BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP010A07 437 bp,:Filtered

Length=374
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007042077.1|  Papain family cysteine protease                  87.8    4e-25   Theobroma cacao [chocolate]
gb|KJB79047.1|  hypothetical protein B456_013G033800                  85.9    8e-25   Gossypium raimondii
ref|XP_002512963.1|  cysteine protease, putative                      87.0    8e-25   Ricinus communis
emb|CAE54306.1|  putative papain-like cysteine proteinase             85.9    8e-25   Gossypium hirsutum [American cotton]
gb|AAX19661.1|  cysteine proteinase                                   86.7    1e-24   Populus tomentosa [Chinese white poplar]
gb|KHG15253.1|  Cysteinease RD19a -like protein                       85.5    1e-24   Gossypium arboreum [tree cotton]
gb|KHG24064.1|  Cysteinease RD19a -like protein                       86.3    1e-24   Gossypium arboreum [tree cotton]
gb|KJB32561.1|  hypothetical protein B456_005G247000                  86.3    1e-24   Gossypium raimondii
gb|AAK27969.1|AF242373_1  cysteine protease                           85.1    4e-24   Ipomoea batatas [batate]
gb|AAF61440.1|AF138264_1  papain-like cysteine proteinase isoform I   85.1    4e-24   Ipomoea batatas [batate]
gb|AAF40414.1|AF216783_1  papain-like cysteine proteinase isoform I   85.1    4e-24   Ipomoea batatas [batate]
gb|AAF40415.1|AF216784_1  papain-like cysteine proteinase isoform II  85.1    4e-24   Ipomoea batatas [batate]
gb|AAF61441.1|AF138265_1  papain-like cysteine proteinase isoform II  85.1    4e-24   Ipomoea batatas [batate]
gb|AAF40416.1|AF216785_1  papain-like cysteine proteinase isoform...  85.1    5e-24   Ipomoea batatas [batate]
ref|NP_001267989.1|  cysteine protease precursor                      85.1    2e-23   Vitis vinifera
gb|KDP41743.1|  hypothetical protein JCGZ_26761                       84.7    2e-23   Jatropha curcas
gb|KDO49483.1|  hypothetical protein CISIN_1g017318mg                 88.2    3e-23   Citrus sinensis [apfelsine]
ref|XP_006487337.1|  PREDICTED: cysteine proteinase RD19a-like        88.2    3e-23   Citrus sinensis [apfelsine]
ref|XP_011092831.1|  PREDICTED: cysteine proteinase RD19a-like        84.7    3e-23   Sesamum indicum [beniseed]
ref|XP_011088458.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...  84.0    3e-23   Sesamum indicum [beniseed]
emb|CDP20652.1|  unnamed protein product                              84.7    3e-23   Coffea canephora [robusta coffee]
ref|XP_011047717.1|  PREDICTED: cysteine proteinase RD19a             84.0    4e-23   Populus euphratica
ref|XP_006423403.1|  hypothetical protein CICLE_v10028670mg           88.2    4e-23   Citrus clementina
ref|XP_004148554.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...  84.3    6e-23   
ref|XP_004165230.1|  PREDICTED: cysteine proteinase RD19a-like        84.0    6e-23   
gb|ABQ10201.1|  cysteine protease Cp3                                 85.1    6e-23   Actinidia deliciosa [Chinese gooseberry]
gb|KGN43159.1|  Papain-like cysteine proteinase isoform I             84.0    7e-23   Cucumis sativus [cucumbers]
ref|XP_009376976.1|  PREDICTED: cysteine proteinase RD19a-like        82.8    8e-23   Pyrus x bretschneideri [bai li]
gb|EYU37835.1|  hypothetical protein MIMGU_mgv1a008237mg              82.8    8e-23   Erythranthe guttata [common monkey flower]
gb|AIB06024.1|  CP2                                                   83.6    9e-23   Hevea brasiliensis [jebe]
gb|ABK92536.1|  unknown                                               82.4    1e-22   Populus trichocarpa [western balsam poplar]
ref|XP_002313770.1|  cysteine proteinase A494 precursor               82.4    1e-22   Populus trichocarpa [western balsam poplar]
ref|XP_004150061.1|  PREDICTED: cysteine proteinase RD19a-like        80.1    1e-22   Cucumis sativus [cucumbers]
ref|XP_010066197.1|  PREDICTED: probable cysteine proteinase A494     82.8    1e-22   Eucalyptus grandis [rose gum]
ref|XP_007017672.1|  Papain family cysteine protease                  82.8    1e-22   Theobroma cacao [chocolate]
ref|XP_008448073.1|  PREDICTED: cysteine proteinase RD19a-like        82.8    2e-22   Cucumis melo [Oriental melon]
ref|XP_004507484.1|  PREDICTED: cysteine proteinase RD19a-like        80.5    2e-22   Cicer arietinum [garbanzo]
ref|XP_008460996.1|  PREDICTED: cysteine proteinase RD19a-like        79.3    2e-22   Cucumis melo [Oriental melon]
ref|XP_007131787.1|  hypothetical protein PHAVU_011G041600g           80.5    2e-22   Phaseolus vulgaris [French bean]
ref|XP_003606998.1|  Cysteine proteinase                              80.1    2e-22   Medicago truncatula
ref|XP_009373025.1|  PREDICTED: cysteine proteinase RD19a-like        82.0    3e-22   Pyrus x bretschneideri [bai li]
ref|XP_010271520.1|  PREDICTED: cysteine proteinase RD19a-like        81.3    3e-22   Nelumbo nucifera [Indian lotus]
ref|XP_008382317.1|  PREDICTED: cysteine proteinase RD19a             82.0    3e-22   Malus domestica [apple tree]
ref|XP_009373000.1|  PREDICTED: cysteine proteinase RD19a             82.0    3e-22   Pyrus x bretschneideri [bai li]
gb|ACI04578.1|  cysteine protease-like protein                        81.3    4e-22   Robinia pseudoacacia [black locust]
ref|XP_003539008.1|  PREDICTED: cysteine proteinase RD19a-like        79.3    4e-22   Glycine max [soybeans]
ref|XP_010028631.1|  PREDICTED: cysteine proteinase RD19a-like        82.8    4e-22   Eucalyptus grandis [rose gum]
ref|XP_011037175.1|  PREDICTED: cysteine proteinase RD19a-like        80.9    5e-22   Populus euphratica
gb|KHN39817.1|  Cysteine proteinase RD19a                             79.3    5e-22   Glycine soja [wild soybean]
ref|XP_009376977.1|  PREDICTED: cysteine proteinase RD19a-like        79.7    5e-22   Pyrus x bretschneideri [bai li]
ref|XP_009351218.1|  PREDICTED: cysteine proteinase RD19a-like        81.6    6e-22   Pyrus x bretschneideri [bai li]
ref|XP_002305451.2|  cysteine proteinase A494 precursor               80.1    7e-22   Populus trichocarpa [western balsam poplar]
ref|XP_004290288.1|  PREDICTED: probable cysteine proteinase A494     81.3    1e-21   Fragaria vesca subsp. vesca
gb|AAR92156.1|  putative cysteine protease 3                          82.4    1e-21   Iris x hollandica [Dutch iris]
ref|XP_003550405.2|  PREDICTED: cysteine proteinase 15A               79.3    1e-21   
ref|XP_004291404.1|  PREDICTED: cysteine proteinase 15A-like          80.5    1e-21   Fragaria vesca subsp. vesca
sp|P05993.1|PAPA5_CARPA  RecName: Full=Cysteine proteinase; AltNa...  80.1    1e-21   Carica papaya [mamon]
ref|XP_011028940.1|  PREDICTED: cysteine proteinase 15A-like          79.3    1e-21   Populus euphratica
ref|XP_010910124.1|  PREDICTED: cysteine proteinase 1-like            82.0    1e-21   Elaeis guineensis
ref|XP_008236965.1|  PREDICTED: cysteine proteinase RD19a             80.9    2e-21   Prunus mume [ume]
gb|ABK96252.1|  unknown                                               79.3    2e-21   Populus trichocarpa x Populus deltoides
ref|XP_007201310.1|  hypothetical protein PRUPE_ppa007454mg           80.5    2e-21   Prunus persica
ref|XP_010061009.1|  PREDICTED: cysteine proteinase RD19a-like        80.1    2e-21   Eucalyptus grandis [rose gum]
gb|EYU42593.1|  hypothetical protein MIMGU_mgv1a008336mg              79.0    2e-21   Erythranthe guttata [common monkey flower]
gb|ABK96580.1|  unknown                                               78.2    2e-21   Populus trichocarpa x Populus deltoides
gb|ABK94801.1|  unknown                                               78.2    3e-21   Populus trichocarpa [western balsam poplar]
ref|XP_009406357.1|  PREDICTED: cysteine proteinase 1-like            78.2    3e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002302004.2|  hypothetical protein POPTR_0002s03020g           78.2    3e-21   Populus trichocarpa [western balsam poplar]
ref|XP_010268619.1|  PREDICTED: cysteine proteinase RD19a-like        80.1    4e-21   Nelumbo nucifera [Indian lotus]
ref|XP_003540987.1|  PREDICTED: cysteine proteinase RD19a-like        77.4    4e-21   Glycine max [soybeans]
gb|ABF46642.1|  papain-like cysteine proteinase                       83.6    4e-21   Pachysandra terminalis
ref|XP_002280798.2|  PREDICTED: cysteine proteinase 15A               79.3    4e-21   Vitis vinifera
emb|CDQ51995.1|  Cysteine proteinase                                  78.6    4e-21   Fagus sylvatica
gb|KJB07487.1|  hypothetical protein B456_001G026600                  81.6    5e-21   Gossypium raimondii
ref|XP_010672379.1|  PREDICTED: cysteine proteinase RD19a-like        79.0    6e-21   Beta vulgaris subsp. vulgaris [field beet]
gb|AJP16692.1|  cysteine protease                                     81.3    6e-21   Striga hermonthica [purple witchweed]
ref|XP_009109502.1|  PREDICTED: cysteine proteinase RD19a-like        78.6    7e-21   Brassica rapa
ref|XP_008775532.1|  PREDICTED: cysteine proteinase 1-like            78.6    8e-21   Phoenix dactylifera
ref|XP_002275759.1|  PREDICTED: cysteine proteinase RD19a             79.7    8e-21   Vitis vinifera
ref|XP_006473584.1|  PREDICTED: cysteine proteinase 15A-like          78.6    9e-21   Citrus sinensis [apfelsine]
gb|AAU81589.1|  cysteine proteinase                                   80.5    1e-20   Petunia x hybrida [garden petunia]
ref|XP_009392632.1|  PREDICTED: cysteine proteinase 1-like            78.2    1e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001241450.1|  uncharacterized protein LOC100778716 precursor   78.2    1e-20   Glycine max [soybeans]
ref|XP_002510469.1|  cysteine protease, putative                      77.4    1e-20   Ricinus communis
ref|XP_003523684.1|  PREDICTED: cysteine proteinase 15A-like          78.2    1e-20   Glycine max [soybeans]
gb|KHN45894.1|  Cysteine proteinase RD19a                             78.2    1e-20   Glycine soja [wild soybean]
gb|KDO84720.1|  hypothetical protein CISIN_1g017548mg                 78.6    1e-20   Citrus sinensis [apfelsine]
ref|XP_006435090.1|  hypothetical protein CICLE_v10001559mg           78.6    1e-20   Citrus clementina
dbj|BAC41322.1|  hypothetical protein                                 76.6    1e-20   Lotus japonicus
dbj|BAJ53178.1|  JHL18I08.12                                          80.9    2e-20   Jatropha curcas
emb|CAE45588.1|  papain-like cysteine proteinase-like protein 1       76.3    2e-20   Lotus japonicus
gb|KHN25410.1|  Cysteine proteinase RD19a                             77.4    2e-20   Glycine soja [wild soybean]
gb|KJB58164.1|  hypothetical protein B456_009G197400                  81.3    2e-20   Gossypium raimondii
emb|CAB53397.1|  cysteine protease                                    79.0    2e-20   Medicago sativa [alfalfa]
gb|AAL05851.1|AF411121_1  cysteine proteinase precursor               79.3    2e-20   Sandersonia aurantiaca [Chinese-lantern lily]
dbj|BAF98584.1|  CM0216.500.nc                                        76.3    2e-20   Lotus japonicus
gb|AAM65162.1|  cysteine proteinase RD19A                             77.8    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568052.1|  cysteine proteinase RD19a                           77.8    2e-20   Arabidopsis thaliana [mouse-ear cress]
emb|CDY71205.1|  BnaCnng71840D                                        78.2    2e-20   Brassica napus [oilseed rape]
ref|XP_010105270.1|  Cysteine proteinase 15A                          77.8    3e-20   Morus notabilis
gb|AAL60581.1|AF454959_1  senescence-associated cysteine protease     78.2    3e-20   Brassica oleracea
emb|CAE45589.1|  papain-like cysteine proteinase-like protein 2       76.3    3e-20   Lotus japonicus
ref|XP_009602233.1|  PREDICTED: cysteine proteinase RD19a-like        74.7    3e-20   Nicotiana tomentosiformis
ref|XP_006341997.1|  PREDICTED: cysteine proteinase 15A-like          80.5    3e-20   Solanum tuberosum [potatoes]
gb|AAD29084.1|AF082181_1  cysteine proteinase precursor               80.5    3e-20   Solanum melongena [aubergine]
gb|KFK30492.1|  hypothetical protein AALP_AA7G268600                  78.6    3e-20   Arabis alpina [alpine rockcress]
ref|XP_003589348.1|  Cysteine proteinase                              77.0    4e-20   Medicago truncatula
dbj|BAF98585.1|  CM0216.510.nc                                        75.9    4e-20   Lotus japonicus
ref|XP_006411706.1|  hypothetical protein EUTSA_v10025494mg           79.3    4e-20   Eutrema salsugineum
gb|AGV54334.1|  cysteine proteinase RD19a-like protein                76.6    4e-20   Phaseolus vulgaris [French bean]
ref|XP_007136047.1|  hypothetical protein PHAVU_009G013600g           76.6    4e-20   Phaseolus vulgaris [French bean]
gb|AAU81591.1|  cysteine proteinase                                   74.3    4e-20   Petunia x hybrida [garden petunia]
ref|XP_008387995.1|  PREDICTED: cysteine proteinase 15A               81.3    4e-20   Malus domestica [apple tree]
gb|KHN22211.1|  Cysteine proteinase 15A                               78.2    4e-20   Glycine soja [wild soybean]
sp|P25804.1|CYSP_PEA  RecName: Full=Cysteine proteinase 15A; AltN...  77.0    5e-20   Pisum sativum [garden pea]
ref|XP_007160702.1|  hypothetical protein PHAVU_001G009900g           76.3    5e-20   Phaseolus vulgaris [French bean]
emb|CAA82995.1|  cysteine proteinase                                  76.6    5e-20   Vicia sativa [spring vetch]
dbj|BAF03553.1|  cysteine proteinase CP2                              76.3    5e-20   Phaseolus vulgaris [French bean]
ref|XP_008444769.1|  PREDICTED: cysteine proteinase RD19a-like        82.0    6e-20   Cucumis melo [Oriental melon]
ref|XP_006283963.1|  hypothetical protein CARUB_v10005086mg           78.6    6e-20   Capsella rubella
ref|XP_006362019.1|  PREDICTED: cysteine proteinase RD19a-like        73.6    6e-20   Solanum tuberosum [potatoes]
gb|AAO11786.1|  pre-pro cysteine proteinase                           76.3    7e-20   Vicia faba [broad bean]
gb|AAB67878.1|  pre-pro-cysteine proteinase                           76.3    7e-20   Vicia faba [broad bean]
ref|XP_004230928.1|  PREDICTED: cysteine proteinase RD19a             73.2    7e-20   Solanum lycopersicum
ref|XP_002868883.1|  hypothetical protein ARALYDRAFT_490677           79.0    8e-20   Arabidopsis lyrata subsp. lyrata
emb|CDP07452.1|  unnamed protein product                              81.6    8e-20   Coffea canephora [robusta coffee]
ref|XP_009146338.1|  PREDICTED: cysteine proteinase 15A-like          77.8    9e-20   Brassica rapa
emb|CDY34441.1|  BnaC01g21920D                                        77.8    9e-20   Brassica napus [oilseed rape]
gb|AAL69389.1|AF462226_1  putative cysteine proteinase                77.4    9e-20   Narcissus pseudonarcissus
ref|XP_010531457.1|  PREDICTED: probable cysteine proteinase A494     77.4    1e-19   Tarenaya hassleriana [spider flower]
dbj|BAA92495.1|  cysteine protease                                    79.7    1e-19   Vigna mungo [urad dal]
gb|ABK24153.1|  unknown                                               77.8    1e-19   Picea sitchensis
emb|CDY41960.1|  BnaA01g05320D                                        78.6    1e-19   Brassica napus [oilseed rape]
ref|XP_002306900.1|  hypothetical protein POPTR_0005s25540g           76.6    1e-19   Populus trichocarpa [western balsam poplar]
ref|XP_010530325.1|  PREDICTED: cysteine proteinase RD19a             77.0    1e-19   Tarenaya hassleriana [spider flower]
ref|XP_011045161.1|  PREDICTED: cysteine proteinase 15A-like          76.3    1e-19   Populus euphratica
ref|NP_001266121.1|  uncharacterized protein LOC101501911 precursor   73.6    1e-19   Cicer arietinum [garbanzo]
gb|AJA74415.1|  cysteine protease                                     73.6    1e-19   Cicer arietinum [garbanzo]
dbj|BAD94010.1|  drought-inducible cysteine proteinase RD19A prec...  76.6    1e-19   Arabidopsis thaliana [mouse-ear cress]
gb|ACK57563.1|  cysteine protease-like protein                        78.6    1e-19   Arachis hypogaea [goober]
ref|XP_010446443.1|  PREDICTED: cysteine proteinase RD19a             79.0    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_007223351.1|  hypothetical protein PRUPE_ppa007441mg           79.7    2e-19   Prunus persica
ref|XP_010437007.1|  PREDICTED: cysteine proteinase RD19a-like        78.6    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010431862.1|  PREDICTED: cysteine proteinase RD19a             78.6    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_003545051.1|  PREDICTED: cysteine proteinase 15A-like          74.3    2e-19   Glycine max [soybeans]
ref|XP_008221329.1|  PREDICTED: cysteine proteinase 15A-like          79.7    2e-19   Prunus mume [ume]
ref|XP_003579573.2|  PREDICTED: cysteine proteinase 1-like            82.4    2e-19   Brachypodium distachyon [annual false brome]
emb|CDX98179.1|  BnaC07g09190D                                        76.3    2e-19   Brassica napus [oilseed rape]
gb|KHN12668.1|  Cysteine proteinase 15A                               74.7    2e-19   Glycine soja [wild soybean]
ref|XP_009150026.1|  PREDICTED: cysteine proteinase RD19a             77.8    2e-19   Brassica rapa
gb|AIB06025.1|  CP3                                                   75.1    2e-19   Hevea brasiliensis [jebe]
ref|XP_002870174.1|  hypothetical protein ARALYDRAFT_915142           79.7    2e-19   Arabidopsis lyrata subsp. lyrata
ref|XP_002280808.2|  PREDICTED: cysteine proteinase 15A               73.6    2e-19   Vitis vinifera
gb|ABK93575.1|  unknown                                               75.9    2e-19   Populus trichocarpa [western balsam poplar]
dbj|BAF46302.1|  cysteine proteinase precursor                        76.6    2e-19   Ipomoea nil [qian niu]
ref|XP_008775280.1|  PREDICTED: cysteine proteinase 1-like            79.0    3e-19   Phoenix dactylifera
ref|XP_006828787.1|  hypothetical protein AMTR_s00001p00114210        75.9    3e-19   Amborella trichopoda
ref|XP_002880378.1|  hypothetical protein ARALYDRAFT_481008           76.3    3e-19   Arabidopsis lyrata subsp. lyrata
gb|AAK07731.1|  CPR2-like cysteine proteinase                         76.3    3e-19   Nicotiana tabacum [American tobacco]
ref|XP_009611293.1|  PREDICTED: cysteine proteinase 15A-like          76.3    4e-19   Nicotiana tomentosiformis
ref|XP_009335626.1|  PREDICTED: cysteine proteinase 15A               79.7    4e-19   Pyrus x bretschneideri [bai li]
ref|XP_009776238.1|  PREDICTED: cysteine proteinase 15A-like          76.3    4e-19   Nicotiana sylvestris
ref|XP_011083631.1|  PREDICTED: cysteine proteinase 15A-like          80.9    4e-19   Sesamum indicum [beniseed]
emb|CAD40319.2|  OSJNBb0054B09.3                                      81.3    4e-19   Oryza sativa Japonica Group [Japonica rice]
emb|CAA78365.1|  tobacco pre-pro-cysteine proteinase                  76.3    4e-19   Nicotiana tabacum [American tobacco]
gb|ACX54787.2|  cysteine protease                                     77.8    4e-19   Arachis diogoi
emb|CAA78361.1|  tobacco pre-pro-cysteine proteinase                  76.3    4e-19   Nicotiana tabacum [American tobacco]
ref|XP_004238314.1|  PREDICTED: cysteine proteinase 15A               76.3    4e-19   
gb|AAB62937.1|  stress-induced cysteine proteinase                    73.6    5e-19   Lavatera thuringiaca
emb|CAB17075.1|  cysteine proteinase precursor                        72.8    5e-19   Phaseolus vulgaris [French bean]
gb|AAQ81938.1|  cysteine proteinase precursor                         76.6    5e-19   Ipomoea batatas [batate]
ref|XP_004975256.1|  PREDICTED: cysteine proteinase 1-like            82.4    5e-19   Setaria italica
ref|NP_567489.1|  papain family cysteine protease                     79.7    6e-19   Arabidopsis thaliana [mouse-ear cress]
gb|KJB29611.1|  hypothetical protein B456_005G110200                  72.4    6e-19   Gossypium raimondii
gb|EMT16425.1|  Cysteine proteinase 1                                 79.3    7e-19   Aegilops tauschii
ref|XP_004952477.1|  PREDICTED: cysteine proteinase 1-like            79.3    7e-19   Setaria italica
ref|XP_010943608.1|  PREDICTED: cysteine proteinase 1-like            75.1    7e-19   Elaeis guineensis
gb|EPS70818.1|  cysteine proteinase                                   77.0    7e-19   Genlisea aurea
gb|EMS53996.1|  Cysteine proteinase 1                                 80.9    8e-19   Triticum urartu
dbj|BAD43619.1|  putative cysteine proteinase                         75.1    8e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565512.1|  Papain family cysteine protease                     74.7    8e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006665032.1|  PREDICTED: cysteine proteinase 1-like            80.1    9e-19   
ref|NP_001052440.1|  Os04g0311400                                     82.0    1e-18   
emb|CAA52403.1|  putative thiol protease                              74.7    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006653265.1|  PREDICTED: cysteine proteinase 1-like            80.5    1e-18   
gb|EYU27644.1|  hypothetical protein MIMGU_mgv1a008452mg              76.6    1e-18   Erythranthe guttata [common monkey flower]
gb|KHG15062.1|  Cysteinease RD19a -like protein                       72.8    1e-18   Gossypium arboreum [tree cotton]
gb|EPS65881.1|  cysteine proteinase                                   80.9    1e-18   Genlisea aurea
ref|XP_003574963.1|  PREDICTED: cysteine proteinase 1-like            76.3    1e-18   Brachypodium distachyon [annual false brome]
ref|NP_001105685.1|  cysteine proteinase 1 precursor                  79.3    1e-18   Zea mays [maize]
gb|ACF86683.1|  unknown                                               79.3    1e-18   Zea mays [maize]
ref|XP_003607110.1|  Cysteine proteinase                              68.2    1e-18   Medicago truncatula
ref|XP_010440192.1|  PREDICTED: cysteine proteinase RD19a-like        75.5    1e-18   Camelina sativa [gold-of-pleasure]
gb|ACM80348.1|  cysteine proteinase                                   73.2    2e-18   Solanum lycopersicum
gb|KEH30505.1|  papain family cysteine protease                       68.2    2e-18   Medicago truncatula
emb|CAA78403.1|  pre-pro-cysteine proteinase                          76.3    2e-18   Solanum lycopersicum
ref|XP_006414378.1|  hypothetical protein EUTSA_v10025521mg           75.5    2e-18   Eutrema salsugineum
ref|XP_002452058.1|  hypothetical protein SORBIDRAFT_04g017830        77.8    2e-18   Sorghum bicolor [broomcorn]
ref|XP_010434865.1|  PREDICTED: cysteine proteinase 15A-like          75.5    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010449835.1|  PREDICTED: cysteine proteinase 15A-like          75.5    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009405542.1|  PREDICTED: cysteine proteinase 1-like            73.2    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAB16996.1|  thiol protease isoform B                              75.1    2e-18   Glycine max [soybeans]
ref|XP_006283974.1|  hypothetical protein CARUB_v10005098mg           76.3    2e-18   Capsella rubella
ref|NP_001046828.1|  Os02g0469600                                     75.5    3e-18   
ref|XP_004152668.1|  PREDICTED: cysteine proteinase RD19a-like        79.7    4e-18   Cucumis sativus [cucumbers]
gb|EEE60725.1|  hypothetical protein OsJ_14236                        79.3    4e-18   Oryza sativa Japonica Group [Japonica rice]
gb|EAY93546.1|  hypothetical protein OsI_15336                        79.3    4e-18   Oryza sativa Indica Group [Indian rice]
emb|CDY09707.1|  BnaC07g33540D                                        72.8    4e-18   Brassica napus [oilseed rape]
gb|KFK24413.1|  hypothetical protein AALP_AAs58848U000200             75.1    5e-18   Arabis alpina [alpine rockcress]
emb|CDX99593.1|  BnaC04g33500D                                        72.8    5e-18   Brassica napus [oilseed rape]
ref|XP_009140277.1|  PREDICTED: probable cysteine proteinase A494     72.8    6e-18   Brassica rapa
gb|AAZ32411.1|  cysteine proteinase glycinain type                    76.3    6e-18   Nicotiana benthamiana
emb|CDY15894.1|  BnaA04g12170D                                        73.2    6e-18   Brassica napus [oilseed rape]
emb|CAA57675.1|  cysteine proteinase                                  77.8    8e-18   Zea mays [maize]
tpe|CAD66657.1|  TPA: putative cysteine proteinase precursor          75.9    8e-18   Hordeum vulgare subsp. vulgare [barley]
ref|XP_006404590.1|  hypothetical protein EUTSA_v10000210mg           73.6    8e-18   Eutrema salsugineum
dbj|BAG16515.1|  putative cysteine proteinase                         75.5    1e-17   Capsicum chinense [bonnet pepper]
gb|AGS43121.1|  cysteine protease 1                                   77.8    1e-17   Zea mays [maize]
gb|AAW21813.1|  cysteine protease                                     75.9    2e-17   Triticum aestivum [Canadian hard winter wheat]
dbj|BAD10859.1|  cysteine protease                                    79.0    2e-17   Tripolium pannonicum [sea starwort]
emb|CAQ00101.1|  papain-like cysteine proteinase                      74.3    2e-17   Hordeum vulgare subsp. vulgare [barley]
ref|XP_009136751.1|  PREDICTED: cysteine proteinase RD19a-like        72.8    2e-17   Brassica rapa
emb|CDX90537.1|  BnaA03g42440D                                        72.8    2e-17   Brassica napus [oilseed rape]
emb|CAH59428.1|  cysteine protease 2                                  72.8    2e-17   Plantago major [cart-track plant]
ref|XP_002279862.1|  PREDICTED: cysteine proteinase RD19a             72.8    3e-17   Vitis vinifera
gb|AEX97108.1|  cysteine proteinase                                   77.0    3e-17   Malus domestica [apple tree]
gb|AAB16997.1|  thiol protease isoform A                              72.4    4e-17   Glycine max [soybeans]
gb|ABK21238.1|  unknown                                               72.8    5e-17   Picea sitchensis
gb|ABK24688.1|  unknown                                               72.8    5e-17   Picea sitchensis
gb|ACN40679.1|  unknown                                               72.8    5e-17   Picea sitchensis
gb|AES89347.2|  papain family cysteine protease                       62.4    9e-17   Medicago truncatula
ref|XP_003607150.1|  Cysteine proteinase                              62.4    9e-17   
gb|EMT10192.1|  Cysteine proteinase 1                                 74.3    9e-17   Aegilops tauschii
gb|EMS64962.1|  Cysteine proteinase 1                                 74.7    1e-16   Triticum urartu
ref|XP_009786000.1|  PREDICTED: cysteine proteinase RD19a-like        73.6    6e-16   Nicotiana sylvestris
ref|XP_010690815.1|  PREDICTED: cysteine proteinase RD19a             73.9    7e-16   Beta vulgaris subsp. vulgaris [field beet]
gb|ABO93617.1|  papain-like cysteine proteinase                       79.7    7e-16   Vitis vinifera
gb|ADY04293.1|  cysteine protease                                     79.3    7e-16   Clarkia xantiana subsp. xantiana
gb|ADY04490.1|  cysteine protease                                     79.0    1e-15   Clarkia xantiana subsp. xantiana
ref|XP_002969223.1|  hypothetical protein SELMODRAFT_91274            73.6    1e-15   Selaginella moellendorffii
gb|ADY04414.1|  cysteine protease                                     79.0    1e-15   Clarkia xantiana subsp. xantiana
gb|ADY04361.1|  cysteine protease                                     79.0    1e-15   Clarkia xantiana subsp. xantiana
ref|XP_002960585.1|  hypothetical protein SELMODRAFT_266583           73.6    1e-15   Selaginella moellendorffii
gb|ADY04342.1|  cysteine protease                                     78.6    1e-15   Clarkia xantiana subsp. xantiana
gb|ADY04336.1|  cysteine protease                                     78.6    1e-15   Clarkia xantiana subsp. xantiana
gb|ADY04262.1|  cysteine protease                                     78.6    1e-15   Clarkia xantiana subsp. xantiana
gb|ADY04457.1|  cysteine protease                                     78.6    1e-15   Clarkia xantiana subsp. xantiana
dbj|BAC57957.1|  thiol protease                                       74.3    1e-15   Tripolium pannonicum [sea starwort]
gb|AAB53103.1|  cysteine protease                                     76.6    2e-15   Brassica napus [oilseed rape]
gb|ADY04359.1|  cysteine protease                                     78.2    2e-15   Clarkia xantiana subsp. xantiana
gb|ADY04482.1|  cysteine protease                                     78.2    2e-15   Clarkia xantiana subsp. xantiana
gb|ADY04368.1|  cysteine protease                                     77.8    2e-15   Clarkia xantiana subsp. xantiana
gb|ADY04358.1|  cysteine protease                                     77.8    2e-15   Clarkia xantiana subsp. xantiana
gb|ADY04480.1|  cysteine protease                                     77.4    4e-15   Clarkia xantiana subsp. xantiana
gb|ADY04268.1|  cysteine protease                                     77.4    4e-15   Clarkia xantiana subsp. xantiana
emb|CCA95098.1|  putative responsive to dehydration 19                77.0    6e-15   Liriodendron tulipifera
gb|ADY04295.1|  cysteine protease                                     76.3    1e-14   Clarkia xantiana subsp. xantiana
ref|XP_003560213.1|  PREDICTED: cysteine proteinase 1                 68.6    2e-14   Brachypodium distachyon [annual false brome]
ref|NP_001059639.1|  Os07g0480900                                     63.2    2e-14   
emb|CCA95082.1|  putative responsive to dehydration 19                74.7    2e-14   Ginkgo biloba [ginkgo]
ref|XP_002460693.1|  hypothetical protein SORBIDRAFT_02g033270        63.2    3e-14   Sorghum bicolor [broomcorn]
ref|XP_010534431.1|  PREDICTED: cysteine proteinase 15A               69.3    5e-14   Tarenaya hassleriana [spider flower]
ref|XP_008802783.1|  PREDICTED: probable cysteine proteinase A494     63.2    5e-14   Phoenix dactylifera
gb|EMS59778.1|  Cysteine proteinase 15A                               62.0    6e-14   Triticum urartu
gb|AEQ54770.1|  cysteine proteinase CP1                               70.1    6e-14   Coffea canephora [robusta coffee]
ref|NP_001236888.1|  cysteine proteinase precursor                    69.7    6e-14   Glycine max [soybeans]
emb|CAQ00102.1|  papain-like cysteine proteinase                      60.5    1e-13   Hordeum vulgare subsp. vulgare [barley]
tpg|DAA40800.1|  TPA: putative cysteine protease family protein       62.8    2e-13   Zea mays [maize]
ref|XP_006293095.1|  hypothetical protein CARUB_v10019394mg           65.5    2e-13   Capsella rubella
ref|XP_010504326.1|  PREDICTED: cysteine proteinase 15A-like          65.5    2e-13   Camelina sativa [gold-of-pleasure]
ref|XP_002876278.1|  hypothetical protein ARALYDRAFT_485911           65.5    2e-13   Arabidopsis lyrata subsp. lyrata
emb|CDO99795.1|  unnamed protein product                              68.2    2e-13   Coffea canephora [robusta coffee]
ref|XP_008804021.1|  PREDICTED: cysteine proteinase RD19a-like        61.6    2e-13   Phoenix dactylifera
ref|XP_009404192.1|  PREDICTED: cysteine proteinase 15A               60.5    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN00877.1|  Cysteine proteinase 15A                               65.9    3e-13   Glycine soja [wild soybean]
ref|XP_004959670.1|  PREDICTED: cysteine proteinase 1-like            62.8    3e-13   Setaria italica
gb|EEC82027.1|  hypothetical protein OsI_25996                        65.1    3e-13   Oryza sativa Indica Group [Indian rice]
emb|CAB41090.1|  cysteine proteinase precursor-like protein           64.3    3e-13   Arabidopsis thaliana [mouse-ear cress]
gb|KEH43476.1|  papain family cysteine protease                       68.6    4e-13   Medicago truncatula
ref|XP_008776953.1|  PREDICTED: cysteine proteinase-like              60.8    4e-13   
ref|NP_567010.5|  Papain family cysteine protease                     64.3    4e-13   
gb|KFK34737.1|  hypothetical protein AALP_AA5G186400                  65.5    4e-13   
ref|XP_010918606.1|  PREDICTED: probable cysteine proteinase A494     62.8    4e-13   
ref|XP_006658557.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...  59.7    5e-13   
ref|XP_007218137.1|  hypothetical protein PRUPE_ppa007240mg           69.7    5e-13   
ref|XP_008233261.1|  PREDICTED: cysteine proteinase 15A               69.7    6e-13   
emb|CAB16316.1|  cysteine proteinase precursor                        68.6    8e-13   
ref|XP_004496226.1|  PREDICTED: cysteine proteinase 15A-like          67.0    9e-13   
gb|KJB73490.1|  hypothetical protein B456_011G235500                  63.9    1e-12   
ref|XP_006403513.1|  hypothetical protein EUTSA_v10010475mg           65.9    1e-12   
gb|KHN37802.1|  Cysteine proteinase 1                                 67.4    1e-12   
ref|XP_009116190.1|  PREDICTED: probable cysteine proteinase A494     67.0    1e-12   
emb|CDX73424.1|  BnaC08g25790D                                        67.0    1e-12   
gb|AAD46920.1|AF167986_1  putative cysteine proteinase GmPM33         67.4    1e-12   
emb|CDY56961.1|  BnaA09g55030D                                        67.0    1e-12   
ref|XP_008362714.1|  PREDICTED: cysteine proteinase 15A               65.9    2e-12   
ref|XP_008354070.1|  PREDICTED: cysteine proteinase 15A-like          65.9    2e-12   
ref|XP_011024366.1|  PREDICTED: cysteine proteinase 15A               65.5    2e-12   
ref|XP_001781954.1|  predicted protein                                63.5    3e-12   
ref|XP_001761980.1|  predicted protein                                64.7    3e-12   
ref|XP_009789260.1|  PREDICTED: cysteine proteinase 15A               65.1    3e-12   
ref|XP_009617441.1|  PREDICTED: cysteine proteinase 15A               64.3    5e-12   
ref|XP_007143764.1|  hypothetical protein PHAVU_007G099600g           60.8    7e-12   
gb|KDP30486.1|  hypothetical protein JCGZ_16165                       65.5    7e-12   
emb|CAN71324.1|  hypothetical protein VITISV_013970                   71.6    7e-12   
ref|XP_004157559.1|  PREDICTED: cysteine proteinase 15A-like          63.9    8e-12   
ref|XP_004142497.1|  PREDICTED: cysteine proteinase 15A-like          63.9    8e-12   
ref|XP_009117680.1|  PREDICTED: probable cysteine proteinase A494     62.0    9e-12   
ref|XP_004250044.1|  PREDICTED: cysteine proteinase 15A               64.3    9e-12   
gb|EYU39642.1|  hypothetical protein MIMGU_mgv1a008552mg              65.1    9e-12   
ref|XP_002533377.1|  cysteine protease, putative                      64.3    1e-11   
ref|XP_006436511.1|  hypothetical protein CICLE_v10031865mg           61.2    2e-11   
ref|XP_010243268.1|  PREDICTED: cysteine proteinase 15A               60.5    2e-11   
emb|CAB17077.1|  cysteine proteinase precursor                        59.3    2e-11   
ref|XP_003081549.1|  Cysteine proteinase Cathepsin F (ISS)            68.6    2e-11   
emb|CDY13816.1|  BnaA09g43180D                                        60.1    3e-11   
ref|XP_006361690.1|  PREDICTED: cysteine proteinase 15A-like          61.6    4e-11   
emb|CBI23088.3|  unnamed protein product                              66.6    4e-11   
gb|ADE76932.1|  unknown                                               63.5    4e-11   
ref|XP_002266821.1|  PREDICTED: cysteine proteinase 15A               62.8    5e-11   
gb|KHG08355.1|  Cysteinease 1                                         60.5    5e-11   
emb|CEF99324.1|  Cysteine peptidase, cysteine active site             68.6    6e-11   
emb|CAN80141.1|  hypothetical protein VITISV_038978                   68.2    7e-11   
ref|XP_007010012.1|  Papain family cysteine protease                  60.5    7e-11   
ref|XP_010688493.1|  PREDICTED: cysteine proteinase 15A               59.7    8e-11   
ref|XP_011094506.1|  PREDICTED: cysteine proteinase 15A               62.4    9e-11   
ref|XP_001419933.1|  predicted protein                                66.6    1e-10   
ref|XP_007510080.1|  unknown                                          64.7    1e-10   
ref|XP_010034320.1|  PREDICTED: cysteine proteinase 1                 61.2    1e-10   
ref|XP_008647122.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin 7-...  66.2    2e-10   
ref|XP_008446834.1|  PREDICTED: cysteine proteinase 15A               60.5    3e-10   
emb|CAN81617.1|  hypothetical protein VITISV_001998                   65.5    3e-10   
ref|XP_006850211.1|  hypothetical protein AMTR_s00022p00251800        63.5    4e-10   
emb|CAN81619.1|  hypothetical protein VITISV_002000                   65.5    4e-10   
ref|XP_002316398.1|  hypothetical protein POPTR_0010s23510g           60.8    5e-10   
gb|AFW72358.1|  putative cysteine protease family protein             66.2    6e-10   
emb|CAN64491.1|  hypothetical protein VITISV_015725                   59.7    7e-10   
emb|CBI31400.3|  unnamed protein product                              60.1    8e-10   
ref|XP_011169692.1|  PREDICTED: putative cysteine proteinase CG12163  65.9    9e-10   
ref|XP_010103534.1|  putative cysteine proteinase A494                57.8    1e-09   
ref|XP_011145705.1|  PREDICTED: uncharacterized protein LOC105186896  63.9    1e-09   
gb|EFN80374.1|  Putative cysteine proteinase CG12163                  63.9    1e-09   
ref|XP_006608091.1|  PREDICTED: uncharacterized protein LOC102680728  63.9    1e-09   
gb|EPS63354.1|  hypothetical protein M569_11429                       58.9    1e-09   
ref|XP_003696602.1|  PREDICTED: putative cysteine proteinase CG12...  63.5    2e-09   
ref|XP_011052455.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  62.4    3e-09   
gb|EGI66903.1|  Putative cysteine proteinase                          62.4    3e-09   
ref|XP_011496222.1|  PREDICTED: uncharacterized protein LOC105360904  61.2    4e-09   
dbj|BAI44279.1|  cysteine proteinase inhibitor precursor              62.4    5e-09   
ref|XP_006567715.1|  PREDICTED: putative cysteine proteinase CG12...  62.0    6e-09   
ref|XP_392381.3|  PREDICTED: putative cysteine proteinase CG12163...  62.0    6e-09   
ref|XP_003707276.1|  PREDICTED: uncharacterized protein LOC100880620  60.5    7e-09   
ref|XP_003492760.1|  PREDICTED: hypothetical protein LOC100745708     62.8    1e-08   
ref|XP_005184486.1|  PREDICTED: putative cysteine proteinase CG12...  58.9    2e-08   
ref|XP_005184487.1|  PREDICTED: putative cysteine proteinase CG12...  58.9    2e-08   
ref|XP_011184040.1|  PREDICTED: putative cysteine proteinase CG12163  58.9    2e-08   
ref|XP_011203808.1|  PREDICTED: putative cysteine proteinase CG12163  58.9    2e-08   
ref|XP_004519757.1|  PREDICTED: putative cysteine proteinase CG12...  58.5    2e-08   
ref|XP_001607324.1|  PREDICTED: uncharacterized protein LOC100123649  59.7    2e-08   
gb|EFN65613.1|  Putative cysteine proteinase CG12163                  61.6    3e-08   
ref|XP_011469621.1|  PREDICTED: cysteine proteinase 15A-like          54.7    3e-08   
ref|XP_011260522.1|  PREDICTED: uncharacterized protein LOC105253881  61.6    3e-08   
ref|XP_003057227.1|  predicted protein                                57.8    3e-08   
gb|AEW08440.1|  hypothetical protein 2_9845_02                        54.7    4e-08   
ref|XP_011493714.1|  AAEL017153-PA                                    57.0    5e-08   
gb|AJF94882.1|  C1 family cathepsin F10                               60.8    5e-08   
ref|XP_001844355.1|  conserved hypothetical protein                   58.2    6e-08   
gb|KFB38327.1|  AGAP002879-PB-like protein                            57.0    6e-08   
gb|ETN61472.1|  hypothetical protein AND_006867                       56.6    8e-08   
ref|XP_003436277.1|  AGAP002879-PB                                    56.6    9e-08   
ref|XP_312034.5|  AGAP002879-PA                                       56.2    9e-08   
ref|XP_008550537.1|  PREDICTED: uncharacterized protein LOC103573287  59.7    1e-07   
emb|CDX82031.1|  BnaC08g35700D                                        57.8    1e-07   
ref|XP_008195657.1|  PREDICTED: uncharacterized protein LOC662417...  59.3    2e-07   
ref|XP_008195656.1|  PREDICTED: uncharacterized protein LOC662417...  59.3    2e-07   
ref|XP_001994049.1|  GH22731                                          55.8    2e-07   
gb|AFM37363.1|  cathepsin F1                                          55.1    2e-07   
gb|EHJ64782.1|  cysteine proteinase inhibitor precursor               55.8    2e-07   
ref|XP_002000409.1|  GI10216                                          55.5    2e-07   
ref|XP_005184488.1|  PREDICTED: putative cysteine proteinase CG12...  55.1    2e-07   
ref|XP_004519758.1|  PREDICTED: putative cysteine proteinase CG12...  55.1    2e-07   
gb|ABC48936.1|  cathepsin F like protease                             55.5    3e-07   
ref|NP_505215.2|  Protein TAG-196                                     53.1    3e-07   
ref|XP_003115597.1|  CRE-TAG-196 protein                              52.8    3e-07   
ref|XP_011309436.1|  PREDICTED: uncharacterized protein LOC105270293  57.8    3e-07   
emb|CBY11269.1|  unnamed protein product                              49.3    3e-07   
ref|XP_011331416.1|  PREDICTED: uncharacterized protein LOC105275911  56.6    4e-07   
gb|EZA58965.1|  Putative cysteine proteinase                          56.6    4e-07   
ref|XP_002056575.1|  GJ11017                                          55.5    4e-07   
ref|XP_002017233.1|  GL22196                                          55.1    4e-07   
ref|XP_002137768.1|  GA27408, isoform A                               55.1    4e-07   
gb|AFQ01139.1|  cathepsin F-like protease                             55.5    5e-07   
gb|ENN81374.1|  hypothetical protein YQE_02191                        58.2    5e-07   
ref|XP_002096026.1|  GE25302                                          55.1    5e-07   
gb|KFM67613.1|  putative cysteine proteinase                          57.4    5e-07   
emb|CDJ92562.1|  Proteinase inhibitor I25 and Proteinase inhibito...  53.1    6e-07   
emb|CDJ88889.1|  Proteinase inhibitor I25 and Proteinase inhibito...  53.1    6e-07   
gb|ABE72973.1|  cathepsin L                                           53.1    6e-07   
ref|XP_002635317.1|  C. briggsae CBR-TAG-196 protein                  52.8    7e-07   
gb|EGT34543.1|  hypothetical protein CAEBREN_26318                    52.8    7e-07   
emb|CBY31096.1|  unnamed protein product                              49.3    8e-07   
gb|EGT34572.1|  hypothetical protein CAEBREN_13324                    52.8    8e-07   
gb|ACR08662.1|  cathepsin F                                           54.3    9e-07   
ref|XP_003736743.1|  GA27408, isoform B                               54.3    1e-06   
ref|XP_002073772.1|  GK14287                                          53.1    1e-06   
ref|XP_001955780.1|  GF16067                                          53.5    2e-06   
ref|XP_002038380.1|  GM10654                                          53.1    2e-06   
ref|NP_730901.1|  CG12163, isoform A                                  53.1    2e-06   
gb|ABD35293.1|  cysteine proteinase                                   52.8    2e-06   
ref|XP_001978897.1|  GG11133                                          53.1    2e-06   
gb|KDR17524.1|  Putative cysteine proteinase                          53.9    2e-06   
gb|ABD35292.1|  cysteine proteinase                                   53.1    2e-06   
ref|XP_011434326.1|  PREDICTED: uncharacterized protein LOC105333...  55.8    2e-06   
ref|XP_011434325.1|  PREDICTED: uncharacterized protein LOC105333...  55.8    2e-06   
ref|NP_649521.1|  CG12163, isoform B                                  53.1    2e-06   
gb|EKC42097.1|  Cathepsin F                                           55.5    3e-06   
ref|XP_003436276.1|  AGAP002879-PC                                    51.6    3e-06   
gb|ERL92611.1|  hypothetical protein D910_09924                       55.1    3e-06   
ref|XP_009047014.1|  hypothetical protein LOTGIDRAFT_172186           53.9    3e-06   
gb|AFN27134.1|  cysteine protease                                     54.7    3e-06   
gb|ERG79645.1|  cysteine proteinase                                   51.2    5e-06   
gb|ABD35296.1|  cysteine proteinase                                   52.0    5e-06   
ref|XP_002427787.1|  Cathepsin F precursor, putative                  49.7    5e-06   
gb|EYC18288.1|  hypothetical protein Y032_0028g1777                   50.1    5e-06   
gb|ABD35291.1|  truncated cysteine proteinase                         51.2    6e-06   
gb|KHN72698.1|  Putative cysteine proteinase                          51.2    6e-06   
gb|AFN27133.1|  cysteine protease                                     53.9    6e-06   
gb|AFN27131.1|  cysteine protease                                     53.9    7e-06   
ref|XP_002505924.1|  cysteine endopeptidase                           52.0    7e-06   
gb|ABD35294.1|  cysteine proteinase                                   51.6    8e-06   
gb|AFN27127.1|  cysteine protease                                     53.5    8e-06   
emb|CDJ26737.1|  cathepsin F-like cysteine peptidase protein          53.5    8e-06   
gb|AAZ23596.1|  cysteine protease                                     53.5    8e-06   
gb|AFN27128.1|  cysteine protease                                     53.5    9e-06   
gb|EPY22055.1|  cysteine peptidase A                                  53.5    1e-05   
ref|XP_002979143.1|  hypothetical protein SELMODRAFT_110288           46.6    1e-05   
ref|XP_002988513.1|  hypothetical protein SELMODRAFT_128220           47.0    1e-05   
ref|XP_003371509.1|  cathepsin L1                                     53.1    1e-05   
gb|AEE42620.1|  cysteine protease                                     53.1    1e-05   
emb|CDQ07779.1|  Protein Bm12113, isoform a                           50.1    1e-05   
gb|ABB88697.1|  cysteine protease                                     53.1    1e-05   
gb|KIH48456.1|  cysteine proteinase family protein                    49.3    1e-05   
gb|AEE42617.1|  cysteine protease                                     52.8    1e-05   
gb|ABD35297.1|  cysteine proteinase                                   50.8    1e-05   
gb|AEE42613.1|  cysteine protease                                     52.8    1e-05   
gb|AFN27126.1|  cysteine protease                                     52.8    1e-05   
gb|ACS66748.1|  cysteine protease                                     52.8    2e-05   
gb|AEE42616.1|  cysteine protease                                     52.8    2e-05   
gb|EPY28241.1|  cysteine peptidase B                                  52.8    2e-05   
gb|ABD35295.1|  cysteine proteinase                                   50.8    2e-05   
gb|AEE42615.1|  cysteine protease                                     52.8    2e-05   
gb|ABY75169.1|  cysteine protease                                     42.4    2e-05   
gb|ABX74953.1|  cysteine protease                                     52.8    2e-05   
ref|XP_001681132.1|  cathepsin L-like protease                        52.8    2e-05   
gb|AFN27130.1|  cysteine protease                                     52.8    2e-05   
gb|AAB48120.1|  cathepsin L-like protease                             52.4    2e-05   
ref|XP_001681135.1|  cathepsin L-like protease                        52.4    2e-05   
ref|XP_635374.1|  cysteine protease                                   52.4    2e-05   
gb|AFN27132.1|  cysteine protease                                     52.4    2e-05   
gb|AEE42618.1|  cysteine protease                                     52.4    2e-05   
gb|AEE42614.1|  cysteine protease                                     52.4    2e-05   
ref|XP_010555986.1|  PREDICTED: LOW QUALITY PROTEIN: probable cys...  52.4    2e-05   
gb|AFN27125.1|  cysteine protease                                     52.0    2e-05   
gb|AFN27092.1|  cysteine protease                                     52.0    2e-05   
ref|XP_001681131.1|  cathepsin L-like protease                        52.0    2e-05   
gb|AFC76265.1|  cathepsin L-like protease                             52.0    2e-05   
gb|AFC76264.1|  cathepsin L-like protease                             52.0    2e-05   
gb|AFN27090.1|  cysteine protease                                     52.0    2e-05   
ref|XP_001681134.1|  cathepsin L-like protease                        52.0    2e-05   
gb|AFC76271.1|  cathepsin L-like protease                             52.0    2e-05   
ref|XP_001681136.1|  cathepsin L-like protease                        52.0    2e-05   
gb|AFN27094.1|  cysteine protease                                     52.0    2e-05   
gb|ACX43964.1|  cysteine protease 4                                   49.7    2e-05   
gb|EFO15826.2|  hypothetical protein LOAG_12683                       47.0    3e-05   
gb|ADG63164.1|  cysteine protease F                                   51.2    3e-05   
ref|XP_003148243.1|  hypothetical protein LOAG_12683                  47.0    3e-05   
gb|AAV97878.1|  recombinant cysteine protease                         51.6    3e-05   
ref|XP_009316281.1|  cathepsin L-like protein                         51.6    3e-05   
ref|XP_003886537.1|  unnamed protein product                          52.0    3e-05   
gb|AEE42619.1|  cysteine protease                                     52.0    3e-05   
ref|XP_001562141.1|  cathepsin L-like protease                        52.0    3e-05   
ref|XP_001562139.1|  cathepsin L-like protease                        52.0    3e-05   
gb|EPY21129.1|  cysteine peptidase A                                  52.0    3e-05   
ref|XP_003386471.1|  PREDICTED: cysteine proteinase 1-like            49.7    4e-05   
emb|CDQ05036.1|  Protein Bm9835                                       49.7    4e-05   
ref|XP_001898698.1|  fibroinase precursor                             49.7    4e-05   
gb|AAW80540.1|  cathepsin L-like cysteine protease                    50.1    5e-05   
gb|EFX71333.1|  hypothetical protein DAPPUDRAFT_189155                50.8    5e-05   
gb|AFA34856.1|  cathepsin L-like protein                              51.2    5e-05   
gb|KJB14609.1|  hypothetical protein B456_002G133800                  51.2    5e-05   
ref|XP_003886559.1|  unnamed protein product                          51.2    5e-05   
ref|XP_002463749.1|  hypothetical protein SORBIDRAFT_01g005350        50.8    5e-05   
gb|EJY83513.1|  Cathepsin L                                           50.8    5e-05   
gb|ACR34737.1|  unknown                                               51.2    5e-05   
ref|XP_003375070.1|  viral cathepsin                                  51.2    6e-05   
ref|XP_009161938.1|  hypothetical protein T265_00017                  49.3    6e-05   
gb|AAL09443.1|  cysteine protease                                     50.8    6e-05   
gb|KHG05637.1|  Cysteinease RD21a -like protein                       50.8    6e-05   
ref|XP_002965337.1|  hypothetical protein SELMODRAFT_230602           50.8    6e-05   
gb|AGI92544.1|  cysteine protease b                                   50.8    6e-05   



>ref|XP_007042077.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOX97908.1| Papain family cysteine protease [Theobroma cacao]
Length=395

 Score = 87.8 bits (216),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+GYAP+R+K+KPYWIIKNSWGESWGE G
Sbjct  326  KRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGESWGEDG  367


 Score = 53.5 bits (127),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 23/24 (96%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRNICGVDSMVSTVAAV+T
Sbjct  369  YKICRGRNICGVDSMVSTVAAVDT  392



>gb|KJB79047.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
Length=373

 Score = 85.9 bits (211),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 35/45 (78%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGGATR  136
            +RLD GVLLVGYGS+GYAP+R+K+KPYWIIKNSWGE+WGE G  R
Sbjct  304  KRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGENGFYR  348


 Score = 54.3 bits (129),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 23/24 (96%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            Y+ICRGRNICGVDSMVSTVAAVNT
Sbjct  347  YRICRGRNICGVDSMVSTVAAVNT  370



>ref|XP_002512963.1| cysteine protease, putative [Ricinus communis]
 gb|EEF49466.1| cysteine protease, putative [Ricinus communis]
Length=373

 Score = 87.0 bits (214),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+GYAPIR+KEKPYWIIKNSWGE+WGE G
Sbjct  304  KRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGENWGESG  345


 Score = 53.1 bits (126),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRGRNICGVDSMVSTVAAV T +
Sbjct  347  YKICRGRNICGVDSMVSTVAAVQTAS  372



>emb|CAE54306.1| putative papain-like cysteine proteinase [Gossypium hirsutum]
Length=373

 Score = 85.9 bits (211),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 35/45 (78%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGGATR  136
            +RLD GVLLVGYGS+GYAP+R+K+KPYWIIKNSWGE+WGE G  R
Sbjct  304  KRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGENGFYR  348


 Score = 54.3 bits (129),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 23/24 (96%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            Y+ICRGRNICGVDSMVSTVAAVNT
Sbjct  347  YRICRGRNICGVDSMVSTVAAVNT  370



>gb|AAX19661.1| cysteine proteinase [Populus tomentosa]
Length=374

 Score = 86.7 bits (213),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+GYAP+R+KEKPYWIIKNSWGESWGE G
Sbjct  305  RRLDHGVLLVGYGSAGYAPVRMKEKPYWIIKNSWGESWGENG  346


 Score = 53.1 bits (126),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRGRNICGVDSMVSTVAAV T +
Sbjct  348  YKICRGRNICGVDSMVSTVAAVQTSS  373



>gb|KHG15253.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=373

 Score = 85.5 bits (210),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 35/45 (78%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGGATR  136
            +RLD GVLLVGYGS+GYAP+R+K+KPYWIIKNSWGE+WGE G  R
Sbjct  304  KRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGENGFYR  348


 Score = 54.3 bits (129),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/24 (96%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            Y+ICRGRNICGVDSMVSTVAAVNT
Sbjct  347  YRICRGRNICGVDSMVSTVAAVNT  370



>gb|KHG24064.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=374

 Score = 86.3 bits (212),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+GYAPIRLK+KPYWIIKNSWGE+WGE G
Sbjct  305  KRLDHGVLLVGYGSAGYAPIRLKDKPYWIIKNSWGETWGENG  346


 Score = 53.1 bits (126),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 22/24 (92%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRN+CGVDS+VSTVAAVNT
Sbjct  348  YKICRGRNVCGVDSLVSTVAAVNT  371



>gb|KJB32561.1| hypothetical protein B456_005G247000 [Gossypium raimondii]
Length=374

 Score = 86.3 bits (212),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+GYAPIRLK+KPYWIIKNSWGE+WGE G
Sbjct  305  KRLDHGVLLVGYGSAGYAPIRLKDKPYWIIKNSWGETWGENG  346


 Score = 53.1 bits (126),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 22/24 (92%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRN+CGVDS+VSTVAAVNT
Sbjct  348  YKICRGRNVCGVDSLVSTVAAVNT  371



>gb|AAK27969.1|AF242373_1 cysteine protease [Ipomoea batatas]
Length=366

 Score = 85.1 bits (209),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+GYAPIR+KEKPYWIIKNSWGESWGE G
Sbjct  296  KRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENG  337


 Score = 52.8 bits (125),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTS  210
            YKICRGRN+CGVDSMVSTVAAV+T TS
Sbjct  339  YKICRGRNVCGVDSMVSTVAAVSTTTS  365



>gb|AAF61440.1|AF138264_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score = 85.1 bits (209),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+GYAPIR+KEKPYWIIKNSWGESWGE G
Sbjct  298  KRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENG  339


 Score = 52.8 bits (125),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTS  210
            YKICRGRN+CGVDSMVSTVAAV+T TS
Sbjct  341  YKICRGRNVCGVDSMVSTVAAVSTTTS  367



>gb|AAF40414.1|AF216783_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score = 85.1 bits (209),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+GYAPIR+KEKPYWIIKNSWGESWGE G
Sbjct  298  KRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENG  339


 Score = 52.8 bits (125),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTS  210
            YKICRGRN+CGVDSMVSTVAAV+T TS
Sbjct  341  YKICRGRNVCGVDSMVSTVAAVSTTTS  367



>gb|AAF40415.1|AF216784_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=368

 Score = 85.1 bits (209),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+GYAPIR+KEKPYWIIKNSWGESWGE G
Sbjct  298  KRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENG  339


 Score = 52.8 bits (125),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTS  210
            YKICRGRN+CGVDSMVSTVAAV+T TS
Sbjct  341  YKICRGRNVCGVDSMVSTVAAVSTTTS  367



>gb|AAF61441.1|AF138265_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=366

 Score = 85.1 bits (209),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+GYAPIR+KEKPYWIIKNSWGESWGE G
Sbjct  296  KRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENG  337


 Score = 52.8 bits (125),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTS  210
            YKICRGRN+CGVDSMVSTVAAV+T TS
Sbjct  339  YKICRGRNVCGVDSMVSTVAAVSTTTS  365



>gb|AAF40416.1|AF216785_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
 gb|AAF61442.1|AF138266_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
Length=366

 Score = 85.1 bits (209),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+GYAPIR+KEKPYWIIKNSWGESWGE G
Sbjct  296  KRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENG  337


 Score = 52.4 bits (124),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTS  210
            YKICRGRN+CGVDSMVSTVAAV+T TS
Sbjct  339  YKICRGRNVCGVDSMVSTVAAVSTTTS  365



>ref|NP_001267989.1| cysteine protease precursor [Vitis vinifera]
 gb|ABX79341.1| cysteine protease [Vitis vinifera]
Length=377

 Score = 85.1 bits (209),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+GYAPIR+K+KPYWIIKNSWGE+WGE G
Sbjct  308  KRLDHGVLLVGYGSAGYAPIRMKDKPYWIIKNSWGENWGENG  349


 Score = 50.4 bits (119),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTS  210
            YKICRGRN+CGVDSMVSTVAAV+T ++
Sbjct  351  YKICRGRNVCGVDSMVSTVAAVHTTSN  377



>gb|KDP41743.1| hypothetical protein JCGZ_26761 [Jatropha curcas]
Length=370

 Score = 84.7 bits (208),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+GYAPIRLKEKPYWIIKNSWGE+WGE G
Sbjct  301  KRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGETWGESG  342


 Score = 50.4 bits (119),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRGRN+CGVDSMVSTVAAV T +
Sbjct  344  YKICRGRNVCGVDSMVSTVAAVQTSS  369



>gb|KDO49483.1| hypothetical protein CISIN_1g017318mg [Citrus sinensis]
Length=373

 Score = 88.2 bits (217),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+GYAPIRLKEKPYWIIKNSWGESWGE G
Sbjct  308  RRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGENG  349


 Score = 46.6 bits (109),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAV  195
            YKICRGRN+CGVDSMVSTVAA 
Sbjct  351  YKICRGRNVCGVDSMVSTVAAA  372



>ref|XP_006487337.1| PREDICTED: cysteine proteinase RD19a-like [Citrus sinensis]
Length=373

 Score = 88.2 bits (217),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+GYAPIRLKEKPYWIIKNSWGESWGE G
Sbjct  308  RRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGENG  349


 Score = 46.6 bits (109),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAV  195
            YKICRGRN+CGVDSMVSTVAA 
Sbjct  351  YKICRGRNVCGVDSMVSTVAAA  372



>ref|XP_011092831.1| PREDICTED: cysteine proteinase RD19a-like [Sesamum indicum]
Length=378

 Score = 84.7 bits (208),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYG++ YAPIRLKEKPYWIIKNSWGE+WGE G
Sbjct  310  KRLDHGVLLVGYGAASYAPIRLKEKPYWIIKNSWGENWGENG  351


 Score = 50.1 bits (118),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRG N+CGVDSMVSTVAAV+T
Sbjct  353  YKICRGHNVCGVDSMVSTVAAVST  376



>ref|XP_011088458.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Sesamum indicum]
Length=379

 Score = 84.0 bits (206),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYG +GYAPIR KEKPYWIIKNSWGE WGE G
Sbjct  311  KRLDHGVLLVGYGEAGYAPIRRKEKPYWIIKNSWGEKWGEKG  352


 Score = 50.4 bits (119),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 23/24 (96%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRNICGVDSMVSTVAAV+T
Sbjct  354  YKICRGRNICGVDSMVSTVAAVST  377



>emb|CDP20652.1| unnamed protein product [Coffea canephora]
Length=372

 Score = 84.7 bits (208),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGSSGYAPIR+KEKPYWIIKNSWGE WGE G
Sbjct  304  KRLDHGVLLVGYGSSGYAPIRMKEKPYWIIKNSWGEHWGENG  345


 Score = 50.1 bits (118),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRG NICGVDSMVSTVAAV+T T
Sbjct  347  YKICRGHNICGVDSMVSTVAAVHTST  372



>ref|XP_011047717.1| PREDICTED: cysteine proteinase RD19a [Populus euphratica]
Length=368

 Score = 84.0 bits (206),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+GYAP+R+KEKPYWIIKNSWGESWGE G
Sbjct  299  RRLDHGVLLVGYGSAGYAPVRMKEKPYWIIKNSWGESWGENG  340


 Score = 50.8 bits (120),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 23/24 (96%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRNICGVDSMVSTVAAV T
Sbjct  342  YKICRGRNICGVDSMVSTVAAVQT  365



>ref|XP_006423403.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
 gb|ESR36643.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
Length=375

 Score = 88.2 bits (217),  Expect(2) = 4e-23, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+GYAPIRLKEKPYWIIKNSWGESWGE G
Sbjct  308  RRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGENG  349


 Score = 46.2 bits (108),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAV  195
            YKICRGRN+CGVDSMVST+AA 
Sbjct  351  YKICRGRNVCGVDSMVSTIAAA  372



>ref|XP_004148554.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Cucumis sativus]
Length=381

 Score = 84.3 bits (207),  Expect(2) = 6e-23, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+GYAPIR+++K YWIIKNSWGESWGE G
Sbjct  302  KRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGENG  343


 Score = 49.7 bits (117),  Expect(2) = 6e-23, Method: Composition-based stats.
 Identities = 21/23 (91%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVN  198
            YKICRGRNICGVDS+VSTVAAV+
Sbjct  345  YKICRGRNICGVDSLVSTVAAVH  367



>ref|XP_004165230.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
Length=387

 Score = 84.0 bits (206),  Expect(2) = 6e-23, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+GYAPIR+++K YWIIKNSWGESWGE G
Sbjct  308  KRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGENG  349


 Score = 49.7 bits (117),  Expect(2) = 6e-23, Method: Composition-based stats.
 Identities = 21/23 (91%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVN  198
            YKICRGRNICGVDS+VSTVAAV+
Sbjct  351  YKICRGRNICGVDSLVSTVAAVH  373



>gb|ABQ10201.1| cysteine protease Cp3 [Actinidia deliciosa]
Length=365

 Score = 85.1 bits (209),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+GYAPIR+KEKPYWIIKNSWGESWGE G
Sbjct  296  KRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENG  337


 Score = 48.5 bits (114),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTS  210
            YKIC+GRN+CGVDSMVSTVAAV+T ++
Sbjct  339  YKICQGRNVCGVDSMVSTVAAVHTTSN  365



>gb|KGN43159.1| Papain-like cysteine proteinase isoform I [Cucumis sativus]
Length=387

 Score = 84.0 bits (206),  Expect(2) = 7e-23, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+GYAPIR+++K YWIIKNSWGESWGE G
Sbjct  308  KRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGENG  349


 Score = 49.7 bits (117),  Expect(2) = 7e-23, Method: Composition-based stats.
 Identities = 21/23 (91%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVN  198
            YKICRGRNICGVDS+VSTVAAV+
Sbjct  351  YKICRGRNICGVDSLVSTVAAVH  373



>ref|XP_009376976.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=445

 Score = 82.8 bits (203),  Expect(2) = 8e-23, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYG++GY+PIRLKEKPYWIIKNSWGESW E G
Sbjct  374  RRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGESWRESG  415


 Score = 50.8 bits (120),  Expect(2) = 8e-23, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTS  210
            YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  417  YKICRGRNICGVDSMVSTVAAASVKTN  443



>gb|EYU37835.1| hypothetical protein MIMGU_mgv1a008237mg [Erythranthe guttata]
Length=380

 Score = 82.8 bits (203),  Expect(2) = 8e-23, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYG +GY+PIR+KEKPYWIIKNSWG +WGE G
Sbjct  311  KRLDHGVLLVGYGETGYSPIRMKEKPYWIIKNSWGPNWGEDG  352


 Score = 50.4 bits (119),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRGRNICGVDSMVSTVAAV+T +
Sbjct  354  YKICRGRNICGVDSMVSTVAAVSTTS  379



>gb|AIB06024.1| CP2 [Hevea brasiliensis]
Length=372

 Score = 83.6 bits (205),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+GYAP+RLKEKPYWIIKNSWGE+WGE G
Sbjct  302  KRLDHGVLLVGYGSAGYAPVRLKEKPYWIIKNSWGENWGESG  343


 Score = 49.7 bits (117),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 1/27 (4%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAA-VNTPT  207
            YKICRGRNICGVDSMVSTVAA V TP+
Sbjct  345  YKICRGRNICGVDSMVSTVAAVVQTPS  371



>gb|ABK92536.1| unknown [Populus trichocarpa]
Length=368

 Score = 82.4 bits (202),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+ YAP+R+KEKPYWIIKNSWGESWGE G
Sbjct  299  RRLDHGVLLVGYGSAAYAPVRMKEKPYWIIKNSWGESWGENG  340


 Score = 50.8 bits (120),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 23/24 (96%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRNICGVDSMVSTVAAV T
Sbjct  342  YKICRGRNICGVDSMVSTVAAVQT  365



>ref|XP_002313770.1| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE87725.1| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score = 82.4 bits (202),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+ YAP+R+KEKPYWIIKNSWGESWGE G
Sbjct  299  RRLDHGVLLVGYGSAAYAPVRMKEKPYWIIKNSWGESWGENG  340


 Score = 50.8 bits (120),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 23/24 (96%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRNICGVDSMVSTVAAV T
Sbjct  342  YKICRGRNICGVDSMVSTVAAVQT  365



>ref|XP_004150061.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004166953.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN61836.1| Cysteine protease [Cucumis sativus]
Length=377

 Score = 80.1 bits (196),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS GYAPIRLK+KPYWIIKNSWG +WGE G
Sbjct  308  KHLDHGVLLVGYGSDGYAPIRLKDKPYWIIKNSWGANWGENG  349


 Score = 52.8 bits (125),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 23/24 (96%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRNICGVDSMVSTVAAV+T
Sbjct  351  YKICRGRNICGVDSMVSTVAAVHT  374



>ref|XP_010066197.1| PREDICTED: probable cysteine proteinase A494 [Eucalyptus grandis]
 gb|KCW64029.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
 gb|KCW64030.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
Length=376

 Score = 82.8 bits (203),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+ Y+PIR+KEKPYWIIKNSWGE+WGE G
Sbjct  307  KRLDHGVLLVGYGSAAYSPIRMKEKPYWIIKNSWGENWGENG  348


 Score = 50.1 bits (118),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRNICGVDSMVSTVAA++T
Sbjct  350  YKICRGRNICGVDSMVSTVAAIHT  373



>ref|XP_007017672.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOY14897.1| Papain family cysteine protease [Theobroma cacao]
Length=401

 Score = 82.8 bits (203),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS+GYAPIR KEKPYWIIKNSWGE+WGE G
Sbjct  332  RHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEEG  373


 Score = 49.7 bits (117),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRGRN+CGVDSMVS+VAA+ T +
Sbjct  375  YKICRGRNVCGVDSMVSSVAALQTKS  400



>ref|XP_008448073.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=385

 Score = 82.8 bits (203),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  5    RLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            RLD GVLLVGYGS+GYAPIR+++K YWIIKNSWGE+WGE G
Sbjct  307  RLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGENWGENG  347


 Score = 49.7 bits (117),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 21/23 (91%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVN  198
            YKICRGRNICGVDS+VSTVAAV+
Sbjct  349  YKICRGRNICGVDSLVSTVAAVH  371



>ref|XP_004507484.1| PREDICTED: cysteine proteinase RD19a-like [Cicer arietinum]
Length=363

 Score = 80.5 bits (197),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS  YAPIR+KEKPYWIIKNSWGE+WGE G
Sbjct  294  RRLDHGVLLVGYGSGAYAPIRMKEKPYWIIKNSWGENWGENG  335


 Score = 51.6 bits (122),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRGRNICGVDSMVSTVAAV+T T
Sbjct  337  YKICRGRNICGVDSMVSTVAAVHTTT  362



>ref|XP_008460996.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=377

 Score = 79.3 bits (194),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS GYAPIR+K+KPYWIIKNSWG +WGE G
Sbjct  308  RHLDHGVLLVGYGSEGYAPIRMKDKPYWIIKNSWGANWGENG  349


 Score = 52.8 bits (125),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 23/24 (96%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRNICGVDSMVSTVAAV+T
Sbjct  351  YKICRGRNICGVDSMVSTVAAVHT  374



>ref|XP_007131787.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
 gb|ESW03781.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
Length=361

 Score = 80.5 bits (197),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS  YAPIR+KEKPYWIIKNSWGE+WGE G
Sbjct  292  RRLDHGVLLVGYGSGAYAPIRMKEKPYWIIKNSWGENWGENG  333


 Score = 51.6 bits (122),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRGRNICGVDSMVSTVAAV+T T
Sbjct  335  YKICRGRNICGVDSMVSTVAAVHTTT  360



>ref|XP_003606998.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89195.1| papain family cysteine protease [Medicago truncatula]
Length=362

 Score = 80.1 bits (196),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS  Y+PIRLKEKPYWIIKNSWGE+WGE G
Sbjct  294  KRLDHGVLLVGYGSGAYSPIRLKEKPYWIIKNSWGETWGENG  335


 Score = 51.6 bits (122),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRGRNICGVDSMVSTVAAV+T T
Sbjct  337  YKICRGRNICGVDSMVSTVAAVHTTT  362



>ref|XP_009373025.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=371

 Score = 82.0 bits (201),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYG++GY+PIRLKEKPYWIIKNSWGE+WGE G
Sbjct  300  KRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENG  341


 Score = 49.7 bits (117),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTS  210
            YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  343  YKICRGRNICGVDSMVSTVAAASVKTN  369



>ref|XP_010271520.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=370

 Score = 81.3 bits (199),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS GYAPIRLK+KPYWIIKNSWGE WGE G
Sbjct  301  KRLDHGVLLVGYGSEGYAPIRLKDKPYWIIKNSWGEGWGENG  342


 Score = 50.4 bits (119),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVN  198
            YKICRGRN+CGVDSMVSTVAAVN
Sbjct  344  YKICRGRNVCGVDSMVSTVAAVN  366



>ref|XP_008382317.1| PREDICTED: cysteine proteinase RD19a [Malus domestica]
Length=371

 Score = 82.0 bits (201),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYG++GY+PIRLKEKPYWIIKNSWGE+WGE G
Sbjct  300  KRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENG  341


 Score = 49.3 bits (116),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTS  210
            YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  343  YKICRGRNICGVDSMVSTVAAASVKTN  369



>ref|XP_009373000.1| PREDICTED: cysteine proteinase RD19a [Pyrus x bretschneideri]
Length=371

 Score = 82.0 bits (201),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYG++GY+PIRLKEKPYWIIKNSWGE+WGE G
Sbjct  300  KRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENG  341


 Score = 49.3 bits (116),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTS  210
            YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  343  YKICRGRNICGVDSMVSTVAAASVKTN  369



>gb|ACI04578.1| cysteine protease-like protein [Robinia pseudoacacia]
Length=335

 Score = 81.3 bits (199),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG +GYAPIRLKEKPYWIIKNSWGESWGE G
Sbjct  266  KNLDHGVLLVGYGKAGYAPIRLKEKPYWIIKNSWGESWGENG  307


 Score = 50.1 bits (118),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRN+CGVDSMVSTVAAV+T
Sbjct  309  YKICRGRNVCGVDSMVSTVAAVHT  332



>ref|XP_003539008.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=363

 Score = 79.3 bits (194),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE G
Sbjct  294  RRLDHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENG  335


 Score = 51.6 bits (122),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRGRNICGVDSMVSTVAAV+T T
Sbjct  337  YKICRGRNICGVDSMVSTVAAVHTTT  362



>ref|XP_010028631.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW55393.1| hypothetical protein EUGRSUZ_I01305 [Eucalyptus grandis]
Length=370

 Score = 82.8 bits (203),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+GYAPIR+K+KPYWIIKNSWGE+WGE G
Sbjct  298  KRLDHGVLLVGYGSAGYAPIRMKDKPYWIIKNSWGETWGENG  339


 Score = 48.1 bits (113),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 25/30 (83%), Gaps = 2/30 (7%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAV--NTPTSY  213
            YKICRGRNICGVDSMVSTVAA    TP S+
Sbjct  341  YKICRGRNICGVDSMVSTVAAAVHTTPGSH  370



>ref|XP_011037175.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
 ref|XP_011037176.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
Length=368

 Score = 80.9 bits (198),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+GY+PIR+K+KPYWIIKNSWGE WGE G
Sbjct  299  RRLDHGVLLVGYGSAGYSPIRMKDKPYWIIKNSWGEKWGENG  340


 Score = 50.1 bits (118),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRN+CGVDSMVSTVAAV T
Sbjct  342  YKICRGRNVCGVDSMVSTVAAVQT  365



>gb|KHN39817.1| Cysteine proteinase RD19a [Glycine soja]
Length=332

 Score = 79.3 bits (194),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE G
Sbjct  263  RRLDHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENG  304


 Score = 51.6 bits (122),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRGRNICGVDSMVSTVAAV+T T
Sbjct  306  YKICRGRNICGVDSMVSTVAAVHTTT  331



>ref|XP_009376977.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=447

 Score = 79.7 bits (195),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYG++GY+PIRLKEKPYWIIKNSWGESW E G
Sbjct  376  RRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGESWRESG  417


 Score = 50.8 bits (120),  Expect(2) = 5e-22, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTS  210
            YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  419  YKICRGRNICGVDSMVSTVAAASVKTN  445



>ref|XP_009351218.1| PREDICTED: cysteine proteinase RD19a-like, partial [Pyrus x bretschneideri]
Length=282

 Score = 81.6 bits (200),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYG++GY+PIRLKEKPYWIIKNSWGE+WGE G
Sbjct  211  KRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENG  252


 Score = 48.9 bits (115),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTS  210
            YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  254  YKICRGRNICGVDSMVSTVAAASVKTN  280



>ref|XP_002305451.2| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE85962.2| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score = 80.1 bits (196),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+GY+P+R+KEKP+WIIKNSWGE WGE G
Sbjct  299  RRLDHGVLLVGYGSAGYSPVRMKEKPFWIIKNSWGEKWGENG  340


 Score = 50.4 bits (119),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRGRN+CGVDSMVSTVAAV T +
Sbjct  342  YKICRGRNVCGVDSMVSTVAAVQTSS  367



>ref|XP_004290288.1| PREDICTED: probable cysteine proteinase A494 [Fragaria vesca 
subsp. vesca]
Length=372

 Score = 81.3 bits (199),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+GY+P+R+KEKPYWIIKNSWGE+WGE G
Sbjct  306  KRLDHGVLLVGYGSAGYSPVRMKEKPYWIIKNSWGENWGEKG  347


 Score = 48.9 bits (115),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVN  198
            YKICRGRNICGVDSMVSTVAAV 
Sbjct  349  YKICRGRNICGVDSMVSTVAAVE  371



>gb|AAR92156.1| putative cysteine protease 3 [Iris x hollandica]
Length=292

 Score = 82.4 bits (202),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS+GYAPIRLKEKPYWIIKNSWGE+WGE G
Sbjct  221  KHLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGETWGENG  262


 Score = 47.4 bits (111),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRN+CGVDSMVSTV A++T
Sbjct  264  YKICRGRNVCGVDSMVSTVTAIHT  287



>ref|XP_003550405.2| PREDICTED: cysteine proteinase 15A [Glycine max]
Length=392

 Score = 79.3 bits (194),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG   YAPIR K KPYWIIKNSWGESWGE G
Sbjct  323  KHLDHGVLLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENG  364


 Score = 50.4 bits (119),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 1/28 (4%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTSY  213
            YKICRGRN+CGVDSMVSTVAA+  P+S+
Sbjct  366  YKICRGRNVCGVDSMVSTVAAI-YPSSH  392



>ref|XP_004291404.1| PREDICTED: cysteine proteinase 15A-like [Fragaria vesca subsp. 
vesca]
Length=365

 Score = 80.5 bits (197),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
              LD GVLLVGYGSSGYAPIR KEKPYWIIKNSWG+SWGE G
Sbjct  299  NHLDHGVLLVGYGSSGYAPIRFKEKPYWIIKNSWGQSWGEEG  340


 Score = 48.9 bits (115),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRN+CGVDSMVSTVAA++T
Sbjct  342  YKICRGRNVCGVDSMVSTVAAMHT  365



>sp|P05993.1|PAPA5_CARPA RecName: Full=Cysteine proteinase; AltName: Full=Clone PLBPC13, 
partial [Carica papaya]
 emb|CAA27609.1| pot. cysteine proteinase [Carica papaya]
Length=96

 Score = 80.1 bits (196),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYGS+GYAPIRLKEKPYW+IKNSWGE+WGE G
Sbjct  27   RRLNHGVLLVGYGSAGYAPIRLKEKPYWVIKNSWGENWGENG  68


 Score = 49.3 bits (116),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRGRNICGVDSMVSTVAAV+T +
Sbjct  70   YKICRGRNICGVDSMVSTVAAVHTTS  95



>ref|XP_011028940.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score = 79.3 bits (194),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +R D GVLLVGYGS+GYAPIR KEKP+WIIKNSWGE+WGE G
Sbjct  298  KRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGENWGENG  339


 Score = 50.1 bits (118),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRNICGVDSMVSTVAA++T
Sbjct  341  YKICRGRNICGVDSMVSTVAAIHT  364



>ref|XP_010910124.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=374

 Score = 82.0 bits (201),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS+GYAPIR KEKPYWIIKNSWGE+WGE G
Sbjct  307  KHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEDG  348


 Score = 47.4 bits (111),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKIC+GRN+CGVDSMVSTV AV +
Sbjct  350  YKICKGRNVCGVDSMVSTVTAVRS  373



>ref|XP_008236965.1| PREDICTED: cysteine proteinase RD19a [Prunus mume]
Length=367

 Score = 80.9 bits (198),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYG++GY+PIR+KEKPYWIIKNSWGE+WGE G
Sbjct  296  KRLDHGVLLVGYGAAGYSPIRMKEKPYWIIKNSWGENWGEKG  337


 Score = 48.1 bits (113),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTS  210
            YKIC+GRNICGVDSMVSTVAA +  T+
Sbjct  339  YKICKGRNICGVDSMVSTVAAASVETN  365



>gb|ABK96252.1| unknown [Populus trichocarpa x Populus deltoides]
Length=156

 Score = 79.3 bits (194),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS+GY+P+R+KEKP+WIIKNSWGE WGE G
Sbjct  88   RRLDHGVLLVGYGSAGYSPVRMKEKPFWIIKNSWGEKWGENG  129


 Score = 49.7 bits (117),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRGRN+CGVDSMVSTVAAV T +
Sbjct  131  YKICRGRNVCGVDSMVSTVAAVQTSS  156



>ref|XP_007201310.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
 gb|EMJ02509.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
Length=367

 Score = 80.5 bits (197),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYG++GY+PIR+KEKPYWIIKNSWGE+WGE G
Sbjct  296  KRLDHGVLLVGYGAAGYSPIRMKEKPYWIIKNSWGENWGEKG  337


 Score = 48.1 bits (113),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTS  210
            YKIC+GRNICGVDSMVSTVAA +  T+
Sbjct  339  YKICKGRNICGVDSMVSTVAAASVETN  365



>ref|XP_010061009.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW67908.1| hypothetical protein EUGRSUZ_F01612 [Eucalyptus grandis]
Length=369

 Score = 80.1 bits (196),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS+GYAPIR KEKPYWIIKNSWGE+WGE G
Sbjct  300  KHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGENG  341


 Score = 48.5 bits (114),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGR+ICGVDSMVSTVAA++T
Sbjct  343  YKICRGRDICGVDSMVSTVAAIHT  366



>gb|EYU42593.1| hypothetical protein MIMGU_mgv1a008336mg [Erythranthe guttata]
Length=377

 Score = 79.0 bits (193),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYG+  +APIR+KEKPYWIIKNSWG +WGE G
Sbjct  310  KRLDHGVLLVGYGAGAFAPIRMKEKPYWIIKNSWGPNWGEKG  351


 Score = 49.7 bits (117),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKIC+GRN+CGVDSMVSTVAAV T
Sbjct  353  YKICQGRNLCGVDSMVSTVAAVTT  376



>gb|ABK96580.1| unknown [Populus trichocarpa x Populus deltoides]
Length=367

 Score = 78.2 bits (191),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +R D GVLLVGYGS+GYAPIR KEKP+WIIKNSWG++WGE G
Sbjct  298  KRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGENG  339


 Score = 50.4 bits (119),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRNICGVDSMVSTVAA++T
Sbjct  341  YKICRGRNICGVDSMVSTVAAIHT  364



>gb|ABK94801.1| unknown [Populus trichocarpa]
Length=367

 Score = 78.2 bits (191),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +R D GVLLVGYGS+GYAPIR KEKP+WIIKNSWG++WGE G
Sbjct  298  KRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGENG  339


 Score = 50.1 bits (118),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRNICGVDSMVSTVAA++T
Sbjct  341  YKICRGRNICGVDSMVSTVAAIHT  364



>ref|XP_009406357.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=372

 Score = 78.2 bits (191),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS+GY+PIRLK+KP+WIIKNSWGE+WGE G
Sbjct  302  RHLDHGVLLVGYGSAGYSPIRLKQKPFWIIKNSWGETWGEKG  343


 Score = 50.1 bits (118),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRN+CGVDSMVSTV A+NT
Sbjct  345  YKICRGRNVCGVDSMVSTVTAINT  368



>ref|XP_002302004.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
 gb|ABK94746.1| unknown [Populus trichocarpa]
 gb|EEE81277.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
Length=367

 Score = 78.2 bits (191),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +R D GVLLVGYGS+GYAPIR KEKP+WIIKNSWG++WGE G
Sbjct  298  KRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGENG  339


 Score = 50.1 bits (118),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRNICGVDSMVSTVAA++T
Sbjct  341  YKICRGRNICGVDSMVSTVAAIHT  364



>ref|XP_010268619.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=369

 Score = 80.1 bits (196),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYGS GY+PIR+K+KPYWIIKNSWGESWGE G
Sbjct  300  RRLNHGVLLVGYGSEGYSPIRMKDKPYWIIKNSWGESWGENG  341


 Score = 47.8 bits (112),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGR++CGVDSMVSTVAA++T
Sbjct  343  YKICRGRDVCGVDSMVSTVAAIHT  366



>ref|XP_003540987.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=365

 Score = 77.4 bits (189),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE G
Sbjct  296  RRLNHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENG  337


 Score = 50.4 bits (119),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRGRNICGVDSMVSTVA+V+T T
Sbjct  339  YKICRGRNICGVDSMVSTVASVHTTT  364



>gb|ABF46642.1| papain-like cysteine proteinase [Pachysandra terminalis]
Length=374

 Score = 83.6 bits (205),  Expect(2) = 4e-21, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  8    LDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            LD GVLLVGYGS+G+APIR KEKPYWIIKNSWGESWGE G
Sbjct  307  LDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGESWGEKG  346


 Score = 44.3 bits (103),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 22/26 (85%), Gaps = 1/26 (4%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRGRNICG+DSMVS VAA   PT
Sbjct  348  YKICRGRNICGMDSMVSAVAAA-VPT  372



>ref|XP_002280798.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CAN73591.1| hypothetical protein VITISV_022889 [Vitis vinifera]
 emb|CBI19785.3| unnamed protein product [Vitis vinifera]
Length=371

 Score = 79.3 bits (194),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  8    LDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            LD GVLLVGYGS+GY+PIR KEKPYWIIKNSWGESWGE G
Sbjct  304  LDHGVLLVGYGSAGYSPIRFKEKPYWIIKNSWGESWGEQG  343


 Score = 48.1 bits (113),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRG NICGVDSMVSTVAA++T
Sbjct  345  YKICRGHNICGVDSMVSTVAAIHT  368



>emb|CDQ51995.1| Cysteine proteinase, partial [Fagus sylvatica]
Length=165

 Score = 78.6 bits (192),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVG+GS+GYAPIRLKEKP+WIIKNSWGE+WGE G
Sbjct  99   RHLDHGVLLVGFGSAGYAPIRLKEKPFWIIKNSWGENWGENG  140


 Score = 48.9 bits (115),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVN  198
            YKICRGRN+CGVDSMVSTVAA+N
Sbjct  142  YKICRGRNVCGVDSMVSTVAAIN  164



>gb|KJB07487.1| hypothetical protein B456_001G026600 [Gossypium raimondii]
Length=377

 Score = 81.6 bits (200),  Expect(2) = 5e-21, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS+GY+PI LK+KPYWIIKNSWGE+WGE G
Sbjct  308  KHLDHGVLLVGYGSAGYSPIHLKDKPYWIIKNSWGENWGENG  349


 Score = 45.8 bits (107),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRG N+CGVDS+VSTV A+NT +
Sbjct  351  YKICRGSNVCGVDSLVSTVVALNTKS  376



>ref|XP_010672379.1| PREDICTED: cysteine proteinase RD19a-like [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score = 79.0 bits (193),  Expect(2) = 6e-21, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GV+LVGYGS+GYAPIR KEKPYWIIKNSWG +WG+ G
Sbjct  305  RSLDHGVVLVGYGSAGYAPIRFKEKPYWIIKNSWGPNWGDQG  346


 Score = 48.1 bits (113),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVN  198
            YKICRG N+CGVDSMVSTVAAVN
Sbjct  348  YKICRGHNVCGVDSMVSTVAAVN  370



>gb|AJP16692.1| cysteine protease, partial [Striga hermonthica]
Length=148

 Score = 81.3 bits (199),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYG SGYAPIR+K+KPYWIIKNSWGE+WGE G
Sbjct  85   KRLDHGVLLVGYGESGYAPIRMKDKPYWIIKNSWGENWGENG  126


 Score = 45.8 bits (107),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 20/21 (95%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAA  192
            YKICRGRN+CGVDSMVSTVAA
Sbjct  128  YKICRGRNVCGVDSMVSTVAA  148



>ref|XP_009109502.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
 emb|CDX90310.1| BnaA08g16740D [Brassica napus]
Length=369

 Score = 78.6 bits (192),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYGS+GYAP R KEKPYWIIKNSWGE+WGE G
Sbjct  299  RRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENG  340


 Score = 48.5 bits (114),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTSY  213
            YKICRGRN+CGVDS+VSTV A  +PT++
Sbjct  342  YKICRGRNVCGVDSLVSTVTAAVSPTAH  369



>ref|XP_008775532.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=371

 Score = 78.6 bits (192),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS+ YAPIR KEKPYWIIKNSWGE WGE G
Sbjct  304  RHLDHGVLLVGYGSAAYAPIRFKEKPYWIIKNSWGEKWGENG  345


 Score = 48.1 bits (113),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRN+CGVDSMVSTVAAV +
Sbjct  347  YKICRGRNVCGVDSMVSTVAAVRS  370



>ref|XP_002275759.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI17456.3| unnamed protein product [Vitis vinifera]
Length=367

 Score = 79.7 bits (195),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GV+LVGYGS+GYAPIR KEKPYWIIKNSWGESWGE G
Sbjct  298  RNLDHGVVLVGYGSAGYAPIRFKEKPYWIIKNSWGESWGEDG  339


 Score = 47.0 bits (110),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRG N CGVDSMVSTVAA+ T T
Sbjct  341  YKICRGHNACGVDSMVSTVAAIQTTT  366



>ref|XP_006473584.1| PREDICTED: cysteine proteinase 15A-like [Citrus sinensis]
Length=369

 Score = 78.6 bits (192),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  8    LDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            LD GVL+VGYGSSG+APIR KEKPYWIIKNSWGE+WGE G
Sbjct  302  LDHGVLIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGENG  341


 Score = 47.8 bits (112),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTS  210
            YKIC GRN+CGVDSMVS+VAAV+T +S
Sbjct  343  YKICMGRNVCGVDSMVSSVAAVHTTSS  369



>gb|AAU81589.1| cysteine proteinase [Petunia x hybrida]
Length=257

 Score = 80.5 bits (197),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +R D GVLLVGYGS+G+APIRLKEKPYWIIKNSWGESWGE G
Sbjct  186  KRQDHGVLLVGYGSAGFAPIRLKEKPYWIIKNSWGESWGEQG  227


 Score = 45.8 bits (107),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRNICGVD+MVSTV A +T
Sbjct  229  YKICRGRNICGVDAMVSTVTAAHT  252



>ref|XP_009392632.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=369

 Score = 78.2 bits (191),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS+GY+PIRLK+KP+WIIKNSWGE+WGE G
Sbjct  299  RHLDHGVLLVGYGSAGYSPIRLKDKPFWIIKNSWGENWGEHG  340


 Score = 48.1 bits (113),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRNICGVDSMVS+V+A++T
Sbjct  342  YKICRGRNICGVDSMVSSVSAIHT  365



>ref|NP_001241450.1| uncharacterized protein LOC100778716 precursor [Glycine max]
 gb|ACU20049.1| unknown [Glycine max]
Length=366

 Score = 78.2 bits (191),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE G
Sbjct  297  KHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEG  338


 Score = 47.8 bits (112),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVN  198
            YKICRGRN+CGVDSMVSTVAA++
Sbjct  340  YKICRGRNVCGVDSMVSTVAAIH  362



>ref|XP_002510469.1| cysteine protease, putative [Ricinus communis]
 gb|EEF52656.1| cysteine protease, putative [Ricinus communis]
Length=366

 Score = 77.4 bits (189),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +R D GV+LVGYGS+GYAP+RLK+KP+WIIKNSWGE+WGE G
Sbjct  297  KRQDHGVVLVGYGSAGYAPVRLKDKPFWIIKNSWGENWGENG  338


 Score = 48.5 bits (114),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRN+CGVD+MVSTVAA++T
Sbjct  340  YKICRGRNVCGVDAMVSTVAAIHT  363



>ref|XP_003523684.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=366

 Score = 78.2 bits (191),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE G
Sbjct  297  KHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEG  338


 Score = 47.8 bits (112),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVN  198
            YKICRGRN+CGVDSMVSTVAA++
Sbjct  340  YKICRGRNVCGVDSMVSTVAAIH  362



>gb|KHN45894.1| Cysteine proteinase RD19a [Glycine soja]
Length=366

 Score = 78.2 bits (191),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE G
Sbjct  297  KHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEG  338


 Score = 47.8 bits (112),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVN  198
            YKICRGRN+CGVDSMVSTVAA++
Sbjct  340  YKICRGRNVCGVDSMVSTVAAIH  362



>gb|KDO84720.1| hypothetical protein CISIN_1g017548mg [Citrus sinensis]
Length=369

 Score = 78.6 bits (192),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  8    LDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            LD GVL+VGYGSSG+APIR KEKPYWIIKNSWGE+WGE G
Sbjct  302  LDHGVLIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGENG  341


 Score = 47.4 bits (111),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTS  210
            YKIC GRN+CGVDSMVS+VAA++T +S
Sbjct  343  YKICMGRNVCGVDSMVSSVAAIHTTSS  369



>ref|XP_006435090.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
 gb|ESR48330.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
Length=369

 Score = 78.6 bits (192),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  8    LDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            LD GVL+VGYGSSG+APIR KEKPYWIIKNSWGE+WGE G
Sbjct  302  LDHGVLIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGENG  341


 Score = 47.4 bits (111),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTS  210
            YKIC GRN+CGVDSMVS+VAA++T +S
Sbjct  343  YKICMGRNVCGVDSMVSSVAAIHTTSS  369



>dbj|BAC41322.1| hypothetical protein [Lotus japonicus]
Length=358

 Score = 76.6 bits (187),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            ++L+ GVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE G
Sbjct  291  KKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENG  332


 Score = 49.3 bits (116),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRNICGVDSMVSTVAA++T
Sbjct  334  YKICRGRNICGVDSMVSTVAALHT  357



>dbj|BAJ53178.1| JHL18I08.12 [Jatropha curcas]
 gb|KDP38578.1| hypothetical protein JCGZ_04503 [Jatropha curcas]
Length=368

 Score = 80.9 bits (198),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGGATR  136
            +R D GVLLVGYGS+GYAPIRLK+KP+WIIKNSWGESWGE G  R
Sbjct  298  KRQDHGVLLVGYGSAGYAPIRLKDKPFWIIKNSWGESWGENGYYR  342


 Score = 44.7 bits (104),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVN  198
            Y+ICRGRNICGVD+MVS+VAA++
Sbjct  341  YRICRGRNICGVDAMVSSVAAIH  363



>emb|CAE45588.1| papain-like cysteine proteinase-like protein 1 [Lotus japonicus]
Length=359

 Score = 76.3 bits (186),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            ++L+ GVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE G
Sbjct  292  KKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENG  333


 Score = 49.3 bits (116),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRNICGVDSMVSTVAA++T
Sbjct  335  YKICRGRNICGVDSMVSTVAALHT  358



>gb|KHN25410.1| Cysteine proteinase RD19a [Glycine soja]
Length=365

 Score = 77.4 bits (189),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE G
Sbjct  296  RRLNHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENG  337


 Score = 48.1 bits (113),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRGR+ICGVDSMVSTVA+V+T T
Sbjct  339  YKICRGRSICGVDSMVSTVASVHTTT  364



>gb|KJB58164.1| hypothetical protein B456_009G197400 [Gossypium raimondii]
Length=375

 Score = 81.3 bits (199),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS+GYAP+R K KPYWIIKNSWGE+WGE G
Sbjct  301  KHLDHGVLLVGYGSAGYAPVRFKNKPYWIIKNSWGENWGENG  342


 Score = 44.3 bits (103),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 17/23 (74%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVN  198
            YKICRG N+CGVDSMVS+V+A++
Sbjct  344  YKICRGNNVCGVDSMVSSVSALH  366



>emb|CAB53397.1| cysteine protease [Medicago sativa]
Length=209

 Score = 79.0 bits (193),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  5    RLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            RLD GVLLVG+GS GYAPIRLKEKPYWIIKNSWG++WGE G
Sbjct  144  RLDHGVLLVGFGSGGYAPIRLKEKPYWIIKNSWGQNWGEEG  184


 Score = 46.6 bits (109),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRN+CGVDSMVSTVAA  +
Sbjct  186  YKICRGRNVCGVDSMVSTVAAAQS  209



>gb|AAL05851.1|AF411121_1 cysteine proteinase precursor [Sandersonia aurantiaca]
Length=360

 Score = 79.3 bits (194),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS+G+APIR KEKPYWIIKNSWGE+WGE G
Sbjct  292  KHLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGENWGENG  333


 Score = 45.8 bits (107),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRN+CGVDSMVS+V+A +T
Sbjct  335  YKICRGRNVCGVDSMVSSVSAFHT  358



>dbj|BAF98584.1| CM0216.500.nc [Lotus japonicus]
Length=360

 Score = 76.3 bits (186),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            ++L+ GVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE G
Sbjct  291  KKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENG  332


 Score = 48.9 bits (115),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRNICGVDSMVSTVAA++T
Sbjct  334  YKICRGRNICGVDSMVSTVAALHT  357



>gb|AAM65162.1| cysteine proteinase RD19A [Arabidopsis thaliana]
Length=368

 Score = 77.8 bits (190),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYG++GYAP R KEKPYWIIKNSWGE+WGE G
Sbjct  298  RRLNHGVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENG  339


 Score = 47.4 bits (111),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTSY  213
            YKIC+GRNICGVDSMVSTVAA  + T++
Sbjct  341  YKICKGRNICGVDSMVSTVAATVSTTAH  368



>ref|NP_568052.1| cysteine proteinase RD19a [Arabidopsis thaliana]
 sp|P43296.1|RD19A_ARATH RecName: Full=Cysteine proteinase RD19a; Short=RD19; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA02373.1| thiol protease [Arabidopsis thaliana]
 emb|CAB38829.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 emb|CAB80572.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AAL85009.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 gb|AAM91778.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 dbj|BAE98545.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AEE87016.1| cysteine proteinase RD19a [Arabidopsis thaliana]
Length=368

 Score = 77.8 bits (190),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYG++GYAP R KEKPYWIIKNSWGE+WGE G
Sbjct  298  RRLNHGVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENG  339


 Score = 47.4 bits (111),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTSY  213
            YKIC+GRNICGVDSMVSTVAA  + T++
Sbjct  341  YKICKGRNICGVDSMVSTVAATVSTTAH  368



>emb|CDY71205.1| BnaCnng71840D [Brassica napus]
Length=368

 Score = 78.2 bits (191),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYGS+GYAP R KEKPYWIIKNSWGE+WGE G
Sbjct  298  RRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEDG  339


 Score = 46.6 bits (109),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTSY  213
            YKICRGRN+CGVDS+VSTV A  +P ++
Sbjct  341  YKICRGRNVCGVDSLVSTVTATVSPAAH  368



>ref|XP_010105270.1| Cysteine proteinase 15A [Morus notabilis]
 gb|EXC04205.1| Cysteine proteinase 15A [Morus notabilis]
Length=372

 Score = 77.8 bits (190),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
              LD GVLLVGYG++GYAPIR K+KPYWIIKNSWGE+WGE G
Sbjct  298  HMLDHGVLLVGYGTAGYAPIRFKDKPYWIIKNSWGENWGEQG  339


 Score = 47.4 bits (111),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVN  198
            YKICRGRN+CGVDSMVSTVAA++
Sbjct  341  YKICRGRNVCGVDSMVSTVAALH  363



>gb|AAL60581.1|AF454959_1 senescence-associated cysteine protease [Brassica oleracea]
Length=368

 Score = 78.2 bits (191),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYGS+GYAP R KEKPYWIIKNSWGE+WGE G
Sbjct  298  RRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEDG  339


 Score = 46.6 bits (109),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTSY  213
            YKICRGRN+CGVDS+VSTV A  +P ++
Sbjct  341  YKICRGRNVCGVDSLVSTVTATVSPAAH  368



>emb|CAE45589.1| papain-like cysteine proteinase-like protein 2 [Lotus japonicus]
Length=361

 Score = 76.3 bits (186),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            ++L+ GVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE G
Sbjct  292  KKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENG  333


 Score = 48.5 bits (114),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRN+CGVDSMVSTVAA++T
Sbjct  335  YKICRGRNVCGVDSMVSTVAALHT  358



>ref|XP_009602233.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana tomentosiformis]
Length=369

 Score = 74.7 bits (182),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE G
Sbjct  301  KRLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGENG  341


 Score = 50.1 bits (118),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRGRN+CGVDSMVSTVAAV+T +
Sbjct  343  YKICRGRNVCGVDSMVSTVAAVSTSS  368



>ref|XP_006341997.1| PREDICTED: cysteine proteinase 15A-like [Solanum tuberosum]
Length=376

 Score = 80.5 bits (197),  Expect(2) = 3e-20, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +R D GVLLVGYGS G+APIRLK KPYWIIKNSWG++WGE G
Sbjct  305  KRQDHGVLLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEHG  346


 Score = 44.3 bits (103),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRG NICGVD+MVSTV A +T
Sbjct  348  YKICRGHNICGVDAMVSTVTATHT  371



>gb|AAD29084.1|AF082181_1 cysteine proteinase precursor [Solanum melongena]
Length=363

 Score = 80.5 bits (197),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +R D GVLLVGYGS+G+APIRLKEKPYWIIKNSWGE+WGE G
Sbjct  292  KRQDHGVLLVGYGSAGFAPIRLKEKPYWIIKNSWGENWGEHG  333


 Score = 44.3 bits (103),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRG NICGVD+MVSTV A +T
Sbjct  335  YKICRGHNICGVDAMVSTVTATHT  358



>gb|KFK30492.1| hypothetical protein AALP_AA7G268600 [Arabis alpina]
Length=367

 Score = 78.6 bits (192),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYGS+GYAP R KEKPYWIIKNSWGE+WGE G
Sbjct  297  RRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENG  338


 Score = 46.2 bits (108),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTSY  213
            YKIC+GRNICGVDS+VSTVAA  + T++
Sbjct  340  YKICKGRNICGVDSLVSTVAATVSTTAH  367



>ref|XP_003589348.1| Cysteine proteinase [Medicago truncatula]
 gb|AES59599.1| papain family cysteine protease [Medicago truncatula]
Length=364

 Score = 77.0 bits (188),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  5    RLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            RLD GVLL+G+G  GYAPIRLKEKPYWIIKNSWG++WGE G
Sbjct  299  RLDHGVLLLGFGQGGYAPIRLKEKPYWIIKNSWGQNWGEEG  339


 Score = 47.4 bits (111),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRN+CGVDSMVSTVAA  +
Sbjct  341  YKICRGRNVCGVDSMVSTVAAAQS  364



>dbj|BAF98585.1| CM0216.510.nc [Lotus japonicus]
Length=360

 Score = 75.9 bits (185),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            ++L+ GVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE G
Sbjct  291  KKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENG  332


 Score = 48.5 bits (114),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRN+CGVDSMVSTVAA++T
Sbjct  334  YKICRGRNVCGVDSMVSTVAALHT  357



>ref|XP_006411706.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
 dbj|BAJ33785.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53159.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
Length=373

 Score = 79.3 bits (194),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYGS+GYAP R KEKPYWIIKNSWGESWGE G
Sbjct  303  RRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGESWGENG  344


 Score = 45.1 bits (105),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTSY  213
            YKIC+GRNICGVDS+VSTV+A  + T++
Sbjct  346  YKICKGRNICGVDSLVSTVSATVSTTAH  373



>gb|AGV54334.1| cysteine proteinase RD19a-like protein [Phaseolus vulgaris]
Length=366

 Score = 76.6 bits (187),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG+  YAPIR KEKP+WIIKNSWGESWGE G
Sbjct  297  KHLDHGVLLVGYGAGAYAPIRFKEKPFWIIKNSWGESWGENG  338


 Score = 47.8 bits (112),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRG N+CGVDSMVSTVAA++T +
Sbjct  340  YKICRGHNVCGVDSMVSTVAAIHTSS  365



>ref|XP_007136047.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
 gb|ESW08041.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
Length=366

 Score = 76.6 bits (187),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG+  YAPIR KEKP+WIIKNSWGESWGE G
Sbjct  297  KHLDHGVLLVGYGAGAYAPIRFKEKPFWIIKNSWGESWGENG  338


 Score = 47.8 bits (112),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRG N+CGVDSMVSTVAA++T +
Sbjct  340  YKICRGHNVCGVDSMVSTVAAIHTSS  365



>gb|AAU81591.1| cysteine proteinase, partial [Petunia x hybrida]
Length=190

 Score = 74.3 bits (181),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +R D GVLLVGYGS G+APIR+KEKPYWIIKNSWGE WGE G
Sbjct  123  KRQDHGVLLVGYGS-GFAPIRMKEKPYWIIKNSWGEKWGESG  163


 Score = 50.1 bits (118),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRGRN+CGVDSMVSTVAAV+T +
Sbjct  165  YKICRGRNVCGVDSMVSTVAAVSTSS  190



>ref|XP_008387995.1| PREDICTED: cysteine proteinase 15A [Malus domestica]
Length=365

 Score = 81.3 bits (199),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +R+D GVLLVGYGSSG+APIRLKEKPYWI+KNSWG+SWGE G
Sbjct  296  KRIDHGVLLVGYGSSGFAPIRLKEKPYWILKNSWGQSWGEQG  337


 Score = 43.1 bits (100),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRG N CGVDS+VSTVAA++T
Sbjct  339  YKICRGYNSCGVDSLVSTVAALHT  362



>gb|KHN22211.1| Cysteine proteinase 15A [Glycine soja]
Length=366

 Score = 78.2 bits (191),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE G
Sbjct  297  KHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEG  338


 Score = 45.8 bits (107),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVN  198
            Y ICRGRN+CGVDSMVSTVAA++
Sbjct  340  YNICRGRNVCGVDSMVSTVAAIH  362



>sp|P25804.1|CYSP_PEA RecName: Full=Cysteine proteinase 15A; AltName: Full=Turgor-responsive 
protein 15A; Flags: Precursor [Pisum sativum]
 emb|CAA38242.1| unnamed protein product [Pisum sativum]
Length=363

 Score = 77.0 bits (188),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  5    RLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            RLD GVLLVG+G   YAPIRLKEKPYWIIKNSWG++WGE G
Sbjct  296  RLDHGVLLVGFGKGAYAPIRLKEKPYWIIKNSWGQNWGEQG  336


 Score = 47.4 bits (111),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRN+CGVDSMVSTVAA  +
Sbjct  338  YKICRGRNVCGVDSMVSTVAAAQS  361



>ref|XP_007160702.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
 gb|ESW32696.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
Length=365

 Score = 76.3 bits (186),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG   YAPIR KEKPYWIIKNSWGE+WGE G
Sbjct  296  KHLDHGVLLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGENG  337


 Score = 47.8 bits (112),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRGRN+CGVDSMVSTV A++  T
Sbjct  339  YKICRGRNVCGVDSMVSTVGAIHAST  364



>emb|CAA82995.1| cysteine proteinase [Vicia sativa]
Length=358

 Score = 76.6 bits (187),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  5    RLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            RLD GVLLVG+G   YAPIRLKEKPYWIIKNSWG++WGE G
Sbjct  291  RLDHGVLLVGFGKGAYAPIRLKEKPYWIIKNSWGQNWGEQG  331


 Score = 47.4 bits (111),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRN+CGVDSMVSTVAA  +
Sbjct  333  YKICRGRNVCGVDSMVSTVAAAQS  356



>dbj|BAF03553.1| cysteine proteinase CP2 [Phaseolus vulgaris]
Length=365

 Score = 76.3 bits (186),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG   YAPIR KEKPYWIIKNSWGE+WGE G
Sbjct  296  KHLDHGVLLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGENG  337


 Score = 47.8 bits (112),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTS  210
            YKICRGRN+CGVDSMVSTV A++  T 
Sbjct  339  YKICRGRNVCGVDSMVSTVGAIHASTQ  365



>ref|XP_008444769.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=373

 Score = 82.0 bits (201),  Expect(2) = 6e-20, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS+G+APIR KEKPYWIIKNSWGE+WGE G
Sbjct  305  RNLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGENWGENG  346


 Score = 41.6 bits (96),  Expect(2) = 6e-20, Method: Composition-based stats.
 Identities = 16/25 (64%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTP  204
            Y IC+G+N+CG +SMVS+VAA  TP
Sbjct  348  YFICKGKNVCGSESMVSSVAAAATP  372



>ref|XP_006283963.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
 gb|EOA16861.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
Length=368

 Score = 78.6 bits (192),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYGS+GYAP R KEKPYWIIKNSWGE+WGE G
Sbjct  298  RRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENG  339


 Score = 45.1 bits (105),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTSY  213
            YKIC+GRNICGVDS+VSTV+A  + T++
Sbjct  341  YKICKGRNICGVDSLVSTVSATVSTTAH  368



>ref|XP_006362019.1| PREDICTED: cysteine proteinase RD19a-like [Solanum tuberosum]
Length=368

 Score = 73.6 bits (179),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            ++LD GVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE G
Sbjct  301  KQLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGENG  341


 Score = 50.1 bits (118),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRGRN+CGVDSMVSTVAAV+T +
Sbjct  343  YKICRGRNVCGVDSMVSTVAAVSTSS  368



>gb|AAO11786.1| pre-pro cysteine proteinase [Vicia faba]
Length=363

 Score = 76.3 bits (186),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  5    RLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            RLD GVLLVG+G   YAPIRLKEKPYWI+KNSWG++WGE G
Sbjct  296  RLDHGVLLVGFGKGAYAPIRLKEKPYWIVKNSWGQNWGEQG  336


 Score = 47.4 bits (111),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRN+CGVDSMVSTVAA  +
Sbjct  338  YKICRGRNVCGVDSMVSTVAAAQS  361



>gb|AAB67878.1| pre-pro-cysteine proteinase [Vicia faba]
Length=363

 Score = 76.3 bits (186),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  5    RLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            RLD GVLLVG+G   YAPIRLKEKPYWI+KNSWG++WGE G
Sbjct  296  RLDHGVLLVGFGKGAYAPIRLKEKPYWIVKNSWGQNWGEQG  336


 Score = 47.4 bits (111),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRN+CGVDSMVSTVAA  +
Sbjct  338  YKICRGRNVCGVDSMVSTVAAAQS  361



>ref|XP_004230928.1| PREDICTED: cysteine proteinase RD19a [Solanum lycopersicum]
Length=369

 Score = 73.2 bits (178),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            ++LD GVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE G
Sbjct  301  KQLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGESG  341


 Score = 50.4 bits (119),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRGRN+CGVDSMVSTVAAV+T +
Sbjct  343  YKICRGRNVCGVDSMVSTVAAVSTSS  368



>ref|XP_002868883.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45142.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score = 79.0 bits (193),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYGS+GYAP R KEKPYWIIKNSWGE+WGE G
Sbjct  298  RRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENG  339


 Score = 44.3 bits (103),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTSY  213
            YKIC+GRNICGVDS+VSTV A  + T++
Sbjct  341  YKICKGRNICGVDSLVSTVTAAVSTTAH  368



>emb|CDP07452.1| unnamed protein product [Coffea canephora]
Length=376

 Score = 81.6 bits (200),  Expect(2) = 8e-20, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +2

Query  11   DFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            D GVLLVGYG++GYAPIRLK+KPYWIIKNSWGE+WGE G
Sbjct  312  DHGVLLVGYGAAGYAPIRLKDKPYWIIKNSWGENWGENG  350


 Score = 41.6 bits (96),  Expect(2) = 8e-20, Method: Composition-based stats.
 Identities = 19/25 (76%), Positives = 22/25 (88%), Gaps = 1/25 (4%)
 Frame = +1

Query  130  YKICRG-RNICGVDSMVSTVAAVNT  201
            YK CR  RN+CGVDSMVS+VAAV+T
Sbjct  352  YKFCRADRNLCGVDSMVSSVAAVHT  376



>ref|XP_009146338.1| PREDICTED: cysteine proteinase 15A-like [Brassica rapa]
 emb|CDY32227.1| BnaA01g17570D [Brassica napus]
Length=368

 Score = 77.8 bits (190),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  11   DFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            D GVLLVG+GSSGYAPIRLKEKPYWIIKNSWG +WGE G
Sbjct  301  DHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGSTWGEDG  339


 Score = 45.4 bits (106),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 1/27 (4%)
 Frame = +1

Query  130  YKICRGR-NICGVDSMVSTVAAVNTPT  207
            YKICRGR NICG+D+MVSTVAAV+T T
Sbjct  341  YKICRGRHNICGMDTMVSTVAAVHTST  367



>emb|CDY34441.1| BnaC01g21920D [Brassica napus]
Length=368

 Score = 77.8 bits (190),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  11   DFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            D GVLLVG+GSSGYAPIRLKEKPYWIIKNSWG +WGE G
Sbjct  301  DHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGSTWGEDG  339


 Score = 45.4 bits (106),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 1/27 (4%)
 Frame = +1

Query  130  YKICRGR-NICGVDSMVSTVAAVNTPT  207
            YKICRGR NICG+D+MVSTVAAV+T T
Sbjct  341  YKICRGRHNICGMDTMVSTVAAVHTST  367



>gb|AAL69389.1|AF462226_1 putative cysteine proteinase [Narcissus pseudonarcissus]
Length=136

 Score = 77.4 bits (189),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGSSG+APIR KEKPYWIIKNSWGE+WGE G
Sbjct  66   KHLDHGVLLVGYGSSGWAPIRFKEKPYWIIKNSWGENWGEKG  107


 Score = 45.8 bits (107),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKIC+GRN+CGVDSMVSTV A++T
Sbjct  109  YKICKGRNVCGVDSMVSTVTAIHT  132



>ref|XP_010531457.1| PREDICTED: probable cysteine proteinase A494 [Tarenaya hassleriana]
Length=364

 Score = 77.4 bits (189),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYGS+GYAP R+KEKP+WIIKNSWGE+WGE G
Sbjct  297  RRLNHGVLLVGYGSAGYAPARMKEKPFWIIKNSWGENWGEKG  338


 Score = 45.8 bits (107),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 20/21 (95%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAA  192
            YKICRGRNICGVDS+VSTVAA
Sbjct  340  YKICRGRNICGVDSLVSTVAA  360



>dbj|BAA92495.1| cysteine protease [Vigna mungo]
Length=364

 Score = 79.7 bits (195),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GV +VGYG SGYAPIR KEKPYWIIKNSWGESWGE G
Sbjct  295  KRLDHGVQIVGYGESGYAPIRFKEKPYWIIKNSWGESWGENG  336


 Score = 43.1 bits (100),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRG+N CGVDSMVSTV A++ 
Sbjct  338  YKICRGQNACGVDSMVSTVGAIHA  361



>gb|ABK24153.1| unknown [Picea sitchensis]
Length=394

 Score = 77.8 bits (190),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            Q LD GVLLVGYG++GYAP RLK KP+WIIKNSWG  WGE G
Sbjct  323  QNLDHGVLLVGYGAAGYAPGRLKNKPFWIIKNSWGPDWGEDG  364


 Score = 45.1 bits (105),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 17/26 (65%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YK+CRG N+CG+++MVSTVAA N  T
Sbjct  366  YKLCRGHNVCGINTMVSTVAAANIQT  391



>emb|CDY41960.1| BnaA01g05320D [Brassica napus]
Length=367

 Score = 78.6 bits (192),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYGS+GYAP R KEKPYWIIKNSWGE+WGE G
Sbjct  297  RRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENG  338


 Score = 44.3 bits (103),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTSY  213
            YKIC+GRNICGVDS+VSTV A  + T++
Sbjct  340  YKICKGRNICGVDSLVSTVTAAVSTTAH  367



>ref|XP_002306900.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
 gb|ABK92924.1| unknown [Populus trichocarpa]
 gb|EEE93896.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
Length=367

 Score = 76.6 bits (187),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +  D GVLLVGYG++GYAPIR KEKP+WIIKNSWGE+WGE G
Sbjct  298  KHQDHGVLLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGENG  339


 Score = 46.2 bits (108),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICR RNICGVDSMVSTVAA++ 
Sbjct  341  YKICRARNICGVDSMVSTVAAIHA  364



>ref|XP_010530325.1| PREDICTED: cysteine proteinase RD19a [Tarenaya hassleriana]
Length=370

 Score = 77.0 bits (188),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +R D GVLLVGYGS+GY+PIRLKEKPYWIIKNSWG +WGE G
Sbjct  301  KRQDHGVLLVGYGSAGYSPIRLKEKPYWIIKNSWGANWGEEG  342


 Score = 45.8 bits (107),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKIC GRN+CG+D+MVS+VAAV+T T
Sbjct  344  YKICHGRNLCGMDTMVSSVAAVHTST  369



>ref|XP_011045161.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score = 76.3 bits (186),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +  D GVLLVGYG++GYAPIR KEKP+WIIKNSWGE+WGE G
Sbjct  298  KHQDHGVLLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGENG  339


 Score = 46.6 bits (109),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVN  198
            YKICR RNICGVDSMVSTVAA++
Sbjct  341  YKICRARNICGVDSMVSTVAAIH  363



>ref|NP_001266121.1| uncharacterized protein LOC101501911 precursor [Cicer arietinum]
 emb|CAA08906.1| cysteine proteinase [Cicer arietinum]
Length=362

 Score = 73.6 bits (179),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 1/41 (2%)
 Frame = +2

Query  5    RLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            RLD GVLLVG+G+ G+APIRLKEKPYWIIKNSWG++WGE G
Sbjct  295  RLDHGVLLVGFGN-GFAPIRLKEKPYWIIKNSWGQNWGEEG  334


 Score = 48.9 bits (115),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTS  210
            YKICRGRNICGVDSMVSTVAAV+   +
Sbjct  336  YKICRGRNICGVDSMVSTVAAVHASNN  362



>gb|AJA74415.1| cysteine protease [Cicer arietinum]
Length=358

 Score = 73.6 bits (179),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 1/41 (2%)
 Frame = +2

Query  5    RLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            RLD GVLLVG+G+ G+APIRLKEKPYWIIKNSWG++WGE G
Sbjct  291  RLDHGVLLVGFGN-GFAPIRLKEKPYWIIKNSWGQNWGEEG  330


 Score = 48.9 bits (115),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTS  210
            YKICRGRNICGVDSMVSTVAAV+   +
Sbjct  332  YKICRGRNICGVDSMVSTVAAVHASNN  358



>dbj|BAD94010.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
Length=86

 Score = 76.6 bits (187),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYG++GYAP R KEKPYWIIKNSWGE+WGE G
Sbjct  16   RRLNHGVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENG  57


 Score = 46.2 bits (108),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTSY  213
            YKIC+GRNICGVDSMVSTVAA  + T++
Sbjct  59   YKICKGRNICGVDSMVSTVAATVSTTAH  86



>gb|ACK57563.1| cysteine protease-like protein [Arachis hypogaea]
Length=364

 Score = 78.6 bits (192),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG+ GYAPIR KEKPYWIIKNSWGE+WGE G
Sbjct  295  KHLDHGVLLVGYGAGGYAPIRFKEKPYWIIKNSWGENWGENG  336


 Score = 43.9 bits (102),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRG N+CGVDSMVSTV A++T
Sbjct  338  YKICRGPNMCGVDSMVSTVIAIHT  361



>ref|XP_010446443.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score = 79.0 bits (193),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYGS+GYAP R KEKPYWIIKNSWGE+WGE G
Sbjct  297  RRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENG  338


 Score = 43.5 bits (101),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTSY  213
            YKIC+GRNICGVDS+VSTV+A  +  ++
Sbjct  340  YKICKGRNICGVDSLVSTVSATVSANAH  367



>ref|XP_007223351.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
 gb|EMJ24550.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
Length=367

 Score = 79.7 bits (195),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +R+D GVLLVGYGSSG+APIR KEKPYWI+KNSWG+SWGE G
Sbjct  298  KRIDHGVLLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEEG  339


 Score = 42.4 bits (98),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRG N CGVDS+VSTVA+++T
Sbjct  341  YKICRGHNSCGVDSLVSTVASLHT  364



>ref|XP_010437007.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=368

 Score = 78.6 bits (192),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYGS+GYAP R KEKPYWIIKNSWGE+WGE G
Sbjct  298  RRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENG  339


 Score = 43.5 bits (101),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAV  195
            YKIC+GRNICGVDS+VSTV+A 
Sbjct  341  YKICKGRNICGVDSLVSTVSAT  362



>ref|XP_010431862.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score = 78.6 bits (192),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYGS+GYAP R KEKPYWIIKNSWGE+WGE G
Sbjct  297  RRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENG  338


 Score = 43.5 bits (101),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTSY  213
            YKIC+GRNICGVDS+VSTV+A  +  ++
Sbjct  340  YKICKGRNICGVDSLVSTVSATVSANAH  367



>ref|XP_003545051.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=367

 Score = 74.3 bits (181),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVL+VGYG   YAPIR K KPYWIIKNSWGESWGE G
Sbjct  298  KHLDHGVLIVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENG  339


 Score = 48.1 bits (113),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 1/28 (4%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTSY  213
            YKICRGRN+CGVDSMVSTVAA+  P+S+
Sbjct  341  YKICRGRNVCGVDSMVSTVAAI-YPSSH  367



>ref|XP_008221329.1| PREDICTED: cysteine proteinase 15A-like [Prunus mume]
Length=366

 Score = 79.7 bits (195),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +R+D GVLLVGYGSSG+APIR KEKPYWI+KNSWG+SWGE G
Sbjct  297  KRIDHGVLLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEEG  338


 Score = 42.4 bits (98),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRG N CGVDS+VSTVA+++T
Sbjct  340  YKICRGHNPCGVDSLVSTVASLHT  363



>ref|XP_003579573.2| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=399

 Score = 82.4 bits (202),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS+GYAP+R KEKPYWIIKNSWGE+WGE G
Sbjct  326  RHLDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESG  367


 Score = 39.7 bits (91),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 3/27 (11%)
 Frame = +1

Query  130  YKICRG---RNICGVDSMVSTVAAVNT  201
            YKICRG   +N CGVDSMVSTV A++T
Sbjct  369  YKICRGAHVKNKCGVDSMVSTVTAIHT  395



>emb|CDX98179.1| BnaC07g09190D [Brassica napus]
Length=72

 Score = 76.3 bits (186),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYGS+GYAP R KEKPYWIIKNSWGE+WGE G
Sbjct  2    RRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEDG  43


 Score = 45.8 bits (107),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTSY  213
            YKICRGRN+CGVDS+VSTV A  +P ++
Sbjct  45   YKICRGRNVCGVDSLVSTVTATVSPAAH  72



>gb|KHN12668.1| Cysteine proteinase 15A [Glycine soja]
Length=156

 Score = 74.7 bits (182),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG   YAPIR K KPYWIIKNSWGESWGE G
Sbjct  87   KHLDHGVLLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENG  128


 Score = 47.4 bits (111),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 1/28 (4%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTSY  213
            YKICRGRN+CGVDSMVSTVAA+  P+S+
Sbjct  130  YKICRGRNVCGVDSMVSTVAAI-YPSSH  156



>ref|XP_009150026.1| PREDICTED: cysteine proteinase RD19a [Brassica rapa]
Length=367

 Score = 77.8 bits (190),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYGS+GYAP R KE+PYWIIKNSWGE+WGE G
Sbjct  297  RRLNHGVLLVGYGSAGYAPARFKERPYWIIKNSWGETWGENG  338


 Score = 44.3 bits (103),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTSY  213
            YKIC+GRNICGVDS+VSTV A  + T++
Sbjct  340  YKICKGRNICGVDSLVSTVTAAVSTTAH  367



>gb|AIB06025.1| CP3 [Hevea brasiliensis]
Length=366

 Score = 75.1 bits (183),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  11   DFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            D GVLLVGYG++GYAPIR K+KP+WIIKNSWGE+WGE G
Sbjct  300  DHGVLLVGYGAAGYAPIRFKDKPFWIIKNSWGENWGENG  338


 Score = 47.0 bits (110),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRGRNICG+D+MVS+VAA++T
Sbjct  340  YKICRGRNICGMDAMVSSVAAIHT  363



>ref|XP_002870174.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46433.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
Length=373

 Score = 79.7 bits (195),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  11   DFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            D GVLLVG+GSSGYAPIRLKEKPYWIIKNSWG  WGE G
Sbjct  306  DHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGAMWGEHG  344


 Score = 42.4 bits (98),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 19/25 (76%), Positives = 23/25 (92%), Gaps = 1/25 (4%)
 Frame = +1

Query  130  YKICRG-RNICGVDSMVSTVAAVNT  201
            YKICRG  N+CG+D+MVSTVAAV+T
Sbjct  346  YKICRGPHNMCGMDTMVSTVAAVHT  370



>ref|XP_002280808.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CBI19783.3| unnamed protein product [Vitis vinifera]
Length=365

 Score = 73.6 bits (179),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  8    LDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            L+ GVLLVGYGS+GY+PIR KEKPYW++KNSWG++WGE G
Sbjct  299  LNHGVLLVGYGSAGYSPIRFKEKPYWLLKNSWGQNWGEHG  338


 Score = 48.1 bits (113),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRG NICGVDSMVSTVAA+ + T
Sbjct  340  YKICRGHNICGVDSMVSTVAAIQSAT  365



>gb|ABK93575.1| unknown [Populus trichocarpa]
Length=157

 Score = 75.9 bits (185),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +  D GVLLVGYG++GYAPIR KEKP+WIIKNSWGE+WGE G
Sbjct  88   KHQDHGVLLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGENG  129


 Score = 45.8 bits (107),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICR RNICGVDSMVSTVAA++ 
Sbjct  131  YKICRARNICGVDSMVSTVAAIHA  154



>dbj|BAF46302.1| cysteine proteinase precursor [Ipomoea nil]
Length=369

 Score = 76.6 bits (187),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG++GYAPIR K+KPYWI+KNSWGE+WGE G
Sbjct  300  RNLDHGVLLVGYGAAGYAPIRFKDKPYWIVKNSWGENWGEEG  341


 Score = 45.1 bits (105),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRG NICG+DSMVSTV A +T
Sbjct  343  YKICRGNNICGIDSMVSTVTAAST  366



>ref|XP_008775280.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=368

 Score = 79.0 bits (193),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS+GYAPIR K+KPYWIIKNSWGE+WGE G
Sbjct  302  RHLDHGVLLVGYGSAGYAPIRFKDKPYWIIKNSWGENWGEDG  343


 Score = 42.4 bits (98),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAV  195
            YKICRG NICGV+SMVSTV A+
Sbjct  345  YKICRGHNICGVESMVSTVTAI  366



>ref|XP_006828787.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
 gb|ERM96203.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
Length=365

 Score = 75.9 bits (185),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVL+VGYGS+GYAPIRLK+K YWIIKNSWGE+WGE G
Sbjct  299  RNLDHGVLIVGYGSAGYAPIRLKDKAYWIIKNSWGETWGEKG  340


 Score = 45.4 bits (106),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRG NICGVDSMVSTVA++ +
Sbjct  342  YKICRGHNICGVDSMVSTVASIQS  365



>ref|XP_002880378.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56637.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score = 76.3 bits (186),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLL+GYGSSGY+  RLKEKPYWIIKNSWGESWGE G
Sbjct  294  RRLNHGVLLMGYGSSGYSQARLKEKPYWIIKNSWGESWGENG  335


 Score = 45.1 bits (105),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKIC+GRNICGVDS+VSTVAA  +
Sbjct  337  YKICKGRNICGVDSLVSTVAAATS  360



>gb|AAK07731.1| CPR2-like cysteine proteinase [Nicotiana tabacum]
Length=363

 Score = 76.3 bits (186),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +R D GVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE G
Sbjct  292  KRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHG  333


 Score = 44.7 bits (104),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRG NICGVD+MVSTV A +T
Sbjct  335  YKICRGHNICGVDAMVSTVTAAHT  358



>ref|XP_009611293.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana tomentosiformis]
 emb|CAB44983.1| putative preprocysteine proteinase [Nicotiana tabacum]
Length=363

 Score = 76.3 bits (186),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +R D GVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE G
Sbjct  292  KRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHG  333


 Score = 44.7 bits (104),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRG NICGVD+MVSTV A +T
Sbjct  335  YKICRGHNICGVDAMVSTVTAAHT  358



>ref|XP_009335626.1| PREDICTED: cysteine proteinase 15A [Pyrus x bretschneideri]
Length=366

 Score = 79.7 bits (195),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +R+D GVLLVGYGSSG+APIR KEKPYWI+KNSWG+SWGE G
Sbjct  297  KRIDHGVLLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEQG  338


 Score = 41.2 bits (95),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRG N CGVDS+VSTVAA++ 
Sbjct  340  YKICRGYNSCGVDSLVSTVAALHA  363



>ref|XP_009776238.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana sylvestris]
Length=365

 Score = 76.3 bits (186),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +R D GVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE G
Sbjct  294  KRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHG  335


 Score = 44.7 bits (104),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRG NICGVD+MVSTV A +T
Sbjct  337  YKICRGHNICGVDAMVSTVTAAHT  360



>ref|XP_011083631.1| PREDICTED: cysteine proteinase 15A-like [Sesamum indicum]
Length=371

 Score = 80.9 bits (198),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG++GYAPIRLKEKPYWIIKNSWGE+WGE G
Sbjct  302  KHLDHGVLLVGYGAAGYAPIRLKEKPYWIIKNSWGENWGENG  343


 Score = 40.0 bits (92),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 21/26 (81%), Gaps = 1/26 (4%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVN-TP  204
            YKICRG N+CGV SMVSTV A + TP
Sbjct  345  YKICRGHNVCGVASMVSTVTAAHVTP  370



>emb|CAD40319.2| OSJNBb0054B09.3 [Oryza sativa Japonica Group]
 emb|CAH66180.1| OSIGBa0130O15.4 [Oryza sativa Indica Group]
 emb|CAH66205.1| OSIGBa0148D14.11 [Oryza sativa Indica Group]
Length=381

 Score = 81.3 bits (199),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS+GYAPIR KEKPYWIIKNSWGE+WGE G
Sbjct  307  RHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKG  348


 Score = 39.7 bits (91),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 18/27 (67%), Positives = 22/27 (81%), Gaps = 3/27 (11%)
 Frame = +1

Query  130  YKICRG---RNICGVDSMVSTVAAVNT  201
            YKICRG   +N CGVDSMVS+V A++T
Sbjct  350  YKICRGPHDKNKCGVDSMVSSVTAIHT  376



>emb|CAA78365.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=365

 Score = 76.3 bits (186),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +R D GVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE G
Sbjct  294  KRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHG  335


 Score = 44.7 bits (104),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRG NICGVD+MVSTV A +T
Sbjct  337  YKICRGHNICGVDAMVSTVTAAHT  360



>gb|ACX54787.2| cysteine protease [Arachis diogoi]
Length=360

 Score = 77.8 bits (190),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG++GYAPIR K+KP+WIIKNSWGESWGE G
Sbjct  289  KNLDHGVLLVGYGAAGYAPIRFKDKPFWIIKNSWGESWGEDG  330


 Score = 43.1 bits (100),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTS  210
            YKICRG+N+CGVDSMVS+V A    +S
Sbjct  332  YKICRGKNVCGVDSMVSSVVATTFTSS  358



>emb|CAA78361.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=363

 Score = 76.3 bits (186),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +R D GVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE G
Sbjct  292  KRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHG  333


 Score = 44.7 bits (104),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRG NICGVD+MVSTV A +T
Sbjct  335  YKICRGHNICGVDAMVSTVTAAHT  358



>ref|XP_004238314.1| PREDICTED: cysteine proteinase 15A [Solanum lycopersicum]
Length=363

 Score = 76.3 bits (186),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +R D GVLLVGYGS G+APIRLK KPYWIIKNSWG++WGE G
Sbjct  292  KRQDHGVLLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEHG  333


 Score = 44.3 bits (103),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRG NICGVD+MVSTV A +T
Sbjct  335  YKICRGHNICGVDAMVSTVTATHT  358



>gb|AAB62937.1| stress-induced cysteine proteinase [Lavatera thuringiaca]
Length=175

 Score = 73.6 bits (179),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG++GYAP+R KEKP+WIIKNSWG +WGE G
Sbjct  106  RSLDHGVLLVGYGAAGYAPVRFKEKPFWIIKNSWGANWGEDG  147


 Score = 47.4 bits (111),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRGRN+CGVDSMVS+VAA+ T +
Sbjct  149  YKICRGRNVCGVDSMVSSVAALQTKS  174



>emb|CAB17075.1| cysteine proteinase precursor [Phaseolus vulgaris]
Length=365

 Score = 72.8 bits (177),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG   YAPIR KEKPYWIIKNSWGE+WG  G
Sbjct  296  KHLDHGVLLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGGNG  337


 Score = 47.8 bits (112),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRGRN+CGVDSMVSTV A++  T
Sbjct  339  YKICRGRNVCGVDSMVSTVGAIHAST  364



>gb|AAQ81938.1| cysteine proteinase precursor [Ipomoea batatas]
Length=371

 Score = 76.6 bits (187),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVL+VGYG++GYAPIR K+KPYWIIKNSWGE+WGE G
Sbjct  302  KNLDHGVLIVGYGAAGYAPIRFKDKPYWIIKNSWGENWGEEG  343


 Score = 44.3 bits (103),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRG NICGVDSMVS+V A +T
Sbjct  345  YKICRGNNICGVDSMVSSVTAAST  368



>ref|XP_004975256.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=388

 Score = 82.4 bits (202),  Expect(2) = 5e-19, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS+GYAPIR KEKPYWIIKNSWGE+WGE G
Sbjct  315  RHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGENG  356


 Score = 38.1 bits (87),  Expect(2) = 5e-19, Method: Composition-based stats.
 Identities = 17/26 (65%), Positives = 21/26 (81%), Gaps = 3/26 (12%)
 Frame = +1

Query  130  YKICRG---RNICGVDSMVSTVAAVN  198
            YK+CRG   +N CGVDSMVSTV A++
Sbjct  358  YKLCRGPFVKNKCGVDSMVSTVTAIH  383



>ref|NP_567489.1| papain family cysteine protease [Arabidopsis thaliana]
 emb|CAB10398.1| cysteine proteinase like protein [Arabidopsis thaliana]
 emb|CAB78661.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AAK62611.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM91059.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM96982.1| cysteine proteinase [Arabidopsis thaliana]
 gb|AAN31875.1| putative cysteine proteinase [Arabidopsis thaliana]
 dbj|BAE98514.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AEE83713.1| papain family cysteine protease [Arabidopsis thaliana]
Length=373

 Score = 79.7 bits (195),  Expect(2) = 6e-19, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  11   DFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            D GVLLVG+GSSGYAPIRLKEKPYWIIKNSWG  WGE G
Sbjct  306  DHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGAMWGEHG  344


 Score = 40.8 bits (94),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 23/25 (92%), Gaps = 1/25 (4%)
 Frame = +1

Query  130  YKICRG-RNICGVDSMVSTVAAVNT  201
            YKICRG  N+CG+D+MVSTVAAV+T
Sbjct  346  YKICRGPHNMCGMDTMVSTVAAVHT  370



>gb|KJB29611.1| hypothetical protein B456_005G110200 [Gossypium raimondii]
Length=370

 Score = 72.4 bits (176),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG++GY+PIR K+KP+WIIKNSWG +WGE G
Sbjct  301  RTLDHGVLLVGYGAAGYSPIRFKDKPFWIIKNSWGANWGEDG  342


 Score = 47.8 bits (112),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRGRN+CGVDSMVS+VAA++T +
Sbjct  344  YKICRGRNVCGVDSMVSSVAALHTKS  369



>gb|EMT16425.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=379

 Score = 79.3 bits (194),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS+GYAP+R KEKPYWIIKNSWGE+WGE G
Sbjct  306  RHLDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESG  347


 Score = 40.8 bits (94),  Expect(2) = 7e-19, Method: Composition-based stats.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 3/27 (11%)
 Frame = +1

Query  130  YKICRG---RNICGVDSMVSTVAAVNT  201
            YKICRG   +N CGVDSMVSTV A++T
Sbjct  349  YKICRGPHVKNKCGVDSMVSTVTAIHT  375



>ref|XP_004952477.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=374

 Score = 79.3 bits (194),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG++G+APIRLKEKPYWIIKNSWGE+WGE G
Sbjct  301  RHLDHGVLLVGYGAAGFAPIRLKEKPYWIIKNSWGENWGENG  342


 Score = 40.8 bits (94),  Expect(2) = 7e-19, Method: Composition-based stats.
 Identities = 19/26 (73%), Positives = 22/26 (85%), Gaps = 3/26 (12%)
 Frame = +1

Query  130  YKICRG---RNICGVDSMVSTVAAVN  198
            YKICRG   RN CGVDSMVSTV+A++
Sbjct  344  YKICRGSNVRNKCGVDSMVSTVSAIH  369



>ref|XP_010943608.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=371

 Score = 75.1 bits (183),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS+GYAPIR K+KPYWIIKNSWG +WGE G
Sbjct  304  RHLDHGVLLVGYGSAGYAPIRFKDKPYWIIKNSWGGNWGEDG  345


 Score = 44.7 bits (104),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRG+NICGV+SMVSTV AV T
Sbjct  347  YKICRGQNICGVESMVSTVTAVRT  370



>gb|EPS70818.1| cysteine proteinase, partial [Genlisea aurea]
Length=355

 Score = 77.0 bits (188),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  5    RLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
             LD GVL+VGYGSSGYAPIRLK KPYWI+KNSWG++WGE G
Sbjct  290  NLDHGVLMVGYGSSGYAPIRLKNKPYWIVKNSWGKNWGEKG  330


 Score = 43.1 bits (100),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRG NICGV+SMVSTV A+++
Sbjct  332  YKICRGSNICGVESMVSTVTAIHS  355



>gb|EMS53996.1| Cysteine proteinase 1 [Triticum urartu]
Length=405

 Score = 80.9 bits (198),  Expect(2) = 8e-19, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS+GYAP+R KEKPYWIIKNSWGE+WGE G
Sbjct  332  RHLDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESG  373


 Score = 39.3 bits (90),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 3/27 (11%)
 Frame = +1

Query  130  YKICRG---RNICGVDSMVSTVAAVNT  201
            YKICRG   +N CGVDSMVSTV A++T
Sbjct  375  YKICRGPHVKNKCGVDSMVSTVTAIHT  401



>dbj|BAD43619.1| putative cysteine proteinase [Arabidopsis thaliana]
Length=361

 Score = 75.1 bits (183),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYGS+G++  RLKEKPYWIIKNSWGESWGE G
Sbjct  295  RRLNHGVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENG  336


 Score = 45.1 bits (105),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKIC+GRNICGVDS+VSTVAA  +
Sbjct  338  YKICKGRNICGVDSLVSTVAATTS  361



>ref|NP_565512.1| Papain family cysteine protease [Arabidopsis thaliana]
 sp|P43295.2|A494_ARATH RecName: Full=Probable cysteine proteinase A494; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD23687.1| cysteine proteinase [Arabidopsis thaliana]
 gb|ABJ98563.1| At2g21430 [Arabidopsis thaliana]
 gb|AEC07177.1| Papain family cysteine protease [Arabidopsis thaliana]
Length=361

 Score = 74.7 bits (182),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYGS+G++  RLKEKPYWIIKNSWGESWGE G
Sbjct  295  RRLNHGVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENG  336


 Score = 45.1 bits (105),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKIC+GRNICGVDS+VSTVAA  +
Sbjct  338  YKICKGRNICGVDSLVSTVAATTS  361



>ref|XP_006665032.1| PREDICTED: cysteine proteinase 1-like [Oryza brachyantha]
Length=191

 Score = 80.1 bits (196),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGSSG+APIRLK+KPYWIIKNSWGE+WGE G
Sbjct  119  KHLDHGVLLVGYGSSGFAPIRLKDKPYWIIKNSWGENWGEHG  160


 Score = 39.7 bits (91),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 3/27 (11%)
 Frame = +1

Query  130  YKICRGRNI---CGVDSMVSTVAAVNT  201
            YKICRG N+   CGVDSMVSTV A++T
Sbjct  162  YKICRGSNVRDKCGVDSMVSTVTAIHT  188



>ref|NP_001052440.1| Os04g0311400 [Oryza sativa Japonica Group]
 dbj|BAF14354.1| Os04g0311400, partial [Oryza sativa Japonica Group]
Length=384

 Score = 82.0 bits (201),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS+GYAPIR KEKPYWIIKNSWGE+WGE G
Sbjct  310  RHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKG  351


 Score = 37.7 bits (86),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 22/27 (81%), Gaps = 3/27 (11%)
 Frame = +1

Query  130  YKICRG---RNICGVDSMVSTVAAVNT  201
            YKICRG   +N CGVDSMVS+V A++T
Sbjct  353  YKICRGPHDKNKCGVDSMVSSVTAIHT  379



>emb|CAA52403.1| putative thiol protease [Arabidopsis thaliana]
Length=313

 Score = 74.7 bits (182),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYGS+G++  RLKEKPYWIIKNSWGESWGE G
Sbjct  247  RRLNHGVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENG  288


 Score = 45.1 bits (105),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKIC+GRNICGVDS+VSTVAA  +
Sbjct  290  YKICKGRNICGVDSLVSTVAATTS  313



>ref|XP_006653265.1| PREDICTED: cysteine proteinase 1-like, partial [Oryza brachyantha]
Length=366

 Score = 80.5 bits (197),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS+GYAPIR KEKPYWIIKNSWGE+WGE G
Sbjct  293  KHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGENG  334


 Score = 38.9 bits (89),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 3/27 (11%)
 Frame = +1

Query  130  YKICRG---RNICGVDSMVSTVAAVNT  201
            YKICRG   +N CGVDSMVSTV A++T
Sbjct  336  YKICRGPHVQNKCGVDSMVSTVTAIHT  362



>gb|EYU27644.1| hypothetical protein MIMGU_mgv1a008452mg [Erythranthe guttata]
Length=373

 Score = 76.6 bits (187),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG++GY+ IRLK KPYWI+KNSWGESWGE G
Sbjct  304  RNLDHGVLLVGYGAAGYSTIRLKNKPYWIVKNSWGESWGEEG  345


 Score = 43.1 bits (100),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 16/27 (59%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTS  210
            YKIC+G N+CGV+SMVS+V A++T ++
Sbjct  347  YKICKGHNVCGVESMVSSVNAIHTTSA  373



>gb|KHG15062.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=370

 Score = 72.8 bits (177),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  8    LDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGGATR  136
            LD GVLLVGYG++GY+PIR K+KP+WIIKNSWG +WGE G  R
Sbjct  303  LDHGVLLVGYGAAGYSPIRFKDKPFWIIKNSWGANWGEDGYYR  345


 Score = 46.6 bits (109),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            Y+ICRGRN+CGVDSMVS+VAA++T +
Sbjct  344  YRICRGRNVCGVDSMVSSVAALHTKS  369



>gb|EPS65881.1| cysteine proteinase, partial [Genlisea aurea]
Length=335

 Score = 80.9 bits (198),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  5    RLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            RLD G+L+VGYG+SGYAPIRLKEKPYWI+KNSWGE+WGE G
Sbjct  273  RLDHGILIVGYGASGYAPIRLKEKPYWIVKNSWGENWGEQG  313


 Score = 38.5 bits (88),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAA  192
            YKIC+G N+CGV+S+VSTV A
Sbjct  315  YKICKGHNVCGVESLVSTVTA  335



>ref|XP_003574963.1| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=377

 Score = 76.3 bits (186),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG+SG+AP RLK KPYW+IKNSWGE+WGE G
Sbjct  304  RSLDHGVLLVGYGASGFAPSRLKNKPYWVIKNSWGENWGEKG  345


 Score = 42.7 bits (99),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 22/27 (81%), Gaps = 3/27 (11%)
 Frame = +1

Query  130  YKICRG---RNICGVDSMVSTVAAVNT  201
            YKICRG   RN CGVDSMVSTVAA +T
Sbjct  347  YKICRGSNVRNKCGVDSMVSTVAAAHT  373



>ref|NP_001105685.1| cysteine proteinase 1 precursor [Zea mays]
 sp|Q10716.1|CYSP1_MAIZE RecName: Full=Cysteine proteinase 1; Flags: Precursor [Zea mays]
 dbj|BAA08244.1| cysteine proteinase [Zea mays]
Length=371

 Score = 79.3 bits (194),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG+SG+APIRLK+KPYWIIKNSWGE+WGE G
Sbjct  299  RHLDHGVLLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENG  340


 Score = 39.7 bits (91),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 3/27 (11%)
 Frame = +1

Query  130  YKICRG---RNICGVDSMVSTVAAVNT  201
            YKICRG   RN CGVDSMVSTV+AV+ 
Sbjct  342  YKICRGSNVRNKCGVDSMVSTVSAVHA  368



>gb|ACF86683.1| unknown [Zea mays]
 gb|AFW71402.1| cysteine protease1 [Zea mays]
Length=371

 Score = 79.3 bits (194),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG+SG+APIRLK+KPYWIIKNSWGE+WGE G
Sbjct  299  RHLDHGVLLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENG  340


 Score = 39.7 bits (91),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 3/27 (11%)
 Frame = +1

Query  130  YKICRG---RNICGVDSMVSTVAAVNT  201
            YKICRG   RN CGVDSMVSTV+AV+ 
Sbjct  342  YKICRGSNVRNKCGVDSMVSTVSAVHA  368



>ref|XP_003607110.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89307.1| papain family cysteine protease [Medicago truncatula]
Length=331

 Score = 68.2 bits (165),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS   A ++ KEKPYWI+KNSWGE+WGE G
Sbjct  262  RRLDLGVLLVGYGSGAGADMKEKEKPYWIVKNSWGETWGENG  303


 Score = 50.8 bits (120),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRGRNICGVDSMVSTVAA +T T
Sbjct  305  YKICRGRNICGVDSMVSTVAAAHTTT  330



>ref|XP_010440192.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=365

 Score = 75.5 bits (184),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  11   DFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            D GVLLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE G
Sbjct  298  DHGVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHG  336


 Score = 43.5 bits (101),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 1/27 (4%)
 Frame = +1

Query  130  YKICRG-RNICGVDSMVSTVAAVNTPT  207
            YKICRG  N+CG+DSMVSTVAAV+T T
Sbjct  338  YKICRGPHNVCGMDSMVSTVAAVHTTT  364



>gb|ACM80348.1| cysteine proteinase [Solanum lycopersicum]
Length=368

 Score = 73.2 bits (178),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            ++LD GVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE G
Sbjct  301  KQLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGESG  341


 Score = 45.8 bits (107),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKI RGRN+CGVDSMVSTVAAV+T +
Sbjct  343  YKIRRGRNVCGVDSMVSTVAAVSTSS  368



>gb|KEH30505.1| papain family cysteine protease [Medicago truncatula]
Length=330

 Score = 68.2 bits (165),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS   A ++ KEKPYWI+KNSWGE+WGE G
Sbjct  261  RRLDLGVLLVGYGSGAGADMKEKEKPYWIVKNSWGETWGENG  302


 Score = 50.8 bits (120),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRGRNICGVDSMVSTVAA +T T
Sbjct  304  YKICRGRNICGVDSMVSTVAAAHTNT  329



>emb|CAA78403.1| pre-pro-cysteine proteinase [Solanum lycopersicum]
Length=361

 Score = 76.3 bits (186),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +R D GVLLVGYGS G+APIRLK KPYWIIKNSWG++WGE G
Sbjct  290  KRQDHGVLLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEHG  331


 Score = 42.4 bits (98),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKICRG +ICGVD+MVSTV A +T
Sbjct  333  YKICRGHHICGVDAMVSTVTATHT  356



>ref|XP_006414378.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
 gb|ESQ55831.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
Length=367

 Score = 75.5 bits (184),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  11   DFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            D GVLLVG+GSSGY+PIRLKEKPYWIIKNSWG  WGE G
Sbjct  300  DHGVLLVGFGSSGYSPIRLKEKPYWIIKNSWGSMWGEHG  338


 Score = 43.1 bits (100),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 1/27 (4%)
 Frame = +1

Query  130  YKICRG-RNICGVDSMVSTVAAVNTPT  207
            YKICRG  NICG+D+MVSTVAAV T T
Sbjct  340  YKICRGSHNICGMDTMVSTVAAVQTST  366



>ref|XP_002452058.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
 gb|EES05034.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
Length=371

 Score = 77.8 bits (190),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  8    LDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            LD GVLLVGYG++G+APIRLK+KPYWIIKNSWGE+WGE G
Sbjct  301  LDHGVLLVGYGAAGFAPIRLKDKPYWIIKNSWGENWGENG  340


 Score = 40.8 bits (94),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 22/27 (81%), Gaps = 3/27 (11%)
 Frame = +1

Query  130  YKICRG---RNICGVDSMVSTVAAVNT  201
            YKICRG   RN CGVDSMVSTV+AV T
Sbjct  342  YKICRGSNVRNKCGVDSMVSTVSAVRT  368



>ref|XP_010434865.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score = 75.5 bits (184),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  11   DFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            D GVLLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE G
Sbjct  298  DHGVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHG  336


 Score = 43.1 bits (100),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 1/27 (4%)
 Frame = +1

Query  130  YKICRG-RNICGVDSMVSTVAAVNTPT  207
            YKICRG  N+CG+DSMVSTVAAV+T T
Sbjct  338  YKICRGPHNMCGMDSMVSTVAAVHTTT  364



>ref|XP_010449835.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score = 75.5 bits (184),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  11   DFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            D GVLLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE G
Sbjct  298  DHGVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHG  336


 Score = 43.1 bits (100),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 1/27 (4%)
 Frame = +1

Query  130  YKICRG-RNICGVDSMVSTVAAVNTPT  207
            YKICRG  N+CG+DSMVSTVAAV+T T
Sbjct  338  YKICRGPHNMCGMDSMVSTVAAVHTTT  364



>ref|XP_009405542.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=366

 Score = 73.2 bits (178),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + L+ GVLLVGYGS+GYAP R KEK YWIIKNSWGE+WGE G
Sbjct  300  KHLNHGVLLVGYGSAGYAPARFKEKSYWIIKNSWGENWGENG  341


 Score = 45.4 bits (106),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAV  195
            YKICRGRNICGVDSMVS+V A+
Sbjct  343  YKICRGRNICGVDSMVSSVTAI  364



>gb|AAB16996.1| thiol protease isoform B, partial [Glycine max]
Length=319

 Score = 75.1 bits (183),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG   YAPIR K KPYWIIKNSWGESWGE G
Sbjct  250  KHLDHGVLLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENG  291


 Score = 43.5 bits (101),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 25/27 (93%), Gaps = 1/27 (4%)
 Frame = +1

Query  133  KICRGRNICGVDSMVSTVAAVNTPTSY  213
            +ICRGRN+CGVDSMVSTVAA+  P+S+
Sbjct  294  EICRGRNVCGVDSMVSTVAAI-YPSSH  319



>ref|XP_006283974.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
 gb|EOA16872.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
Length=365

 Score = 76.3 bits (186),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  11   DFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            D GVLLVG+GSSGYAPIRLKEKPYWIIKNSWG  WGE G
Sbjct  298  DHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGSMWGEHG  336


 Score = 42.0 bits (97),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 1/27 (4%)
 Frame = +1

Query  130  YKICRG-RNICGVDSMVSTVAAVNTPT  207
            YKICRG  N+CG+D+MVSTVAAV+T T
Sbjct  338  YKICRGPHNMCGMDTMVSTVAAVHTTT  364



>ref|NP_001046828.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAD19579.1| putative cysteine proteinase 1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF08742.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAG92750.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93804.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94031.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83204.1| hypothetical protein OsI_28465 [Oryza sativa Indica Group]
 gb|EEE56967.1| hypothetical protein OsJ_06681 [Oryza sativa Japonica Group]
Length=373

 Score = 75.5 bits (184),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG+SG+APIRLK+K YWIIKNSWGE+WGE G
Sbjct  301  RHLDHGVLLVGYGASGFAPIRLKDKAYWIIKNSWGENWGEHG  342


 Score = 42.7 bits (99),  Expect(2) = 3e-18, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 3/27 (11%)
 Frame = +1

Query  130  YKICRG---RNICGVDSMVSTVAAVNT  201
            YKICRG   RN CGVDSMVSTV+A++T
Sbjct  344  YKICRGSNVRNKCGVDSMVSTVSAIHT  370



>ref|XP_004152668.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004167370.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN62647.1| Cysteine protease [Cucumis sativus]
Length=371

 Score = 79.7 bits (195),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG++G+APIRLKEKPYWIIKNSWGE+WGE G
Sbjct  305  RNLDHGVLLVGYGAAGFAPIRLKEKPYWIIKNSWGENWGENG  346


 Score = 38.1 bits (87),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAV  195
            Y IC+G+NICG +SMVS+VAA+
Sbjct  348  YFICKGKNICGSESMVSSVAAI  369



>gb|EEE60725.1| hypothetical protein OsJ_14236 [Oryza sativa Japonica Group]
Length=364

 Score = 79.3 bits (194),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS+GYAPIR KEKPYWIIKNSWGE+WGE G
Sbjct  290  RHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKG  331


 Score = 38.1 bits (87),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 22/27 (81%), Gaps = 3/27 (11%)
 Frame = +1

Query  130  YKICRG---RNICGVDSMVSTVAAVNT  201
            YKICRG   +N CGVDSMVS+V A++T
Sbjct  333  YKICRGPHDKNKCGVDSMVSSVTAIHT  359



>gb|EAY93546.1| hypothetical protein OsI_15336 [Oryza sativa Indica Group]
Length=348

 Score = 79.3 bits (194),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS+GYAPIR KEKPYWIIKNSWGE+WGE G
Sbjct  274  RHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKG  315


 Score = 38.1 bits (87),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 22/27 (81%), Gaps = 3/27 (11%)
 Frame = +1

Query  130  YKICRG---RNICGVDSMVSTVAAVNT  201
            YKICRG   +N CGVDSMVS+V A++T
Sbjct  317  YKICRGPHDKNKCGVDSMVSSVTAIHT  343



>emb|CDY09707.1| BnaC07g33540D [Brassica napus]
Length=366

 Score = 72.8 bits (177),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  11   DFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            D GVLLVG+GS+GYAP+RL+EKPYWIIKNSWG  WGE G
Sbjct  299  DHGVLLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEKG  337


 Score = 44.7 bits (104),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 23/25 (92%), Gaps = 1/25 (4%)
 Frame = +1

Query  130  YKICRGR-NICGVDSMVSTVAAVNT  201
            YKICRG  NICGVD+MVSTVAAVNT
Sbjct  339  YKICRGTPNICGVDTMVSTVAAVNT  363



>gb|KFK24413.1| hypothetical protein AALP_AAs58848U000200 [Arabis alpina]
Length=372

 Score = 75.1 bits (183),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  11   DFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            D GVLLVG+G SGYAPIRLKEKPYWIIKNSWG+ WGE G
Sbjct  305  DHGVLLVGFGESGYAPIRLKEKPYWIIKNSWGKMWGEHG  343


 Score = 42.4 bits (98),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 2/27 (7%)
 Frame = +1

Query  130  YKICRGR-NICGVDSMVSTVAAVN-TP  204
            YKICRGR NICG+D+MVSTVAAV  TP
Sbjct  345  YKICRGRHNICGMDTMVSTVAAVQITP  371



>emb|CDX99593.1| BnaC04g33500D [Brassica napus]
Length=343

 Score = 72.8 bits (177),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYGS+G++  R KEKPYWIIKNSWGE+WGE G
Sbjct  278  KRLNHGVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENG  319


 Score = 44.3 bits (103),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAV  195
            YK+C+GRN+CGVDSMVSTVAA 
Sbjct  321  YKLCKGRNVCGVDSMVSTVAAA  342



>ref|XP_009140277.1| PREDICTED: probable cysteine proteinase A494 [Brassica rapa]
Length=362

 Score = 72.8 bits (177),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYGS+G++  R KEKPYWIIKNSWGE+WGE G
Sbjct  297  KRLNHGVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENG  338


 Score = 43.9 bits (102),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAV  195
            YK+C+GRN+CG+DSMVSTVAA 
Sbjct  340  YKLCKGRNVCGIDSMVSTVAAA  361



>gb|AAZ32411.1| cysteine proteinase glycinain type [Nicotiana benthamiana]
Length=355

 Score = 76.3 bits (186),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +R D GVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE G
Sbjct  294  KRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHG  335


 Score = 40.8 bits (94),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 17/19 (89%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTV  186
            YKICRG NICGVD+MVSTV
Sbjct  337  YKICRGHNICGVDAMVSTV  355



>emb|CDY15894.1| BnaA04g12170D [Brassica napus]
Length=362

 Score = 73.2 bits (178),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYGS+G++  R KEKPYWIIKNSWGE+WGE G
Sbjct  297  KRLNHGVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENG  338


 Score = 43.9 bits (102),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAV  195
            YK+C+GRN+CG+DSMVSTVAA 
Sbjct  340  YKLCKGRNVCGIDSMVSTVAAA  361



>emb|CAA57675.1| cysteine proteinase [Zea mays]
Length=145

 Score = 77.8 bits (190),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG+SG+AP+RLK+KPYWIIKNSWGE+WGE G
Sbjct  73   RHLDHGVLLVGYGASGFAPMRLKDKPYWIIKNSWGENWGENG  114


 Score = 38.9 bits (89),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 3/27 (11%)
 Frame = +1

Query  130  YKICRG---RNICGVDSMVSTVAAVNT  201
            YKICRG   RN CGVDSMVSTV+AV+ 
Sbjct  116  YKICRGSNVRNKCGVDSMVSTVSAVHA  142



>tpe|CAD66657.1| TPA: putative cysteine proteinase precursor [Hordeum vulgare 
subsp. vulgare]
 dbj|BAJ94057.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score = 75.9 bits (185),  Expect(2) = 8e-18, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG+SG+AP R KEKPYWIIKNSWGE+WG+ G
Sbjct  304  RHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKG  345


 Score = 40.4 bits (93),  Expect(2) = 8e-18, Method: Composition-based stats.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 3/27 (11%)
 Frame = +1

Query  130  YKICRG---RNICGVDSMVSTVAAVNT  201
            YKICRG   RN CGVDSMVSTV+A ++
Sbjct  347  YKICRGSNVRNKCGVDSMVSTVSATHS  373



>ref|XP_006404590.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
 gb|ESQ46043.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
Length=363

 Score = 73.6 bits (179),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYGS+G+A  RLK+KPYWIIKNSWGE+WGE G
Sbjct  298  RRLNHGVLLVGYGSAGFAQARLKKKPYWIIKNSWGETWGENG  339


 Score = 43.1 bits (100),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 18/20 (90%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVA  189
            YK+CRGRNICGVDS+VSTVA
Sbjct  341  YKLCRGRNICGVDSLVSTVA  360



>dbj|BAG16515.1| putative cysteine proteinase [Capsicum chinense]
Length=367

 Score = 75.5 bits (184),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +  D GVLLVGYGS+G+APIRLK KPYWIIKNSWGE WGE G
Sbjct  295  KHQDHGVLLVGYGSAGFAPIRLKAKPYWIIKNSWGEHWGEHG  336


 Score = 40.8 bits (94),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 22/25 (88%), Gaps = 1/25 (4%)
 Frame = +1

Query  130  YKICRGR-NICGVDSMVSTVAAVNT  201
            YKICRG+ NICGVD+MVSTV A +T
Sbjct  338  YKICRGQHNICGVDAMVSTVTAAHT  362



>gb|AGS43121.1| cysteine protease 1, partial [Zea mays]
Length=90

 Score = 77.8 bits (190),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG+SG+APIRLK+KPYWIIKNSWGE+WGE G
Sbjct  18   RHLDHGVLLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENG  59


 Score = 38.5 bits (88),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 3/27 (11%)
 Frame = +1

Query  130  YKICRG---RNICGVDSMVSTVAAVNT  201
            YKICRG   RN CGVDSMVSTV+AV+ 
Sbjct  61   YKICRGSNVRNKCGVDSMVSTVSAVHA  87



>gb|AAW21813.1| cysteine protease [Triticum aestivum]
Length=377

 Score = 75.9 bits (185),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG+SG+AP R KEKPYWIIKNSWGE+WG+ G
Sbjct  304  RHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKG  345


 Score = 39.7 bits (91),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 19/26 (73%), Positives = 21/26 (81%), Gaps = 3/26 (12%)
 Frame = +1

Query  130  YKICRG---RNICGVDSMVSTVAAVN  198
            YKICRG   RN CGVDSMVSTV+A +
Sbjct  347  YKICRGSNVRNKCGVDSMVSTVSATH  372



>dbj|BAD10859.1| cysteine protease [Aster tripolium]
Length=363

 Score = 79.0 bits (193),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  5    RLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            ++D GVLLVGYGS+GYAP+R KEKPYWIIKNSWGE WGE G
Sbjct  298  KMDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGEDWGEDG  338


 Score = 36.6 bits (83),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YK+C G N CG+D+MVS V + NT
Sbjct  340  YKLCSGYNACGMDTMVSAVVSTNT  363



>emb|CAQ00101.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=381

 Score = 74.3 bits (181),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  20   VLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            V LVGYGS+GYAP+R KEKPYWIIKNSWGE+WGE G
Sbjct  314  VFLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESG  349


 Score = 40.8 bits (94),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 3/27 (11%)
 Frame = +1

Query  130  YKICRG---RNICGVDSMVSTVAAVNT  201
            YKICRG   +N CGVDSMVSTV A++T
Sbjct  351  YKICRGPHVKNKCGVDSMVSTVTAIHT  377



>ref|XP_009136751.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
Length=368

 Score = 72.8 bits (177),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  11   DFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            D GVLLVG+GS+GYAP+RL+EKPYWIIKNSWG  WGE G
Sbjct  301  DHGVLLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEKG  339


 Score = 42.4 bits (98),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 1/25 (4%)
 Frame = +1

Query  130  YKICRGR-NICGVDSMVSTVAAVNT  201
            YKICRG  NICGVD+MVSTVAAV+T
Sbjct  341  YKICRGTPNICGVDTMVSTVAAVHT  365



>emb|CDX90537.1| BnaA03g42440D [Brassica napus]
Length=366

 Score = 72.8 bits (177),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  11   DFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            D GVLLVG+GS+GYAP+RL+EKPYWIIKNSWG  WGE G
Sbjct  299  DHGVLLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEKG  337


 Score = 42.4 bits (98),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 1/25 (4%)
 Frame = +1

Query  130  YKICRGR-NICGVDSMVSTVAAVNT  201
            YKICRG  NICGVD+MVSTVAAV+T
Sbjct  339  YKICRGTPNICGVDTMVSTVAAVHT  363



>emb|CAH59428.1| cysteine protease 2 [Plantago major]
Length=245

 Score = 72.8 bits (177),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVL+VGYG+ GYAP+RLK KPYWIIKNSWGESWGE G
Sbjct  177  KSLDHGVLIVGYGT-GYAPVRLKNKPYWIIKNSWGESWGESG  217


 Score = 42.4 bits (98),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTS  210
            YKICRGRN+CGV+SMVS+V A +  T+
Sbjct  219  YKICRGRNVCGVESMVSSVTAAHFTTT  245



>ref|XP_002279862.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI19784.3| unnamed protein product [Vitis vinifera]
Length=368

 Score = 72.8 bits (177),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  8    LDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGGATR  136
            LD GVLLVGYGS+GY+PIR KEKPYWI+KNSW + WGE G  R
Sbjct  300  LDHGVLLVGYGSAGYSPIRFKEKPYWILKNSWSKYWGEHGYYR  342


 Score = 41.6 bits (96),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPTS  210
            Y+ICRG+N+CGVDSMVS+V A    TS
Sbjct  341  YRICRGQNMCGVDSMVSSVVAAIQTTS  367



>gb|AEX97108.1| cysteine proteinase, partial [Malus domestica]
Length=128

 Score = 77.0 bits (188),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS+G+APIR KEKPYWIIKNSWG++WGE G
Sbjct  24   RNLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGQNWGENG  65


 Score = 37.4 bits (85),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAA  192
            Y IC+GRNICG +SMVS+VAA
Sbjct  67   YLICKGRNICGSESMVSSVAA  87



>gb|AAB16997.1| thiol protease isoform A, partial [Glycine max]
Length=318

 Score = 72.4 bits (176),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEG  124
            + LD GVLLVGYG   YAPIR K KPYWIIKNSWGESWGE 
Sbjct  248  KHLDHGVLLVGYGEGRYAPIRFKNKPYWIIKNSWGESWGEN  288


 Score = 42.0 bits (97),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = +1

Query  133  KICRGRNICGVDSMVSTVAAV  195
            +ICRGRN+CGVD+MVSTVAA+
Sbjct  293  EICRGRNVCGVDAMVSTVAAI  313



>gb|ABK21238.1| unknown [Picea sitchensis]
 gb|ABR16087.1| unknown [Picea sitchensis]
 gb|ABR17330.1| unknown [Picea sitchensis]
 gb|ABR17545.1| unknown [Picea sitchensis]
 gb|ACN40765.1| unknown [Picea sitchensis]
Length=366

 Score = 72.8 bits (177),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG++ +APIR+K+KPYW+IKNSWG +WGE G
Sbjct  302  RNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENG  343


 Score = 40.8 bits (94),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAV  195
            YK+CRG N+CG+++MVSTVAA+
Sbjct  345  YKLCRGHNVCGINNMVSTVAAI  366



>gb|ABK24688.1| unknown [Picea sitchensis]
 gb|ACN39791.1| unknown [Picea sitchensis]
 gb|ACN40241.1| unknown [Picea sitchensis]
Length=366

 Score = 72.8 bits (177),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG++ +APIR+K+KPYW+IKNSWG +WGE G
Sbjct  302  RNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENG  343


 Score = 40.8 bits (94),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAV  195
            YK+CRG N+CG+++MVSTVAA+
Sbjct  345  YKLCRGHNVCGINNMVSTVAAI  366



>gb|ACN40679.1| unknown [Picea sitchensis]
Length=366

 Score = 72.8 bits (177),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG++ +APIR+K+KPYW+IKNSWG +WGE G
Sbjct  302  RNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENG  343


 Score = 40.8 bits (94),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAV  195
            YK+CRG N+CG+++MVSTVAA+
Sbjct  345  YKLCRGHNVCGINNMVSTVAAI  366



>gb|AES89347.2| papain family cysteine protease [Medicago truncatula]
Length=327

 Score = 62.4 bits (150),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 4/42 (10%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS  Y     KEKPYWI+K+SWGE+WGE G
Sbjct  262  RRLDHGVLLVGYGSGAYT----KEKPYWIVKSSWGETWGENG  299


 Score = 50.4 bits (119),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRGRNICGVDSMVSTVAA  T T
Sbjct  301  YKICRGRNICGVDSMVSTVAAAQTTT  326



>ref|XP_003607150.1| Cysteine proteinase [Medicago truncatula]
Length=326

 Score = 62.4 bits (150),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 4/42 (10%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGS  Y     KEKPYWI+K+SWGE+WGE G
Sbjct  261  RRLDHGVLLVGYGSGAYT----KEKPYWIVKSSWGETWGENG  298


 Score = 50.8 bits (120),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTPT  207
            YKICRGRNICGVDSMVSTVAA  T T
Sbjct  300  YKICRGRNICGVDSMVSTVAAAQTTT  325



>gb|EMT10192.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=369

 Score = 74.3 bits (181),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG+SG+AP R KEKPYWIIKNSWGE+WG+ G
Sbjct  296  RHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKG  337


 Score = 38.5 bits (88),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 3/27 (11%)
 Frame = +1

Query  130  YKICRG---RNICGVDSMVSTVAAVNT  201
            YKICRG   RN CGVDSMVSTV+A + 
Sbjct  339  YKICRGSNVRNKCGVDSMVSTVSATHA  365



>gb|EMS64962.1| Cysteine proteinase 1 [Triticum urartu]
Length=302

 Score = 74.7 bits (182),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYG+SG+AP R KEKPYWIIKNSWGE+WG+ G
Sbjct  229  RHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKG  270


 Score = 38.1 bits (87),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 3/27 (11%)
 Frame = +1

Query  130  YKICRG---RNICGVDSMVSTVAAVNT  201
            YKICRG   RN CGVDSMVSTV+A + 
Sbjct  272  YKICRGSNVRNKCGVDSMVSTVSATHA  298



>ref|XP_009786000.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana sylvestris]
Length=370

 Score = 73.6 bits (179),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            ++LD GVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE G
Sbjct  302  KKLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGENG  342


 Score = 37.0 bits (84),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSM  174
            YKICRGRN+CGVDSM
Sbjct  344  YKICRGRNVCGVDSM  358



>ref|XP_010690815.1| PREDICTED: cysteine proteinase RD19a [Beta vulgaris subsp. vulgaris]
Length=403

 Score = 73.9 bits (180),  Expect(2) = 7e-16, Method: Composition-based stats.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  8    LDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGGATR  136
            L+ GVLLVGYGS+GY+ +R +EKPYWIIKNSWGE WGE G  R
Sbjct  339  LEHGVLLVGYGSAGYSDMRKEEKPYWIIKNSWGEYWGENGYYR  381


 Score = 36.2 bits (82),  Expect(2) = 7e-16, Method: Composition-based stats.
 Identities = 14/25 (56%), Positives = 22/25 (88%), Gaps = 2/25 (8%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNTP  204
            Y++CRG ++CGV+++VSTVA  +TP
Sbjct  380  YRLCRGYDLCGVNTLVSTVA--DTP  402



>gb|ABO93617.1| papain-like cysteine proteinase [Vitis vinifera]
Length=161

 Score = 79.7 bits (195),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGGATRSA  142
            + LD GV+LVGYGS+GYAPIR KEKPYWIIKNSWGESWGE G  ++ 
Sbjct  113  RNLDHGVVLVGYGSAGYAPIRFKEKPYWIIKNSWGESWGEDGYDKNC  159



>gb|ADY04293.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04297.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 79.3 bits (194),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGSSGY+P+RLKEKPYWIIKNSWG+ WGE G
Sbjct  91   KRLDHGVLLVGYGSSGYSPVRLKEKPYWIIKNSWGDKWGEEG  132



>gb|ADY04490.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04492.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04494.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04495.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04496.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04497.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04498.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04499.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04500.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=138

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGSSGY+P+R+KEKPYWIIKNSWG+ WGE G
Sbjct  91   KRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEG  132



>ref|XP_002969223.1| hypothetical protein SELMODRAFT_91274 [Selaginella moellendorffii]
 gb|EFJ29311.1| hypothetical protein SELMODRAFT_91274 [Selaginella moellendorffii]
Length=367

 Score = 73.6 bits (179),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
              +D GVLLVGYG+ GYAPIR  EKPYWIIKNSWG +WGE G
Sbjct  305  HHIDHGVLLVGYGAKGYAPIRFTEKPYWIIKNSWGATWGEQG  346


 Score = 35.8 bits (81),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 18/20 (90%), Gaps = 0/20 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVA  189
            YKICRG  +CG+++MVSTVA
Sbjct  348  YKICRGHGMCGMNTMVSTVA  367



>gb|ADY04414.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGSSGY+P+R+KEKPYWIIKNSWG+ WGE G
Sbjct  91   KRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEG  132



>gb|ADY04361.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGSSGY+P+R+KEKPYWIIKNSWG+ WGE G
Sbjct  91   KRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEG  132



>ref|XP_002960585.1| hypothetical protein SELMODRAFT_266583 [Selaginella moellendorffii]
 gb|EFJ38124.1| hypothetical protein SELMODRAFT_266583 [Selaginella moellendorffii]
Length=330

 Score = 73.6 bits (179),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
              +D GVLLVGYG+ GYAPIR  EKPYWIIKNSWG +WGE G
Sbjct  268  HHIDHGVLLVGYGAKGYAPIRFTEKPYWIIKNSWGATWGEQG  309


 Score = 35.4 bits (80),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 18/20 (90%), Gaps = 0/20 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVA  189
            YKICRG  +CG+++MVSTVA
Sbjct  311  YKICRGHGMCGMNTMVSTVA  330



>gb|ADY04342.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGSSGY+P+R+KEKPYWIIKNSWG+ WGE G
Sbjct  91   KRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEG  132



>gb|ADY04336.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04343.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGSSGY+P+R+KEKPYWIIKNSWG+ WGE G
Sbjct  91   KRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEG  132



>gb|ADY04262.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04263.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04264.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04265.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04266.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04267.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04269.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04270.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04271.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04272.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04273.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04274.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04275.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04276.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04277.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04278.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04279.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04280.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04281.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04282.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04283.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04284.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04285.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04286.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04287.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04288.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04289.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04290.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04291.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04292.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04294.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04296.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04298.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04299.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04300.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04301.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04302.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04303.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04304.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04305.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04306.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04307.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04308.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04309.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04310.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04311.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04312.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04313.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04314.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04315.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04316.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04317.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04318.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04319.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04320.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04321.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04322.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04323.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04324.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04325.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04326.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04327.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04328.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04329.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04330.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04331.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04332.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04333.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04334.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04335.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04337.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04338.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04339.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04340.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04341.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04344.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04345.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04346.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04347.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04348.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04349.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04350.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04351.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04352.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04353.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04354.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04355.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04356.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04357.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04360.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04362.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04363.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04364.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04365.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04366.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04367.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04369.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04370.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04371.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04372.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04373.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04374.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04377.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04378.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04379.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04380.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04381.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04382.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04383.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04384.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04385.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04386.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04387.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04388.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04389.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04391.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04392.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04393.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04394.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04395.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04396.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04397.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04398.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04399.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04400.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04401.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04402.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04403.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04404.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04405.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04406.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04407.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04408.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04409.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04410.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04411.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04412.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04413.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04415.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04416.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04417.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04418.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04419.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04420.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04421.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04422.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04423.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04424.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04425.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04426.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04427.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04428.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04429.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04430.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04431.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04432.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04433.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04434.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04435.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04436.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04437.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04438.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04439.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04440.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04441.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04442.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04443.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04444.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04445.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04446.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04447.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04448.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04449.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04450.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04451.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04452.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04453.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04454.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04455.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04456.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04458.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04459.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04460.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04461.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04462.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04463.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04464.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04465.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04466.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04467.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04468.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04469.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04470.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04471.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04472.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04473.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04474.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04475.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04476.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04478.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04481.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04483.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04484.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04485.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04486.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04487.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04488.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04489.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04491.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04493.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04501.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04502.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04503.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04504.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04505.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04506.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04507.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04508.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04509.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04510.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04511.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04512.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04513.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04514.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04515.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04516.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04517.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04518.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGSSGY+P+R+KEKPYWIIKNSWG+ WGE G
Sbjct  91   KRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEG  132



>gb|ADY04457.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGSSGY+P+R+KEKPYWIIKNSWG+ WGE G
Sbjct  91   KRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEG  132



>dbj|BAC57957.1| thiol protease [Aster tripolium]
Length=188

 Score = 74.3 bits (181),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            + LD GVLLVGYGS+GYAP RLKEKPYWIIKNSWG  WGE G
Sbjct  122  KPLDHGVLLVGYGSAGYAPSRLKEKPYWIIKNSWGPDWGEDG  163


 Score = 34.7 bits (78),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMVSTVAAVNT  201
            YKIC G N+CG+D+MVS V + + 
Sbjct  165  YKICSGHNLCGMDTMVSAVVSTSA  188



>gb|AAB53103.1| cysteine protease, partial [Brassica napus]
Length=85

 Score = 76.6 bits (187),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RL+ GVLLVGYGS+GYAP R KEKPYWIIKNSWGE+WGE G
Sbjct  27   RRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENG  68


 Score = 32.3 bits (72),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +1

Query  130  YKICRGRNICGVDSMV  177
            YKICRGRN+CGVD  V
Sbjct  70   YKICRGRNVCGVDMSV  85



>gb|ADY04359.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    QRLDFGVLLVGYGSSGYAPIRLKEKPYWIIKNSWGESWGEGG  127
            +RLD GVLLVGYGSSGY+P+R+KEKPYWIIKNSWG+ WGE G
Sbjct  91   KRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDRWGEEG  132



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555214126005