BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP009H11 207 bp,:Filtered

Length=207
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KCW56191.1|  hypothetical protein EUGRSUZ_I01938                     106   2e-27   Eucalyptus grandis [rose gum]
ref|XP_004135180.1|  PREDICTED: 40S ribosomal protein S9-2-like         107   4e-27   Cucumis sativus [cucumbers]
ref|XP_002323418.1|  hypothetical protein POPTR_0016s07730g             107   4e-27   Populus trichocarpa [western balsam poplar]
gb|EYU22431.1|  hypothetical protein MIMGU_mgv1a014214mg                107   5e-27   Erythranthe guttata [common monkey flower]
gb|EYU34659.1|  hypothetical protein MIMGU_mgv1a014209mg                107   5e-27   Erythranthe guttata [common monkey flower]
ref|XP_010091216.1|  40S ribosomal protein S9-2                         107   6e-27   Morus notabilis
gb|KCW56188.1|  hypothetical protein EUGRSUZ_I01938                     106   6e-27   Eucalyptus grandis [rose gum]
gb|EYU28732.1|  hypothetical protein MIMGU_mgv1a014218mg                107   6e-27   Erythranthe guttata [common monkey flower]
ref|XP_009604777.1|  PREDICTED: 40S ribosomal protein S9-2-like         107   7e-27   Nicotiana tomentosiformis
ref|XP_002522398.1|  40S ribosomal protein S9, putative                 107   8e-27   Ricinus communis
gb|AAP44415.1|  40S ribosomal protein S9                                105   8e-27   Lactuca sativa [cultivated lettuce]
gb|AAP44421.1|  40S ribosomal protein S9                                105   9e-27   Lactuca saligna
gb|KHG14915.1|  40S ribosomal S9-2 -like protein                        105   9e-27   Gossypium arboreum [tree cotton]
ref|XP_011075483.1|  PREDICTED: 40S ribosomal protein S9-2              107   1e-26   Sesamum indicum [beniseed]
ref|XP_010029297.1|  PREDICTED: 40S ribosomal protein S9-2              106   1e-26   Eucalyptus grandis [rose gum]
ref|XP_009798560.1|  PREDICTED: 40S ribosomal protein S9-2-like         106   1e-26   Nicotiana sylvestris
ref|XP_002517490.1|  40S ribosomal protein S9, putative                 106   1e-26   Ricinus communis
gb|KDP31233.1|  hypothetical protein JCGZ_11609                         106   1e-26   Jatropha curcas
ref|XP_006381973.1|  hypothetical protein POPTR_0006s22640g             106   1e-26   Populus trichocarpa [western balsam poplar]
gb|KDP41175.1|  hypothetical protein JCGZ_15582                         106   1e-26   Jatropha curcas
ref|XP_011004201.1|  PREDICTED: 40S ribosomal protein S9-2-like i...    106   1e-26   Populus euphratica
gb|KHG14681.1|  40S ribosomal S9-2 -like protein                        106   1e-26   Gossypium arboreum [tree cotton]
ref|XP_002324730.1|  hypothetical protein POPTR_0018s07520g             106   1e-26   Populus trichocarpa [western balsam poplar]
ref|XP_011004703.1|  PREDICTED: 40S ribosomal protein S9-2-like         106   1e-26   Populus euphratica
gb|KHG14244.1|  40S ribosomal S9-2 -like protein                        106   1e-26   Gossypium arboreum [tree cotton]
ref|XP_009627396.1|  PREDICTED: 40S ribosomal protein S9-2              106   1e-26   Nicotiana tomentosiformis
gb|KJB74899.1|  hypothetical protein B456_012G055000                    106   2e-26   Gossypium raimondii
gb|KJB70960.1|  hypothetical protein B456_011G097500                    106   2e-26   Gossypium raimondii
gb|KJB33600.1|  hypothetical protein B456_006G020700                    106   2e-26   Gossypium raimondii
gb|KHG16530.1|  40S ribosomal S9-2 -like protein                        106   2e-26   Gossypium arboreum [tree cotton]
ref|XP_002511557.1|  40S ribosomal protein S9, putative                 106   2e-26   Ricinus communis
gb|KJB11057.1|  hypothetical protein B456_001G238700                    106   2e-26   Gossypium raimondii
ref|XP_010683223.1|  PREDICTED: 40S ribosomal protein S9-2              106   2e-26   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_011004198.1|  PREDICTED: 40S ribosomal protein S9-2 isofor...    106   2e-26   Populus euphratica
gb|KDP41176.1|  hypothetical protein JCGZ_15583                         106   2e-26   Jatropha curcas
gb|ABQ32300.1|  putative 40S ribosomal protein S9                       105   2e-26   Artemisia annua [sweet Annie]
ref|XP_009778292.1|  PREDICTED: 40S ribosomal protein S9-2              105   2e-26   Nicotiana sylvestris
ref|XP_009779308.1|  PREDICTED: 40S ribosomal protein S9-2-like         105   2e-26   Nicotiana sylvestris
ref|XP_007032505.1|  Ribosomal protein S4                               105   2e-26   Theobroma cacao [chocolate]
gb|KIZ06357.1|  40S ribosomal protein S9-2                              105   3e-26   Monoraphidium neglectum
ref|XP_010242426.1|  PREDICTED: 40S ribosomal protein S9-2              105   3e-26   Nelumbo nucifera [Indian lotus]
ref|XP_007037295.1|  Ribosomal protein S4                               105   3e-26   Theobroma cacao [chocolate]
gb|KHG06711.1|  40S ribosomal S9-2 -like protein                        106   4e-26   Gossypium arboreum [tree cotton]
ref|XP_010092050.1|  40S ribosomal protein S9-2                         107   4e-26   Morus notabilis
gb|KCW56189.1|  hypothetical protein EUGRSUZ_I01938                     104   4e-26   Eucalyptus grandis [rose gum]
ref|XP_010695717.1|  PREDICTED: 40S ribosomal protein S9-2-like         105   4e-26   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|ABR17162.1|  unknown                                                 105   5e-26   Picea sitchensis
ref|XP_002958222.1|  component of cytosolic 80S ribosome and 40S ...    104   5e-26   Volvox carteri f. nagariensis
gb|ADB77797.1|  40S ribosomal protein S9                                104   5e-26   Chlamydomonas reinhardtii
ref|NP_001274868.1|  40S ribosomal protein S9-2-like                    105   5e-26   Solanum tuberosum [potatoes]
gb|ABK21901.1|  unknown                                                 105   5e-26   Picea sitchensis
ref|XP_009598709.1|  PREDICTED: 40S ribosomal protein S9-2-like         104   6e-26   Nicotiana tomentosiformis
ref|XP_001702303.1|  ribosomal protein S9, component of cytosolic...    104   7e-26   Chlamydomonas reinhardtii
ref|XP_010554004.1|  PREDICTED: 40S ribosomal protein S9-2              104   7e-26   Tarenaya hassleriana [spider flower]
ref|XP_006405589.1|  hypothetical protein EUTSA_v10027944mg             104   7e-26   Eutrema salsugineum
ref|XP_010917021.1|  PREDICTED: 40S ribosomal protein S9-2              104   7e-26   Elaeis guineensis
gb|AFK46709.1|  unknown                                                 104   7e-26   Lotus japonicus
ref|NP_001275235.1|  uncharacterized protein LOC102577830               104   8e-26   Solanum tuberosum [potatoes]
gb|AFK35307.1|  unknown                                                 101   8e-26   Lotus japonicus
ref|XP_004499428.1|  PREDICTED: 40S ribosomal protein S9-2-like         104   8e-26   Cicer arietinum [garbanzo]
ref|XP_004238784.1|  PREDICTED: 40S ribosomal protein S9-2              104   8e-26   Solanum lycopersicum
ref|XP_004228395.1|  PREDICTED: 40S ribosomal protein S9-2              104   8e-26   Solanum lycopersicum
ref|XP_006367430.1|  PREDICTED: 40S ribosomal protein S9-2-like i...    104   8e-26   Solanum tuberosum [potatoes]
ref|XP_006367431.1|  PREDICTED: 40S ribosomal protein S9-2-like i...    104   8e-26   Solanum tuberosum [potatoes]
emb|CAG47084.1|  40S ribosomal protein S9                               104   9e-26   Catharanthus roseus [chatas]
ref|NP_001238740.1|  uncharacterized protein LOC100305663               104   9e-26   Glycine max [soybeans]
ref|XP_010256989.1|  PREDICTED: 40S ribosomal protein S9-2-like         104   1e-25   Nelumbo nucifera [Indian lotus]
ref|XP_005708491.1|  40S ribosomal protein S9e                          104   1e-25   Galdieria sulphuraria
ref|XP_007155321.1|  hypothetical protein PHAVU_003G191200g             104   1e-25   Phaseolus vulgaris [French bean]
gb|KFK33188.1|  hypothetical protein AALP_AA6G341500                    104   1e-25   Arabis alpina [alpine rockcress]
ref|XP_003549666.1|  PREDICTED: 40S ribosomal protein S9-2-like         104   1e-25   Glycine max [soybeans]
ref|XP_008341561.1|  PREDICTED: 40S ribosomal protein S9-2              104   1e-25   Malus domestica [apple tree]
ref|XP_007138197.1|  hypothetical protein PHAVU_009G188600g             104   1e-25   Phaseolus vulgaris [French bean]
ref|XP_009600364.1|  PREDICTED: 40S ribosomal protein S9-2-like         104   1e-25   Nicotiana tomentosiformis
ref|XP_004508755.1|  PREDICTED: 40S ribosomal protein S9-2-like         103   1e-25   Cicer arietinum [garbanzo]
ref|XP_002283256.1|  PREDICTED: 40S ribosomal protein S9-2              103   1e-25   Vitis vinifera
gb|AEC11023.1|  40S ribosomal protein s9                                102   1e-25   Camellia sinensis [black tea]
emb|CCA67900.1|  probable 40S ribosomal protein S9                      103   1e-25   Serendipita indica DSM 11827
ref|XP_010037164.1|  PREDICTED: 40S ribosomal protein S9-2-like         103   1e-25   Eucalyptus grandis [rose gum]
ref|XP_006282728.1|  hypothetical protein CARUB_v10005777mg             103   1e-25   Capsella rubella
ref|XP_011085760.1|  PREDICTED: 40S ribosomal protein S9-2-like         103   1e-25   Sesamum indicum [beniseed]
ref|XP_009389620.1|  PREDICTED: 40S ribosomal protein S9-2-like         103   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP00311.1|  unnamed protein product                                103   1e-25   Coffea canephora [robusta coffee]
ref|XP_009414866.1|  PREDICTED: 40S ribosomal protein S9-2              103   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403622.1|  PREDICTED: 40S ribosomal protein S9-2-like         103   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN30826.1|  40S ribosomal protein S9-2                              103   1e-25   Glycine soja [wild soybean]
ref|XP_010435836.1|  PREDICTED: 40S ribosomal protein S9-2              103   2e-25   Camelina sativa [gold-of-pleasure]
ref|NP_198801.1|  40S ribosomal protein S9-2                            103   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870751.1|  40S ribosomal protein S9                           103   2e-25   Arabidopsis lyrata subsp. lyrata
ref|NP_001276185.1|  40S ribosomal protein S9-2-like                    103   2e-25   Glycine max [soybeans]
ref|XP_008784330.1|  PREDICTED: 40S ribosomal protein S9                101   2e-25   Phoenix dactylifera
ref|XP_003623232.1|  40S ribosomal protein S9                           103   2e-25   Medicago truncatula
ref|XP_010029477.1|  PREDICTED: 40S ribosomal protein S9-2              103   2e-25   Eucalyptus grandis [rose gum]
ref|XP_006827176.1|  hypothetical protein AMTR_s00010p00256040          104   2e-25   
ref|XP_003598026.1|  40S ribosomal protein S9                           103   2e-25   Medicago truncatula
gb|AFK40975.1|  unknown                                                 103   2e-25   Medicago truncatula
emb|CDP02222.1|  unnamed protein product                                103   2e-25   Coffea canephora [robusta coffee]
ref|XP_011098613.1|  PREDICTED: 40S ribosomal protein S9-2              103   2e-25   Sesamum indicum [beniseed]
ref|XP_006438664.1|  hypothetical protein CICLE_v10033755mg             102   2e-25   Citrus clementina
ref|XP_008379343.1|  PREDICTED: 40S ribosomal protein S9-2              103   2e-25   Malus domestica [apple tree]
ref|XP_007215987.1|  hypothetical protein PRUPE_ppa011733mg             103   2e-25   Prunus persica
ref|XP_005849917.1|  hypothetical protein CHLNCDRAFT_56085              103   2e-25   Chlorella variabilis
ref|XP_003637511.1|  40S ribosomal protein S9                           103   3e-25   
ref|XP_005715372.1|  40S ribosomal protein S9                           103   3e-25   Chondrus crispus [Irish moss]
ref|XP_008808061.1|  PREDICTED: 40S ribosomal protein S9-2-like         102   3e-25   Phoenix dactylifera
sp|P49214.1|RS9_TOBAC  RecName: Full=40S ribosomal protein S9; Al...  99.8    3e-25   Nicotiana tabacum [American tobacco]
ref|XP_011399104.1|  40S ribosomal protein S9-1                         102   3e-25   Auxenochlorella protothecoides
ref|XP_009124855.1|  PREDICTED: 40S ribosomal protein S9-2              103   3e-25   Brassica rapa
gb|EPS73776.1|  hypothetical protein M569_00980                         103   3e-25   Genlisea aurea
emb|CDX74423.1|  BnaA04g09660D                                          103   3e-25   Brassica napus [oilseed rape]
ref|XP_010937076.1|  PREDICTED: 40S ribosomal protein S9-2-like         102   4e-25   Elaeis guineensis
ref|XP_006438663.1|  hypothetical protein CICLE_v10032800mg             102   4e-25   Citrus clementina
emb|CDS04034.1|  Putative 40S ribosomal protein S9                      102   5e-25   Lichtheimia ramosa
gb|EKC97706.1|  40S ribosomal protein S9-A                              102   5e-25   Trichosporon asahii var. asahii CBS 8904
ref|XP_003026421.1|  40S ribosomal protein S9                           102   5e-25   Schizophyllum commune H4-8
gb|KDD75683.1|  hypothetical protein H632_c551p0                        102   5e-25   Helicosporidium sp. ATCC 50920
gb|KIM31691.1|  hypothetical protein M408DRAFT_236801                   102   5e-25   Serendipita vermifera MAFF 305830
ref|XP_006400037.1|  hypothetical protein EUTSA_v10014722mg             102   6e-25   Eutrema salsugineum
ref|XP_005648482.1|  ribosomal protein S9 component of cytosolic ...    102   6e-25   Coccomyxa subellipsoidea C-169
ref|XP_006288701.1|  hypothetical protein CARUB_v10002009mg             102   6e-25   Capsella rubella
ref|XP_009131450.1|  PREDICTED: 40S ribosomal protein S9-1              102   6e-25   Brassica rapa
emb|CAB64903.1|  40S ribosomal protein S9                             99.8    6e-25   Cyanophora paradoxa
ref|XP_003576178.1|  PREDICTED: 40S ribosomal protein S9-2-like         102   6e-25   Brachypodium distachyon [annual false brome]
emb|CDY30273.1|  BnaC04g31840D                                          107   6e-25   Brassica napus [oilseed rape]
ref|XP_002317362.1|  hypothetical protein POPTR_0011s09670g             102   6e-25   Populus trichocarpa [western balsam poplar]
ref|XP_006380606.1|  hypothetical protein POPTR_0007s09750g             102   7e-25   Populus trichocarpa [western balsam poplar]
gb|EXX79183.1|  ribosomal 40S subunit protein S9A                       100   8e-25   Rhizophagus irregularis DAOM 197198w
gb|ACF79847.1|  unknown                                               99.8    8e-25   Zea mays [maize]
emb|CEI90627.1|  Putative 40S ribosomal protein S9                      101   9e-25   Rhizopus microsporus
gb|EGD95527.1|  ribosomal protein S9                                    101   9e-25   Trichophyton tonsurans CBS 112818
gb|EXX79184.1|  ribosomal 40S subunit protein S9A                       101   9e-25   Rhizophagus irregularis DAOM 197198w
ref|XP_003237660.1|  40S ribosomal protein S9                           101   9e-25   Trichophyton rubrum CBS 118892
ref|XP_003577383.1|  PREDICTED: 40S ribosomal protein S9-2-like         101   1e-24   Brachypodium distachyon [annual false brome]
gb|ACU15321.1|  unknown                                                 102   1e-24   Glycine max [soybeans]
ref|XP_010420178.1|  PREDICTED: 40S ribosomal protein S9-1              101   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010939529.1|  PREDICTED: 40S ribosomal protein S9-2-like         101   1e-24   Elaeis guineensis
ref|XP_002873713.1|  40S ribosomal protein S9                           101   1e-24   Arabidopsis lyrata subsp. lyrata
ref|NP_197024.1|  40S ribosomal protein S9-1                            101   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001824638.1|  40S ribosomal protein S9                           101   1e-24   Aspergillus oryzae RIB40
gb|ESA03224.1|  hypothetical protein GLOINDRAFT_243564                  101   1e-24   Rhizophagus irregularis DAOM 181602
gb|KDQ62955.1|  hypothetical protein JAAARDRAFT_28926                   101   1e-24   Jaapia argillacea MUCL 33604
ref|XP_001945527.1|  PREDICTED: 40S ribosomal protein S9                101   1e-24   Acyrthosiphon pisum
gb|KHN77380.1|  40S ribosomal protein S9                                102   1e-24   Toxocara canis
ref|XP_007860645.1|  ribosomal protein S4                               101   1e-24   Gloeophyllum trabeum ATCC 11539
ref|XP_008780681.1|  PREDICTED: 40S ribosomal protein S9-2              101   1e-24   Phoenix dactylifera
gb|ABR25839.1|  40S ribosomal protein S9                              99.4    1e-24   Oryza sativa Indica Group [Indian rice]
gb|EXX62810.1|  ribosomal 40S subunit protein S9A                       101   1e-24   Rhizophagus irregularis DAOM 197198w
gb|EYE96132.1|  ribosomal protein S4                                  99.8    2e-24   Aspergillus ruber CBS 135680
ref|XP_001754369.1|  predicted protein                                  101   2e-24   Physcomitrella patens
ref|XP_001767226.1|  predicted protein                                  101   2e-24   Physcomitrella patens
ref|XP_001777561.1|  predicted protein                                  101   2e-24   Physcomitrella patens
gb|EAY81474.1|  hypothetical protein OsI_36648                        97.8    2e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_001270715.1|  40S ribosomal protein S9                           100   2e-24   Aspergillus clavatus NRRL 1
ref|XP_009540632.1|  hypothetical protein HETIRDRAFT_456594             100   2e-24   Heterobasidion irregulare TC 32-1
ref|XP_009383889.1|  PREDICTED: 40S ribosomal protein S9-2-like         101   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
gb|KIY62147.1|  ribosomal protein S4                                    100   2e-24   Cylindrobasidium torrendii FP15055 ss-10
ref|XP_001829481.1|  40S ribosomal protein S9                           100   2e-24   Coprinopsis cinerea okayama7#130
ref|XP_011180539.1|  PREDICTED: 40S ribosomal protein S9                100   2e-24   Bactrocera cucurbitae [melon fruit fly]
ref|NP_001176641.1|  Os11g0602501                                     98.2    2e-24   
ref|XP_004518997.1|  PREDICTED: 40S ribosomal protein S9-like           100   2e-24   Ceratitis capitata
ref|XP_007002505.1|  40S ribosomal protein S9                           100   2e-24   Tremella mesenterica DSM 1558
emb|CDO74409.1|  hypothetical protein BN946_scf184867.g7                100   2e-24   Trametes cinnabarina
ref|XP_007379209.1|  40S ribosomal protein S9                           100   2e-24   Punctularia strigosozonata HHB-11173 SS5
gb|KIY51995.1|  ribosomal protein S4                                    100   2e-24   Fistulina hepatica ATCC 64428
gb|EMD42348.1|  40S ribosomal protein S9                                100   2e-24   Gelatoporia subvermispora B
ref|XP_006964217.1|  ribosomal protein S9, S4 family                    100   2e-24   Trichoderma reesei QM6a
ref|XP_007265130.1|  40S ribosomal protein S9                           100   2e-24   Fomitiporia mediterranea MF3/22
ref|XP_007853601.1|  40s ribosomal protein s9                           100   2e-24   Moniliophthora roreri MCA 2997
ref|XP_662407.1|  RS9_PODAN 40S ribosomal protein S9 (S7)               100   2e-24   Aspergillus nidulans FGSC A4
gb|KIO07111.1|  hypothetical protein M404DRAFT_998525                   100   2e-24   Pisolithus tinctorius Marx 270
ref|XP_008032443.1|  40S ribosomal protein S9                           100   2e-24   Trametes versicolor FP-101664 SS1
ref|XP_002540920.1|  40S ribosomal protein S9                           100   2e-24   Uncinocarpus reesii 1704
ref|XP_003056784.1|  predicted protein                                  100   2e-24   Micromonas pusilla CCMP1545
dbj|BAA78592.1|  40S ribosomal protein S9                               100   2e-24   Chlamydomonas sp. HS-5
ref|XP_007307288.1|  40S ribosomal protein S9                           100   2e-24   Stereum hirsutum FP-91666 SS1
ref|XP_003172904.1|  40S ribosomal protein S9                           100   2e-24   Microsporum gypseum CBS 118893
ref|XP_002842953.1|  40S ribosomal protein S9                           100   2e-24   Arthroderma otae CBS 113480
gb|AEE62422.1|  unknown                                                 100   2e-24   Dendroctonus ponderosae
gb|KIM62296.1|  hypothetical protein SCLCIDRAFT_1215157                 100   2e-24   Scleroderma citrinum Foug A
gb|KDQ31494.1|  hypothetical protein PLEOSDRAFT_1054562                 100   2e-24   Pleurotus ostreatus PC15
ref|XP_004304310.1|  PREDICTED: 40S ribosomal protein S9-2              100   3e-24   Fragaria vesca subsp. vesca
gb|EJW71676.1|  30S ribosomal protein S4                              98.2    3e-24   Wuchereria bancrofti [agent of lymphatic filariasis]
gb|KIK29928.1|  hypothetical protein PISMIDRAFT_671906                  100   3e-24   Pisolithus microcarpus 441
ref|NP_001131442.1|  uncharacterized protein LOC100192774               100   3e-24   Zea mays [maize]
emb|CAH04322.1|  S9e ribosomal protein                                  100   3e-24   Meladema coriacea
gb|KDR85862.1|  hypothetical protein GALMADRAFT_132501                  100   3e-24   Galerina marginata CBS 339.88
dbj|BAN20249.1|  ribosomal protein S9                                   100   3e-24   Riptortus pedestris
ref|XP_007391198.1|  hypothetical protein PHACADRAFT_248675             100   3e-24   Phanerochaete carnosa HHB-10118-sp
ref|XP_011497696.1|  PREDICTED: 40S ribosomal protein S9                100   3e-24   Ceratosolen solmsi marchali
ref|XP_004962962.1|  PREDICTED: 40S ribosomal protein S9-2-like         100   3e-24   Setaria italica
gb|ABG01900.1|  S9 ribosomal protein                                    100   3e-24   Gryllus rubens
gb|EPS99409.1|  hypothetical protein FOMPIDRAFT_1024265                 100   3e-24   Fomitopsis pinicola FP-58527 SS1
ref|XP_002471051.1|  ribosomal protein S9                               100   3e-24   Postia placenta Mad-698-R
emb|CAJ17220.1|  ribosomal protein S9e                                  100   3e-24   Sphaerius sp. APV-2005
gb|KIK68304.1|  hypothetical protein GYMLUDRAFT_35690                   100   3e-24   Gymnopus luxurians FD-317 M1
ref|XP_002629546.1|  40S ribosomal protein S9                           100   3e-24   Blastomyces gilchristii SLH14081
gb|ABG01896.1|  S9 ribosomal protein                                    100   3e-24   Gryllus firmus
ref|XP_003014786.1|  hypothetical protein ARB_07347                     101   3e-24   Arthroderma benhamiae CBS 112371
gb|AAT08735.1|  40S ribosomal protein S9                                100   3e-24   Hyacinthus orientalis [common hyacinth]
emb|CEG76087.1|  Putative 40S ribosomal protein S9                    97.8    3e-24   Rhizopus microsporus
ref|XP_002442158.1|  hypothetical protein SORBIDRAFT_08g015270          100   3e-24   Sorghum bicolor [broomcorn]
pdb|3J60|J  Chain J, Localization Of The Small Subunit Ribosomal ...    100   3e-24   Triticum aestivum [Canadian hard winter wheat]
ref|XP_001419792.1|  Ribosomal protein S9, component of cytosolic...    100   3e-24   Ostreococcus lucimarinus CCE9901
emb|CEF99084.1|  Ribosomal protein S4/S9, eukaryotic/archaeal           100   3e-24   Ostreococcus tauri
gb|AAX62465.1|  ribosomal protein S9                                    100   3e-24   Lysiphlebus testaceipes
ref|XP_005181976.1|  PREDICTED: 40S ribosomal protein S9                100   3e-24   Musca domestica
ref|XP_003025614.1|  hypothetical protein TRV_00254                     101   3e-24   Trichophyton verrucosum HKI 0517
gb|KDR16262.1|  40S ribosomal protein S9                                100   3e-24   Zootermopsis nevadensis
ref|XP_003194223.1|  40S ribosomal protein S9-A                         100   3e-24   Cryptococcus gattii WM276
ref|XP_967635.1|  PREDICTED: 40S ribosomal protein S9                   100   3e-24   Tribolium castaneum [rust-red flour beetle]
ref|XP_002007973.1|  GI12083                                            100   4e-24   Drosophila mojavensis
ref|XP_001400515.1|  40S ribosomal protein S9                           100   4e-24   Aspergillus niger CBS 513.88
ref|XP_001263755.1|  40S ribosomal protein S9                           100   4e-24   Aspergillus fischeri NRRL 181
ref|XP_001217311.1|  40S ribosomal protein S9                           100   4e-24   Aspergillus terreus NIH2624
ref|XP_006671722.1|  40S ribosomal protein S9 (S7)                      100   4e-24   Cordyceps militaris CM01
ref|XP_001984182.1|  GH15146                                            100   4e-24   Drosophila grimshawi
gb|KIK37123.1|  hypothetical protein CY34DRAFT_810663                   100   4e-24   Suillus luteus UH-Slu-Lm8-n1
ref|XP_003400837.1|  PREDICTED: 40S ribosomal protein S9-like           100   4e-24   
ref|XP_001754496.1|  predicted protein                                  100   4e-24   Physcomitrella patens
ref|XP_002047289.1|  GJ13353                                            100   4e-24   Drosophila virilis
ref|NP_524004.2|  ribosomal protein S9, isoform A                       100   4e-24   Drosophila melanogaster
ref|XP_570885.1|  hypothetical protein CNE02160                         100   4e-24   Cryptococcus neoformans var. neoformans JEC21
ref|XP_003557815.1|  PREDICTED: 40S ribosomal protein S9-2              100   4e-24   Brachypodium distachyon [annual false brome]
ref|XP_008601048.1|  40S ribosomal protein S9                         99.8    4e-24   Beauveria bassiana ARSEF 2860
ref|XP_011066131.1|  PREDICTED: 40S ribosomal protein S9              99.8    4e-24   Acromyrmex echinatior
ref|XP_006664031.1|  PREDICTED: 40S ribosomal protein S9-2-like         100   4e-24   Oryza brachyantha
ref|XP_007811695.1|  40S ribosomal protein S9                         99.8    5e-24   Metarhizium acridum CQMa 102
gb|ABD98740.1|  putative S9e ribosomal protein                        99.8    5e-24   Graphocephala atropunctata
ref|XP_001956309.1|  GF24655                                          99.8    5e-24   Drosophila ananassae
ref|NP_001049004.1|  Os03g0154700                                     99.8    5e-24   
ref|XP_008544905.1|  PREDICTED: 40S ribosomal protein S9              99.8    5e-24   Microplitis demolitor
ref|XP_009022737.1|  hypothetical protein HELRODRAFT_155894           99.8    5e-24   Helobdella robusta
gb|KFG83429.1|  40S ribosomal protein S9 (S7)                           100   5e-24   Metarhizium anisopliae
ref|XP_001352621.1|  GA28351                                          99.8    5e-24   Drosophila pseudoobscura pseudoobscura
gb|EQL04090.1|  Ribosomal protein S4/S9                               99.8    5e-24   Ophiocordyceps sinensis CO18
emb|CDH55798.1|  40s ribosomal protein s9                             99.8    5e-24   Lichtheimia corymbifera JMRC:FSU:9682
emb|CCM02260.1|  predicted protein                                    99.8    5e-24   Fibroporia radiculosa
emb|CEJ91392.1|  Putative 40S ribosomal protein S9 (S7)               99.8    5e-24   Torrubiella hemipterigena
ref|XP_011144040.1|  PREDICTED: 40S ribosomal protein S9              99.8    5e-24   Harpegnathos saltator
ref|XP_004984207.1|  PREDICTED: 40S ribosomal protein S9-2-like       99.8    5e-24   Setaria italica
gb|AAR09821.1|  similar to Drosophila melanogaster RpS9               99.8    6e-24   Drosophila yakuba
ref|XP_001894478.1|  40S ribosomal protein S9                         99.8    6e-24   Brugia malayi [agent of lymphatic filariasis]
gb|ABC25036.1|  ribosomal protein S9                                  97.4    6e-24   Hydra vulgaris
ref|XP_007634519.1|  PREDICTED: 40S ribosomal protein S9 isoform X2   97.1    6e-24   
ref|XP_006650139.1|  PREDICTED: 40S ribosomal protein S9-2-like       99.4    6e-24   Oryza brachyantha
ref|XP_002110068.1|  S9 ribosomal protein                             99.4    6e-24   Trichoplax adhaerens
gb|ABX75477.1|  40S ribosomal protein S9                              99.0    6e-24   Lycosa singoriensis
ref|XP_002741225.1|  PREDICTED: 40S ribosomal protein S9-like         99.4    7e-24   Saccoglossus kowalevskii
ref|XP_003147914.1|  40S ribosomal protein S9                         99.4    7e-24   Loa loa
gb|ERE61325.1|  40S ribosomal protein S9-like protein                 97.4    7e-24   Cricetulus griseus [Chinese hamsters]
gb|KII94201.1|  hypothetical protein PLICRDRAFT_695235                99.4    7e-24   Plicaturopsis crispa FD-325 SS-3
ref|XP_001609790.1|  40S ribosomal subunit protein S9                 99.0    7e-24   Babesia bovis T2Bo
ref|XP_002119507.1|  PREDICTED: 40S ribosomal protein S9              99.4    7e-24   Ciona intestinalis [sea vase]
gb|KIJ58198.1|  hypothetical protein HYDPIDRAFT_119825                99.4    8e-24   Hydnomerulius pinastri MD-312
gb|KJA19242.1|  hypothetical protein HYPSUDRAFT_204799                99.4    8e-24   Hypholoma sublateritium FD-334 SS-4
gb|KIM82299.1|  hypothetical protein PILCRDRAFT_475098                99.4    8e-24   Piloderma croceum F 1598
gb|ABM55670.1|  putative ribosomal protein S9                         99.4    8e-24   Maconellicoccus hirsutus [pink hibiscus mealybug]
gb|EUR76669.1|  40S ribosomal protein S9                              97.8    8e-24   Plasmodium falciparum 7G8
ref|XP_007360763.1|  40S ribosomal protein S9                         99.0    8e-24   Dichomitus squalens LYAD-421 SS1
gb|ADV40204.1|  40S ribosomal protein S9                              98.2    8e-24   Latrodectus hesperus [black widow]
gb|KDN35405.1|  hypothetical protein RSAG8_11626                      96.7    8e-24   Rhizoctonia solani AG-8 WAC10335
ref|XP_754909.1|  40S ribosomal protein S9                              100   9e-24   Aspergillus fumigatus Af293
ref|XP_005767233.1|  hypothetical protein EMIHUDRAFT_61745            99.0    9e-24   Emiliania huxleyi CCMP1516
gb|AGH70193.1|  40S ribosomal protein S9                              99.0    9e-24   Placozoa sp. H4
gb|EJT48949.1|  40S ribosomal protein S9-A                              100   1e-23   Trichosporon asahii var. asahii CBS 2479
ref|XP_002985335.1|  hypothetical protein SELMODRAFT_157263           99.0    1e-23   Selaginella moellendorffii
ref|XP_007648455.1|  PREDICTED: 40S ribosomal protein S9 isoform X1   97.4    1e-23   Cricetulus griseus [Chinese hamsters]
emb|CEG69035.1|  Putative 40S ribosomal protein S9                    99.0    1e-23   Rhizopus microsporus
ref|XP_002960852.1|  hypothetical protein SELMODRAFT_74302            99.0    1e-23   Selaginella moellendorffii
ref|XP_002430661.1|  40S ribosomal protein S9, putative               99.0    1e-23   Pediculus humanus corporis [human body lice]
gb|EEC74543.1|  hypothetical protein OsI_10067                          100   1e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_008815169.1|  40S ribosomal protein                            98.6    1e-23   Plasmodium inui San Antonio 1
ref|XP_001613757.1|  40S ribosomal protein S9                         98.6    1e-23   Plasmodium vivax Sal-1
gb|KDE04206.1|  40S ribosomal protein S9-A                            99.0    1e-23   Microbotryum lychnidis-dioicae p1A1 Lamole
gb|EIE83578.1|  40S ribosomal protein S9                              98.6    1e-23   Rhizopus delemar RA 99-880
gb|EIE83453.1|  40S ribosomal protein S9                              98.6    1e-23   Rhizopus delemar RA 99-880
ref|XP_002276284.1|  PREDICTED: 40S ribosomal protein S9-2            98.6    1e-23   Vitis vinifera
ref|XP_004222815.1|  40S ribosomal protein S9                         98.6    1e-23   Plasmodium cynomolgi strain B
ref|XP_002500609.1|  predicted protein                                98.6    1e-23   Micromonas commoda
gb|KIO25495.1|  hypothetical protein M407DRAFT_91820                  98.6    1e-23   
ref|XP_011115175.1|  hypothetical protein H072_9617                   98.6    1e-23   
gb|EUT90705.1|  40S ribosomal protein S9                              97.8    1e-23   
gb|EMS59613.1|  40S ribosomal protein S9-2                            98.6    1e-23   
ref|XP_007439934.1|  PREDICTED: 40S ribosomal protein S9-like iso...  98.6    1e-23   
ref|XP_005312659.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...  98.6    1e-23   
gb|AAS49576.1|  ribosomal protein S9                                  98.2    1e-23   
ref|XP_004715740.1|  PREDICTED: 40S ribosomal protein S9              97.4    1e-23   
gb|ETE72572.1|  40S ribosomal protein S9                              98.6    1e-23   
ref|XP_005880022.1|  PREDICTED: 40S ribosomal protein S9 isoform X1   98.6    1e-23   
ref|XP_008116661.1|  PREDICTED: 40S ribosomal protein S9              98.6    1e-23   
ref|XP_002156853.1|  PREDICTED: 40S ribosomal protein S9-like iso...  98.6    1e-23   
ref|XP_001747599.1|  hypothetical protein                             98.6    1e-23   
ref|XP_001625568.1|  predicted protein                                98.6    1e-23   
ref|NP_001232711.1|  putative 40S ribosomal protein S9                98.6    1e-23   
ref|XP_007538773.1|  PREDICTED: 40S ribosomal protein S9              98.6    1e-23   
ref|NP_001006813.1|  ribosomal protein S9                             98.6    1e-23   
ref|NP_001085809.1|  ribosomal protein S9                             98.6    1e-23   
ref|NP_001080124.1|  ribosomal protein S9                             98.6    1e-23   
ref|XP_002603611.1|  hypothetical protein BRAFLDRAFT_126921           98.6    1e-23   
ref|XP_011445733.1|  PREDICTED: 40S ribosomal protein S9              98.6    1e-23   
gb|EAW72215.1|  ribosomal protein S9, isoform CRA_f                   97.4    1e-23   
gb|AAX29348.1|  ribosomal protein S9                                  98.6    1e-23   
gb|ELK32895.1|  40S ribosomal protein S9                              98.2    1e-23   
gb|ABI75190.1|  ribsomal subunit S9                                   95.9    2e-23   
ref|NP_001004.2|  40S ribosomal protein S9                            98.6    2e-23   
ref|XP_004336000.1|  ribosomal protein S4, putative                   98.2    2e-23   
gb|ACH85276.1|  ribosomal protein S9                                  98.2    2e-23   
ref|XP_010218022.1|  PREDICTED: 40S ribosomal protein S9              99.0    2e-23   
ref|XP_313936.2|  AGAP005061-PB                                       98.6    2e-23   
gb|AGM32374.1|  putative S9e ribosomal protein                        98.6    2e-23   
ref|XP_007256932.1|  PREDICTED: 40S ribosomal protein S9-like         98.2    2e-23   
ref|XP_006682851.1|  hypothetical protein BATDEDRAFT_33834            98.2    2e-23   
emb|CDQ94630.1|  unnamed protein product                              98.2    2e-23   
ref|XP_006015023.1|  PREDICTED: 40S ribosomal protein S9-like         98.2    2e-23   
ref|XP_004077978.1|  PREDICTED: 40S ribosomal protein S9              98.2    2e-23   
ref|XP_004363804.1|  30S ribosomal protein S4                         98.2    2e-23   
ref|XP_001351758.1|  40S ribosomal protein S9, putative               98.2    2e-23   
ref|XP_006897356.1|  PREDICTED: 40S ribosomal protein S9              98.2    2e-23   
emb|CCQ18585.1|  40S ribosomal protein S9                             98.2    2e-23   
gb|KDN39854.1|  40S ribosomal protein S9                              98.2    2e-23   
gb|ADK11698.1|  ribosomal protein S9                                  97.8    2e-23   
ref|XP_001762390.1|  predicted protein                                98.6    2e-23   
ref|XP_006760259.1|  PREDICTED: 40S ribosomal protein S9              98.2    2e-23   
ref|NP_957146.1|  40S ribosomal protein S9                            98.2    2e-23   
gb|EMP40612.1|  40S ribosomal protein S9                              99.0    2e-23   
gb|EAW60405.1|  hCG41114, isoform CRA_b                               95.9    2e-23   
ref|XP_005367975.1|  PREDICTED: 40S ribosomal protein S9-like         98.2    2e-23   
gb|EAW60407.1|  hCG41114, isoform CRA_d                               97.1    2e-23   
ref|XP_005534243.1|  PREDICTED: 40S ribosomal protein S9-like         98.2    2e-23   
ref|XP_005433872.1|  PREDICTED: 40S ribosomal protein S9-like         98.2    2e-23   
gb|KDQ15631.1|  hypothetical protein BOTBODRAFT_31523                 98.2    2e-23   
ref|XP_011122298.1|  hypothetical protein AOL_s00079g121              98.2    2e-23   
emb|CEP13909.1|  hypothetical protein                                 98.2    2e-23   
ref|NP_001290865.1|  ribosomal protein S9                             98.2    2e-23   
ref|XP_001608270.1|  PREDICTED: 40S ribosomal protein S9              98.2    2e-23   
ref|XP_007209623.1|  hypothetical protein PRUPE_ppa011764mg           98.2    2e-23   
ref|XP_003450729.1|  PREDICTED: 40S ribosomal protein S9-like         98.2    2e-23   
emb|CDO63078.1|  40S ribosomal protein S9, putative                   98.2    2e-23   
ref|XP_002777200.1|  40S ribosomal protein S9, putative               97.8    2e-23   
gb|AEA39492.1|  ribosomal protein S9                                  98.2    2e-23   
gb|ADO28208.1|  40S ribosomal protein s9                              98.2    2e-23   
ref|NP_001187074.1|  40S ribosomal protein S9                         98.2    2e-23   
gb|KIK97704.1|  hypothetical protein PAXRUDRAFT_824663                98.2    2e-23   
gb|KIJ13786.1|  hypothetical protein PAXINDRAFT_170109                98.2    2e-23   
gb|EMS20104.1|  40S ribosomal protein s9                              98.2    2e-23   
gb|AAS49601.1|  ribosomal protein S9                                  97.4    2e-23   
ref|XP_001846568.1|  conserved hypothetical protein                   98.2    2e-23   
gb|KFB48005.1|  40S ribosomal protein S9                              98.2    2e-23   
emb|CAA47013.1|  ribosomal protein S9                                 97.8    2e-23   
ref|XP_001653969.1|  AAEL001759-PA                                    97.8    3e-23   
ref|XP_010786813.1|  PREDICTED: 40S ribosomal protein S9              97.8    3e-23   
ref|XP_002786733.1|  40S ribosomal protein S9, putative               97.8    3e-23   
emb|CCO33607.1|  40S ribosomal protein S9-A                           97.8    3e-23   
gb|EPS34246.1|  hypothetical protein PDE_09210                        97.8    3e-23   
ref|XP_007763855.1|  40S ribosomal protein S9                         97.8    3e-23   
emb|CCE32701.1|  probable 40S ribosomal protein S9 (S7)               98.6    3e-23   
gb|ABE68880.1|  40S ribosomal protein S9                              97.4    3e-23   
emb|CEP13692.1|  hypothetical protein                                 97.8    3e-23   
dbj|GAN01898.1|  40S ribosomal protein S9                             97.8    3e-23   
dbj|GAN07351.1|  40S ribosomal protein S9                             97.8    3e-23   
gb|EPB81471.1|  40S ribosomal protein S9                              97.8    3e-23   
gb|KJE98318.1|  40S ribosomal protein S9                              98.2    3e-23   
gb|AAW31599.1|  ribosomal protein S9                                  97.8    3e-23   
ref|XP_505037.1|  40S ribosomal protein S9                            97.8    3e-23   
ref|XP_003977663.1|  PREDICTED: 40S ribosomal protein S9-like         97.8    3e-23   
gb|AAV69398.1|  40S ribosomal protein S9                              97.8    3e-23   
ref|XP_004341959.2|  40S ribosomal protein S9                         97.8    3e-23   
ref|XP_002259613.1|  40S ribosomal subunit protein S9                 97.8    3e-23   
ref|XP_002786250.1|  40S ribosomal protein S9, putative               97.4    3e-23   
ref|XP_005664882.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...  98.2    3e-23   
gb|EHK22520.1|  hypothetical protein TRIVIDRAFT_216043                97.4    3e-23   
gb|EAW60406.1|  hCG41114, isoform CRA_c                               97.8    3e-23   
ref|XP_009045417.1|  hypothetical protein LOTGIDRAFT_230231           97.4    3e-23   
ref|XP_001873539.1|  40S ribosomal protein S9                         97.4    3e-23   
ref|XP_002467783.1|  hypothetical protein SORBIDRAFT_01g033980        97.4    3e-23   
ref|XP_007324335.1|  hypothetical protein SERLADRAFT_480346           97.4    3e-23   
gb|EMS50632.1|  40S ribosomal protein S9-2                            97.8    3e-23   
gb|ACY71248.1|  ribosomal protein S9                                  97.4    3e-23   
gb|ACF72878.1|  ribosomal protein S9                                  97.8    3e-23   
gb|KIM47402.1|  hypothetical protein M413DRAFT_199385                 97.4    3e-23   
dbj|BAJ85708.1|  predicted protein                                    97.4    3e-23   
gb|EUC58677.1|  40S ribosomal protein S9                              97.4    3e-23   
ref|XP_791000.2|  PREDICTED: 40S ribosomal protein S9-like            97.4    3e-23   
gb|EPY49628.1|  40S ribosomal protein S9                              97.8    4e-23   
ref|XP_007419339.1|  hypothetical protein MELLADRAFT_41264            96.3    4e-23   
gb|KFH63847.1|  40S ribosomal protein S9                              97.4    4e-23   
ref|XP_001873538.1|  40S ribosomal protein S9                         97.4    4e-23   
ref|XP_533590.3|  PREDICTED: 40S ribosomal protein S9                 98.2    4e-23   
emb|CBY16469.1|  unnamed protein product                              95.1    4e-23   
gb|ABE68882.1|  40S ribosomal protein S9                              97.8    4e-23   
gb|ABX44781.1|  putative 40S ribosomal protein RPS9                   97.4    4e-23   
ref|XP_010835190.1|  PREDICTED: 40S ribosomal protein S9              96.3    4e-23   
gb|EPX74976.1|  40S ribosomal protein S9                              97.4    4e-23   
gb|ABX26127.1|  ribosomal protein S9                                  97.1    4e-23   
gb|AAN86049.1|  ribosomal protein S9                                  95.1    4e-23   
gb|KIP02503.1|  hypothetical protein PHLGIDRAFT_20458                 97.4    4e-23   
gb|ACG33443.1|  40S ribosomal protein S9                              97.4    5e-23   
ref|NP_001278530.1|  40S ribosomal protein S9                         97.1    5e-23   
gb|ABW23205.1|  ribosomal protein rps9                                97.1    5e-23   
gb|EHK42959.1|  hypothetical protein TRIATDRAFT_258286                97.1    5e-23   
ref|XP_003387673.1|  PREDICTED: 40S ribosomal protein S9-like         97.1    5e-23   
gb|AAT76788.1|  40S ribosomal protein S9                              97.1    5e-23   
gb|EJU02852.1|  40S ribosomal protein S9                              97.1    5e-23   
gb|EGW14259.1|  40S ribosomal protein S9                              94.7    5e-23   
ref|XP_740498.1|  40S ribosomal subunit protein S9                    96.3    6e-23   
ref|XP_006663032.1|  PREDICTED: 40S ribosomal protein S9-2-like       97.1    6e-23   
gb|AET50489.1|  hypothetical protein                                  96.7    6e-23   
gb|KIJ95270.1|  hypothetical protein K443DRAFT_332076                 96.7    6e-23   
dbj|BAA24900.1|  ribosomal protein S9                                 96.7    7e-23   
emb|CDP18849.1|  unnamed protein product                              93.6    7e-23   
gb|KIL71469.1|  hypothetical protein M378DRAFT_155038                 96.7    7e-23   
ref|XP_676689.1|  40S ribosomal subunit protein S9                    96.3    7e-23   
ref|XP_005343216.1|  PREDICTED: 40S ribosomal protein S9-like         95.1    8e-23   
emb|CDR95115.1|  40S ribosomal subunit protein S9, putative           96.3    8e-23   
ref|XP_008623589.1|  40S ribosomal protein                            96.7    8e-23   
ref|NP_592945.1|  40S ribosomal protein S9                            96.7    8e-23   
gb|ACI68776.1|  40S ribosomal protein S9                              96.7    8e-23   
emb|CDJ32982.1|  40S ribosomal protein S9, putative                   96.3    9e-23   
gb|ETB62408.1|  40S ribosomal protein S9                              96.3    9e-23   
ref|XP_007413538.1|  hypothetical protein MELLADRAFT_75362            96.3    9e-23   
gb|ERE63025.1|  40S ribosomal protein S9-like protein                 95.9    9e-23   
emb|CDI78299.1|  40S ribosomal protein S9, putative                   96.3    9e-23   
emb|CDJ50108.1|  40S ribosomal protein S9, putative                   96.3    9e-23   
ref|XP_004299381.1|  PREDICTED: 40S ribosomal protein S9-2-like       96.7    9e-23   
gb|ETN81469.1|  ribosomal protein S4                                  96.3    1e-22   
emb|CDS49582.1|  40S ribosomal protein S9, putative                   96.3    1e-22   
ref|NP_001183701.1|  uncharacterized protein LOC100502294             94.4    1e-22   
dbj|BAA82319.1|  ribosomal protein S9 homolog                         96.3    1e-22   
gb|ADO95157.1|  ribosomal protein S9                                  96.3    1e-22   
ref|XP_002416200.1|  40S ribosomal protein S9, putative               96.3    1e-22   
emb|CDP08375.1|  unnamed protein product                              93.2    1e-22   
gb|ADT80642.1|  ribosomal protein S9                                  96.3    1e-22   
ref|XP_003886044.1|  hypothetical protein NCLIV_064440                96.3    1e-22   
ref|NP_001037265.1|  ribosomal protein S9                             96.3    1e-22   
ref|XP_002367195.1|  40S ribosomal protein S9, putative               96.3    1e-22   
ref|NP_595840.1|  40S ribosomal protein S9                            96.3    1e-22   
ref|NP_496384.1|  Protein RPS-9                                       96.3    1e-22   
gb|ACY95323.1|  ribosomal protein S9                                  96.3    1e-22   
gb|KIJ53746.1|  hypothetical protein M422DRAFT_58531                  96.3    1e-22   
gb|AAY66962.1|  40S ribosomal protein S9                              96.3    1e-22   
gb|EGT44967.1|  CBN-RPS-9 protein                                     95.9    1e-22   
ref|XP_002631176.1|  C. briggsae CBR-RPS-9 protein                    95.9    1e-22   
ref|XP_007087223.1|  PREDICTED: 40S ribosomal protein S9              97.8    1e-22   
gb|ACO12686.1|  40S ribosomal protein S9                              95.9    1e-22   
ref|XP_003117273.1|  CRE-RPS-9 protein                                95.9    1e-22   
ref|XP_007632416.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...  95.9    1e-22   
dbj|BAM17690.1|  ribosomal protein S9                                 95.9    1e-22   
ref|XP_003325266.1|  40S ribosomal protein S9                         95.9    1e-22   
ref|XP_007605961.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...  95.9    2e-22   
gb|ACO15505.1|  40S ribosomal protein S9                              95.9    2e-22   
gb|EHJ71338.1|  ribosomal protein S9                                  95.9    2e-22   
ref|XP_005090825.1|  PREDICTED: 40S ribosomal protein S9-like iso...  95.9    2e-22   
ref|XP_005836916.1|  small subunit ribosomal protein S9e, cytopla...  95.5    2e-22   
gb|KFM58001.1|  40S ribosomal protein S9                              95.9    2e-22   
ref|XP_008367548.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...  95.9    2e-22   
tpe|CAL69096.1|  TPA: putative 40S ribosomal protein S9               95.5    2e-22   
dbj|BAM19012.1|  ribosomal protein S9                                 95.9    2e-22   
ref|XP_007510860.1|  40S ribosomal protein S9                         96.7    2e-22   
gb|ACO10247.1|  40S ribosomal protein S9                              95.5    2e-22   
gb|ADB77798.1|  40S ribosomal protein S9                              95.5    2e-22   
gb|KFK25765.1|  hypothetical protein AALP_AA8G156800                  95.9    2e-22   
gb|AAX48885.1|  S9                                                    95.5    2e-22   
gb|AAS49575.1|  ribosomal protein S9                                  95.1    2e-22   
ref|XP_011128579.1|  40S ribosomal protein S9                         95.5    2e-22   
ref|XP_005852611.1|  small subunit ribosomal protein S9e              95.5    2e-22   
gb|AFK33393.1|  unknown                                               95.1    2e-22   
gb|KFH67080.1|  small subunit ribosomal protein S9e                   96.7    3e-22   
gb|EER45719.1|  40S ribosomal protein S9                              95.1    3e-22   
gb|EUC58766.1|  40S ribosomal protein S9                              92.8    3e-22   
ref|XP_003281304.1|  PREDICTED: 40S ribosomal protein S9-like         95.1    3e-22   
ref|XP_006453937.1|  40S ribosomal protein S9                         95.1    3e-22   
ref|XP_730059.1|  ribosomal protein S4                                95.1    4e-22   
gb|ETN58127.1|  40S ribosomal protein S9                              94.4    4e-22   
gb|ELK16780.1|  tRNA-splicing endonuclease subunit Sen34              98.6    4e-22   
gb|EFX88052.1|  hypothetical protein DAPPUDRAFT_230323                94.7    4e-22   
ref|XP_003679632.1|  40S ribosomal protein S9                         94.7    4e-22   
ref|NP_001149705.1|  40S ribosomal protein S9                         94.7    4e-22   
gb|EKC29671.1|  40S ribosomal protein S9                              98.6    5e-22   
emb|CDP08232.1|  unnamed protein product                              91.7    5e-22   
ref|XP_004958404.1|  PREDICTED: 40S ribosomal protein S9-2-like       94.4    5e-22   
ref|XP_004668441.1|  PREDICTED: 40S ribosomal protein S9-like         94.4    5e-22   
dbj|GAA97183.1|  hypothetical protein E5Q_03859                       94.7    5e-22   
ref|XP_002494932.1|  40S ribosomal protein S9                         94.4    5e-22   
dbj|BAF45897.1|  ribosomal protein S9                                 94.4    5e-22   
ref|XP_002463229.1|  hypothetical protein SORBIDRAFT_02g040120        94.4    6e-22   
ref|XP_002463225.1|  hypothetical protein SORBIDRAFT_02g040080        94.4    6e-22   
emb|CDF88290.1|  BN860_06612g1_1                                      94.4    6e-22   
ref|XP_008475833.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...  94.4    6e-22   
gb|KFO36497.1|  tRNA-splicing endonuclease subunit Sen34              97.8    6e-22   
gb|EYC05388.1|  hypothetical protein Y032_0082g1552                   94.4    6e-22   
gb|AHB33642.1|  40S ribosomal protein S9                              94.4    6e-22   
emb|CDH12779.1|  probable LYS20-Homocitrate synthase                  98.2    7e-22   
emb|CBQ71099.1|  probable 40S ribosomal protein S9                    94.0    7e-22   
ref|XP_009265857.1|  40S ribosomal protein S9-B                       94.0    8e-22   
gb|AEB54651.1|  ribosomal protein S9                                  94.0    8e-22   
ref|XP_005361018.1|  PREDICTED: 40S ribosomal protein S9-like         94.0    9e-22   
ref|XP_003341160.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...  94.0    9e-22   
gb|ETS60861.1|  40s ribosomal protein s9                              94.0    9e-22   
dbj|BAJ90873.1|  predicted protein                                    94.0    9e-22   
ref|XP_006902935.1|  PREDICTED: 40S ribosomal protein S9-like         93.6    1e-21   



>gb|KCW56191.1| hypothetical protein EUGRSUZ_I01938 [Eucalyptus grandis]
Length=116

 Score =   106 bits (264),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  40   AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  93



>ref|XP_004135180.1| PREDICTED: 40S ribosomal protein S9-2-like [Cucumis sativus]
 ref|XP_004141548.1| PREDICTED: 40S ribosomal protein S9-2-like [Cucumis sativus]
 ref|XP_004172155.1| PREDICTED: 40S ribosomal protein S9-2-like [Cucumis sativus]
 ref|XP_004173021.1| PREDICTED: 40S ribosomal protein S9-2-like [Cucumis sativus]
 ref|XP_008446334.1| PREDICTED: 40S ribosomal protein S9-2 [Cucumis melo]
 ref|XP_008459594.1| PREDICTED: 40S ribosomal protein S9-2 [Cucumis melo]
 gb|KGN51904.1| hypothetical protein Csa_5G604980 [Cucumis sativus]
 gb|KGN52667.1| hypothetical protein Csa_5G649850 [Cucumis sativus]
Length=197

 Score =   107 bits (268),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQKHIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQKHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_002323418.1| hypothetical protein POPTR_0016s07730g [Populus trichocarpa]
 ref|XP_002322813.2| 40S ribosomal protein S9 [Populus trichocarpa]
 gb|ABK93151.1| unknown [Populus trichocarpa]
 gb|ABK96412.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEF05179.1| hypothetical protein POPTR_0016s07730g [Populus trichocarpa]
 gb|EEF04574.2| 40S ribosomal protein S9 [Populus trichocarpa]
Length=197

 Score =   107 bits (268),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLI+QKHIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIKQKHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>gb|EYU22431.1| hypothetical protein MIMGU_mgv1a014214mg [Erythranthe guttata]
Length=197

 Score =   107 bits (268),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQKHIRVGRQVVNVPSF+VR+DSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQKHIRVGRQVVNVPSFMVRMDSQKHIDFSLTSPFGGGRPGRV  174



>gb|EYU34659.1| hypothetical protein MIMGU_mgv1a014209mg [Erythranthe guttata]
Length=197

 Score =   107 bits (268),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_010091216.1| 40S ribosomal protein S9-2 [Morus notabilis]
 gb|EXB43471.1| 40S ribosomal protein S9-2 [Morus notabilis]
Length=199

 Score =   107 bits (267),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQKHIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQKHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>gb|KCW56188.1| hypothetical protein EUGRSUZ_I01938 [Eucalyptus grandis]
Length=164

 Score =   106 bits (265),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  88   AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  141



>gb|EYU28732.1| hypothetical protein MIMGU_mgv1a014218mg [Erythranthe guttata]
Length=197

 Score =   107 bits (267),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_009604777.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana tomentosiformis]
Length=197

 Score =   107 bits (266),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_002522398.1| 40S ribosomal protein S9, putative [Ricinus communis]
 gb|EEF39890.1| 40S ribosomal protein S9, putative [Ricinus communis]
Length=196

 Score =   107 bits (266),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>gb|AAP44415.1| 40S ribosomal protein S9, partial [Lactuca sativa]
 gb|AAP44416.1| 40S ribosomal protein S9, partial [Lactuca sativa]
 gb|AAP44417.1| 40S ribosomal protein S9, partial [Lactuca sativa]
 gb|AAP44418.1| 40S ribosomal protein S9, partial [Lactuca serriola]
 gb|AAP44419.1| 40S ribosomal protein S9, partial [Lactuca saligna]
 gb|AAP44420.1| 40S ribosomal protein S9, partial [Lactuca saligna]
Length=143

 Score =   105 bits (262),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLI+Q+HIRVGRQVVNVPSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  71   AKSIHHARVLIKQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  124



>gb|AAP44421.1| 40S ribosomal protein S9, partial [Lactuca saligna]
Length=124

 Score =   105 bits (261),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLI+Q+HIRVGRQVVNVPSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  52   AKSIHHARVLIKQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  105



>gb|KHG14915.1| 40S ribosomal S9-2 -like protein [Gossypium arboreum]
 gb|KHG26955.1| 40S ribosomal S9-2 -like protein [Gossypium arboreum]
Length=148

 Score =   105 bits (263),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  72   AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  125



>ref|XP_011075483.1| PREDICTED: 40S ribosomal protein S9-2 [Sesamum indicum]
 ref|XP_011075484.1| PREDICTED: 40S ribosomal protein S9-2 [Sesamum indicum]
Length=197

 Score =   107 bits (266),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_010029297.1| PREDICTED: 40S ribosomal protein S9-2 [Eucalyptus grandis]
 gb|KCW56190.1| hypothetical protein EUGRSUZ_I01938 [Eucalyptus grandis]
Length=197

 Score =   106 bits (265),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_009798560.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana sylvestris]
Length=197

 Score =   106 bits (265),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_002517490.1| 40S ribosomal protein S9, putative [Ricinus communis]
 gb|EEF45032.1| 40S ribosomal protein S9, putative [Ricinus communis]
Length=196

 Score =   106 bits (265),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>gb|KDP31233.1| hypothetical protein JCGZ_11609 [Jatropha curcas]
Length=197

 Score =   106 bits (265),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_006381973.1| hypothetical protein POPTR_0006s22640g [Populus trichocarpa]
 gb|ERP59770.1| hypothetical protein POPTR_0006s22640g [Populus trichocarpa]
Length=178

 Score =   106 bits (264),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLI+Q+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  102  AKSIHHARVLIKQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  155



>gb|KDP41175.1| hypothetical protein JCGZ_15582 [Jatropha curcas]
Length=197

 Score =   106 bits (265),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_011004201.1| PREDICTED: 40S ribosomal protein S9-2-like isoform X1 [Populus 
euphratica]
 ref|XP_011004202.1| PREDICTED: 40S ribosomal protein S9-2-like isoform X2 [Populus 
euphratica]
Length=197

 Score =   106 bits (265),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLI+Q+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>gb|KHG14681.1| 40S ribosomal S9-2 -like protein [Gossypium arboreum]
Length=189

 Score =   106 bits (264),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  113  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  166



>ref|XP_002324730.1| hypothetical protein POPTR_0018s07520g [Populus trichocarpa]
 ref|XP_006381972.1| hypothetical protein POPTR_0006s22630g [Populus trichocarpa]
 gb|ABK93418.1| unknown [Populus trichocarpa]
 gb|ABK95800.1| unknown [Populus trichocarpa]
 gb|ABK96647.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEF03295.1| hypothetical protein POPTR_0018s07520g [Populus trichocarpa]
 gb|ERP59769.1| hypothetical protein POPTR_0006s22630g [Populus trichocarpa]
Length=197

 Score =   106 bits (265),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLI+Q+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_011004703.1| PREDICTED: 40S ribosomal protein S9-2-like [Populus euphratica]
Length=197

 Score =   106 bits (265),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLI+Q+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>gb|KHG14244.1| 40S ribosomal S9-2 -like protein [Gossypium arboreum]
Length=191

 Score =   106 bits (264),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  115  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  168



>ref|XP_009627396.1| PREDICTED: 40S ribosomal protein S9-2 [Nicotiana tomentosiformis]
Length=197

 Score =   106 bits (264),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VR+DSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRLDSQKHIDFSLTSPFGGGRPGRV  174



>gb|KJB74899.1| hypothetical protein B456_012G055000 [Gossypium raimondii]
Length=197

 Score =   106 bits (264),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>gb|KJB70960.1| hypothetical protein B456_011G097500 [Gossypium raimondii]
Length=197

 Score =   106 bits (264),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>gb|KJB33600.1| hypothetical protein B456_006G020700 [Gossypium raimondii]
Length=197

 Score =   106 bits (264),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>gb|KHG16530.1| 40S ribosomal S9-2 -like protein [Gossypium arboreum]
 gb|KJB39897.1| hypothetical protein B456_007G036500 [Gossypium raimondii]
Length=197

 Score =   106 bits (264),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_002511557.1| 40S ribosomal protein S9, putative [Ricinus communis]
 gb|EEF52159.1| 40S ribosomal protein S9, putative [Ricinus communis]
Length=197

 Score =   106 bits (264),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VR+DSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRIDSQKHIDFSLTSPFGGGRPGRV  174



>gb|KJB11057.1| hypothetical protein B456_001G238700 [Gossypium raimondii]
 gb|KJB11058.1| hypothetical protein B456_001G238700 [Gossypium raimondii]
Length=197

 Score =   106 bits (264),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_010683223.1| PREDICTED: 40S ribosomal protein S9-2 [Beta vulgaris subsp. vulgaris]
Length=197

 Score =   106 bits (264),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_011004198.1| PREDICTED: 40S ribosomal protein S9-2 isoform X1 [Populus euphratica]
 ref|XP_011004199.1| PREDICTED: 40S ribosomal protein S9-2 isoform X1 [Populus euphratica]
 ref|XP_011004200.1| PREDICTED: 40S ribosomal protein S9-2 isoform X2 [Populus euphratica]
Length=197

 Score =   106 bits (264),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLI+Q+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>gb|KDP41176.1| hypothetical protein JCGZ_15583 [Jatropha curcas]
Length=201

 Score =   106 bits (264),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  125  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  178


 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = +1

Query  85   LVRVDSQRHIDFSLSSPFGGGR  150
            +VRVDSQ+HIDFSL+SPFGGGR
Sbjct  1    MVRVDSQKHIDFSLTSPFGGGR  22



>gb|ABQ32300.1| putative 40S ribosomal protein S9 [Artemisia annua]
Length=197

 Score =   105 bits (263),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLI+Q+HIRVGRQVVNVPSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_009778292.1| PREDICTED: 40S ribosomal protein S9-2 [Nicotiana sylvestris]
Length=197

 Score =   105 bits (263),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VR+DSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRLDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_009779308.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana sylvestris]
Length=197

 Score =   105 bits (263),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VR+DSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRLDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_007032505.1| Ribosomal protein S4 [Theobroma cacao]
 gb|EOY03431.1| Ribosomal protein S4 [Theobroma cacao]
Length=197

 Score =   105 bits (263),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>gb|KIZ06357.1| 40S ribosomal protein S9-2 [Monoraphidium neglectum]
Length=191

 Score =   105 bits (262),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+QVVN+PSFLVRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGKQVVNIPSFLVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_010242426.1| PREDICTED: 40S ribosomal protein S9-2 [Nelumbo nucifera]
Length=197

 Score =   105 bits (262),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQKHIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQKHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_007037295.1| Ribosomal protein S4 [Theobroma cacao]
 gb|EOY21796.1| Ribosomal protein S4 [Theobroma cacao]
Length=197

 Score =   105 bits (262),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+H+RVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHVRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>gb|KHG06711.1| 40S ribosomal S9-2 -like protein [Gossypium arboreum]
Length=250

 Score =   106 bits (265),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  174  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  227



>ref|XP_010092050.1| 40S ribosomal protein S9-2 [Morus notabilis]
 gb|EXB49964.1| 40S ribosomal protein S9-2 [Morus notabilis]
Length=271

 Score =   107 bits (266),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  195  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  248



>gb|KCW56189.1| hypothetical protein EUGRSUZ_I01938 [Eucalyptus grandis]
Length=176

 Score =   104 bits (260),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGR  159
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGRPGR
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGR  173



>ref|XP_010695717.1| PREDICTED: 40S ribosomal protein S9-2-like [Beta vulgaris subsp. 
vulgaris]
Length=197

 Score =   105 bits (261),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLI+Q+HIRVGRQVVN+PSF+VRVDSQ+HIDFSLSSPFGGGRPGRV
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLSSPFGGGRPGRV  174



>gb|ABR17162.1| unknown [Picea sitchensis]
 gb|ACN39805.1| unknown [Picea sitchensis]
 gb|ACN39957.1| unknown [Picea sitchensis]
 gb|ACN40724.1| unknown [Picea sitchensis]
 gb|ADE77363.1| unknown [Picea sitchensis]
Length=197

 Score =   105 bits (261),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_002958222.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ40676.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=190

 Score =   104 bits (260),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+QVVNVPSF+VRVDSQ+HIDF+L+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGKQVVNVPSFMVRVDSQKHIDFALTSPFGGGRPGRV  174



>gb|ADB77797.1| 40S ribosomal protein S9 [Chlamydomonas reinhardtii]
Length=178

 Score =   104 bits (260),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+QVVNVPSF+VRVDSQ+HIDF+L+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGKQVVNVPSFMVRVDSQKHIDFALTSPFGGGRPGRV  174



>ref|NP_001274868.1| 40S ribosomal protein S9-2-like [Solanum tuberosum]
 gb|AFW90596.1| putative 40S ribosomal protein S9 [Solanum tuberosum]
Length=197

 Score =   105 bits (261),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVNV SF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVASFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>gb|ABK21901.1| unknown [Picea sitchensis]
 gb|ACN40156.1| unknown [Picea sitchensis]
Length=197

 Score =   105 bits (261),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_009598709.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana tomentosiformis]
Length=197

 Score =   104 bits (260),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQ+HIDFSL+SPFG GRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGSGRPGRV  174



>ref|XP_001702303.1| ribosomal protein S9, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 gb|EDO97033.1| ribosomal protein S9, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
Length=190

 Score =   104 bits (260),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+QVVNVPSF+VRVDSQ+HIDF+L+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGKQVVNVPSFMVRVDSQKHIDFALTSPFGGGRPGRV  174



>ref|XP_010554004.1| PREDICTED: 40S ribosomal protein S9-2 [Tarenaya hassleriana]
Length=197

 Score =   104 bits (260),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+V+VDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVKVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_006405589.1| hypothetical protein EUTSA_v10027944mg [Eutrema salsugineum]
 gb|ESQ47042.1| hypothetical protein EUTSA_v10027944mg [Eutrema salsugineum]
Length=198

 Score =   104 bits (260),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+V+VDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVKVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_010917021.1| PREDICTED: 40S ribosomal protein S9-2 [Elaeis guineensis]
Length=197

 Score =   104 bits (260),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSFLVRVDS +HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFLVRVDSAKHIDFSLTSPFGGGRPGRV  174



>gb|AFK46709.1| unknown [Lotus japonicus]
Length=197

 Score =   104 bits (260),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|NP_001275235.1| uncharacterized protein LOC102577830 [Solanum tuberosum]
 ref|XP_006367429.1| PREDICTED: 40S ribosomal protein S9-2-like [Solanum tuberosum]
 gb|ABA46767.1| unknown [Solanum tuberosum]
Length=197

 Score =   104 bits (260),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVNV SF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVASFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>gb|AFK35307.1| unknown [Lotus japonicus]
Length=78

 Score =   101 bits (251),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SP GGGRPGRV
Sbjct  2    AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  55



>ref|XP_004499428.1| PREDICTED: 40S ribosomal protein S9-2-like [Cicer arietinum]
Length=197

 Score =   104 bits (260),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_004238784.1| PREDICTED: 40S ribosomal protein S9-2 [Solanum lycopersicum]
Length=197

 Score =   104 bits (260),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVNV SF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVASFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_004228395.1| PREDICTED: 40S ribosomal protein S9-2 [Solanum lycopersicum]
 ref|XP_004228398.1| PREDICTED: 40S ribosomal protein S9-2-like [Solanum lycopersicum]
 ref|XP_010319448.1| PREDICTED: 40S ribosomal protein S9-2 [Solanum lycopersicum]
 gb|AAU93594.1| 40S ribosomal protein S9 , putative [Solanum demissum]
Length=197

 Score =   104 bits (260),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVNV SF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVASFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_006367430.1| PREDICTED: 40S ribosomal protein S9-2-like isoform X1 [Solanum 
tuberosum]
Length=197

 Score =   104 bits (259),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVNV SF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVASFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_006367431.1| PREDICTED: 40S ribosomal protein S9-2-like isoform X2 [Solanum 
tuberosum]
Length=197

 Score =   104 bits (259),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVNV SF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVASFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>emb|CAG47084.1| 40S ribosomal protein S9 [Catharanthus roseus]
Length=197

 Score =   104 bits (259),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+QVVNVPSF+VRVDSQ+HIDFS++SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGKQVVNVPSFMVRVDSQKHIDFSITSPFGGGRPGRV  174



>ref|NP_001238740.1| uncharacterized protein LOC100305663 [Glycine max]
 gb|ACU13464.1| unknown [Glycine max]
Length=197

 Score =   104 bits (259),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_010256989.1| PREDICTED: 40S ribosomal protein S9-2-like [Nelumbo nucifera]
 ref|XP_010269850.1| PREDICTED: 40S ribosomal protein S9-2-like [Nelumbo nucifera]
Length=197

 Score =   104 bits (259),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_005708491.1| 40S ribosomal protein S9e [Galdieria sulphuraria]
 gb|EME31971.1| 40S ribosomal protein S9e [Galdieria sulphuraria]
Length=193

 Score =   104 bits (259),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VRVDSQ+HIDFSL SPFGGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVGKQLVNVPSFMVRVDSQKHIDFSLDSPFGGGRPGRV  172



>ref|XP_007155321.1| hypothetical protein PHAVU_003G191200g [Phaseolus vulgaris]
 gb|ESW27315.1| hypothetical protein PHAVU_003G191200g [Phaseolus vulgaris]
Length=197

 Score =   104 bits (259),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>gb|KFK33188.1| hypothetical protein AALP_AA6G341500 [Arabis alpina]
Length=197

 Score =   104 bits (259),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+SQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_003549666.1| PREDICTED: 40S ribosomal protein S9-2-like [Glycine max]
 gb|KHN18541.1| 40S ribosomal protein S9-2 [Glycine soja]
 gb|KHN48678.1| 40S ribosomal protein S9-2 [Glycine soja]
Length=197

 Score =   104 bits (259),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_008341561.1| PREDICTED: 40S ribosomal protein S9-2 [Malus domestica]
Length=197

 Score =   104 bits (259),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_007138197.1| hypothetical protein PHAVU_009G188600g [Phaseolus vulgaris]
 gb|ESW10191.1| hypothetical protein PHAVU_009G188600g [Phaseolus vulgaris]
Length=197

 Score =   104 bits (259),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLI+Q+HIRVGRQVVN+PSFLVRVDSQ+HIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNIPSFLVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_009600364.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana tomentosiformis]
 ref|XP_009782105.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana sylvestris]
Length=197

 Score =   104 bits (259),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRLDSQKHIDFSLISPFGGGRPGRV  174



>ref|XP_004508755.1| PREDICTED: 40S ribosomal protein S9-2-like [Cicer arietinum]
 ref|XP_004508756.1| PREDICTED: 40S ribosomal protein S9-2-like [Cicer arietinum]
Length=197

 Score =   103 bits (258),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_002283256.1| PREDICTED: 40S ribosomal protein S9-2 [Vitis vinifera]
 ref|XP_002275166.1| PREDICTED: 40S ribosomal protein S9-2 [Vitis vinifera]
 emb|CBI22191.3| unnamed protein product [Vitis vinifera]
 emb|CBI15244.3| unnamed protein product [Vitis vinifera]
Length=197

 Score =   103 bits (258),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSFLVR+DSQ+HIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFLVRMDSQKHIDFSLTSPLGGGRPGRV  174



>gb|AEC11023.1| 40S ribosomal protein s9, partial [Camellia sinensis]
Length=148

 Score =   102 bits (255),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+ SFLVRVDSQ+HIDFSL+SP GGGRPGRV
Sbjct  72   AKSIHHARVLIRQRHIRVGRQVVNIASFLVRVDSQKHIDFSLTSPLGGGRPGRV  125



>emb|CCA67900.1| probable 40S ribosomal protein S9 [Piriformospora indica DSM 
11827]
Length=192

 Score =   103 bits (258),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQ+VNVPSF+VR+DSQ+HIDF+L+SPFGGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVGRQIVNVPSFVVRLDSQKHIDFALTSPFGGGRPGRV  172



>ref|XP_010037164.1| PREDICTED: 40S ribosomal protein S9-2-like [Eucalyptus grandis]
 gb|KCW48831.1| hypothetical protein EUGRSUZ_K02467 [Eucalyptus grandis]
Length=197

 Score =   103 bits (258),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGGR GRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRAGRV  174



>ref|XP_006282728.1| hypothetical protein CARUB_v10005777mg [Capsella rubella]
 gb|EOA15626.1| hypothetical protein CARUB_v10005777mg [Capsella rubella]
Length=198

 Score =   103 bits (258),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIR+GRQ+VN+PSF+VRV+SQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRIGRQLVNIPSFMVRVESQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_011085760.1| PREDICTED: 40S ribosomal protein S9-2-like [Sesamum indicum]
Length=196

 Score =   103 bits (258),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQ+HIDFSL+SPFGGGR GRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRAGRV  174



>ref|XP_009389620.1| PREDICTED: 40S ribosomal protein S9-2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009411686.1| PREDICTED: 40S ribosomal protein S9-2-like [Musa acuminata subsp. 
malaccensis]
Length=197

 Score =   103 bits (258),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDS +HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSAKHIDFSLTSPFGGGRPGRV  174



>emb|CDP00311.1| unnamed protein product [Coffea canephora]
Length=197

 Score =   103 bits (258),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQ+HIDFSL+SPFGGGR GRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRAGRV  174



>ref|XP_009414866.1| PREDICTED: 40S ribosomal protein S9-2 [Musa acuminata subsp. 
malaccensis]
Length=197

 Score =   103 bits (258),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDS +HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSAKHIDFSLTSPFGGGRPGRV  174



>ref|XP_009403622.1| PREDICTED: 40S ribosomal protein S9-2-like [Musa acuminata subsp. 
malaccensis]
Length=197

 Score =   103 bits (258),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDS +HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSAKHIDFSLTSPFGGGRPGRV  174



>gb|KHN30826.1| 40S ribosomal protein S9-2 [Glycine soja]
Length=188

 Score =   103 bits (257),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLI+Q+HIRVGRQVVN+PSFLVRVDSQ+HIDFSL+SP GGGRPGRV
Sbjct  112  AKSIHHARVLIKQRHIRVGRQVVNIPSFLVRVDSQKHIDFSLTSPLGGGRPGRV  165



>ref|XP_010435836.1| PREDICTED: 40S ribosomal protein S9-2 [Camelina sativa]
 ref|XP_010441098.1| PREDICTED: 40S ribosomal protein S9-2 [Camelina sativa]
 ref|XP_010450759.1| PREDICTED: 40S ribosomal protein S9-2 [Camelina sativa]
Length=197

 Score =   103 bits (258),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+SQ+H+DFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESQKHVDFSLTSPFGGGRPGRV  174



>ref|NP_198801.1| 40S ribosomal protein S9-2 [Arabidopsis thaliana]
 sp|Q9FLF0.1|RS92_ARATH RecName: Full=40S ribosomal protein S9-2 [Arabidopsis thaliana]
 dbj|BAB10209.1| 40S ribosomal protein S9 [Arabidopsis thaliana]
 gb|AAM65655.1| 40S ribosomal protein S9-like [Arabidopsis thaliana]
 gb|ABD94071.1| At5g39850 [Arabidopsis thaliana]
 gb|AED94483.1| 40S ribosomal protein S9-2 [Arabidopsis thaliana]
Length=197

 Score =   103 bits (258),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+SQ+H+DFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESQKHVDFSLTSPFGGGRPGRV  174



>ref|XP_002870751.1| 40S ribosomal protein S9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47010.1| 40S ribosomal protein S9 [Arabidopsis lyrata subsp. lyrata]
Length=197

 Score =   103 bits (258),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+SQ+H+DFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESQKHVDFSLTSPFGGGRPGRV  174



>ref|NP_001276185.1| 40S ribosomal protein S9-2-like [Glycine max]
 ref|XP_003523030.1| PREDICTED: 40S ribosomal protein S9-2-like [Glycine max]
 ref|XP_007137996.1| hypothetical protein PHAVU_009G172300g [Phaseolus vulgaris]
 gb|ACU20562.1| unknown [Glycine max]
 gb|ESW09990.1| hypothetical protein PHAVU_009G172300g [Phaseolus vulgaris]
Length=197

 Score =   103 bits (257),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLI+Q+HIRVGRQVVN+PSFLVRVDSQ+HIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNIPSFLVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_008784330.1| PREDICTED: 40S ribosomal protein S9 [Phoenix dactylifera]
Length=116

 Score =   101 bits (252),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDS +HIDF+L+SPFGGGRPGRV
Sbjct  40   AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSAKHIDFALNSPFGGGRPGRV  93



>ref|XP_003623232.1| 40S ribosomal protein S9 [Medicago truncatula]
 gb|AES79450.1| 40S ribosomal S9-like protein [Medicago truncatula]
Length=197

 Score =   103 bits (257),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGG PGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGLPGRV  174



>ref|XP_010029477.1| PREDICTED: 40S ribosomal protein S9-2 [Eucalyptus grandis]
 gb|KCW83573.1| hypothetical protein EUGRSUZ_B00467 [Eucalyptus grandis]
Length=197

 Score =   103 bits (257),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+ SF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIASFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_006827176.1| hypothetical protein AMTR_s00010p00256040 [Amborella trichopoda]
 gb|ERM94413.1| hypothetical protein AMTR_s00010p00256040 [Amborella trichopoda]
Length=227

 Score =   104 bits (259),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SP GGGRPGRV
Sbjct  151  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  204



>ref|XP_003598026.1| 40S ribosomal protein S9 [Medicago truncatula]
 ref|XP_003598028.1| 40S ribosomal protein S9 [Medicago truncatula]
 ref|XP_003604908.1| 40S ribosomal protein S9 [Medicago truncatula]
 gb|ACJ85917.1| unknown [Medicago truncatula]
 gb|AES68277.1| 40S ribosomal S9-like protein [Medicago truncatula]
 gb|AES68279.1| 40S ribosomal S9-like protein [Medicago truncatula]
 gb|AES87105.1| 40S ribosomal S9-like protein [Medicago truncatula]
 gb|AFK39708.1| unknown [Medicago truncatula]
 gb|AFK43821.1| unknown [Medicago truncatula]
Length=197

 Score =   103 bits (257),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGG PGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGLPGRV  174



>gb|AFK40975.1| unknown [Medicago truncatula]
Length=197

 Score =   103 bits (257),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGG PGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGLPGRV  174



>emb|CDP02222.1| unnamed protein product [Coffea canephora]
Length=197

 Score =   103 bits (257),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVNVPSFLVRVDSQ+HIDFS++SPFGGGR GRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFLVRVDSQKHIDFSITSPFGGGRAGRV  174



>ref|XP_011098613.1| PREDICTED: 40S ribosomal protein S9-2 [Sesamum indicum]
Length=196

 Score =   103 bits (257),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIR+GRQVVNVPSF+VRVDSQ+HIDFSL+SPFGGGR GRV
Sbjct  121  AKSIHHARVLIRQRHIRIGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRAGRV  174



>ref|XP_006438664.1| hypothetical protein CICLE_v10033755mg [Citrus clementina]
 gb|ESR51904.1| hypothetical protein CICLE_v10033755mg [Citrus clementina]
Length=178

 Score =   102 bits (255),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVDSQ+HI+FSL+SPFGGGRPGRV
Sbjct  102  AKSIHHARVLIRQRHIRVGRQLVNIPSFVVRVDSQKHIEFSLTSPFGGGRPGRV  155



>ref|XP_008379343.1| PREDICTED: 40S ribosomal protein S9-2 [Malus domestica]
Length=197

 Score =   103 bits (256),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVDSQ+HIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_007215987.1| hypothetical protein PRUPE_ppa011733mg [Prunus persica]
 ref|XP_008230756.1| PREDICTED: 40S ribosomal protein S9-2 [Prunus mume]
 gb|EMJ17186.1| hypothetical protein PRUPE_ppa011733mg [Prunus persica]
Length=198

 Score =   103 bits (256),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFS++SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSITSPLGGGRPGRV  174



>ref|XP_005849917.1| hypothetical protein CHLNCDRAFT_56085 [Chlorella variabilis]
 gb|EFN57815.1| hypothetical protein CHLNCDRAFT_56085 [Chlorella variabilis]
Length=192

 Score =   103 bits (256),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VRVDSQ+HIDF+L+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGKQIVNIPSFMVRVDSQKHIDFALNSPFGGGRPGRV  174



>ref|XP_003637511.1| 40S ribosomal protein S9 [Medicago truncatula]
 gb|KEH42383.1| 40S ribosomal S9-like protein [Medicago truncatula]
Length=224

 Score =   103 bits (258),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SPFGGG PGRV
Sbjct  148  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGLPGRV  201



>ref|XP_005715372.1| 40S ribosomal protein S9 [Chondrus crispus]
 emb|CDF35553.1| 40S ribosomal protein S9 [Chondrus crispus]
Length=193

 Score =   103 bits (256),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHAR LIRQ+HIRVG+Q+VNVPSF+VRVDSQ+HIDFSL+SPFGGGRPGRV
Sbjct  118  AKSIHHARCLIRQRHIRVGKQLVNVPSFMVRVDSQKHIDFSLNSPFGGGRPGRV  171



>ref|XP_008808061.1| PREDICTED: 40S ribosomal protein S9-2-like, partial [Phoenix 
dactylifera]
Length=165

 Score =   102 bits (254),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDS +HIDF+L+SPFGGGRPGRV
Sbjct  89   AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSAKHIDFALNSPFGGGRPGRV  142



>sp|P49214.1|RS9_TOBAC RecName: Full=40S ribosomal protein S9; AltName: Full=S4, partial 
[Nicotiana tabacum]
 emb|CAA78463.1| RIBOSOMAL PROTEIN S4 [Nicotiana tabacum]
Length=77

 Score = 99.8 bits (247),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKS+HHARVLIRQ+HIRVGRQVVNVPSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  1    AKSVHHARVLIRQRHIRVGRQVVNVPSFMVRLDSQKHIDFSLISPFGGGRPGRV  54



>ref|XP_011399104.1| 40S ribosomal protein S9-1 [Auxenochlorella protothecoides]
 gb|KFM26208.1| 40S ribosomal protein S9-1 [Auxenochlorella protothecoides]
Length=192

 Score =   102 bits (255),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGKQIVNVPSFIVRIDSQKHIDFALNSPFGGGRPGRV  174



>ref|XP_009124855.1| PREDICTED: 40S ribosomal protein S9-2 [Brassica rapa]
Length=197

 Score =   103 bits (256),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+V+V+SQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVKVESQKHIDFSLTSPFGGGRPGRV  174



>gb|EPS73776.1| hypothetical protein M569_00980 [Genlisea aurea]
Length=197

 Score =   103 bits (256),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+H+RVGRQVVNVPSF+VR+DSQ+HIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHVRVGRQVVNVPSFMVRLDSQKHIDFSLTSPLGGGRPGRV  174



>emb|CDX74423.1| BnaA04g09660D [Brassica napus]
Length=198

 Score =   103 bits (256),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+V+V+SQ+HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVKVESQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_010937076.1| PREDICTED: 40S ribosomal protein S9-2-like [Elaeis guineensis]
Length=197

 Score =   102 bits (255),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDS +HIDF+L+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSAKHIDFALNSPFGGGRPGRV  174



>ref|XP_006438663.1| hypothetical protein CICLE_v10032800mg [Citrus clementina]
 ref|XP_006483187.1| PREDICTED: 40S ribosomal protein S9-2-like [Citrus sinensis]
 ref|XP_006483188.1| PREDICTED: 40S ribosomal protein S9-2-like [Citrus sinensis]
 gb|ESR51903.1| hypothetical protein CICLE_v10032800mg [Citrus clementina]
Length=197

 Score =   102 bits (254),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVDSQ+HI+FSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFVVRVDSQKHIEFSLTSPFGGGRPGRV  174



>emb|CDS04034.1| Putative 40S ribosomal protein S9 [Absidia idahoensis var. thermophila]
 emb|CDS05828.1| Putative 40S ribosomal protein S9 [Absidia idahoensis var. thermophila]
 emb|CDS09313.1| Putative 40S ribosomal protein S9 [Absidia idahoensis var. thermophila]
Length=190

 Score =   102 bits (254),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+QVVNVPSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVGKQVVNVPSFIVRLDSQKHIDFALTSPYGGGRPGRV  172



>gb|EKC97706.1| 40S ribosomal protein S9-A [Trichosporon asahii var. asahii CBS 
8904]
Length=193

 Score =   102 bits (254),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKS+HHARVLIRQ+HIRVG+QVVNVPSF+VR+DSQ+HIDFSL SP+GGGRPGRV
Sbjct  119  AKSVHHARVLIRQRHIRVGKQVVNVPSFVVRLDSQKHIDFSLKSPYGGGRPGRV  172



>ref|XP_003026421.1| 40S ribosomal protein S9 [Schizophyllum commune H4-8]
 gb|EFI91518.1| 40S ribosomal protein S9 [Schizophyllum commune H4-8]
Length=193

 Score =   102 bits (254),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDFSL+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFSLTSPYGGGRPGRV  172



>gb|KDD75683.1| hypothetical protein H632_c551p0 [Helicosporidium sp. ATCC 50920]
Length=203

 Score =   102 bits (254),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGR  159
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSFLVRVDSQ+HIDF+L+SPFGGGRPGR
Sbjct  132  AKSIHHARVLIRQRHIRVGKQLVNVPSFLVRVDSQKHIDFALNSPFGGGRPGR  184



>gb|KIM31691.1| hypothetical protein M408DRAFT_236801 [Serendipita vermifera 
MAFF 305830]
Length=192

 Score =   102 bits (253),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VR+DSQ+HIDFS +SPFGGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVGRQVVNVPSFVVRLDSQKHIDFSSTSPFGGGRPGRV  172



>ref|XP_006400037.1| hypothetical protein EUTSA_v10014722mg [Eutrema salsugineum]
 gb|ESQ41490.1| hypothetical protein EUTSA_v10014722mg [Eutrema salsugineum]
Length=198

 Score =   102 bits (254),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 69/69 (100%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRVkrknqk  180
            AKSIHH+RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQ+HIDF+L+SPFGGGRPGRVKR+N+K
Sbjct  121  AKSIHHSRVLIRQRHIRVGKQLVNIPSFMVRLDSQKHIDFALTSPFGGGRPGRVKRRNEK  180

Query  181  aaakkaaGG  207
            +A+KKA+GG
Sbjct  181  SASKKASGG  189



>ref|XP_005648482.1| ribosomal protein S9 component of cytosolic 80S ribosome and 
40S small subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE23938.1| ribosomal protein S9 component of cytosolic 80S ribosome and 
40S small subunit [Coccomyxa subellipsoidea C-169]
Length=180

 Score =   102 bits (253),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGR  159
            AKS+HHARVLIRQ+HIRVG+Q+VNVPSF+VRVDSQ+HIDF+L+SPFGGGRPGR
Sbjct  121  AKSMHHARVLIRQRHIRVGKQIVNVPSFMVRVDSQKHIDFALNSPFGGGRPGR  173



>ref|XP_006288701.1| hypothetical protein CARUB_v10002009mg [Capsella rubella]
 ref|XP_010453649.1| PREDICTED: 40S ribosomal protein S9-1-like [Camelina sativa]
 ref|XP_010492346.1| PREDICTED: 40S ribosomal protein S9-1-like [Camelina sativa]
 gb|EOA21599.1| hypothetical protein CARUB_v10002009mg [Capsella rubella]
Length=197

 Score =   102 bits (254),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 69/69 (100%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRVkrknqk  180
            AKSIHH+RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQ+HIDF+L+SPFGGGRPGRVKR+N+K
Sbjct  121  AKSIHHSRVLIRQRHIRVGKQLVNIPSFMVRLDSQKHIDFALTSPFGGGRPGRVKRRNEK  180

Query  181  aaakkaaGG  207
            +A+KKA+GG
Sbjct  181  SASKKASGG  189



>ref|XP_009131450.1| PREDICTED: 40S ribosomal protein S9-1 [Brassica rapa]
 ref|XP_009121599.1| PREDICTED: 40S ribosomal protein S9-1 [Brassica rapa]
 emb|CDX91003.1| BnaC02g05940D [Brassica napus]
 emb|CDX85559.1| BnaA02g02540D [Brassica napus]
 emb|CDX85058.1| BnaC05g19970D [Brassica napus]
 emb|CDX78618.1| BnaA03g05300D [Brassica napus]
 emb|CDX70599.1| BnaC03g06830D [Brassica napus]
 emb|CDX69542.1| BnaA10g18910D [Brassica napus]
Length=197

 Score =   102 bits (254),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 69/69 (100%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRVkrknqk  180
            AKSIHH+RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQ+HIDF+L+SPFGGGRPGRVKR+N+K
Sbjct  121  AKSIHHSRVLIRQRHIRVGKQLVNIPSFMVRLDSQKHIDFALTSPFGGGRPGRVKRRNEK  180

Query  181  aaakkaaGG  207
            +A+KKA+GG
Sbjct  181  SASKKASGG  189



>emb|CAB64903.1| 40S ribosomal protein S9 [Cyanophora paradoxa]
Length=101

 Score = 99.8 bits (247),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VRVDSQ+HIDF+L+SPFGGGR GRV
Sbjct  27   AKSIHHARVLIRQRHIRVGKQIVNIPSFMVRVDSQKHIDFALTSPFGGGRAGRV  80



>ref|XP_003576178.1| PREDICTED: 40S ribosomal protein S9-2-like [Brachypodium distachyon]
Length=195

 Score =   102 bits (253),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQ+VNVPSF+VRV+S++HIDFSL+SPFGGG+PGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQIVNVPSFMVRVESEKHIDFSLTSPFGGGQPGRV  174



>emb|CDY30273.1| BnaC04g31840D [Brassica napus]
Length=965

 Score =   107 bits (268),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+V+V+SQ+HIDFSL+SPFGGGRPGRV
Sbjct  889  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVKVESQKHIDFSLTSPFGGGRPGRV  942



>ref|XP_002317362.1| hypothetical protein POPTR_0011s09670g [Populus trichocarpa]
 gb|ABK93285.1| unknown [Populus trichocarpa]
 gb|EEE97974.1| hypothetical protein POPTR_0011s09670g [Populus trichocarpa]
Length=197

 Score =   102 bits (253),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLI+Q+HIRVGRQ VN+PSF+VRVDSQ+HIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIKQRHIRVGRQAVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_006380606.1| hypothetical protein POPTR_0007s09750g [Populus trichocarpa]
 gb|ERP58403.1| hypothetical protein POPTR_0007s09750g [Populus trichocarpa]
Length=197

 Score =   102 bits (253),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLI+Q+H RVGRQVVN+PSF+VRVDSQ+HIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIKQRHTRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>gb|EXX79183.1| ribosomal 40S subunit protein S9A [Rhizophagus irregularis DAOM 
197198w]
Length=159

 Score =   100 bits (250),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  88   AKSIHHARVLIRQRHIRVGKQIVNIPSFIVRLDSQKHIDFALTSPYGGGRPGRV  141



>gb|ACF79847.1| unknown [Zea mays]
Length=112

 Score = 99.8 bits (247),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVDS++HIDFSL+SP GGG PGRV
Sbjct  40   AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVDSEKHIDFSLTSPLGGGEPGRV  93



>emb|CEI90627.1| Putative 40S ribosomal protein S9 [Rhizopus microsporus]
Length=191

 Score =   101 bits (252),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPYGGGRPGRV  172



>gb|EGD95527.1| ribosomal protein S9 [Trichophyton tonsurans CBS 112818]
 gb|EGE05828.1| ribosomal protein S9 [Trichophyton equinum CBS 127.97]
 gb|EZF31376.1| 40S ribosomal protein S9 [Trichophyton interdigitale H6]
 gb|KDB21176.1| 40S ribosomal protein S9 [Trichophyton interdigitale MR816]
Length=191

 Score =   101 bits (252),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDFSL+SP GGGRPGRV
Sbjct  117  AKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFSLTSPLGGGRPGRV  170



>gb|EXX79184.1| ribosomal 40S subunit protein S9A [Rhizophagus irregularis DAOM 
197198w]
Length=190

 Score =   101 bits (252),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVGKQIVNIPSFIVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_003237660.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 118892]
 gb|EGD86111.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 118892]
 gb|EZF11976.1| 40S ribosomal protein S9 [Trichophyton rubrum MR850]
 gb|EZF38837.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 100081]
 gb|EZF49469.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 288.86]
 gb|EZF60077.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 289.86]
 gb|EZF70598.1| 40S ribosomal protein S9 [Trichophyton soudanense CBS 452.61]
 gb|EZF81480.1| 40S ribosomal protein S9 [Trichophyton rubrum MR1448]
 gb|EZF92037.1| 40S ribosomal protein S9 [Trichophyton rubrum MR1459]
 gb|EZG03407.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 735.88]
 gb|EZG13613.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 202.88]
 gb|KDB30580.1| 40S ribosomal protein S9 [Trichophyton rubrum D6]
Length=191

 Score =   101 bits (252),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDFSL+SP GGGRPGRV
Sbjct  117  AKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFSLTSPLGGGRPGRV  170



>ref|XP_003577383.1| PREDICTED: 40S ribosomal protein S9-2-like [Brachypodium distachyon]
Length=195

 Score =   101 bits (252),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VRVDS++HIDFSL+SPFGGG PGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGKQIVNIPSFMVRVDSEKHIDFSLTSPFGGGNPGRV  174



>gb|ACU15321.1| unknown [Glycine max]
Length=222

 Score =   102 bits (253),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQ+HIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_010420178.1| PREDICTED: 40S ribosomal protein S9-1 [Camelina sativa]
Length=198

 Score =   101 bits (252),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHH+RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQ+HIDF+L+SPFGGGRPGRV
Sbjct  121  AKSIHHSRVLIRQRHIRVGKQLVNIPSFMVRLDSQKHIDFALTSPFGGGRPGRV  174



>ref|XP_010939529.1| PREDICTED: 40S ribosomal protein S9-2-like [Elaeis guineensis]
Length=197

 Score =   101 bits (252),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVDS +HIDF+L+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVDSAKHIDFALNSPFGGGRPGRV  174



>ref|XP_002873713.1| 40S ribosomal protein S9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49972.1| 40S ribosomal protein S9 [Arabidopsis lyrata subsp. lyrata]
Length=198

 Score =   101 bits (252),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHH+RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQ+HIDF+L+SPFGGGRPGRV
Sbjct  121  AKSIHHSRVLIRQRHIRVGKQLVNIPSFMVRLDSQKHIDFALTSPFGGGRPGRV  174



>ref|NP_197024.1| 40S ribosomal protein S9-1 [Arabidopsis thaliana]
 sp|Q9LXG1.1|RS91_ARATH RecName: Full=40S ribosomal protein S9-1 [Arabidopsis thaliana]
 emb|CAB89330.1| 40S ribosomal protein-like [Arabidopsis thaliana]
 gb|AAR24214.1| At5g15200 [Arabidopsis thaliana]
 gb|AAR92351.1| At5g15200 [Arabidopsis thaliana]
 dbj|BAF00367.1| 40S ribosomal protein - like [Arabidopsis thaliana]
 gb|AED92128.1| 40S ribosomal protein S9-1 [Arabidopsis thaliana]
Length=198

 Score =   101 bits (252),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHH+RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQ+HIDF+L+SPFGGGRPGRV
Sbjct  121  AKSIHHSRVLIRQRHIRVGKQLVNIPSFMVRLDSQKHIDFALTSPFGGGRPGRV  174



>ref|XP_001824638.1| 40S ribosomal protein S9 [Aspergillus oryzae RIB40]
 ref|XP_002383988.1| 40S ribosomal protein S9 [Aspergillus flavus NRRL3357]
 dbj|BAE63505.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EED46452.1| 40S ribosomal protein S9 [Aspergillus flavus NRRL3357]
 gb|EIT72324.1| ribosomal protein [Aspergillus oryzae 3.042]
 gb|KDE75201.1| ribosomal protein [Aspergillus oryzae 100-8]
Length=193

 Score =   101 bits (252),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLI+Q+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIKQRHIRVGKQIVNVPSFMVRLDSQKHIDFALTSPYGGGRPGRV  172



>gb|ESA03224.1| hypothetical protein GLOINDRAFT_243564 [Rhizophagus irregularis 
DAOM 181602]
Length=186

 Score =   101 bits (251),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVGKQIVNIPSFIVRLDSQKHIDFALTSPYGGGRPGRV  172



>gb|KDQ62955.1| hypothetical protein JAAARDRAFT_28926 [Jaapia argillacea MUCL 
33604]
Length=193

 Score =   101 bits (251),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_001945527.1| PREDICTED: 40S ribosomal protein S9 [Acyrthosiphon pisum]
 gb|AFN37233.1| ribosomal protein s9 [Aphis glycines]
Length=197

 Score =   101 bits (251),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVNVPSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNVPSFIVRLDSQKHIDFSLKSPFGGGRPGRV  174



>gb|KHN77380.1| 40S ribosomal protein S9 [Toxocara canis]
Length=253

 Score =   102 bits (254),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQKHIRV RQ+VNVPSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  180  AKSIHHARVLIRQKHIRVRRQIVNVPSFIVRLDSQKHIDFSLKSPFGGGRPGRV  233



>ref|XP_007860645.1| ribosomal protein S4 [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ60181.1| ribosomal protein S4 [Gloeophyllum trabeum ATCC 11539]
Length=193

 Score =   101 bits (251),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_008780681.1| PREDICTED: 40S ribosomal protein S9-2 [Phoenix dactylifera]
 ref|XP_008780688.1| PREDICTED: 40S ribosomal protein S9-2 [Phoenix dactylifera]
 ref|XP_008780693.1| PREDICTED: 40S ribosomal protein S9-2 [Phoenix dactylifera]
Length=197

 Score =   101 bits (251),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDS +HIDFSL+SPFGGG PGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSAKHIDFSLTSPFGGGCPGRV  174



>gb|ABR25839.1| 40S ribosomal protein S9 [Oryza sativa Indica Group]
Length=116

 Score = 99.4 bits (246),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+S++HIDFSL+SPFGGG PGRV
Sbjct  42   AKSIHHARVLIRQRHIRVGRQIVNIPSFMVRVESEKHIDFSLTSPFGGGPPGRV  95



>gb|EXX62810.1| ribosomal 40S subunit protein S9A [Rhizophagus irregularis DAOM 
197198w]
Length=197

 Score =   101 bits (251),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  126  AKSIHHARVLIRQRHIRVGKQIVNIPSFIVRLDSQKHIDFALTSPYGGGRPGRV  179



>gb|EYE96132.1| ribosomal protein S4 [Aspergillus ruber CBS 135680]
Length=144

 Score = 99.8 bits (247),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLI+Q+HIRVG+Q+VNVPS++VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  70   AKSIHHARVLIKQRHIRVGKQIVNVPSYMVRLDSQKHIDFALTSPYGGGRPGRV  123



>ref|XP_001754369.1| predicted protein [Physcomitrella patens]
 ref|XP_001761244.1| predicted protein [Physcomitrella patens]
 gb|EDQ73966.1| predicted protein [Physcomitrella patens]
 gb|EDQ80819.1| predicted protein [Physcomitrella patens]
Length=198

 Score =   101 bits (251),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRVkrknqk  180
            AKSIHHARVLI+Q+HIRVG+Q+V+VPSF+VRVDSQ+H+DF+LSSP GGGRPGRVKRKN K
Sbjct  121  AKSIHHARVLIKQRHIRVGKQIVDVPSFMVRVDSQKHVDFALSSPLGGGRPGRVKRKNMK  180

Query  181  aaakkaaGG  207
            AA+KKA+GG
Sbjct  181  AASKKASGG  189



>ref|XP_001767226.1| predicted protein [Physcomitrella patens]
 gb|EDQ67907.1| predicted protein [Physcomitrella patens]
Length=198

 Score =   101 bits (251),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRVkrknqk  180
            AKSIHHARVLI+Q+HIRVG+Q+V+VPSF+VRVDSQ+H+DF+LSSP GGGRPGRVKRKN K
Sbjct  121  AKSIHHARVLIKQRHIRVGKQIVDVPSFMVRVDSQKHVDFALSSPLGGGRPGRVKRKNMK  180

Query  181  aaakkaaGG  207
            AA+KKA+GG
Sbjct  181  AASKKASGG  189



>ref|XP_001777561.1| predicted protein [Physcomitrella patens]
 gb|EDQ57604.1| predicted protein [Physcomitrella patens]
Length=197

 Score =   101 bits (251),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRVkrknqk  180
            AKSIHHARVLI+Q+HIRVG+Q+V+VPSF+VRVDSQ+H+DF+LSSP GGGRPGRVKRKN K
Sbjct  121  AKSIHHARVLIKQRHIRVGKQIVDVPSFMVRVDSQKHVDFALSSPLGGGRPGRVKRKNMK  180

Query  181  aaakkaaGG  207
            AA+KKA+GG
Sbjct  181  AASKKASGG  189



>gb|EAY81474.1| hypothetical protein OsI_36648 [Oryza sativa Indica Group]
Length=76

 Score = 97.8 bits (242),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+S++HIDFSL+SPFGGG PGRV
Sbjct  2    AKSIHHARVLIRQRHIRVGRQIVNIPSFMVRVESEKHIDFSLTSPFGGGPPGRV  55



>ref|XP_001270715.1| 40S ribosomal protein S9 [Aspergillus clavatus NRRL 1]
 gb|EAW09289.1| 40S ribosomal protein S9 [Aspergillus clavatus NRRL 1]
Length=193

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLI+Q+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIKQRHIRVGKQIVNVPSFMVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_009540632.1| hypothetical protein HETIRDRAFT_456594 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW86629.1| hypothetical protein HETIRDRAFT_456594 [Heterobasidion irregulare 
TC 32-1]
Length=193

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_009383889.1| PREDICTED: 40S ribosomal protein S9-2-like [Musa acuminata subsp. 
malaccensis]
Length=197

 Score =   101 bits (251),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+ SF+VRVDS +HIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIASFMVRVDSAKHIDFSLTSPFGGGRPGRV  174



>gb|KIY62147.1| ribosomal protein S4 [Cylindrobasidium torrendii FP15055 ss-10]
Length=193

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_001829481.1| 40S ribosomal protein S9 [Coprinopsis cinerea okayama7#130]
 gb|EAU92441.1| 40S ribosomal protein S9 [Coprinopsis cinerea okayama7#130]
Length=192

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_011180539.1| PREDICTED: 40S ribosomal protein S9 [Bactrocera cucurbitae]
 ref|XP_011208927.1| PREDICTED: 40S ribosomal protein S9 [Bactrocera dorsalis]
Length=195

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV RQVVN+PSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRRQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRV  174



>ref|NP_001176641.1| Os11g0602501 [Oryza sativa Japonica Group]
 dbj|BAH95369.1| Os11g0602501, partial [Oryza sativa Japonica Group]
Length=94

 Score = 98.2 bits (243),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+S++HIDFSL+SPFGGG PGRV
Sbjct  20   AKSIHHARVLIRQRHIRVGRQIVNIPSFMVRVESEKHIDFSLTSPFGGGPPGRV  73



>ref|XP_004518997.1| PREDICTED: 40S ribosomal protein S9-like [Ceratitis capitata]
Length=195

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV RQVVN+PSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRRQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRV  174



>ref|XP_007002505.1| 40S ribosomal protein S9, partial [Tremella mesenterica DSM 1558]
 gb|EIW71646.1| 40S ribosomal protein S9, partial [Tremella mesenterica DSM 1558]
Length=194

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKS+HHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HID+SL+SP+GGGRPGRV
Sbjct  119  AKSVHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDYSLTSPYGGGRPGRV  172



>emb|CDO74409.1| hypothetical protein BN946_scf184867.g7 [Trametes cinnabarina]
Length=193

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_007379209.1| 40S ribosomal protein S9 [Punctularia strigosozonata HHB-11173 
SS5]
 gb|EIN14292.1| 40S ribosomal protein S9 [Punctularia strigosozonata HHB-11173 
SS5]
Length=193

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>gb|KIY51995.1| ribosomal protein S4 [Fistulina hepatica ATCC 64428]
Length=193

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGKQIVNVPSFTVRLDSQKHIDFALTSPYGGGRPGRV  174



>gb|EMD42348.1| 40S ribosomal protein S9 [Ceriporiopsis subvermispora B]
Length=192

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_006964217.1| ribosomal protein S9, S4 family [Trichoderma reesei QM6a]
 gb|EGR49873.1| ribosomal protein S9, S4 family [Trichoderma reesei QM6a]
 gb|ETS03579.1| ribosomal protein S4, partial [Trichoderma reesei RUT C-30]
Length=191

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SPFG GRPGRV
Sbjct  117  AKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPFGNGRPGRV  170



>ref|XP_007265130.1| 40S ribosomal protein S9 [Fomitiporia mediterranea MF3/22]
 gb|EJD03529.1| 40S ribosomal protein S9 [Fomitiporia mediterranea MF3/22]
Length=193

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_007853601.1| 40s ribosomal protein s9 [Moniliophthora roreri MCA 2997]
 gb|ESK87090.1| 40s ribosomal protein s9 [Moniliophthora roreri MCA 2997]
Length=192

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_662407.1| RS9_PODAN 40S ribosomal protein S9 (S7) [Aspergillus nidulans 
FGSC A4]
 gb|EAA60373.1| RS9_PODAN 40S ribosomal protein S9 (S7) [Aspergillus nidulans 
FGSC A4]
 tpe|CBF76749.1| TPA: hypothetical protein similar to 40S ribosomal protein S9 
(Broad) [Aspergillus nidulans FGSC A4]
Length=193

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLI+Q+HIRVG+Q+VNVPS++VR+DSQ+HIDF+L+SPFGGGRPGRV
Sbjct  119  AKSIHHARVLIKQRHIRVGKQIVNVPSYMVRLDSQKHIDFALTSPFGGGRPGRV  172



>gb|KIO07111.1| hypothetical protein M404DRAFT_998525 [Pisolithus tinctorius 
Marx 270]
Length=193

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_008032443.1| 40S ribosomal protein S9 [Trametes versicolor FP-101664 SS1]
 gb|EIW63864.1| 40S ribosomal protein S9 [Trametes versicolor FP-101664 SS1]
Length=193

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_002540920.1| 40S ribosomal protein S9 [Uncinocarpus reesii 1704]
 gb|EEP75587.1| 40S ribosomal protein S9 [Uncinocarpus reesii 1704]
Length=188

 Score =   100 bits (249),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLI+Q+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SPFG GRPGRV
Sbjct  115  AKSIHHARVLIKQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPFGSGRPGRV  168



>ref|XP_003056784.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58429.1| predicted protein [Micromonas pusilla CCMP1545]
Length=196

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKS+HHARVLIRQ+HIRVG+Q+VNVPSFLVR DSQ+HIDF+L+SP GGGRPGRV
Sbjct  121  AKSVHHARVLIRQRHIRVGKQIVNVPSFLVRTDSQKHIDFALNSPLGGGRPGRV  174



>dbj|BAA78592.1| 40S ribosomal protein S9 [Chlamydomonas sp. HS-5]
Length=192

 Score =   100 bits (249),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLI+Q HIRVG+QVVN+PSF+VRVDSQ+H+DF+L+SPFGGGRPGR 
Sbjct  121  AKSIHHARVLIKQNHIRVGKQVVNIPSFMVRVDSQKHVDFALTSPFGGGRPGRC  174



>ref|XP_007307288.1| 40S ribosomal protein S9, partial [Stereum hirsutum FP-91666 
SS1]
 gb|EIM83555.1| 40S ribosomal protein S9, partial [Stereum hirsutum FP-91666 
SS1]
Length=192

 Score =   100 bits (249),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  117  AKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  170



>ref|XP_003172904.1| 40S ribosomal protein S9 [Microsporum gypseum CBS 118893]
 gb|EFR02493.1| 40S ribosomal protein S9 [Microsporum gypseum CBS 118893]
Length=191

 Score =   100 bits (249),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLI+Q+HIRVG+Q+VNVPSF+VR+DSQ+HIDFSL+SP GGGRPGRV
Sbjct  117  AKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKHIDFSLTSPLGGGRPGRV  170



>ref|XP_002842953.1| 40S ribosomal protein S9 [Arthroderma otae CBS 113480]
 gb|EEQ35217.1| 40S ribosomal protein S9 [Arthroderma otae CBS 113480]
Length=191

 Score =   100 bits (249),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLI+Q+HIRVG+Q+VNVPSF+VR+DSQ+HIDFSL+SP GGGRPGRV
Sbjct  117  AKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDSQKHIDFSLTSPLGGGRPGRV  170



>gb|AEE62422.1| unknown [Dendroctonus ponderosae]
Length=194

 Score =   100 bits (249),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLKSPFGGGRPGRV  174



>gb|KIM62296.1| hypothetical protein SCLCIDRAFT_1215157 [Scleroderma citrinum 
Foug A]
Length=193

 Score =   100 bits (249),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>gb|KDQ31494.1| hypothetical protein PLEOSDRAFT_1054562 [Pleurotus ostreatus 
PC15]
Length=193

 Score =   100 bits (249),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_004304310.1| PREDICTED: 40S ribosomal protein S9-2 [Fragaria vesca subsp. 
vesca]
Length=197

 Score =   100 bits (249),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VR+DS++HIDF+++SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRIDSEKHIDFAITSPLGGGRPGRV  174



>gb|EJW71676.1| 30S ribosomal protein S4 [Wuchereria bancrofti]
Length=102

 Score = 98.2 bits (243),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQKHIRV RQ+VNVPSF+VR+DSQ+HIDFSL SPFGGGR GRV
Sbjct  29   AKSIHHARVLIRQKHIRVRRQIVNVPSFIVRLDSQKHIDFSLKSPFGGGRAGRV  82



>gb|KIK29928.1| hypothetical protein PISMIDRAFT_671906 [Pisolithus microcarpus 
441]
Length=193

 Score =   100 bits (249),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|NP_001131442.1| uncharacterized protein LOC100192774 [Zea mays]
 gb|ACG30355.1| 40S ribosomal protein S9 [Zea mays]
 gb|AFW87984.1| 40S ribosomal protein S9 [Zea mays]
Length=193

 Score =   100 bits (249),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVDS++HIDFSL+SP GGG PGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVDSEKHIDFSLTSPLGGGEPGRV  174



>emb|CAH04322.1| S9e ribosomal protein [Meladema coriacea]
Length=193

 Score =   100 bits (249),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLKSPFGGGRPGRV  174



>gb|KDR85862.1| hypothetical protein GALMADRAFT_132501 [Galerina marginata CBS 
339.88]
Length=193

 Score =   100 bits (249),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>dbj|BAN20249.1| ribosomal protein S9 [Riptortus pedestris]
Length=193

 Score =   100 bits (249),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLKSPFGGGRPGRV  174



>ref|XP_007391198.1| hypothetical protein PHACADRAFT_248675 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM61799.1| hypothetical protein PHACADRAFT_248675 [Phanerochaete carnosa 
HHB-10118-sp]
Length=193

 Score =   100 bits (249),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_011497696.1| PREDICTED: 40S ribosomal protein S9 [Ceratosolen solmsi marchali]
Length=193

 Score =   100 bits (249),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLKSPFGGGRPGRV  174



>ref|XP_004962962.1| PREDICTED: 40S ribosomal protein S9-2-like [Setaria italica]
Length=195

 Score =   100 bits (249),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLI+Q+HIRVGRQ+VNVPSF+VRV+S++HIDFSLSSPFGGG PGRV
Sbjct  121  AKSIHHARVLIKQRHIRVGRQIVNVPSFMVRVESEKHIDFSLSSPFGGGPPGRV  174



>gb|ABG01900.1| S9 ribosomal protein [Gryllus rubens]
Length=177

 Score =   100 bits (248),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  124  AKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLKSPFGGGRPGRV  177



>gb|EPS99409.1| hypothetical protein FOMPIDRAFT_1024265 [Fomitopsis pinicola 
FP-58527 SS1]
Length=192

 Score =   100 bits (249),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_002471051.1| ribosomal protein S9 [Postia placenta Mad-698-R]
 ref|XP_002474479.1| 40S ribosomal protein S9 [Postia placenta Mad-698-R]
 gb|EED80345.1| 40S ribosomal protein S9 [Postia placenta Mad-698-R]
 gb|EED83708.1| ribosomal protein S9 [Postia placenta Mad-698-R]
Length=192

 Score =   100 bits (249),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>emb|CAJ17220.1| ribosomal protein S9e [Sphaerius sp. APV-2005]
Length=193

 Score =   100 bits (249),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLKSPFGGGRPGRV  174



>gb|KIK68304.1| hypothetical protein GYMLUDRAFT_35690 [Gymnopus luxurians FD-317 
M1]
Length=193

 Score =   100 bits (249),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_002629546.1| 40S ribosomal protein S9 [Blastomyces dermatitidis SLH14081]
 gb|EEQ69974.1| 40S ribosomal protein S9 [Blastomyces dermatitidis SLH14081]
 gb|EEQ91116.1| 40S ribosomal protein S9 [Blastomyces dermatitidis ER-3]
 gb|EGE82757.1| 40S ribosomal protein S9 [Blastomyces dermatitidis ATCC 18188]
 gb|EQL29231.1| 40S ribosomal protein S9 [Blastomyces dermatitidis ATCC 26199]
Length=191

 Score =   100 bits (248),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SPFG GRPGRV
Sbjct  117  AKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPFGEGRPGRV  170



>gb|ABG01896.1| S9 ribosomal protein [Gryllus firmus]
 gb|ABG01897.1| S9 ribosomal protein [Gryllus bimaculatus]
 gb|ABG01898.1| S9 ribosomal protein [Gryllus veletis]
 gb|ABG01899.1| S9 ribosomal protein [Gryllus pennsylvanicus]
Length=184

 Score =   100 bits (248),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  124  AKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLKSPFGGGRPGRV  177



>ref|XP_003014786.1| hypothetical protein ARB_07347 [Arthroderma benhamiae CBS 112371]
 gb|EFE33883.1| hypothetical protein ARB_07347 [Arthroderma benhamiae CBS 112371]
Length=247

 Score =   101 bits (251),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDFSL+SP GGGRPGRV
Sbjct  173  AKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFSLTSPLGGGRPGRV  226



>gb|AAT08735.1| 40S ribosomal protein S9 [Hyacinthus orientalis]
Length=197

 Score =   100 bits (249),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQVVNVPSFLV+++S +HIDF+LSSPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFLVKLESGKHIDFALSSPFGGGRPGRV  174



>emb|CEG76087.1| Putative 40S ribosomal protein S9 [Rhizopus microsporus]
Length=101

 Score = 97.8 bits (242),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SP+GGGR GRV
Sbjct  29   AKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPYGGGRAGRV  82



>ref|XP_002442158.1| hypothetical protein SORBIDRAFT_08g015270 [Sorghum bicolor]
 gb|EES15996.1| hypothetical protein SORBIDRAFT_08g015270 [Sorghum bicolor]
Length=195

 Score =   100 bits (249),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLI+Q+HIRVGRQ+VNVPSF+VRV+S++HIDFSLSSPFGGG PGRV
Sbjct  121  AKSIHHARVLIKQRHIRVGRQIVNVPSFMVRVESEKHIDFSLSSPFGGGPPGRV  174



>pdb|3J60|J Chain J, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
Length=195

 Score =   100 bits (248),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+S++HIDFSL+SPFGGG PGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQIVNIPSFMVRVESEKHIDFSLTSPFGGGPPGRV  174



>ref|XP_001419792.1| Ribosomal protein S9, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO98085.1| Ribosomal protein S9, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=194

 Score =   100 bits (248),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKS+HHARVLIRQ+HIRVG+Q+VNVPSFLVR DSQ+HIDF+L+SP GGGRPGRV
Sbjct  121  AKSVHHARVLIRQRHIRVGKQIVNVPSFLVRTDSQKHIDFALNSPLGGGRPGRV  174



>emb|CEF99084.1| Ribosomal protein S4/S9, eukaryotic/archaeal [Ostreococcus tauri]
Length=192

 Score =   100 bits (248),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKS+HHARVLIRQ+HIRVG+Q+VNVPSFLVR DSQ+HIDF+L+SP GGGRPGRV
Sbjct  121  AKSVHHARVLIRQRHIRVGKQIVNVPSFLVRTDSQKHIDFALNSPLGGGRPGRV  174



>gb|AAX62465.1| ribosomal protein S9 [Lysiphlebus testaceipes]
 gb|AAX62466.1| ribosomal protein S9 variant 1 [Lysiphlebus testaceipes]
Length=194

 Score =   100 bits (248),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRV  174



>ref|XP_005181976.1| PREDICTED: 40S ribosomal protein S9 [Musca domestica]
Length=194

 Score =   100 bits (248),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRV  174



>ref|XP_003025614.1| hypothetical protein TRV_00254 [Trichophyton verrucosum HKI 0517]
 gb|EFE45003.1| hypothetical protein TRV_00254 [Trichophyton verrucosum HKI 0517]
Length=271

 Score =   101 bits (252),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDFSL+SP GGGRPGRV
Sbjct  197  AKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFSLTSPLGGGRPGRV  250



>gb|KDR16262.1| 40S ribosomal protein S9 [Zootermopsis nevadensis]
Length=194

 Score =   100 bits (248),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLKSPFGGGRPGRV  174



>ref|XP_003194223.1| 40S ribosomal protein S9-A [Cryptococcus gattii WM276]
 gb|ADV22436.1| 40S ribosomal protein S9-A [Cryptococcus gattii WM276]
 gb|KGB77955.1| 40S ribosomal protein S9 [Cryptococcus gattii R265]
 gb|KIR29422.1| 40S ribosomal protein S9 [Cryptococcus gattii LA55]
 gb|KIR34615.1| 40S ribosomal protein S9 [Cryptococcus gattii MMRL2647]
 gb|KIR39449.1| 40S ribosomal protein S9 [Cryptococcus gattii Ram5]
 gb|KIR46839.1| 40S ribosomal protein S9 [Cryptococcus gattii CA1280]
 gb|KIR56623.1| 40S ribosomal protein S9 [Cryptococcus gattii Ru294]
 gb|KIR60063.1| 40S ribosomal protein S9 [Cryptococcus gattii CA1873]
 gb|KIR73784.1| 40S ribosomal protein S9 [Cryptococcus gattii CA1014]
 gb|KIR78539.1| 40S ribosomal protein S9 [Cryptococcus gattii EJB2]
 gb|KIR85851.1| 40S ribosomal protein S9 [Cryptococcus gattii IND107]
 gb|KIR93276.1| 40S ribosomal protein S9 [Cryptococcus gattii CBS 10090]
 gb|KIR99461.1| 40S ribosomal protein S9 [Cryptococcus gattii 2001/935-1]
 gb|KIY34719.1| 40S ribosomal protein S9 [Cryptococcus gattii E566]
 gb|KIY59079.1| 40S ribosomal protein S9 [Cryptococcus gattii 99/473]
 gb|KJE00570.1| 40S ribosomal protein S9 [Cryptococcus gattii NT-10]
Length=192

 Score =   100 bits (248),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKS+HHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HID++L+SP+GGGRPGRV
Sbjct  119  AKSVHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDYALTSPYGGGRPGRV  172



>ref|XP_967635.1| PREDICTED: 40S ribosomal protein S9 [Tribolium castaneum]
 gb|EFA09067.1| hypothetical protein TcasGA2_TC006782 [Tribolium castaneum]
Length=194

 Score =   100 bits (248),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLKSPFGGGRPGRV  174



>ref|XP_002007973.1| GI12083 [Drosophila mojavensis]
 gb|EDW18449.1| GI12083 [Drosophila mojavensis]
Length=195

 Score =   100 bits (248),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRV  174



>ref|XP_001400515.1| 40S ribosomal protein S9 [Aspergillus niger CBS 513.88]
 emb|CAK37968.1| unnamed protein product [Aspergillus niger]
 gb|EHA23566.1| hypothetical protein ASPNIDRAFT_55644 [Aspergillus niger ATCC 
1015]
 dbj|GAA84261.1| 40S ribosomal protein S9 [Aspergillus kawachii IFO 4308]
Length=193

 Score =   100 bits (248),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLI+Q+HIRVG+Q+VNVPS++VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIKQRHIRVGKQIVNVPSYMVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_001263755.1| 40S ribosomal protein S9 [Neosartorya fischeri NRRL 181]
 gb|EAW21858.1| 40S ribosomal protein S9 [Neosartorya fischeri NRRL 181]
Length=193

 Score =   100 bits (248),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLI+Q+HIRVG+Q+VNVPS++VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIKQRHIRVGKQIVNVPSYMVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_001217311.1| 40S ribosomal protein S9 [Aspergillus terreus NIH2624]
 gb|EAU30857.1| 40S ribosomal protein S9 [Aspergillus terreus NIH2624]
Length=193

 Score =   100 bits (248),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLI+Q+HIRVG+Q+VNVPS++VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIKQRHIRVGKQIVNVPSYMVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_006671722.1| 40S ribosomal protein S9 (S7) [Cordyceps militaris CM01]
 gb|EGX90098.1| 40S ribosomal protein S9 (S7) [Cordyceps militaris CM01]
Length=190

 Score =   100 bits (248),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SPFG GRPGRV
Sbjct  117  AKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALNSPFGSGRPGRV  170



>ref|XP_001984182.1| GH15146 [Drosophila grimshawi]
 gb|EDV96530.1| GH15146 [Drosophila grimshawi]
Length=195

 Score =   100 bits (248),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRV  174



>gb|KIK37123.1| hypothetical protein CY34DRAFT_810663 [Suillus luteus UH-Slu-Lm8-n1]
Length=194

 Score =   100 bits (248),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  120  AKSIHHARVLIRQRHIRVGKQIVNIPSFVVRLDSQKHIDFALTSPYGGGRPGRV  173



>ref|XP_003400837.1| PREDICTED: 40S ribosomal protein S9-like [Bombus terrestris]
 ref|XP_003493048.1| PREDICTED: 40S ribosomal protein S9-like [Bombus impatiens]
 ref|XP_003697513.1| PREDICTED: 40S ribosomal protein S9-like isoform 1 [Apis florea]
 ref|XP_003702864.1| PREDICTED: 40S ribosomal protein S9-like [Megachile rotundata]
 ref|XP_392726.3| PREDICTED: 40S ribosomal protein S9 isoform X1 [Apis mellifera]
 ref|XP_006611572.1| PREDICTED: 40S ribosomal protein S9-like [Apis dorsata]
Length=193

 Score =   100 bits (248),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLKSPFGGGRPGRV  174



>ref|XP_001754496.1| predicted protein [Physcomitrella patens]
 gb|EDQ80466.1| predicted protein [Physcomitrella patens]
Length=198

 Score =   100 bits (248),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRVkrknqk  180
            AKSIHHARVLI+Q+HIRVG+Q+V+VPSF+VR+DSQ+H+DF+LSSP GGGRPGRVKRKN K
Sbjct  121  AKSIHHARVLIKQRHIRVGKQIVDVPSFMVRLDSQKHVDFALSSPLGGGRPGRVKRKNMK  180

Query  181  aaakkaaGG  207
            AA+KKA+GG
Sbjct  181  AASKKASGG  189



>ref|XP_002047289.1| GJ13353 [Drosophila virilis]
 gb|EDW69631.1| GJ13353 [Drosophila virilis]
Length=195

 Score =   100 bits (248),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRV  174



>ref|NP_524004.2| ribosomal protein S9, isoform A [Drosophila melanogaster]
 ref|NP_729506.1| ribosomal protein S9, isoform D [Drosophila melanogaster]
 ref|NP_001287008.1| ribosomal protein S9, isoform E [Drosophila melanogaster]
 ref|XP_001972186.1| GG14025 [Drosophila erecta]
 ref|XP_002029892.1| GM24860 [Drosophila sechellia]
 ref|XP_002093291.1| RpS9 [Drosophila yakuba]
 ref|XP_002084280.1| GD12912 [Drosophila simulans]
 sp|P55935.2|RS9_DROME RecName: Full=40S ribosomal protein S9 [Drosophila melanogaster]
 pdb|3J38|J Chain J, Structure Of The D. Melanogaster 40s Ribosomal Proteins
 gb|AAF50249.1| ribosomal protein S9, isoform A [Drosophila melanogaster]
 gb|AAN11946.1| ribosomal protein S9, isoform D [Drosophila melanogaster]
 gb|EDV51212.1| GG14025 [Drosophila erecta]
 gb|EDW40878.1| GM24860 [Drosophila sechellia]
 gb|EDW93003.1| RpS9 [Drosophila yakuba]
 gb|EDX09865.1| GD12912 [Drosophila simulans]
 gb|ACT80127.1| LD13662p [Drosophila melanogaster]
 gb|AHN58033.1| ribosomal protein S9, isoform E [Drosophila melanogaster]
Length=195

 Score =   100 bits (248),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRV  174



>ref|XP_570885.1| hypothetical protein CNE02160 [Cryptococcus neoformans var. neoformans 
JEC21]
 ref|XP_775501.1| 40S ribosomal protein S9 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL20854.1| hypothetical protein CNBE2150 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW43578.1| hypothetical protein CNE02160 [Cryptococcus neoformans var. neoformans 
JEC21]
 gb|AFR95498.1| small subunit ribosomal protein S9 [Cryptococcus neoformans var. 
grubii H99]
Length=193

 Score =   100 bits (248),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKS+HHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HID++L+SP+GGGRPGRV
Sbjct  119  AKSVHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDYALTSPYGGGRPGRV  172



>ref|XP_003557815.1| PREDICTED: 40S ribosomal protein S9-2 [Brachypodium distachyon]
Length=195

 Score =   100 bits (248),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVD+++HIDFSL+SP GGG PGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVDTEKHIDFSLTSPLGGGEPGRV  174



>ref|XP_008601048.1| 40S ribosomal protein S9 [Beauveria bassiana ARSEF 2860]
 gb|EJP63335.1| 40S ribosomal protein S9 [Beauveria bassiana ARSEF 2860]
 gb|KGQ06651.1| 40S ribosomal protein S9 [Beauveria bassiana D1-5]
Length=190

 Score = 99.8 bits (247),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SPFG GRPGRV
Sbjct  117  AKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALNSPFGSGRPGRV  170



>ref|XP_011066131.1| PREDICTED: 40S ribosomal protein S9 [Acromyrmex echinatior]
 ref|XP_011176214.1| PREDICTED: 40S ribosomal protein S9 [Solenopsis invicta]
 ref|XP_011254627.1| PREDICTED: 40S ribosomal protein S9 [Camponotus floridanus]
 ref|XP_011254628.1| PREDICTED: 40S ribosomal protein S9 [Camponotus floridanus]
 ref|XP_011337859.1| PREDICTED: 40S ribosomal protein S9 [Cerapachys biroi]
 gb|EFN69456.1| 40S ribosomal protein S9 [Camponotus floridanus]
 gb|EFZ21050.1| hypothetical protein SINV_10506 [Solenopsis invicta]
 gb|EGI58192.1| 40S ribosomal protein S9 [Acromyrmex echinatior]
 gb|EZA54586.1| 40S ribosomal protein S9 [Cerapachys biroi]
Length=193

 Score = 99.8 bits (247),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLKSPFGGGRPGRV  174



>ref|XP_006664031.1| PREDICTED: 40S ribosomal protein S9-2-like [Oryza brachyantha]
Length=195

 Score =   100 bits (248),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQ+VNVPSF+VR++S++HIDFSL+SPFGGG PGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQIVNVPSFMVRLESEKHIDFSLTSPFGGGPPGRV  174



>ref|XP_007811695.1| 40S ribosomal protein S9 [Metarhizium acridum CQMa 102]
 ref|XP_007819904.2| hypothetical protein MAA_03715 [Metarhizium robertsii ARSEF 23]
 gb|EFY88590.1| 40S ribosomal protein S9 [Metarhizium acridum CQMa 102]
 gb|EXV03675.1| 40S ribosomal protein S4/S9 [Metarhizium robertsii]
 gb|KDB17697.1| 40S ribosomal protein S9 [Ustilaginoidea virens]
 gb|KHO00957.1| hypothetical protein MAM_01735 [Metarhizium album ARSEF 1941]
 gb|EFZ01119.2| hypothetical protein MAA_03715 [Metarhizium robertsii ARSEF 23]
 gb|KID69871.1| RNA-binding S4, partial [Metarhizium anisopliae ARSEF 549]
 gb|KID72391.1| RNA-binding S4, partial [Metarhizium brunneum ARSEF 3297]
 gb|KID89036.1| RNA-binding S4 [Metarhizium guizhouense ARSEF 977]
 gb|KIE00489.1| RNA-binding S4, partial [Metarhizium majus ARSEF 297]
Length=191

 Score = 99.8 bits (247),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SPFG GRPGRV
Sbjct  117  AKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALNSPFGSGRPGRV  170



>gb|ABD98740.1| putative S9e ribosomal protein [Graphocephala atropunctata]
Length=193

 Score = 99.8 bits (247),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRV  174



>ref|XP_001956309.1| GF24655 [Drosophila ananassae]
 ref|XP_002062512.1| GK17575 [Drosophila willistoni]
 gb|EDV39115.1| GF24655 [Drosophila ananassae]
 gb|EDW73498.1| GK17575 [Drosophila willistoni]
Length=195

 Score = 99.8 bits (247),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRV  174



>ref|NP_001049004.1| Os03g0154700 [Oryza sativa Japonica Group]
 ref|NP_001068233.1| Os11g0602600 [Oryza sativa Japonica Group]
 gb|ABA94599.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA94601.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF94048.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABG22548.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10918.1| Os03g0154700 [Oryza sativa Japonica Group]
 dbj|BAF28596.1| Os11g0602600 [Oryza sativa Japonica Group]
 gb|EAY81477.1| hypothetical protein OsI_36650 [Oryza sativa Indica Group]
 gb|EAZ18880.1| hypothetical protein OsJ_34422 [Oryza sativa Japonica Group]
 gb|ABR25448.1| 40S ribosomal protein S9 [Oryza sativa Indica Group]
 dbj|BAG96424.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87870.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93092.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96556.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96871.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96935.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC68442.1| hypothetical protein OsI_36651 [Oryza sativa Indica Group]
 gb|EEE52362.1| hypothetical protein OsJ_34424 [Oryza sativa Japonica Group]
 gb|EEE58343.1| hypothetical protein OsJ_09456 [Oryza sativa Japonica Group]
Length=195

 Score = 99.8 bits (247),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+S++HIDFSL+SPFGGG PGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQIVNIPSFMVRVESEKHIDFSLTSPFGGGPPGRV  174



>ref|XP_008544905.1| PREDICTED: 40S ribosomal protein S9 [Microplitis demolitor]
Length=193

 Score = 99.8 bits (247),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLKSPFGGGRPGRV  174



>ref|XP_009022737.1| hypothetical protein HELRODRAFT_155894 [Helobdella robusta]
 gb|ESN98765.1| hypothetical protein HELRODRAFT_155894 [Helobdella robusta]
Length=191

 Score = 99.8 bits (247),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQ+HIDFSL SP+GGGRPGRV
Sbjct  119  AKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLKSPYGGGRPGRV  172



>gb|KFG83429.1| 40S ribosomal protein S9 (S7) [Metarhizium anisopliae]
Length=204

 Score =   100 bits (248),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SPFG GRPGRV
Sbjct  130  AKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALNSPFGSGRPGRV  183



>ref|XP_001352621.1| GA28351 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002024847.1| GL17960 [Drosophila persimilis]
 ref|XP_002029028.1| GL20135 [Drosophila persimilis]
 ref|XP_002029552.1| GL21280 [Drosophila persimilis]
 gb|EAL30119.1| GA28351 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW25738.1| GL21280 [Drosophila persimilis]
 gb|EDW30320.1| GL17960 [Drosophila persimilis]
 gb|EDW39426.1| GL20135 [Drosophila persimilis]
Length=195

 Score = 99.8 bits (247),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRV  174



>gb|EQL04090.1| Ribosomal protein S4/S9 [Ophiocordyceps sinensis CO18]
Length=191

 Score = 99.8 bits (247),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SPFG GRPGRV
Sbjct  117  AKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALNSPFGSGRPGRV  170



>emb|CDH55798.1| 40s ribosomal protein s9 [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDH49579.1| 40s ribosomal protein s9 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=190

 Score = 99.8 bits (247),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+QVVNVPSF+VR+DSQ+HIDF+L+SP+GGGR GRV
Sbjct  119  AKSIHHARVLIRQRHIRVGKQVVNVPSFIVRLDSQKHIDFALTSPYGGGRAGRV  172



>emb|CCM02260.1| predicted protein [Fibroporia radiculosa]
Length=195

 Score = 99.8 bits (247),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VR+DSQ+HIDF+L+SP+GGGRPGRV
Sbjct  122  AKSIHHARVLIRQRHIRVGKQIVNIPSFVVRLDSQKHIDFALTSPYGGGRPGRV  175



>emb|CEJ91392.1| Putative 40S ribosomal protein S9 (S7) [Torrubiella hemipterigena]
Length=190

 Score = 99.8 bits (247),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQ+HIDF+L+SPFG GRPGRV
Sbjct  117  AKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALNSPFGSGRPGRV  170



>ref|XP_011144040.1| PREDICTED: 40S ribosomal protein S9 [Harpegnathos saltator]
 gb|EFN81577.1| 40S ribosomal protein S9 [Harpegnathos saltator]
Length=193

 Score = 99.8 bits (247),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLKSPFGGGRPGRV  174



>ref|XP_004984207.1| PREDICTED: 40S ribosomal protein S9-2-like [Setaria italica]
Length=194

 Score = 99.8 bits (247),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVDS++H+DFSL+SP GGG PGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVDSEKHVDFSLTSPLGGGEPGRV  174



>gb|AAR09821.1| similar to Drosophila melanogaster RpS9, partial [Drosophila 
yakuba]
Length=191

 Score = 99.8 bits (247),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQ+HIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRV  174



>ref|XP_001894478.1| 40S ribosomal protein S9 [Brugia malayi]
 emb|CDQ05962.1| Protein BM-RPS-9 [Brugia malayi]
Length=192

 Score = 99.8 bits (247),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQKHIRV RQ+VNVPSF+VR+DSQ+HIDFSL SPFGGGR GRV
Sbjct  119  AKSIHHARVLIRQKHIRVRRQIVNVPSFIVRLDSQKHIDFSLKSPFGGGRAGRV  172



>gb|ABC25036.1| ribosomal protein S9, partial [Hydra vulgaris]
Length=116

 Score = 97.4 bits (241),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQKHIRV +Q+VN+PSF+VR+DSQ+HIDFS +SPFGGGRPGRV
Sbjct  43   AKSIHHARVLIRQKHIRVRKQLVNIPSFIVRLDSQKHIDFSTNSPFGGGRPGRV  96



>ref|XP_007634519.1| PREDICTED: 40S ribosomal protein S9 isoform X2 [Cricetulus griseus]
 gb|EAW72210.1| ribosomal protein S9, isoform CRA_b [Homo sapiens]
Length=103

 Score = 97.1 bits (240),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQ+HIDFSL SP+GGGRPGRV
Sbjct  29   AKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYGGGRPGRV  82



>ref|XP_006650139.1| PREDICTED: 40S ribosomal protein S9-2-like [Oryza brachyantha]
Length=195

 Score = 99.4 bits (246),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VR+DS++HIDFSL+SP GGG PGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRLDSEKHIDFSLTSPLGGGEPGRV  174



>ref|XP_002110068.1| S9 ribosomal protein [Trichoplax adhaerens]
 gb|EDV28234.1| S9 ribosomal protein [Trichoplax adhaerens]
Length=194

 Score = 99.4 bits (246),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVNVPSF+VR+DSQ+HIDFSLSSPFGGGR GRV
Sbjct  117  AKSIHHARVLIRQRHIRVRKQVVNVPSFVVRLDSQKHIDFSLSSPFGGGRAGRV  170



>gb|ABX75477.1| 40S ribosomal protein S9 [Lycosa singoriensis]
Length=175

 Score = 99.0 bits (245),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVNVPSF+VR+DS++HIDFSL SPFGGGRPGRV
Sbjct  102  AKSIHHARVLIRQRHIRVRKQVVNVPSFVVRLDSEKHIDFSLKSPFGGGRPGRV  155



>ref|XP_002741225.1| PREDICTED: 40S ribosomal protein S9-like [Saccoglossus kowalevskii]
Length=190

 Score = 99.4 bits (246),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQ+HIDFSL SP+GGGRPGRV
Sbjct  116  AKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLKSPYGGGRPGRV  169



>ref|XP_003147914.1| 40S ribosomal protein S9 [Loa loa]
 gb|EFO16154.1| 40S ribosomal protein S9 [Loa loa]
Length=192

 Score = 99.4 bits (246),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQKHIRV RQ+VNVPSF+VR+DSQ+HIDFSL SPFGGGR GRV
Sbjct  119  AKSIHHARVLIRQKHIRVRRQIVNVPSFIVRLDSQKHIDFSLKSPFGGGRAGRV  172



>gb|ERE61325.1| 40S ribosomal protein S9-like protein, partial [Cricetulus griseus]
Length=120

 Score = 97.4 bits (241),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQRHIDFSLSSPFGGGRPGRV  162
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQ+HIDFSL SP+GGGRPGRV
Sbjct  46   AKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYGGGRPGRV  99



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559716100580