BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP010A11 658 bp,

Length=628
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_003588355.1|  Mitochondrial protein, putative                    197   4e-54   
gb|AGC78890.1|  hypothetical protein                                    181   1e-53   Vicia faba [broad bean]
emb|CDY45505.1|  BnaCnng12640D                                          179   1e-50   Brassica napus [oilseed rape]
gb|AFK35083.1|  unknown                                                 138   2e-38   Lotus japonicus
ref|XP_006830462.1|  hypothetical protein AMTR_s00115p00112450        80.5    3e-16   
gb|KIU09600.1|  hypothetical protein SC08_Contig83orf03710            75.5    1e-13   Clostridium butyricum
gb|EEP52421.1|  conserved hypothetical protein                        75.1    2e-13   Clostridium butyricum E4 str. BoNT E BL5262
gb|EEP55936.1|  conserved hypothetical protein                        74.3    3e-13   Clostridium butyricum E4 str. BoNT E BL5262
gb|EEP52383.1|  conserved hypothetical protein                        74.3    3e-13   Clostridium butyricum E4 str. BoNT E BL5262
gb|EEP55040.1|  conserved hypothetical protein                        72.4    2e-12   Clostridium butyricum E4 str. BoNT E BL5262
emb|CCG06614.1|  Putative uncharacterized protein                     60.1    8e-12   Pararhodospirillum photometricum DSM 122
gb|EID19495.1|  hypothetical protein HMPREF1043_0707                  70.5    9e-12   Streptococcus anginosus subsp. whileyi CCUG 39159
ref|XP_003608262.1|  hypothetical protein MTR_4g091430                70.1    1e-11   Medicago truncatula
emb|CCG06602.1|  Putative uncharacterized protein                     60.1    1e-11   Pararhodospirillum photometricum DSM 122
ref|XP_002516402.1|  conserved hypothetical protein                   67.0    2e-11   
emb|CCG06617.1|  Putative uncharacterized protein                     59.7    4e-11   Pararhodospirillum photometricum DSM 122
dbj|BAC18353.1|  conserved hypothetical protein                       65.5    4e-10   Corynebacterium efficiens YS-314
gb|EEW08769.1|  hypothetical protein VMD_37440                        59.7    2e-08   Vibrio mimicus VM573
ref|XP_002515778.1|  conserved hypothetical protein                   59.3    2e-08   
emb|CAJ30046.1|  hypothetical protein mgI388                          56.6    3e-08   Magnetospirillum gryphiswaldense MSR-1
gb|EFO28588.1|  conserved hypothetical protein                        57.0    8e-08   Roseibium sp. TrichSKD4
gb|EEZ93815.1|  conserved hypothetical protein                        58.5    8e-08   Legionella longbeachae D-4968
gb|KHF27783.1|  hypothetical protein CM49_06648                       58.2    2e-07   Paenibacillus sp. P1XP2
gb|EPS74531.1|  hypothetical protein M569_00248                       52.4    5e-07   Genlisea aurea
gb|EMR91350.1|  IS1 transposase InsAB                                 55.1    6e-07   Escherichia coli ONT:H33 str. C48/93
gb|EFK16730.1|  hypothetical protein HMPREF9541_00874                 54.3    1e-06   Escherichia coli MS 116-1
gb|ADI19371.1|  hypothetical protein                                  55.5    1e-06   uncultured Spirochaetales bacterium HF0500_06B09
dbj|GAL60548.1|  hypothetical protein EV102420_46_00001               53.5    1e-06   Escherichia vulneris NBRC 102420
gb|EEH89630.1|  hypothetical protein ESAG_07155                       53.5    2e-06   
gb|EEJ41387.1|  hypothetical protein HMPREF0549_0166                  53.5    2e-06   Lactobacillus vaginalis DSM 5837 = ATCC 49540
gb|ADI17937.1|  hypothetical protein                                  53.5    2e-06   uncultured Desulfobacterales bacterium HF0200_07G10
gb|EFE07627.1|  hypothetical protein CIT292_08961                     53.1    2e-06   Citrobacter youngae ATCC 29220
gb|EKN21706.1|  hypothetical protein HMPREF1075_02341                 54.7    2e-06   Parabacteroides distasonis CL03T12C09
gb|ADI16721.1|  hypothetical protein                                  50.8    7e-06   uncultured Verrucomicrobiales bacterium HF0010_05E02
ref|XP_009604942.1|  PREDICTED: NAC domain-containing protein 2-like  54.7    1e-05   Nicotiana tomentosiformis
gb|EFD68878.1|  LOW QUALITY PROTEIN: conserved hypothetical protein   46.2    1e-05   Streptomyces lividans TK24
gb|EDM52657.1|  hypothetical protein EUBVEN_00035                     50.8    2e-05   Eubacterium ventriosum ATCC 27560
ref|WP_019782138.1|  hypothetical protein                             50.8    2e-05   
ref|WP_005421831.1|  hypothetical protein [                           49.7    3e-05   
ref|XP_007141246.1|  hypothetical protein PHAVU_008G179700g           49.7    3e-05   Phaseolus vulgaris [French bean]
ref|XP_009761286.1|  PREDICTED: NAC domain-containing protein 2-like  53.1    4e-05   Nicotiana sylvestris
ref|WP_004595993.1|  hypothetical protein                             51.2    5e-05   
gb|ADI18136.1|  hypothetical protein                                  50.1    5e-05   uncultured Verrucomicrobiales bacterium HF0200_39L05
gb|EDN76396.1|  hypothetical protein RUMGNA_03265                     48.9    6e-05   Ruminococcus gnavus ATCC 29149
ref|WP_039188518.1|  hypothetical protein                             49.3    8e-05   Listeria monocytogenes
gb|EFE51205.1|  hypothetical protein PROVRETT_10140                   48.1    1e-04   Providencia rettgeri DSM 1131
ref|WP_021210567.1|  hypothetical protein                             48.5    2e-04   Leuconostoc mesenteroides
gb|ACO04175.1|  conserved hypothetical protein                        50.1    2e-04   Persephonella marina EX-H1
ref|WP_034879132.1|  hypothetical protein                             47.8    2e-04   Endozoicomonas montiporae
gb|AGC71893.1|  hypothetical protein                                  47.8    2e-04   uncultured bacterium A1Q1_fos_4
ref|WP_006427236.1|  hypothetical protein                             47.8    3e-04   
gb|KDF02499.1|  hypothetical protein AF42_05465                       47.0    3e-04   Citrobacter freundii MGH 56
ref|WP_004846162.1|  hypothetical protein [                           47.0    3e-04   
gb|EEB75630.1|  hypothetical protein CDSM653_949                      43.9    3e-04   
gb|EFR51295.1|  hypothetical protein BBNG_01843                       46.6    4e-04   Bifidobacterium bifidum NCIMB 41171
gb|EGG54219.1|  hypothetical protein HMPREF9439_01517                 47.0    4e-04   Parasutterella excrementihominis YIT 11859
ref|WP_006426162.1|  hypothetical protein                             47.4    5e-04   
gb|EFE69118.1|  conserved hypothetical protein                        46.2    6e-04   Streptomyces ghanaensis ATCC 14672
gb|EPS70029.1|  hypothetical protein M569_04736                       46.6    6e-04   Genlisea aurea
dbj|BAG46933.1|  conserved hypothetical protein                       47.0    6e-04   Burkholderia multivorans ATCC 17616
gb|KGW37799.1|  hypothetical protein Y045_6146                        46.6    7e-04   Burkholderia pseudomallei MSHR2451
gb|EST57089.1|  hypothetical protein K151_3366                        46.2    7e-04   Proteus hauseri ZMd44
gb|EPR32483.1|  hypothetical protein dsmv_3640                        47.8    0.001   Desulfococcus multivorans DSM 2059



>ref|XP_003588355.1| Mitochondrial protein, putative [Medicago truncatula]
Length=1106

 Score =   197 bits (500),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 118/204 (58%), Gaps = 71/204 (35%)
 Frame = -3

Query  626  SCYHLAESCVFNKQSLPPGMCRFPNQKIGEHPFSRSYGVILPSSFDMVLSSALVYSTCSP  447
            SCYHLAESCVFNKQSLPPGMCRFPNQKIGEHPFSRSYGVILPSSFDMVLSSALVYSTCSP
Sbjct  593  SCYHLAESCVFNKQSLPPGMCRFPNQKIGEHPFSRSYGVILPSSFDMVLSSALVYSTCSP  652

Query  446  VSVWGTVSSPGGSPSQFEVFSWKFQPC*L*QQSRL*TDS*LWQGGTLCPLATPTLIKRLK  267
            VSVWGTVSSPGGSPSQFE                         GGTLC LATPTL  +  
Sbjct  653  VSVWGTVSSPGGSPSQFE-------------------------GGTLCSLATPTLTSKQV  687

Query  266  APTEDRSPNYDESFAF*SASRVGPGRVRKALMTQGSY*GKESEGKRGQPSARSSNSLQQT  87
                 R           S    GPGRVRK                               
Sbjct  688  NYLLKRQ----------SRRATGPGRVRK-------------------------------  706

Query  86   GMVL*SKQLRHFRVPIGRQPFRGF  15
                 SKQLRHFRVPIGRQPFRGF
Sbjct  707  -----SKQLRHFRVPIGRQPFRGF  725



>gb|AGC78890.1| hypothetical protein (mitochondrion) [Vicia faba]
 gb|AGC79003.1| hypothetical protein (mitochondrion) [Vicia faba]
Length=162

 Score =   181 bits (458),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/87 (100%), Positives = 87/87 (100%), Gaps = 0/87 (0%)
 Frame = -3

Query  626  SCYHLAESCVFNKQSLPPGMCRFPNQKIGEHPFSRSYGVILPSSFDMVLSSALVYSTCSP  447
            SCYHLAESCVFNKQSLPPGMCRFPNQKIGEHPFSRSYGVILPSSFDMVLSSALVYSTCSP
Sbjct  76   SCYHLAESCVFNKQSLPPGMCRFPNQKIGEHPFSRSYGVILPSSFDMVLSSALVYSTCSP  135

Query  446  VSVWGTVSSPGGSPSQFEVFSWKFQPC  366
            VSVWGTVSSPGGSPSQFEVFSWKFQPC
Sbjct  136  VSVWGTVSSPGGSPSQFEVFSWKFQPC  162



>emb|CDY45505.1| BnaCnng12640D [Brassica napus]
Length=378

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/86 (100%), Positives = 86/86 (100%), Gaps = 0/86 (0%)
 Frame = -3

Query  626  SCYHLAESCVFNKQSLPPGMCRFPNQKIGEHPFSRSYGVILPSSFDMVLSSALVYSTCSP  447
            SCYHLAESCVFNKQSLPPGMCRFPNQKIGEHPFSRSYGVILPSSFDMVLSSALVYSTCSP
Sbjct  292  SCYHLAESCVFNKQSLPPGMCRFPNQKIGEHPFSRSYGVILPSSFDMVLSSALVYSTCSP  351

Query  446  VSVWGTVSSPGGSPSQFEVFSWKFQP  369
            VSVWGTVSSPGGSPSQFEVFSWKFQP
Sbjct  352  VSVWGTVSSPGGSPSQFEVFSWKFQP  377



>gb|AFK35083.1| unknown [Lotus japonicus]
Length=68

 Score =   138 bits (348),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/68 (100%), Positives = 68/68 (100%), Gaps = 0/68 (0%)
 Frame = -3

Query  569  MCRFPNQKIGEHPFSRSYGVILPSSFDMVLSSALVYSTCSPVSVWGTVSSPGGSPSQFEV  390
            MCRFPNQKIGEHPFSRSYGVILPSSFDMVLSSALVYSTCSPVSVWGTVSSPGGSPSQFEV
Sbjct  1    MCRFPNQKIGEHPFSRSYGVILPSSFDMVLSSALVYSTCSPVSVWGTVSSPGGSPSQFEV  60

Query  389  FSWKFQPC  366
            FSWKFQPC
Sbjct  61   FSWKFQPC  68



>ref|XP_006830462.1| hypothetical protein AMTR_s00115p00112450 [Amborella trichopoda]
 gb|ERM97878.1| hypothetical protein AMTR_s00115p00112450 [Amborella trichopoda]
Length=61

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -3

Query  146  ESEGKRGQPSARSSNSLQQTGMVL*SKQLRHFRVPIGRQPFRGFLRDR  3
            ESEGKRGQP ARSSNS QQTGMV  SKQL H RVPIGRQPF+GFLRDR
Sbjct  2    ESEGKRGQPMARSSNSFQQTGMVQQSKQLHHSRVPIGRQPFQGFLRDR  49



>gb|KIU09600.1| hypothetical protein SC08_Contig83orf03710 [Clostridium butyricum]
Length=155

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 53/85 (62%), Gaps = 8/85 (9%)
 Frame = -3

Query  626  SCYHLAESCVFNKQSLPPGMCRFPNQKIGEHPFSRSYGVILPSSFDMVLSSALVYSTCSP  447
            S Y LAE+CVF KQ L P +C  PN   G HPFSRSYGV LPSS  ++L SAL +S   P
Sbjct  10   SAYALAETCVFVKQLLVPILCGLPN---GRHPFSRSYGVNLPSSLTVILPSALGFSPHLP  66

Query  446  VSVWGTVSSPGGSPSQFEVFSWKFQ  372
            VSV GT     G+ S    FSWK +
Sbjct  67   VSVCGT-----GTTSLSRCFSWKHE  86



>gb|EEP52421.1| conserved hypothetical protein [Clostridium butyricum E4 str. 
BoNT E BL5262]
 gb|EEP55268.1| conserved hypothetical protein [Clostridium butyricum E4 str. 
BoNT E BL5262]
Length=162

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 53/85 (62%), Gaps = 8/85 (9%)
 Frame = -3

Query  626  SCYHLAESCVFNKQSLPPGMCRFPNQKIGEHPFSRSYGVILPSSFDMVLSSALVYSTCSP  447
            S Y LAE+CVF KQ L P +C  PN   G HPFSRSYGV LPSS  ++L SAL +S   P
Sbjct  17   SAYALAETCVFVKQLLVPILCGLPN---GRHPFSRSYGVNLPSSLTVILPSALGFSPHLP  73

Query  446  VSVWGTVSSPGGSPSQFEVFSWKFQ  372
            VSV GT     G+ S    FSWK +
Sbjct  74   VSVCGT-----GTTSLSRCFSWKHE  93



>gb|EEP55936.1| conserved hypothetical protein [Clostridium butyricum E4 str. 
BoNT E BL5262]
Length=158

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 53/85 (62%), Gaps = 8/85 (9%)
 Frame = -3

Query  626  SCYHLAESCVFNKQSLPPGMCRFPNQKIGEHPFSRSYGVILPSSFDMVLSSALVYSTCSP  447
            S Y LAE+CVF KQ L P +C  P   IG HPFSRSYGV LPSS  ++L SAL +S   P
Sbjct  17   SAYALAETCVFVKQLLVPILCGLP---IGRHPFSRSYGVNLPSSLTVILPSALGFSPHLP  73

Query  446  VSVWGTVSSPGGSPSQFEVFSWKFQ  372
            VSV GT     G+ S    FSWK +
Sbjct  74   VSVCGT-----GTTSLSRCFSWKHE  93



>gb|EEP52383.1| conserved hypothetical protein [Clostridium butyricum E4 str. 
BoNT E BL5262]
 gb|EEP52428.1| conserved hypothetical protein [Clostridium butyricum E4 str. 
BoNT E BL5262]
 gb|EEP52468.1| conserved hypothetical protein [Clostridium butyricum E4 str. 
BoNT E BL5262]
 gb|EEP52597.1| conserved hypothetical protein [Clostridium butyricum E4 str. 
BoNT E BL5262]
 gb|EEP55524.1| conserved hypothetical protein [Clostridium butyricum E4 str. 
BoNT E BL5262]
 gb|EEP55744.1| conserved hypothetical protein [Clostridium butyricum E4 str. 
BoNT E BL5262]
Length=162

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 53/85 (62%), Gaps = 8/85 (9%)
 Frame = -3

Query  626  SCYHLAESCVFNKQSLPPGMCRFPNQKIGEHPFSRSYGVILPSSFDMVLSSALVYSTCSP  447
            S Y LAE+CVF KQ L P +C  P   IG HPFSRSYGV LPSS  ++L SAL +S   P
Sbjct  17   SAYALAETCVFVKQLLVPILCGLP---IGRHPFSRSYGVNLPSSLTVILPSALGFSPHLP  73

Query  446  VSVWGTVSSPGGSPSQFEVFSWKFQ  372
            VSV GT     G+ S    FSWK +
Sbjct  74   VSVCGT-----GTTSLSRCFSWKHE  93



>gb|EEP55040.1| conserved hypothetical protein [Clostridium butyricum E4 str. 
BoNT E BL5262]
Length=162

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 52/85 (61%), Gaps = 8/85 (9%)
 Frame = -3

Query  626  SCYHLAESCVFNKQSLPPGMCRFPNQKIGEHPFSRSYGVILPSSFDMVLSSALVYSTCSP  447
            S Y LAE+CVF KQ L P +C  P    G HPFSRSYGV LPSS  ++L SAL +S   P
Sbjct  17   SAYALAETCVFVKQLLVPILCGLP---FGRHPFSRSYGVNLPSSLTVILPSALGFSPHLP  73

Query  446  VSVWGTVSSPGGSPSQFEVFSWKFQ  372
            VSV GT     G+ S    FSWK +
Sbjct  74   VSVCGT-----GTTSLSRCFSWKHE  93



>emb|CCG06614.1| Putative uncharacterized protein, partial [Rhodospirillum photometricum 
DSM 122]
Length=114

 Score = 60.1 bits (144),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  539  EHPFSRSYGVILPSSFDMVLSSALVYSTCSPVSVWGTVSSPG  414
              PFSRSYG ILPSSF+ +LSSALVYST  PVSVWGTV + G
Sbjct  42   RAPFSRSYGGILPSSFNTILSSALVYSTSPPVSVWGTVHTWG  83


 Score = 37.0 bits (84),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -1

Query  625  RVTT*QSPVFLINSRYPLVCA  563
            R+ T QSPVFL+NSR+PLVCA
Sbjct  13   RLATSQSPVFLVNSRHPLVCA  33



>gb|EID19495.1| hypothetical protein HMPREF1043_0707 [Streptococcus anginosus 
subsp. whileyi CCUG 39159]
Length=191

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -2

Query  537  APLLPKLRGHFAEFLRHGSLKRPSILYLFTCVGLGYGQF  421
            APLLPKLRGHFAEFL H SL R SILYL TCVGLGYGQF
Sbjct  28   APLLPKLRGHFAEFLNHDSLDRLSILYLTTCVGLGYGQF  66



>ref|XP_003608262.1| hypothetical protein MTR_4g091430 [Medicago truncatula]
 gb|AES90459.1| hypothetical protein MTR_4g091430 [Medicago truncatula]
Length=167

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  626  SCYHLAESCVFNKQSLPPGMCRFPNQKIGEHPF  528
            SCYHLAESCVFNKQSLPPGMCRFPNQKIG+  F
Sbjct  120  SCYHLAESCVFNKQSLPPGMCRFPNQKIGDLSF  152



>emb|CCG06602.1| Putative uncharacterized protein, partial [Rhodospirillum photometricum 
DSM 122]
Length=114

 Score = 60.1 bits (144),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  539  EHPFSRSYGVILPSSFDMVLSSALVYSTCSPVSVWGTVSSPG  414
              PFSRSYG ILPSSF+ +LSSALVYST  PVSVWGTV + G
Sbjct  42   RAPFSRSYGGILPSSFNTILSSALVYSTSPPVSVWGTVHTWG  83


 Score = 36.6 bits (83),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -1

Query  625  RVTT*QSPVFLINSRYPLVCA  563
            R+ T QSPVFL+NSR+PLVCA
Sbjct  13   RLATSQSPVFLVNSRHPLVCA  33



>ref|XP_002516402.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46019.1| conserved hypothetical protein [Ricinus communis]
Length=52

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  38   RWVHESDEVALTTEPCLSVGANWMIGPRAAPSSPHSPFPNM  160
            RWV ES EVAL TEPCL VGANWMIGPR   S PHSPFPN+
Sbjct  12   RWVDESAEVALPTEPCLPVGANWMIGPRTGLSFPHSPFPNI  52



>emb|CCG06617.1| Putative uncharacterized protein, partial [Rhodospirillum photometricum 
DSM 122]
Length=114

 Score = 59.7 bits (143),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  539  EHPFSRSYGVILPSSFDMVLSSALVYSTCSPVSVWGTVSSPG  414
              PFSRSYG ILPSSF+ +LSSALVYST  PVSVWGTV + G
Sbjct  42   RAPFSRSYGGILPSSFNTILSSALVYSTSPPVSVWGTVHTWG  83


 Score = 35.0 bits (79),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -1

Query  625  RVTT*QSPVFLINSRYPLVCA  563
            R+ T Q PVFL+NSR+PLVCA
Sbjct  13   RLATSQGPVFLVNSRHPLVCA  33



>dbj|BAC18353.1| conserved hypothetical protein [Corynebacterium efficiens YS-314]
Length=261

 Score = 65.5 bits (158),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -2

Query  540  RAPLLPKLRGHFAEFLRHGSLKRPSILYLFTCVGLGYG  427
            +APLLPKLRGHFAEFL H S +R SILYL TCVGLGYG
Sbjct  99   QAPLLPKLRGHFAEFLNHSSPERLSILYLTTCVGLGYG  136


 Score = 25.8 bits (55),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = -3

Query  614  LAESCVFNKQSLPPGMC  564
             A +CVF+KQSLP  +C
Sbjct  69   FARTCVFSKQSLPSILC  85



>gb|EEW08769.1| hypothetical protein VMD_37440 [Vibrio mimicus VM573]
Length=104

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 49/85 (58%), Gaps = 16/85 (19%)
 Frame = -3

Query  626  SCYHLAESCVFNKQSLPPGMCRFPNQKIGEHPFSRSYGVILPSSFDMVLSSALVYSTCSP  447
            SC HL  + + +  S+  G+         E  FSRSYG ILPSSF  VLSSALV+ST  P
Sbjct  10   SCSHLVSATLVS--SIREGLHH------QERTFSRSYGTILPSSFTRVLSSALVFSTRPP  61

Query  446  VSVWGTVSSPGGSPSQFEV--FSWK  378
            VSVWGT+      P   ++  FSWK
Sbjct  62   VSVWGTI------PYNLKLRGFSWK  80



>ref|XP_002515778.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46617.1| conserved hypothetical protein [Ricinus communis]
Length=87

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = -2

Query  105  QFAPTDRHGSVVKATSSLSCTHRTAALSGVP  13
            QF PTDRHGSVVKATSSLSCT+RT ALSGVP
Sbjct  57   QFTPTDRHGSVVKATSSLSCTYRTIALSGVP  87



>emb|CAJ30046.1| hypothetical protein mgI388 [Magnetospirillum gryphiswaldense 
MSR-1]
Length=150

 Score = 56.6 bits (135),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  548  KIGEHPFSRSYGVILPSSFDMVLSSALVYSTCSPVSVWGTV  426
            + G +P SRSYGV LPSSF+ +LSSALVYST  PVSV GTV
Sbjct  19   RNGRYPLSRSYGVNLPSSFNTILSSALVYSTSPPVSVSGTV  59


 Score = 28.5 bits (62),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 10/15 (67%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -1

Query  601  VFLINSRYPLVCAAF  557
            +FL+NSR+PLVCA +
Sbjct  1    MFLVNSRHPLVCATY  15



>gb|EFO28588.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gb|EFO31301.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gb|EFO32114.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gb|EFO32147.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gb|EFO33310.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gb|EFO33529.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
Length=60

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -2

Query  543  RRAPLLPKLRGHFAEFLRHGSLKRPSILYLFTCVGLGYGQFTGRIA  406
            +   LL  LR HFAEFL+H SLKR  ILY  TCVG GYG + G I+
Sbjct  5    KEVSLLANLREHFAEFLQHSSLKRLGILYQSTCVGFGYGLYGGAIS  50



>gb|EEZ93815.1| conserved hypothetical protein [Legionella longbeachae D-4968]
Length=157

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 52/91 (57%), Gaps = 15/91 (16%)
 Frame = -3

Query  617  HLAESCVFNKQSLPPGMCRFPNQKIGEHPFSRSYGVILPSSFDMVLSSALVYSTCSPVSV  438
            HL  + +F+ +S      +F ++K     FSRSYG ILPSSF  VLSSALV+STC PVSV
Sbjct  9    HLVSAALFSSES------KFLHRK--GRTFSRSYGTILPSSFTRVLSSALVFSTCPPVSV  60

Query  437  WGTV-------SSPGGSPSQFEVFSWKFQPC  366
             GTV       + PG   S   +++    PC
Sbjct  61   CGTVLYKLWLAAFPGSRASMTSLYTEVSAPC  91



>gb|KHF27783.1| hypothetical protein CM49_06648 [Paenibacillus sp. P1XP2]
Length=191

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = -3

Query  626  SCYHLAESCVFNKQSLPPGMCR-FPNQKIGEHPFSRSYGVILPSSFDMVLSSALVYSTCS  450
            S Y  A++CVF KQSL P  C       +  HPFSRSYGVILPSS   VL  AL +S+  
Sbjct  110  SPYGFAQTCVFAKQSLGPFHCGPLVLFTLPGHPFSRSYGVILPSSLTRVLPRALEFSSRL  169

Query  449  PVSVWGT  429
            PVSV GT
Sbjct  170  PVSVCGT  176



>gb|EPS74531.1| hypothetical protein M569_00248, partial [Genlisea aurea]
Length=102

 Score = 52.4 bits (124),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  543  RRAPLLPKLRGHFAEFLRHGSLKRPSILYLFTCVGLGY  430
              APLLPKLRG+FAEFLR   L    ILYL TCVG GY
Sbjct  60   EEAPLLPKLRGYFAEFLRESCLAPLGILYLPTCVGFGY  97


 Score = 28.5 bits (62),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -3

Query  620  YHLAESCVFNKQSLPPGMC  564
            Y  AE+CVF KQS  PG C
Sbjct  37   YDFAETCVFGKQSPGPGHC  55



>gb|EMR91350.1| IS1 transposase InsAB, partial [Escherichia coli ONT:H33 str. 
C48/93]
Length=80

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 39/67 (58%), Gaps = 6/67 (9%)
 Frame = -1

Query  610  QSPVFLINSRYPLVCAAFL------IKR*ESTPSPEVTGSFCRVPSTWFSQAP*YTLLVH  449
             S VFLINS   LV +         +    S PSPEVT  FC VPS  FSQAP Y+L  H
Sbjct  10   HSAVFLINSCSQLVSSTDFSSTSKSLHLHISVPSPEVTAPFCLVPSPEFSQAPWYSLPDH  69

Query  448  LCRFGVR  428
            LCRFGVR
Sbjct  70   LCRFGVR  76



>gb|EFK16730.1| hypothetical protein HMPREF9541_00874 [Escherichia coli MS 116-1]
Length=68

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 38/64 (59%), Gaps = 6/64 (9%)
 Frame = -1

Query  601  VFLINSRYPLVCAAFLIKR*E------STPSPEVTGSFCRVPSTWFSQAP*YTLLVHLCR  440
            +FLINS   LV +       E      S PSPEVT  FC VPS  FSQAP Y+L  HLCR
Sbjct  1    MFLINSCSQLVSSTDFSSIREGLHLHISVPSPEVTAPFCLVPSPEFSQAPWYSLPDHLCR  60

Query  439  FGVR  428
            FGVR
Sbjct  61   FGVR  64



>gb|ADI19371.1| hypothetical protein [uncultured Spirochaetales bacterium HF0500_06B09]
Length=160

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 44/82 (54%), Gaps = 10/82 (12%)
 Frame = -3

Query  626  SCYHLAESCVFNKQSLPPGMCRFPNQKIGEH--------PFSRSYGVILPSSFDMVLSSA  471
            S Y LAE+CVF KQS  P +C      I            FSRSY  ILPSS   V SSA
Sbjct  59   SRYRLAETCVFGKQSPGPFLCNLSQTPIARKLWCISARPHFSRSYVCILPSSLTRVHSSA  118

Query  470  LVYSTCSPVSVWGTVSSPGGSP  405
            L  S+  PVSV+GTV  PG  P
Sbjct  119  LESSSRLPVSVYGTV--PGRLP  138



>dbj|GAL60548.1| hypothetical protein EV102420_46_00001 [Escherichia vulneris 
NBRC 102420]
Length=68

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 38/64 (59%), Gaps = 6/64 (9%)
 Frame = -1

Query  601  VFLINSRYPLVCAAFL------IKR*ESTPSPEVTGSFCRVPSTWFSQAP*YTLLVHLCR  440
            +FLINS   LV +         +    S PSPEVT  FC VPS  FSQAP Y+L  HLCR
Sbjct  1    MFLINSCSQLVSSTGFSSVSKSLHLRTSVPSPEVTAPFCLVPSPEFSQAPWYSLPDHLCR  60

Query  439  FGVR  428
            FGVR
Sbjct  61   FGVR  64



>gb|EEH89630.1| hypothetical protein ESAG_07155 [Escherichia sp. 3_2_53FAA]
Length=68

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -1

Query  538  STPSPEVTGSFCRVPSTWFSQAP*YTLLVHLCRFGVR  428
            S PSPEVT  FC VPS  FSQAP Y+L  HLCRFGVR
Sbjct  28   SVPSPEVTAPFCLVPSPEFSQAPWYSLPDHLCRFGVR  64



>gb|EEJ41387.1| hypothetical protein HMPREF0549_0166 [Lactobacillus vaginalis 
DSM 5837 = ATCC 49540]
Length=62

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -1

Query  538  STPSPEVTGSFCRVPSTWFSQAP*YTLLVHLCRFGVR  428
            S PSPEVT  FC VPS  FSQAP Y+L  HLCRFGVR
Sbjct  22   SVPSPEVTAPFCLVPSPEFSQAPWYSLPDHLCRFGVR  58



>gb|ADI17937.1| hypothetical protein [uncultured Desulfobacterales bacterium 
HF0200_07G10]
Length=70

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  540  RAPLLPKLRGHFAEFLRHGSLKRPSILYLFTCVGLGYGQ  424
             A L+PKLR  FAEFL   SLKR SILY  TCVGL YG+
Sbjct  2    EALLIPKLRSQFAEFLNQSSLKRLSILYSSTCVGLEYGR  40



>gb|EFE07627.1| hypothetical protein CIT292_08961 [Citrobacter youngae ATCC 29220]
Length=68

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -1

Query  538  STPSPEVTGSFCRVPSTWFSQAP*YTLLVHLCRFGVR  428
            S PSPEVT  FC VPS  FSQAP Y+L  HLCRFGVR
Sbjct  28   SVPSPEVTAPFCLVPSPEFSQAPWYSLPDHLCRFGVR  64



>gb|EKN21706.1| hypothetical protein HMPREF1075_02341, partial [Parabacteroides 
distasonis CL03T12C09]
 gb|EKN25302.1| hypothetical protein HMPREF1075_00635, partial [Parabacteroides 
distasonis CL03T12C09]
Length=143

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 41/66 (62%), Gaps = 3/66 (5%)
 Frame = -3

Query  626  SCYHLAESCVFNKQSLPPGMCRFPNQKIGEHPFSRSYGVILPSSFDMVLSSALVYSTCSP  447
            SC+HLA+ CVF KQ   P +C  P     E P SRSY V LPSS  +  SSA V+ST   
Sbjct  10   SCFHLAQPCVFVKQLPGPILCASP---YDEDPLSRSYRVNLPSSLTVNHSSASVFSTRPR  66

Query  446  VSVWGT  429
            VSV+GT
Sbjct  67   VSVYGT  72



>gb|ADI16721.1| hypothetical protein [uncultured Verrucomicrobiales bacterium 
HF0010_05E02]
Length=126

 Score = 50.8 bits (120),  Expect(2) = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -2

Query  540  RAPLLPKLRGHFAEFLRHGSLKRPSILYLFTCVGLGYGQ  424
            +APLLPKLRG+FAEFL+  SL R  IL   TCVGL YG+
Sbjct  85   QAPLLPKLRGNFAEFLKEVSLTRLRILISDTCVGLRYGR  123


 Score = 26.2 bits (56),  Expect(2) = 7e-06, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -3

Query  626  SCYHLAESCVFNKQSL  579
            S Y LAESCVF KQS+
Sbjct  59   STYVLAESCVFAKQSV  74



>ref|XP_009604942.1| PREDICTED: NAC domain-containing protein 2-like [Nicotiana tomentosiformis]
Length=310

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  382  QEKTSNWEGDPPGELTVPQTDTGEQVEYTRALERT  486
            QEKT NWEGD  G LTVP TDTGEQV YT ALER 
Sbjct  183  QEKTLNWEGDTSGVLTVPITDTGEQVGYTEALERN  217



>gb|EFD68878.1| LOW QUALITY PROTEIN: conserved hypothetical protein, partial 
[Streptomyces lividans TK24]
 gb|EFD70528.1| LOW QUALITY PROTEIN: conserved hypothetical protein, partial 
[Streptomyces lividans TK24]
Length=81

 Score = 46.2 bits (108),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -2

Query  537  APLLPKLRGHFAEFLRHGSLKRPSILYLFT  448
            APLLPKLRGHFAEFL H S +R  ILYL T
Sbjct  52   APLLPKLRGHFAEFLNHSSPERLGILYLTT  81


 Score = 30.0 bits (66),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 0/28 (0%)
 Frame = -3

Query  626  SCYHLAESCVFNKQSLPPGMCRFPNQKI  543
            S Y  A +CVF+KQSL  G+C  P  ++
Sbjct  17   SPYGFARTCVFSKQSLLAGLCGHPQLRV  44



>gb|EDM52657.1| hypothetical protein EUBVEN_00035 [Eubacterium ventriosum ATCC 
27560]
Length=76

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  569  MCRFPNQKIGEHPFSRSYGVILPSSFDMVLSSALVYSTCSPVSVWGT  429
            M +F    +  HP SRSYG ILPSS  M+L SAL +S   PVSV+GT
Sbjct  1    MGQFSAAYLRRHPLSRSYGAILPSSLTMLLPSALGFSPHPPVSVYGT  47



>ref|WP_019782138.1| hypothetical protein, partial [Streptococcus sobrinus]
Length=73

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -2

Query  543  RRAPLLPKLRGHFAEFLRHGSLKRPSILYLFTCVGLGYG  427
            + APLLPKLRGHFAEFL   SL    +L   TCVGL YG
Sbjct  35   KSAPLLPKLRGHFAEFLNESSLAHLRLLASTTCVGLRYG  73



>ref|WP_005421831.1| hypothetical protein [[Ruminococcus] obeum]
 gb|EDM85211.1| hypothetical protein RUMOBE_04226 [Ruminococcus obeum ATCC 29174]
Length=50

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  539  EHPFSRSYGVILPSSFDMVLSSALVYSTCSPVSVWGT  429
             HPFSRSYGVILPSS  M+L  AL +S   PVSV+GT
Sbjct  11   RHPFSRSYGVILPSSLTMLLPPALGFSPHPPVSVYGT  47



>ref|XP_007141246.1| hypothetical protein PHAVU_008G179700g [Phaseolus vulgaris]
 gb|ESW13240.1| hypothetical protein PHAVU_008G179700g [Phaseolus vulgaris]
Length=47

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -2

Query  543  RRAPLLPKLRGHFAEFLRHGSLKRPSILYLFTCVGLG  433
              APLLPKLRG+FAEFLR   L    ILYL TCVG G
Sbjct  11   EEAPLLPKLRGYFAEFLRESCLAPLGILYLPTCVGFG  47



>ref|XP_009761286.1| PREDICTED: NAC domain-containing protein 2-like [Nicotiana sylvestris]
Length=311

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  382  QEKTSNWEGDPPGELTVPQTDTGEQVEYTRALERT  486
            +EKT NWEGD  G LTVP TDTGEQVEY   LER 
Sbjct  183  EEKTWNWEGDSSGALTVPITDTGEQVEYIEVLERN  217



>ref|WP_004595993.1| hypothetical protein [Rickettsia prowazekii]
 gb|EOB10733.1| hypothetical protein H376_690 [Rickettsia prowazekii str. GvF12]
 gb|EOB11076.1| hypothetical protein H377_530 [Rickettsia prowazekii str. Cairo 
3]
Length=156

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 35/59 (59%), Gaps = 7/59 (12%)
 Frame = -1

Query  529  SPEVTGSFCRVPSTWFSQAP*YTLLVHLCRFGVRSVHREDRPPNSKFFPGSFNLVDYDN  353
            S EVT   C VPS  FSQAP YTL VHLCRF VRS+ +         FPG ++L +  N
Sbjct  14   SSEVTDVICLVPSASFSQAPWYTLPVHLCRFWVRSIIKV-------LFPGKYSLHNQSN  65



>gb|ADI18136.1| hypothetical protein [uncultured Verrucomicrobiales bacterium 
HF0200_39L05]
Length=95

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -3

Query  536  HPFSRSYGVILPSSFDMVLSSALVYSTCSPVSVWGT  429
            HPFSRSYG  LPSS +  LS +LVYST  PVSV+GT
Sbjct  19   HPFSRSYGANLPSSLERFLSRSLVYSTHLPVSVYGT  54



>gb|EDN76396.1| hypothetical protein RUMGNA_03265 [Ruminococcus gnavus ATCC 29149]
Length=50

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  569  MCRFPNQKIGEHPFSRSYGVILPSSFDMVLSSALVYSTCSPVSVWGT  429
            M +F       H FSRSYGVILPSS  M+L SAL +S   PVSV+GT
Sbjct  1    MGQFSAATFTWHSFSRSYGVILPSSLTMLLPSALGFSPHPPVSVYGT  47



>ref|WP_039188518.1| hypothetical protein [Listeria monocytogenes]
 gb|KID17125.1| hypothetical protein NV44_06865 [Listeria monocytogenes]
Length=75

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -2

Query  543  RRAPLLPKLRGHFAEFLRHGSLKRPSILYLFTCVGLGYG  427
             +APLLPKLRGHFAEFL   SL    IL+  TCVGL  G
Sbjct  37   NKAPLLPKLRGHFAEFLNVSSLAHHRILFSSTCVGLRSG  75



>gb|EFE51205.1| hypothetical protein PROVRETT_10140 [Providencia rettgeri DSM 
1131]
 gb|EFE51942.1| hypothetical protein PROVRETT_09373 [Providencia rettgeri DSM 
1131]
 gb|EFE52752.1| hypothetical protein PROVRETT_08536 [Providencia rettgeri DSM 
1131]
Length=45

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  424  LTVPQTDTGEQVEYTRALERTMSKELGKMTP  516
            L VPQTDTG QVE T+ALERT  KELGKM P
Sbjct  15   LIVPQTDTGGQVENTQALERTRVKELGKMVP  45



>ref|WP_021210567.1| hypothetical protein [Leuconostoc mesenteroides]
 gb|EQC83714.1| hypothetical protein LMT8_07390 [Leuconostoc mesenteroides subsp. 
cremoris TIFN8]
Length=78

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 41/73 (56%), Gaps = 2/73 (3%)
 Frame = +1

Query  304  QSVPPCHSHESVYSRDCCHSQQG*NFQEKTSNWEGDPPGELT--VPQTDTGEQVEYTRAL  477
            Q+V    S    + R  C + +    + +TS+      G +T  VPQTDTG +VE T+  
Sbjct  6    QAVSLEKSEMLFFIRTSCDADRNKVEKSETSHCREKLLGSITLPVPQTDTGSRVENTKVS  65

Query  478  ERTMSKELGKMTP  516
            ERT+ KELGKMTP
Sbjct  66   ERTLVKELGKMTP  78



>gb|ACO04175.1| conserved hypothetical protein [Persephonella marina EX-H1]
 gb|ACO04521.1| conserved hypothetical protein [Persephonella marina EX-H1]
Length=189

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 33/58 (57%), Gaps = 3/58 (5%)
 Frame = -3

Query  626  SCYHLAESCVFNKQSLPPGMCR-FP--NQKIGEHPFSRSYGVILPSSFDMVLSSALVY  462
            S +  A+ CVF KQS PPG C   P  N     HP SRSYGV LPSS   V  +AL Y
Sbjct  132  SSFEFAQCCVFGKQSPPPGFCDPLPHLNGTACGHPLSRSYGVNLPSSLRRVTPTALGY  189



>ref|WP_034879132.1| hypothetical protein [Endozoicomonas montiporae]
Length=60

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 32/46 (70%), Gaps = 4/46 (9%)
 Frame = +1

Query  379  FQEKTSNWEGDPPGELTVPQTDTGEQVEYTRALERTMSKELGKMTP  516
            FQEK  ++      + TVPQTDTG QVE T+ALERT  KELGKM P
Sbjct  19   FQEKLLSFRS----KGTVPQTDTGGQVENTKALERTWVKELGKMAP  60



>gb|AGC71893.1| hypothetical protein [uncultured bacterium A1Q1_fos_4]
Length=52

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +1

Query  427  TVPQTDTGEQVEYTRALERTMSKELGKMTP  516
            TVPQTDTG + EY++ALERT  KELGK+TP
Sbjct  23   TVPQTDTGARDEYSKALERTQEKELGKLTP  52



>ref|WP_006427236.1| hypothetical protein [Dorea longicatena]
 gb|EDM61632.1| hypothetical protein DORLON_03015 [Dorea longicatena DSM 13814]
Length=76

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  569  MCRFPNQKIGEHPFSRSYGVILPSSFDMVLSSALVYSTCSPVSVWGT  429
            M +F       H FSRSYGVILPSS  M+L SAL +S   PVSV+GT
Sbjct  1    MGQFSAASSRWHSFSRSYGVILPSSLTMLLPSALGFSPHPPVSVYGT  47



>gb|KDF02499.1| hypothetical protein AF42_05465 [Citrobacter freundii MGH 56]
 gb|KDF02544.1| hypothetical protein AF42_05461 [Citrobacter freundii MGH 56]
 gb|KDF09432.1| hypothetical protein AF42_04050 [Citrobacter freundii MGH 56]
 gb|KDF13758.1| hypothetical protein AF42_02980 [Citrobacter freundii MGH 56]
Length=30

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  430  VPQTDTGEQVEYTRALERTMSKELGKMTP  516
            VPQTDTG QVE T+ALERT  KELGKM P
Sbjct  2    VPQTDTGGQVENTKALERTRVKELGKMVP  30



>ref|WP_004846162.1| hypothetical protein [[Ruminococcus] torques]
 gb|EDK22960.1| hypothetical protein RUMTOR_02880 [Ruminococcus torques ATCC 
27756]
Length=45

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -3

Query  536  HPFSRSYGVILPSSFDMVLSSALVYSTCSPVSVWGT  429
            H FSRSYGVILPSS  M+L SAL +S   PVSV+GT
Sbjct  7    HSFSRSYGVILPSSLTMLLPSALGFSPHPPVSVYGT  42



>gb|EEB75630.1| hypothetical protein CDSM653_949 [Caldanaerobacter subterraneus 
subsp. pacificus DSM 12653]
Length=155

 Score = 43.9 bits (102),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  525  PKLRGHFAEFLRHGSLKRPSILYLFTCVGLGYGQFTGR  412
            PKLR HFAEFL+ GS  R  IL   TCVGL YG    R
Sbjct  118  PKLRSHFAEFLKEGSPARLWILSSPTCVGLRYGHLRPR  155


 Score = 27.3 bits (59),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 12/18 (67%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = -3

Query  626  SCYHLAESCVFNKQSLPP  573
            S + LAE+CVF KQSL P
Sbjct  90   SPFGLAETCVFGKQSLGP  107



>gb|EFR51295.1| hypothetical protein BBNG_01843 [Bifidobacterium bifidum NCIMB 
41171]
Length=61

 Score = 46.6 bits (109),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = -2

Query  531  LLPKLRGHFAEFLRHGSLKRPSILYLFTCVGLGYGQ  424
            L+PK R  FAEFL   SL R  ILYL T VGLGYG+
Sbjct  23   LMPKAREQFAEFLDQDSLDRFGILYLTTSVGLGYGR  58


 Score = 24.6 bits (52),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 8/11 (73%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = -1

Query  595  LINSRYPLVCA  563
            ++NSRYPL CA
Sbjct  1    MVNSRYPLACA  11



>gb|EGG54219.1| hypothetical protein HMPREF9439_01517 [Parasutterella excrementihominis 
YIT 11859]
Length=53

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  427  TVPQTDTGEQVEYTRALERTMSKELGKMTP  516
            TVPQTDTG + EY +ALERT  KELGK+TP
Sbjct  24   TVPQTDTGGRAEYAQALERTREKELGKLTP  53



>ref|WP_006426162.1| hypothetical protein [Dorea longicatena]
 gb|EDM61644.1| hypothetical protein DORLON_03006 [Dorea longicatena DSM 13814]
 gb|EDM61651.1| hypothetical protein DORLON_02987 [Dorea longicatena DSM 13814]
Length=109

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  569  MCRFPNQKIGEHPFSRSYGVILPSSFDMVLSSALVYSTCSPVSVWGT  429
            M +F       H FSRSYGVILPSS  M+L SAL +S   PVSV+GT
Sbjct  1    MGQFSAASSRWHSFSRSYGVILPSSLTMLLPSALGFSPHPPVSVYGT  47



>gb|EFE69118.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 
14672]
 gb|EFE70736.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 
14672]
Length=31

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -2

Query  537  APLLPKLRGHFAEFLRHGSLKRPSILYLFT  448
            APLLPKLRGHFAEFL H S +R  ILYL T
Sbjct  2    APLLPKLRGHFAEFLNHSSPERLGILYLTT  31



>gb|EPS70029.1| hypothetical protein M569_04736, partial [Genlisea aurea]
Length=66

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 30/47 (64%), Gaps = 2/47 (4%)
 Frame = -1

Query  610  QSPVFLINSRYPLVCAAFLIKR*ESTPSPEVTGSFCRVPSTWFSQAP  470
            Q  VFL+NSR+ LVC    IK    TPSPEVTGS C VPS  F+  P
Sbjct  22   QILVFLLNSRHFLVCVIQPIKV--DTPSPEVTGSNCLVPSVLFTHVP  66



>dbj|BAG46933.1| conserved hypothetical protein [Burkholderia multivorans ATCC 
17616]
Length=90

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  424  LTVPQTDTGEQVEYTRALERTMSKELGKMTP  516
            +TVPQTDTG + EY++ALERT  KELGK+ P
Sbjct  60   MTVPQTDTGGRDEYSKALERTREKELGKLVP  90



>gb|KGW37799.1| hypothetical protein Y045_6146 [Burkholderia pseudomallei MSHR2451]
Length=78

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  424  LTVPQTDTGEQVEYTRALERTMSKELGKMTP  516
            +TVPQTDTG + EY++ALERT  KELGK+ P
Sbjct  48   MTVPQTDTGGRDEYSKALERTREKELGKLVP  78



>gb|EST57089.1| hypothetical protein K151_3366 [Proteus hauseri ZMd44]
Length=45

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  430  VPQTDTGEQVEYTRALERTMSKELGKMTP  516
            VPQTDTG QVE T+ALERT  KELGKM P
Sbjct  17   VPQTDTGGQVENTQALERTRVKELGKMVP  45



>gb|EPR32483.1| hypothetical protein dsmv_3640 [Desulfococcus multivorans DSM 
2059]
Length=152

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  537  APLLPKLRGHFAEFLRHGSLKRPSILYLFTCVGLGYGQ  424
            A LLPKLR HFAEFL  GSLKR  IL   TCVGL Y  
Sbjct  28   AHLLPKLRCHFAEFLNQGSLKRLGILSPPTCVGLRYDH  65



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250