  L ++L+Q+E RWSEYE+KMKSMEE WQKQM SLQ SL+ A+KSL
Sbjct  1009  LKSEAALAQKEEENTALREQLRQFEERWSEYEMKMKSMEETWQKQMSSLQMSLAAARKSL  1068

Query  182   alDDSARNS----DASVNA----SDDKGSTWDIG-NNRTALENNG------VRPVRAGLS  316
             A ++    +    D S++     S+D  ST   G    T    NG      VR +   L+
Sbjct  1069  AAENMTGQAGGRQDTSISPFGYDSEDTTSTGTPGVRTPTTKFTNGNTPELRVRELNGSLN  1128

Query  317   VIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLN------PDHELRRLKHMFESWKKD  478
              +  LA EF+QR   F +DA+ +VEVK G  +A  N      P+ E RRLK  FE+WKKD
Sbjct  1129  AVNHLAREFDQRRLNFDEDARAIVEVKLG-PQATPNGQQQQHPEDEFRRLKLRFETWKKD  1187

Query  479   YGVRLKETKVILHKLGSEEGASDKMKKKWWGRR  577
             Y  RL+ETK  LH++  ++       +KWWG+R
Sbjct  1188  YKARLRETKARLHRVDGDKS----RHRKWWGKR  1216



>ref|XP_006592898.1| PREDICTED: myosin-2-like isoform X3 [Glycine max]
Length=1083

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 127/211 (60%), Gaps = 23/211 (11%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             ++AEA + +K+EEN  L ++L+Q+E RW EYE +MKSME++WQKQM SLQ SL+ A+KSL
Sbjct  876   IKAEATIEQKEEENAELKEQLKQFERRWIEYEKRMKSMEDMWQKQMASLQMSLAAARKSL  935

Query  182   alDDS----ARNSDASVNASDD-------------KGSTWDIGNNRTALENNGVRPVRAG  310
             A +++    AR   AS    D               G++  +  + +  E    R  +  
Sbjct  936   ASENASSQIARRDVASPFGYDSEDATSVGSRTPRTPGASTPLKYSSSLTEAGAGRDAKGT  995

Query  311   LSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVR  490
             L+ +  L +EFEQR   F DDA+ LVEVK+G + AN N   ELR+LKH FE WKK+Y  R
Sbjct  996   LTSVSNLMKEFEQRRHTFDDDARALVEVKTGQS-ANTNSVEELRKLKHSFEGWKKEYKAR  1054

Query  491   LKETKVILHKLGSEEGASDKMKKKWWGRRNS  583
             L+ETK  LHK        DK +++WWG+ +S
Sbjct  1055  LRETKARLHK-----SEMDKSRRRWWGKLSS  1080



>ref|XP_003539582.1| PREDICTED: myosin-2-like isoform X1 [Glycine max]
Length=1196

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 127/211 (60%), Gaps = 23/211 (11%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             ++AEA + +K+EEN  L ++L+Q+E RW EYE +MKSME++WQKQM SLQ SL+ A+KSL
Sbjct  989   IKAEATIEQKEEENAELKEQLKQFERRWIEYEKRMKSMEDMWQKQMASLQMSLAAARKSL  1048

Query  182   alDDS----ARNSDASVNASDD-------------KGSTWDIGNNRTALENNGVRPVRAG  310
             A +++    AR   AS    D               G++  +  + +  E    R  +  
Sbjct  1049  ASENASSQIARRDVASPFGYDSEDATSVGSRTPRTPGASTPLKYSSSLTEAGAGRDAKGT  1108

Query  311   LSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVR  490
             L+ +  L +EFEQR   F DDA+ LVEVK+G + AN N   ELR+LKH FE WKK+Y  R
Sbjct  1109  LTSVSNLMKEFEQRRHTFDDDARALVEVKTGQS-ANTNSVEELRKLKHSFEGWKKEYKAR  1167

Query  491   LKETKVILHKLGSEEGASDKMKKKWWGRRNS  583
             L+ETK  LHK        DK +++WWG+ +S
Sbjct  1168  LRETKARLHK-----SEMDKSRRRWWGKLSS  1193



>ref|XP_006592897.1| PREDICTED: myosin-2-like isoform X2 [Glycine max]
Length=1197

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 127/211 (60%), Gaps = 23/211 (11%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             ++AEA + +K+EEN  L ++L+Q+E RW EYE +MKSME++WQKQM SLQ SL+ A+KSL
Sbjct  990   IKAEATIEQKEEENAELKEQLKQFERRWIEYEKRMKSMEDMWQKQMASLQMSLAAARKSL  1049

Query  182   alDDS----ARNSDASVNASDD-------------KGSTWDIGNNRTALENNGVRPVRAG  310
             A +++    AR   AS    D               G++  +  + +  E    R  +  
Sbjct  1050  ASENASSQIARRDVASPFGYDSEDATSVGSRTPRTPGASTPLKYSSSLTEAGAGRDAKGT  1109

Query  311   LSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVR  490
             L+ +  L +EFEQR   F DDA+ LVEVK+G + AN N   ELR+LKH FE WKK+Y  R
Sbjct  1110  LTSVSNLMKEFEQRRHTFDDDARALVEVKTGQS-ANTNSVEELRKLKHSFEGWKKEYKAR  1168

Query  491   LKETKVILHKLGSEEGASDKMKKKWWGRRNS  583
             L+ETK  LHK        DK +++WWG+ +S
Sbjct  1169  LRETKARLHK-----SEMDKSRRRWWGKLSS  1194



>ref|XP_011098363.1| PREDICTED: myosin-2-like [Sesamum indicum]
Length=1209

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 129/212 (61%), Gaps = 25/212 (12%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L AEA + +K++EN  L +++QQ+E RW EYE KMKSMEE+WQKQM SLQ SL+ A+KSL
Sbjct  1002  LMAEATVEQKEKENAALREQVQQFEARWPEYETKMKSMEEMWQKQMASLQMSLASAQKSL  1061

Query  182   alD---------DSARNS------DASVNASDDKGSTWDIGNNRTALENNGVR--PVR--  304
                         D A++       D S++ S   G+    G+      NNG+   P R  
Sbjct  1062  GAHNTIGQPGRLDGAQSPQFYDSEDMSMSLS--MGTQTPGGSTPMRFVNNGIEELPCRDT  1119

Query  305   -AGLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDY  481
               GL+ IG L +EFE+R Q F ++A+ +VEVK G +  ++NP  +LRRLKH FESWKKDY
Sbjct  1120  NGGLNPIGPLMKEFERRRQNFDEEAQAIVEVKPGHS-PSVNPVEDLRRLKHRFESWKKDY  1178

Query  482   GVRLKETKVILHKLGSEEGASDKMKKKWWGRR  577
              VRLKE K    KL   +   ++ ++KWW ++
Sbjct  1179  KVRLKEAKAKAQKLVQND--PERHRRKWWSKK  1208



>ref|XP_010443003.1| PREDICTED: myosin-2 [Camelina sativa]
Length=1215

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 130/214 (61%), Gaps = 26/214 (12%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L++EAAL +K+EEN  L ++L+Q+E RWSEYE+KMKSME+ WQKQM SLQ SL+ A+KSL
Sbjct  1005  LKSEAALAQKEEENTALREQLRQFEERWSEYEVKMKSMEDTWQKQMSSLQMSLAAARKSL  1064

Query  182   alDD----SARNSDASVNA----SDDKGSTWDIG-NNRTALENNG------VRPVRAGLS  316
             A +     +    D S++     S+D  ST   G    T    NG      +R +   L+
Sbjct  1065  ATESITGQAGGRQDTSISPFGYESEDTMSTGTPGVRTPTTKFTNGNTPELRIRELNGSLN  1124

Query  317   VIGQLAEEFEQRSQVFGDDAKFLVEVKSGL-TEANLN------PDHELRRLKHMFESWKK  475
              +  LA EF+QR   F +DA+ +VEVK G+  +A  N      P+ E RRLK  FE+WKK
Sbjct  1125  AVNHLAREFDQRRLNFDEDARAIVEVKLGVGPQATPNGQQQQHPEDEFRRLKQRFETWKK  1184

Query  476   DYGVRLKETKVILHKLGSEEGASDKMKKKWWGRR  577
             DY  RL++TK  LH++  ++G      +KWWG+R
Sbjct  1185  DYKARLRDTKARLHRVDGDKG----RHRKWWGKR  1214



>ref|XP_010101784.1| Myosin-2 heavy chain [Morus notabilis]
 gb|EXB89639.1| Myosin-2 heavy chain [Morus notabilis]
Length=1122

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 119/193 (62%), Gaps = 17/193 (9%)
 Frame = +2

Query  41    NDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalD---------D  193
             N  L ++LQQ+E RWS+YE KMKSMEE+WQKQM SLQ SL+ A+KSL +D         D
Sbjct  926   NAALREQLQQFETRWSDYEAKMKSMEEMWQKQMASLQMSLAAARKSLGVDHSVGQPGRHD  985

Query  194   SARNS------DASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRS  355
             +A +       DA+   S   G++  +  + +  +    R     LS +  L +EFEQ+ 
Sbjct  986   AATSPRYYDSEDATSMGSRTPGASTPLKYSNSGHDVGVGRDTNGTLSAVSNLMKEFEQQR  1045

Query  356   QVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSEE  535
             Q F +DAK LV+VK G + +N N D ELR L+  FE WKK+Y VRL+ETK  LH+LG  E
Sbjct  1046  QAFDNDAKALVDVKPGQSASNKNSDAELRMLRSRFEMWKKEYKVRLRETKAKLHRLGHSE  1105

Query  536   GASDKMKKKWWGR  574
               +++ ++KWWGR
Sbjct  1106  --AERSRRKWWGR  1116



>ref|XP_010446745.1| PREDICTED: myosin-2-like [Camelina sativa]
Length=1217

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 130/214 (61%), Gaps = 26/214 (12%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L++EAAL +K+EEN  L ++L+Q+E RWSEYE+KMKSME+ WQKQM SLQ SL+ A+KSL
Sbjct  1007  LKSEAALAQKEEENTALREQLRQFEERWSEYEVKMKSMEDTWQKQMSSLQMSLAAARKSL  1066

Query  182   alDD----SARNSDASVNA----SDDKGSTWDIG-NNRTALENNG------VRPVRAGLS  316
             A +     +    D S++     S+D  ST   G    T    NG      +R +   L+
Sbjct  1067  ATESITGQAGGRQDTSISPFGYESEDTMSTGTPGVRTPTTKFTNGNTPELRIRELNGSLN  1126

Query  317   VIGQLAEEFEQRSQVFGDDAKFLVEVKSGL-TEANLN------PDHELRRLKHMFESWKK  475
              +  LA EF+QR   F +DA+ +VEVK G+  +A  N      P+ E RRLK  FE+WKK
Sbjct  1127  AVNHLAREFDQRRLNFDEDARAIVEVKLGVGPQATPNGQQQQHPEDEFRRLKQRFETWKK  1186

Query  476   DYGVRLKETKVILHKLGSEEGASDKMKKKWWGRR  577
             DY  RL++TK  LH++  ++G      +KWWG+R
Sbjct  1187  DYKARLRDTKARLHRVDGDKG----RHRKWWGKR  1216



>ref|XP_009792547.1| PREDICTED: myosin-2-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009792548.1| PREDICTED: myosin-2-like isoform X1 [Nicotiana sylvestris]
Length=1197

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 123/208 (59%), Gaps = 18/208 (9%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             + AEA+L EKD+EN  L +++ Q E RWS+YE++M+SMEE+WQKQM SLQ+SL+ AKKSL
Sbjct  991   MVAEASLDEKDKENAALKEQVNQLEARWSDYEVRMRSMEEMWQKQMVSLQASLAAAKKSL  1050

Query  182   alDDSARNS---------------DASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLS  316
              +D+ A +                D +   +   G +  I      ++  G+R    GL 
Sbjct  1051  GVDNPAGHPGKREGSQSPCGYDSEDTTTMGTHTPGGSTPIEFASNGVDFGGIRENNGGLC  1110

Query  317   VIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLK  496
             V+  L  EFE R Q F D+A  + ++KS    +  NP  + RRL+H FE WKKDY  RLK
Sbjct  1111  VVNYLNREFELRRQNFDDEAMAIAQLKSEQLHST-NPAEDFRRLRHRFEEWKKDYKARLK  1169

Query  497   ETKVILHKLGSEEGASDKMKKKWWGRRN  580
             ETK  +HK G  E  ++K ++ WWG+++
Sbjct  1170  ETKAKVHKFGYSE--AEKTRRNWWGKKS  1195



>ref|XP_009792549.1| PREDICTED: myosin-2-like isoform X2 [Nicotiana sylvestris]
Length=1196

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 123/208 (59%), Gaps = 18/208 (9%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             + AEA+L EKD+EN  L +++ Q E RWS+YE++M+SMEE+WQKQM SLQ+SL+ AKKSL
Sbjct  990   MVAEASLDEKDKENAALKEQVNQLEARWSDYEVRMRSMEEMWQKQMVSLQASLAAAKKSL  1049

Query  182   alDDSARNS---------------DASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLS  316
              +D+ A +                D +   +   G +  I      ++  G+R    GL 
Sbjct  1050  GVDNPAGHPGKREGSQSPCGYDSEDTTTMGTHTPGGSTPIEFASNGVDFGGIRENNGGLC  1109

Query  317   VIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLK  496
             V+  L  EFE R Q F D+A  + ++KS    +  NP  + RRL+H FE WKKDY  RLK
Sbjct  1110  VVNYLNREFELRRQNFDDEAMAIAQLKSEQLHST-NPAEDFRRLRHRFEEWKKDYKARLK  1168

Query  497   ETKVILHKLGSEEGASDKMKKKWWGRRN  580
             ETK  +HK G  E  ++K ++ WWG+++
Sbjct  1169  ETKAKVHKFGYSE--AEKTRRNWWGKKS  1194



>emb|CDP05853.1| unnamed protein product [Coffea canephora]
Length=882

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 120/202 (59%), Gaps = 20/202 (10%)
 Frame = +2

Query  2    LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
            L AEA L +K+ EN  L +++Q++E RW EYE KMK+ME+ WQKQM SLQ SL+ AKKSL
Sbjct  694  LIAEANLGKKETENAALREQVQEFEVRWLEYEGKMKAMEDTWQKQMASLQVSLAAAKKSL  753

Query  182  alDDSARNSDASVNASD-----DKGSTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFE  346
              D +A      ++        D   T   G      E NG      GL+ +G LA+EFE
Sbjct  754  GADHTAVQPAGRLDGLTSPRYYDSEDTMSGGARTPGGEANG------GLNSVGHLAKEFE  807

Query  347  QRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLG  526
             R Q+F +DAK +VEVKSG      NP  E RRLKH FE+WKKDY  RL+E K  L K G
Sbjct  808  NRKQIFDEDAKAIVEVKSG-----QNPGEEYRRLKHRFEAWKKDYKARLREAKSRLQKHG  862

Query  527  SEEGASDKMKKKWWGRRNSSRF  592
              EG  +K  +KWW ++  SRF
Sbjct  863  HLEG--EKRNRKWWIKK--SRF  880



>gb|KHN28019.1| Myosin-J heavy chain [Glycine soja]
Length=1196

 Score =   128 bits (322),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 126/211 (60%), Gaps = 23/211 (11%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             ++AEA + +K+EEN  L ++L+Q+E RW EYE +MKSME++WQKQM SLQ SL+ A+KSL
Sbjct  989   IKAEATIEQKEEENAELKEQLKQFERRWIEYEKRMKSMEDMWQKQMASLQMSLAAARKSL  1048

Query  182   alDDS----ARNSDASVNASDD-------------KGSTWDIGNNRTALENNGVRPVRAG  310
             A +++    AR   AS    D               G++  +  + +  E    R     
Sbjct  1049  ASENASGQIARRDVASPFGYDSEDATSVGSRTPRTPGASTPLKYSSSLTEAGAGRDANGT  1108

Query  311   LSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVR  490
             L+ +  L +EFEQR   F DDA+ LVEVK+G + AN N   ELR+LKH FE WKK+Y  R
Sbjct  1109  LTSVSNLMKEFEQRRHTFDDDARALVEVKAGQS-ANTNSVEELRKLKHSFEGWKKEYKAR  1167

Query  491   LKETKVILHKLGSEEGASDKMKKKWWGRRNS  583
             L+ETK  LHK        DK +++WWG+ +S
Sbjct  1168  LRETKARLHK-----SEMDKSRRRWWGKLSS  1193



>ref|XP_002866036.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42295.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1219

 Score =   128 bits (321),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 129/213 (61%), Gaps = 26/213 (12%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L++EAAL +K+EEN  L ++L+Q+E RWSEY++KMKSMEE WQKQM SLQ SL+ A+KSL
Sbjct  1011  LKSEAALAQKEEENTALREQLRQFEERWSEYDIKMKSMEETWQKQMSSLQMSLAAARKSL  1070

Query  182   alDD----SARNSDASVNA----SDDKGSTWDIG-NNRTALENNG------VRPVRAGLS  316
             A +     +    D S++     S+D  ST   G    T    NG      +R +   L+
Sbjct  1071  AAESITGQAGGRQDTSISPFGYDSEDTMSTGTPGVRTPTTKFTNGNTPELRIRELNGSLN  1130

Query  317   VIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLN------PDHELRRLKHMFESWKKD  478
              +  LA EF+QR   F +DA+ +VEVK G  +A  N      P+ E RRLK  FE+WKKD
Sbjct  1131  AVNHLAREFDQRRLNFDEDARAIVEVKLG-PQATPNGQQQQHPEDEFRRLKLRFETWKKD  1189

Query  479   YGVRLKETKVILHKLGSEEGASDKMKKKWWGRR  577
             Y  RL++TK  LH++  ++G      +KWWG+R
Sbjct  1190  YKARLRDTKARLHRVDGDKG----RHRKWWGKR  1218



>ref|XP_009589781.1| PREDICTED: myosin-2-like isoform X2 [Nicotiana tomentosiformis]
Length=1194

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 122/208 (59%), Gaps = 18/208 (9%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             + AEA+L EKD+EN  L +++ Q E RWS+YE++M+SMEE+WQKQM SLQ SL+ AKKSL
Sbjct  988   MVAEASLDEKDKENAALKEQVNQLEARWSDYEVRMRSMEEMWQKQMVSLQVSLAAAKKSL  1047

Query  182   alDDSARNS---------------DASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLS  316
              +D+ A +                D +   +   G +  I      ++  G+R    GL 
Sbjct  1048  GVDNPAGHPGKREGSQSPCGYDSEDTTTMGTHTPGGSTPIEFASNGVDFGGIRENNGGLC  1107

Query  317   VIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLK  496
             V+  L  EFE R Q F D+A  + ++KS    +  NP  + RRL+H FE WKKDY  RLK
Sbjct  1108  VVNYLNREFELRRQNFDDEAMAIAQLKSEQLHST-NPAEDFRRLRHRFEEWKKDYKARLK  1166

Query  497   ETKVILHKLGSEEGASDKMKKKWWGRRN  580
             ETK  +HKL   E  ++K ++ WWG+++
Sbjct  1167  ETKAKVHKLSYSE--AEKTRRNWWGKKS  1192



>ref|XP_009589778.1| PREDICTED: myosin-2-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009589780.1| PREDICTED: myosin-2-like isoform X1 [Nicotiana tomentosiformis]
Length=1195

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 122/208 (59%), Gaps = 18/208 (9%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             + AEA+L EKD+EN  L +++ Q E RWS+YE++M+SMEE+WQKQM SLQ SL+ AKKSL
Sbjct  989   MVAEASLDEKDKENAALKEQVNQLEARWSDYEVRMRSMEEMWQKQMVSLQVSLAAAKKSL  1048

Query  182   alDDSARNS---------------DASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLS  316
              +D+ A +                D +   +   G +  I      ++  G+R    GL 
Sbjct  1049  GVDNPAGHPGKREGSQSPCGYDSEDTTTMGTHTPGGSTPIEFASNGVDFGGIRENNGGLC  1108

Query  317   VIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLK  496
             V+  L  EFE R Q F D+A  + ++KS    +  NP  + RRL+H FE WKKDY  RLK
Sbjct  1109  VVNYLNREFELRRQNFDDEAMAIAQLKSEQLHST-NPAEDFRRLRHRFEEWKKDYKARLK  1167

Query  497   ETKVILHKLGSEEGASDKMKKKWWGRRN  580
             ETK  +HKL   E  ++K ++ WWG+++
Sbjct  1168  ETKAKVHKLSYSE--AEKTRRNWWGKKS  1193



>ref|XP_009773271.1| PREDICTED: myosin-2-like isoform X2 [Nicotiana sylvestris]
Length=1156

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 119/207 (57%), Gaps = 19/207 (9%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L EK+ EN  L ++L  +E R  EYE+KM+SMEE+WQKQM SLQ+SL+ AK SL
Sbjct  954   LKAEATLGEKEMENVALKEQLNLFEARCLEYEVKMRSMEEMWQKQMASLQASLAAAKNSL  1013

Query  182   alDDSA--------------RNSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLSV  319
                D+                +SD + +     G T     N   +  N  R V  GL++
Sbjct  1014  GAGDTTGRPGKPEGSPSPRYYDSDDATSMDTPAGCTPVKFTNSLGVGAN--REVNGGLAI  1071

Query  320   IGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKE  499
             +  L  EFEQR Q F D+A  +V +K G   +  NP  E RRLK  FE WKKDY VRLKE
Sbjct  1072  VSHLTLEFEQRKQNFDDEALAIVHLKPGQLHST-NPADEYRRLKCRFEEWKKDYKVRLKE  1130

Query  500   TKVILHKLGSEEGASDKMKKKWWGRRN  580
             TK  +HKLG  +    K ++KWWG+++
Sbjct  1131  TKAKVHKLGCSKAG--KNRRKWWGKKS  1155



>ref|XP_010482837.1| PREDICTED: myosin-2-like [Camelina sativa]
Length=1215

 Score =   127 bits (320),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 92/214 (43%), Positives = 130/214 (61%), Gaps = 26/214 (12%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L++EAAL +K+EEN  L ++L+Q+E RWSEYE+KMKSME+ WQKQM SLQ SL+ A+KSL
Sbjct  1005  LKSEAALAQKEEENTALREQLRQFEERWSEYEVKMKSMEDTWQKQMSSLQMSLAAARKSL  1064

Query  182   alDD----SARNSDASVNA----SDDKGSTWDIG-NNRTALENNG------VRPVRAGLS  316
             A +     +    D S++     S+D  ST   G    T    NG      +R +   L+
Sbjct  1065  AAESITGQAGGRQDTSISPFGYESEDTMSTGTPGVRTPTTKFTNGNTPELRIRELNGSLN  1124

Query  317   VIGQLAEEFEQRSQVFGDDAKFLVEVKSGL-TEANLN------PDHELRRLKHMFESWKK  475
              +  LA EF+QR   F +DA+ +V+VK G+  +A  N      P+ E RRLK  FE+WKK
Sbjct  1125  AVNHLAREFDQRRLNFDEDARAIVDVKLGVGPQATPNGQQQQHPEDEFRRLKQRFETWKK  1184

Query  476   DYGVRLKETKVILHKLGSEEGASDKMKKKWWGRR  577
             DY  RL++TK  LH++  ++G      +KWWG+R
Sbjct  1185  DYKARLRDTKARLHRVDGDKG----RHRKWWGKR  1214



>ref|XP_009773270.1| PREDICTED: myosin-2-like isoform X1 [Nicotiana sylvestris]
Length=1157

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 117/208 (56%), Gaps = 20/208 (10%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L+AEA L EK+ EN  L ++L  +E R  EYE+KM+SMEE+WQKQM SLQ +   A K+ 
Sbjct  954   LKAEATLGEKEMENVALKEQLNLFEARCLEYEVKMRSMEEMWQKQMASLQQASLAAAKNS  1013

Query  182   --alDDSAR-------------NSDASVNASDDKGSTWDIGNNRTALENNGVRPVRAGLS  316
               A D + R             +SD + +     G T     N   +  N  R V  GL+
Sbjct  1014  LGAGDTTGRPGKPEGSPSPRYYDSDDATSMDTPAGCTPVKFTNSLGVGAN--REVNGGLA  1071

Query  317   VIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLK  496
             ++  L  EFEQR Q F D+A  +V +K G   +  NP  E RRLK  FE WKKDY VRLK
Sbjct  1072  IVSHLTLEFEQRKQNFDDEALAIVHLKPGQLHST-NPADEYRRLKCRFEEWKKDYKVRLK  1130

Query  497   ETKVILHKLGSEEGASDKMKKKWWGRRN  580
             ETK  +HKLG  +    K ++KWWG+++
Sbjct  1131  ETKAKVHKLGCSKAG--KNRRKWWGKKS  1156



>ref|NP_001059992.1| Os07g0562800 [Oryza sativa Japonica Group]
 gb|AAQ87012.1| myosin heavy chain class VIII A1 protein [Oryza sativa Japonica 
Group]
 dbj|BAF21906.1| Os07g0562800 [Oryza sativa Japonica Group]
Length=1219

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 113/197 (57%), Gaps = 32/197 (16%)
 Frame = +2

Query  5     RAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksla  184
             +AEAALR+K+EEN++L Q+L QYE +WSEY         V  +  R+  + +        
Sbjct  1050  KAEAALRDKEEENEMLKQQLDQYEKKWSEY---------VASRAARTDAAPMHAHY----  1096

Query  185   lDDSARNSDASVNASDDKGSTWDIGNN----RTALENNGVRPVRAGLSVIGQLAEEFEQR  352
               DS    D S      +G+ +   N+    R A  N+  R     ++ +  LA+EFE R
Sbjct  1097  --DS---EDTSTGTHTPEGTEFKYQNHNSEARVAAPNSDRR-----INAVNHLAKEFEDR  1146

Query  353   SQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVILHKLGSE  532
              QVF DDA FLV VKSG   +N+NPD ELR+LK  F +WKKDY  RLKETKV L K+G E
Sbjct  1147  RQVFEDDAGFLVAVKSGQVGSNMNPDDELRKLKDRFATWKKDYKSRLKETKVNLQKVGEE  1206

Query  533   EGASDKMKKKWWGRRNS  583
                  K +K+WWG+++S
Sbjct  1207  -----KSRKRWWGKKSS  1218



>ref|NP_001078755.1| myosin 2 [Arabidopsis thaliana]
 sp|F4K0A6.1|MYO2_ARATH RecName: Full=Myosin-2; AltName: Full=AtATM2; AltName: Full=AtMYOS1 
[Arabidopsis thaliana]
 gb|AED96479.1| myosin 2 [Arabidopsis thaliana]
Length=1220

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 129/213 (61%), Gaps = 26/213 (12%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L++EAAL +K+EEN  L ++L+Q+E RWSEY++KMKSMEE WQKQM SLQ SL+ A+KSL
Sbjct  1012  LKSEAALSQKEEENTALREQLRQFEERWSEYDIKMKSMEETWQKQMSSLQMSLAAARKSL  1071

Query  182   alDD----SARNSDASVNA----SDDKGSTWDIG-NNRTALENNG------VRPVRAGLS  316
             A +     +    D S++     S+D  ST   G    T    NG      +R +   L+
Sbjct  1072  AAESITGQAGGRQDTSISPFGYDSEDTMSTGTPGVRTPTNKFTNGNTPELRIRELNGSLN  1131

Query  317   VIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLN------PDHELRRLKHMFESWKKD  478
              +  LA EF+QR   F +DA+ +VEVK G  +A  N      P+ E RRLK  FE+WKKD
Sbjct  1132  AVNHLAREFDQRRLNFDEDARAIVEVKLG-PQATPNGQQQQHPEDEFRRLKLRFETWKKD  1190

Query  479   YGVRLKETKVILHKLGSEEGASDKMKKKWWGRR  577
             Y  RL++TK  LH++  ++G      +KWWG+R
Sbjct  1191  YKARLRDTKARLHRVDGDKG----RHRKWWGKR  1219



>dbj|BAF01329.1| myosin heavy chain [Arabidopsis thaliana]
Length=1220

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 129/213 (61%), Gaps = 26/213 (12%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L++EAAL +K+EEN  L ++L+Q+E RWSEY++KMKSMEE WQKQM SLQ SL+ A+KSL
Sbjct  1012  LKSEAALSQKEEENTALREQLRQFEERWSEYDIKMKSMEETWQKQMSSLQMSLAAARKSL  1071

Query  182   alDD----SARNSDASVNA----SDDKGSTWDIG-NNRTALENNG------VRPVRAGLS  316
             A +     +    D S++     S+D  ST   G    T    NG      +R +   L+
Sbjct  1072  AAESITGQAGGRQDTSISPFGYDSEDTMSTGTPGVRTPTNKFTNGNTPELRIRELNGSLN  1131

Query  317   VIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLN------PDHELRRLKHMFESWKKD  478
              +  LA EF+QR   F +DA+ +VEVK G  +A  N      P+ E RRLK  FE+WKKD
Sbjct  1132  AVNHLAREFDQRRLNFDEDARAIVEVKLG-PQATPNGQQQQHPEDEFRRLKLRFETWKKD  1190

Query  479   YGVRLKETKVILHKLGSEEGASDKMKKKWWGRR  577
             Y  RL++TK  LH++  ++G      +KWWG+R
Sbjct  1191  YKARLRDTKARLHRVDGDKG----RHRKWWGKR  1219



>ref|NP_568806.3| myosin 2 [Arabidopsis thaliana]
 gb|AED96478.1| myosin 2 [Arabidopsis thaliana]
Length=1030

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 129/213 (61%), Gaps = 26/213 (12%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L++EAAL +K+EEN  L ++L+Q+E RWSEY++KMKSMEE WQKQM SLQ SL+ A+KSL
Sbjct  822   LKSEAALSQKEEENTALREQLRQFEERWSEYDIKMKSMEETWQKQMSSLQMSLAAARKSL  881

Query  182   alDD----SARNSDASVNA----SDDKGSTWDIG-NNRTALENNG------VRPVRAGLS  316
             A +     +    D S++     S+D  ST   G    T    NG      +R +   L+
Sbjct  882   AAESITGQAGGRQDTSISPFGYDSEDTMSTGTPGVRTPTNKFTNGNTPELRIRELNGSLN  941

Query  317   VIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLN------PDHELRRLKHMFESWKKD  478
              +  LA EF+QR   F +DA+ +VEVK G  +A  N      P+ E RRLK  FE+WKKD
Sbjct  942   AVNHLAREFDQRRLNFDEDARAIVEVKLG-PQATPNGQQQQHPEDEFRRLKLRFETWKKD  1000

Query  479   YGVRLKETKVILHKLGSEEGASDKMKKKWWGRR  577
             Y  RL++TK  LH++  ++G      +KWWG+R
Sbjct  1001  YKARLRDTKARLHRVDGDKGR----HRKWWGKR  1029



>dbj|BAB10751.1| myosin heavy chain [Arabidopsis thaliana]
Length=1111

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 129/213 (61%), Gaps = 26/213 (12%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L++EAAL +K+EEN  L ++L+Q+E RWSEY++KMKSMEE WQKQM SLQ SL+ A+KSL
Sbjct  903   LKSEAALSQKEEENTALREQLRQFEERWSEYDIKMKSMEETWQKQMSSLQMSLAAARKSL  962

Query  182   alDD----SARNSDASVNA----SDDKGSTWDIG-NNRTALENNG------VRPVRAGLS  316
             A +     +    D S++     S+D  ST   G    T    NG      +R +   L+
Sbjct  963   AAESITGQAGGRQDTSISPFGYDSEDTMSTGTPGVRTPTNKFTNGNTPELRIRELNGSLN  1022

Query  317   VIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLN------PDHELRRLKHMFESWKKD  478
              +  LA EF+QR   F +DA+ +VEVK G  +A  N      P+ E RRLK  FE+WKKD
Sbjct  1023  AVNHLAREFDQRRLNFDEDARAIVEVKLG-PQATPNGQQQQHPEDEFRRLKLRFETWKKD  1081

Query  479   YGVRLKETKVILHKLGSEEGASDKMKKKWWGRR  577
             Y  RL++TK  LH++  ++G      +KWWG+R
Sbjct  1082  YKARLRDTKARLHRVDGDKG----RHRKWWGKR  1110



>emb|CAA84065.1| myosin [Arabidopsis thaliana]
Length=1101

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 129/213 (61%), Gaps = 26/213 (12%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             L++EAAL +K+EEN  L ++L+Q+E RWSEY++KMKSMEE WQKQM SLQ SL+ A+KSL
Sbjct  893   LKSEAALSQKEEENTALREQLRQFEERWSEYDIKMKSMEETWQKQMSSLQMSLAAARKSL  952

Query  182   alDD----SARNSDASVNA----SDDKGSTWDIG-NNRTALENNG------VRPVRAGLS  316
             A +     +    D S++     S+D  ST   G    T    NG      +R +   L+
Sbjct  953   AAESITGQAGGRQDTSISPFGYDSEDTMSTGTPGVRTPTNKFTNGNTPELRIRELNGSLN  1012

Query  317   VIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLN------PDHELRRLKHMFESWKKD  478
              +  LA EF+QR   F +DA+ +VEVK G  +A  N      P+ E RRLK  FE+WKKD
Sbjct  1013  AVNHLAREFDQRRLNFDEDARAIVEVKLG-PQATPNGQQQQHPEDEFRRLKLRFETWKKD  1071

Query  479   YGVRLKETKVILHKLGSEEGASDKMKKKWWGRR  577
             Y  RL++TK  LH++  ++G      +KWWG+R
Sbjct  1072  YKARLRDTKARLHRVDGDKGR----HRKWWGKR  1100



>ref|XP_008454630.1| PREDICTED: myosin-2-like [Cucumis melo]
Length=1207

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 91/213 (43%), Positives = 132/213 (62%), Gaps = 23/213 (11%)
 Frame = +2

Query  2     LRAEAALREKDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksl  181
             + AEA + +K+EEN  L ++++Q+E+R  EYE KMKSME++WQKQM SLQ SL+ AKK+L
Sbjct  996   VEAEATIEKKEEENAALREQVKQFESRRLEYEAKMKSMEDMWQKQMASLQMSLAAAKKTL  1055

Query  182   alDDSARNSDASVNASDDKGSTWD------IGNNRTALEN----NGVRPVRAG------L  313
             A +++A      V+A +     +D      +G+    +      +G+  V AG      L
Sbjct  1056  AAENAA--PPGRVDACNSPPHYYDSEDTTSMGSRTPGVTTPKKASGISEVGAGREMNGTL  1113

Query  314   SVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTE--ANLNPDHELRRLKHMFESWKKDYGV  487
               +  L +EFEQR   F DDAK L+E KSG T+  +N NPD E R++K  FE+WKK+Y  
Sbjct  1114  VAVNNLVKEFEQRRIAFDDDAKALIEAKSGQTQMGSNANPDEEYRKIKVRFEAWKKEYKA  1173

Query  488   RLKETKV-ILHKLGSEEGASDKMKKKWWGRRNS  583
             RL+ETK  + HK G  E   DK+++KWWG+ +S
Sbjct  1174  RLRETKAKVHHKHGHFE--VDKLRRKWWGKFSS  1204



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250