BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP009H05 581 bp,:Filtered

Length=533
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KCW61801.1|  hypothetical protein EUGRSUZ_H044981                  97.8    5e-20   Eucalyptus grandis [rose gum]
ref|XP_011023610.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  97.8    5e-20   Populus euphratica
ref|XP_010025194.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  97.8    5e-20   Eucalyptus grandis [rose gum]
emb|CDP15504.1|  unnamed protein product                              96.3    2e-19   Coffea canephora [robusta coffee]
gb|ADN92993.2|  lipoxygenase LOX1                                     95.9    2e-19   Ipomoea nil [qian niu]
ref|XP_011036799.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  95.1    4e-19   Populus euphratica
ref|XP_006382593.1|  hypothetical protein POPTR_0005s03550g           95.1    4e-19   Populus trichocarpa [western balsam poplar]
ref|XP_006382594.1|  hypothetical protein POPTR_0005s03560g           95.1    4e-19   Populus trichocarpa [western balsam poplar]
ref|XP_007208096.1|  hypothetical protein PRUPE_ppa001287mg           94.7    5e-19   Prunus persica
ref|XP_008370477.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  94.7    7e-19   Malus domestica [apple tree]
ref|XP_002319014.2|  lipoxygenase family protein                      94.4    8e-19   Populus trichocarpa [western balsam poplar]
ref|XP_008370478.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  94.4    8e-19   
emb|CAD10779.2|  lipoxygenase                                         94.0    1e-18   Prunus dulcis [sweet almond]
ref|XP_008246456.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  94.0    1e-18   Prunus mume [ume]
gb|KDO74650.1|  hypothetical protein CISIN_1g002776mg                 93.2    1e-18   Citrus sinensis [Valencia orange]
ref|XP_006419896.1|  hypothetical protein CICLE_v10004281mg           93.2    1e-18   Citrus clementina
ref|XP_006344623.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  94.0    1e-18   Solanum tuberosum [potatoes]
gb|KDO74649.1|  hypothetical protein CISIN_1g002776mg                 93.2    1e-18   Citrus sinensis [Valencia orange]
gb|KCW44986.1|  hypothetical protein EUGRSUZ_L01433                   93.2    1e-18   Eucalyptus grandis [rose gum]
ref|XP_010025195.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  93.6    1e-18   Eucalyptus grandis [rose gum]
ref|XP_006419897.1|  hypothetical protein CICLE_v10004281mg           93.2    1e-18   Citrus clementina
ref|XP_009376659.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  93.6    2e-18   Pyrus x bretschneideri [bai li]
ref|XP_010040715.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  93.2    2e-18   Eucalyptus grandis [rose gum]
emb|CAB94852.1|  lipoxygenase                                         93.2    2e-18   Prunus dulcis [sweet almond]
ref|XP_008246453.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  93.2    2e-18   
gb|KCW61797.1|  hypothetical protein EUGRSUZ_H04495                   91.7    2e-18   Eucalyptus grandis [rose gum]
ref|XP_007208098.1|  hypothetical protein PRUPE_ppa001293mg           93.2    2e-18   Prunus persica
ref|XP_007204937.1|  hypothetical protein PRUPE_ppa001311mg           93.2    2e-18   Prunus persica
ref|XP_010025193.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  93.2    2e-18   Eucalyptus grandis [rose gum]
gb|KDO74647.1|  hypothetical protein CISIN_1g002776mg                 92.8    3e-18   Citrus sinensis [Valencia orange]
ref|XP_006419898.1|  hypothetical protein CICLE_v10004281mg           92.8    3e-18   Citrus clementina
gb|KDO74648.1|  hypothetical protein CISIN_1g002776mg                 92.4    3e-18   Citrus sinensis [Valencia orange]
gb|ACG56281.1|  lipoxygenase                                          92.4    3e-18   Olea europaea
ref|XP_010256003.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  92.4    3e-18   Nelumbo nucifera [Indian lotus]
gb|KCW61796.1|  hypothetical protein EUGRSUZ_H04495                   92.0    4e-18   Eucalyptus grandis [rose gum]
emb|CDP20618.1|  unnamed protein product                              91.7    6e-18   Coffea canephora [robusta coffee]
emb|CBI16430.3|  unnamed protein product                              89.0    6e-18   Vitis vinifera
ref|XP_009774054.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  91.7    7e-18   Nicotiana sylvestris
ref|XP_010025196.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  91.7    7e-18   Eucalyptus grandis [rose gum]
ref|XP_010094672.1|  putative linoleate 9S-lipoxygenase 5             91.3    7e-18   Morus notabilis
ref|XP_009625817.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  91.3    8e-18   Nicotiana tomentosiformis
ref|XP_010651467.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  89.0    8e-18   Vitis vinifera
ref|XP_010277584.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  91.3    8e-18   Nelumbo nucifera [Indian lotus]
ref|XP_011087404.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  91.3    8e-18   Sesamum indicum [beniseed]
ref|XP_010277588.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  90.9    9e-18   Nelumbo nucifera [Indian lotus]
ref|XP_010324011.1|  PREDICTED: linoleate 9S-lipoxygenase B isofo...  91.3    1e-17   Solanum lycopersicum
gb|KDP40158.1|  hypothetical protein JCGZ_02156                       90.9    1e-17   Jatropha curcas
ref|XP_008246455.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  90.9    1e-17   Prunus mume [ume]
ref|NP_001281030.1|  probable linoleate 9S-lipoxygenase 5             90.9    1e-17   Malus domestica [apple tree]
gb|AGL96414.1|  9-lipoxygenase                                        90.9    1e-17   Nicotiana benthamiana
ref|XP_009774053.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  90.9    1e-17   Nicotiana sylvestris
ref|XP_002516771.1|  lipoxygenase, putative                           90.9    1e-17   
ref|XP_010323952.1|  PREDICTED: lipoxygenase isoform X3               90.9    1e-17   
ref|XP_004230206.1|  PREDICTED: lipoxygenase isoform X2               90.9    1e-17   
ref|XP_010323943.1|  PREDICTED: lipoxygenase isoform X1               90.9    1e-17   
emb|CAD10740.1|  lipoxygenase                                         90.5    2e-17   Corylus avellana [European hazelnut]
ref|XP_011026284.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  90.5    2e-17   Populus euphratica
ref|XP_011026291.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  90.5    2e-17   Populus euphratica
gb|AAD09861.1|  lipoxygenase                                          90.5    2e-17   Persea americana
ref|XP_011092040.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  90.1    2e-17   Sesamum indicum [beniseed]
ref|XP_011092039.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  90.1    2e-17   Sesamum indicum [beniseed]
ref|NP_001234098.1|  lipoxygenase                                     90.1    2e-17   Solanum lycopersicum
ref|XP_011092038.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  90.1    2e-17   Sesamum indicum [beniseed]
ref|XP_011092037.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  90.1    2e-17   Sesamum indicum [beniseed]
ref|XP_006344621.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  90.1    2e-17   Solanum tuberosum [potatoes]
ref|XP_009597615.1|  PREDICTED: linoleate 9S-lipoxygenase 6           89.7    3e-17   Nicotiana tomentosiformis
ref|XP_009787604.1|  PREDICTED: linoleate 9S-lipoxygenase 6           89.7    3e-17   Nicotiana sylvestris
ref|XP_003521704.2|  PREDICTED: probable linoleate 9S-lipoxygenas...  89.7    3e-17   Glycine max [soybeans]
gb|KHN03989.1|  Putative linoleate 9S-lipoxygenase 5                  89.7    3e-17   Glycine soja [wild soybean]
ref|XP_006382595.1|  hypothetical protein POPTR_0005s03580g           89.7    3e-17   Populus trichocarpa [western balsam poplar]
gb|AAA74393.1|  lipoxygenase                                          89.4    4e-17   Solanum lycopersicum
ref|NP_001234873.1|  linoleate 9S-lipoxygenase B                      89.4    4e-17   
ref|XP_011021549.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  89.4    4e-17   Populus euphratica
ref|XP_002315780.1|  lipoxygenase family protein                      89.4    4e-17   Populus trichocarpa [western balsam poplar]
ref|XP_011021548.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  89.4    4e-17   Populus euphratica
ref|XP_009610900.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  89.4    4e-17   Nicotiana tomentosiformis
emb|CAE17327.1|  lipoxygenase                                         89.4    4e-17   Fragaria x ananassa
ref|XP_004296897.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  89.4    5e-17   Fragaria vesca subsp. vesca
gb|AHX56187.1|  lipoxygenase                                          89.0    5e-17   Diospyros kaki [Japanese persimmon]
ref|XP_002311617.1|  lipoxygenase family protein                      89.0    5e-17   Populus trichocarpa [western balsam poplar]
ref|XP_010674736.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  89.0    5e-17   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_006344622.1|  PREDICTED: linoleate 9S-lipoxygenase B-like      89.0    5e-17   Solanum tuberosum [potatoes]
emb|CAA58859.1|  lipoxygenase                                         89.0    6e-17   Nicotiana tabacum [American tobacco]
gb|AGK82776.1|  lipoxygenase                                          89.0    6e-17   Malus domestica [apple tree]
ref|XP_009344082.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  89.0    6e-17   Pyrus x bretschneideri [bai li]
gb|AGK82775.1|  lipoxygenase                                          88.6    7e-17   Malus domestica [apple tree]
gb|AGK82774.1|  lipoxygenase                                          88.6    7e-17   Malus domestica [apple tree]
ref|NP_001280980.1|  probable linoleate 9S-lipoxygenase 5             88.6    7e-17   Malus domestica [apple tree]
gb|AGK82783.1|  lipoxygenase                                          88.6    7e-17   Malus domestica [apple tree]
ref|XP_009366923.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  88.6    7e-17   Pyrus x bretschneideri [bai li]
gb|AGU28274.1|  lipoxygenase 1                                        88.6    8e-17   Vitis vinifera
ref|XP_007150490.1|  hypothetical protein PHAVU_005G157000g           88.6    8e-17   Phaseolus vulgaris [French bean]
ref|NP_001268178.1|  lipoxygenase                                     88.6    8e-17   Vitis vinifera
gb|AGK82798.1|  lipoxygenase                                          88.2    9e-17   Malus domestica [apple tree]
gb|AGI16379.1|  lipoxygenase                                          88.2    9e-17   Malus domestica [apple tree]
gb|AGI16378.1|  lipoxygenase                                          88.2    9e-17   Malus domestica [apple tree]
ref|XP_004309944.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  88.2    9e-17   Fragaria vesca subsp. vesca
ref|XP_010024349.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  88.2    1e-16   Eucalyptus grandis [rose gum]
ref|XP_007147045.1|  hypothetical protein PHAVU_006G091400g           88.2    1e-16   Phaseolus vulgaris [French bean]
gb|EYU42168.1|  hypothetical protein MIMGU_mgv1a001215mg              87.8    1e-16   Erythranthe guttata [common monkey flower]
ref|XP_007143238.1|  hypothetical protein PHAVU_007G055800g           87.8    1e-16   Phaseolus vulgaris [French bean]
gb|AGH13205.1|  lipoxygenase                                          87.8    1e-16   Salvia miltiorrhiza [Chinese salvia]
emb|CBI36802.3|  unnamed protein product                              87.8    1e-16   Vitis vinifera
emb|CBI36801.3|  unnamed protein product                              87.4    1e-16   Vitis vinifera
ref|XP_010659859.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  87.8    1e-16   Vitis vinifera
ref|XP_010659819.1|  PREDICTED: lipoxygenase isoform X1               87.4    2e-16   Vitis vinifera
ref|XP_011023611.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  87.4    2e-16   Populus euphratica
ref|XP_009626059.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  87.0    2e-16   Nicotiana tomentosiformis
ref|XP_002319015.2|  hypothetical protein POPTR_0013s02310g           87.0    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_011458135.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like      87.0    2e-16   Fragaria vesca subsp. vesca
ref|XP_009626058.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  87.0    2e-16   Nicotiana tomentosiformis
ref|XP_002512386.1|  lipoxygenase, putative                           87.0    2e-16   Ricinus communis
emb|CDP20620.1|  unnamed protein product                              86.7    3e-16   Coffea canephora [robusta coffee]
ref|XP_008359964.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...  84.0    3e-16   Malus domestica [apple tree]
ref|XP_011036801.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  86.7    3e-16   Populus euphratica
ref|XP_008340970.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...  86.7    4e-16   Malus domestica [apple tree]
gb|AAP83135.1|  lipoxygenase                                          86.7    4e-16   Nicotiana attenuata
gb|AAP83134.1|  lipoxygenase                                          86.7    4e-16   Nicotiana attenuata
ref|XP_008388563.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  86.7    4e-16   
gb|ABF19103.2|  9-lipoxygenase                                        86.3    4e-16   Capsicum annuum
dbj|BAH57745.1|  lipoxygenase                                         86.3    5e-16   Actinidia arguta
gb|AGK82779.1|  lipoxygenase                                          86.3    5e-16   Malus domestica [apple tree]
ref|XP_006850111.1|  hypothetical protein AMTR_s00022p00225700        85.5    5e-16   
emb|CCD74473.1|  lipoxygenase 1                                       84.0    6e-16   Arabidopsis halleri subsp. halleri
gb|KCW61804.1|  hypothetical protein EUGRSUZ_H04500                   85.5    7e-16   Eucalyptus grandis [rose gum]
ref|XP_010549787.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like      85.9    7e-16   Tarenaya hassleriana [spider flower]
ref|XP_007030817.1|  Lipoxygenase 1                                   85.5    8e-16   Theobroma cacao [chocolate]
gb|KDP23726.1|  hypothetical protein JCGZ_23559                       85.5    8e-16   Jatropha curcas
gb|AGI16380.1|  lipoxygenase                                          85.5    9e-16   Malus domestica [apple tree]
gb|AGI16382.1|  lipoxygenase                                          85.5    9e-16   Malus domestica [apple tree]
gb|AGI16377.1|  lipoxygenase                                          85.5    9e-16   Malus domestica [apple tree]
ref|XP_009604140.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  82.0    9e-16   Nicotiana tomentosiformis
ref|XP_009365900.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  85.5    9e-16   Pyrus x bretschneideri [bai li]
ref|XP_008348093.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  85.5    9e-16   
ref|NP_001274916.1|  probable linoleate 9S-lipoxygenase 5             85.5    9e-16   Solanum tuberosum [potatoes]
gb|AAG00881.1|AC064840_12  lipoxygenase - partial coding sequence     83.6    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010108010.1|  Linoleate 9S-lipoxygenase 5                      85.1    1e-15   Morus notabilis
gb|KDP23508.1|  hypothetical protein JCGZ_23341                       85.1    1e-15   Jatropha curcas
ref|XP_007030811.1|  Lipoxygenase 1                                   85.1    1e-15   Theobroma cacao [chocolate]
ref|XP_006344836.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  85.1    1e-15   Solanum tuberosum [potatoes]
ref|XP_011090733.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  85.1    1e-15   Sesamum indicum [beniseed]
ref|XP_011090735.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  85.1    1e-15   Sesamum indicum [beniseed]
gb|ABW75772.2|  lipoxygenase                                          85.1    1e-15   Camellia sinensis [black tea]
ref|XP_007030813.1|  Lipoxygenase 1                                   85.1    1e-15   Theobroma cacao [chocolate]
gb|KHN32712.1|  Linoleate 9S-lipoxygenase-4                           85.1    1e-15   Glycine soja [wild soybean]
gb|ABF19102.2|  9-lipoxygenase                                        85.1    1e-15   Capsicum annuum
ref|XP_010025191.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  85.1    1e-15   Eucalyptus grandis [rose gum]
gb|ABX60410.1|  lipoxygenase L-5                                      85.1    1e-15   Glycine max [soybeans]
ref|XP_009763875.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  85.1    1e-15   Nicotiana sylvestris
ref|XP_009763870.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  85.1    1e-15   Nicotiana sylvestris
ref|XP_010326548.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  85.1    1e-15   Solanum lycopersicum
ref|XP_003546741.1|  PREDICTED: linoleate 9S-lipoxygenase-4-like ...  84.7    1e-15   Glycine max [soybeans]
ref|XP_010326551.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  84.7    1e-15   Solanum lycopersicum
emb|CAA31664.1|  unnamed protein product                              84.7    1e-15   Glycine max [soybeans]
ref|XP_004302420.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  84.7    1e-15   Fragaria vesca subsp. vesca
ref|NP_001238203.1|  lipoxygenase L-5                                 84.7    1e-15   Glycine max [soybeans]
prf||1502333A  lipoxygenase 3                                         84.7    1e-15
sp|P09186.1|LOX3_SOYBN  RecName: Full=Seed linoleate 9S-lipoxygen...  84.7    1e-15   Glycine max [soybeans]
gb|KHN16119.1|  Putative linoleate 9S-lipoxygenase 5                  84.7    1e-15   Glycine soja [wild soybean]
gb|KHN32711.1|  Linoleate 9S-lipoxygenase-4                           84.7    2e-15   Glycine soja [wild soybean]
ref|XP_003536076.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  84.7    2e-15   Glycine max [soybeans]
ref|XP_004244890.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  84.3    2e-15   Solanum lycopersicum
pdb|1ROV|A  Chain A, Lipoxygenase-3 Treated With Cumene Hydropero...  84.3    2e-15   Glycine max [soybeans]
gb|ADG03095.1|  lipoxygenase 3                                        84.3    2e-15   Glycine max [soybeans]
gb|AAO03558.1|  lipoxygenase 1                                        84.3    2e-15   Brassica napus [oilseed rape]
gb|KHN32710.1|  Seed linoleate 9S-lipoxygenase-3                      84.3    2e-15   Glycine soja [wild soybean]
ref|NP_001235383.1|  seed linoleate 9S-lipoxygenase-3                 84.3    2e-15   Glycine max [soybeans]
gb|ABX60408.1|  lipoxygenase L-3                                      84.3    2e-15   Glycine max [soybeans]
ref|XP_006838255.1|  hypothetical protein AMTR_s00103p00053790        81.3    2e-15   
ref|XP_007150489.1|  hypothetical protein PHAVU_005G156900g           84.3    2e-15   Phaseolus vulgaris [French bean]
gb|AGL76509.1|  lipoxygenase                                          84.0    2e-15   Phaseolus coccineus [scarlet runner bean]
sp|P27481.1|LOXB_PHAVU  RecName: Full=Linoleate 9S-lipoxygenase; ...  84.0    2e-15   Phaseolus vulgaris [French bean]
ref|XP_006607065.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...  82.8    2e-15   
emb|CDY43490.1|  BnaA01g21450D                                        84.3    2e-15   Brassica napus [oilseed rape]
gb|AET01677.2|  seed linoleate 9S-lipoxygenase                        84.0    3e-15   Medicago truncatula
gb|ACO57136.1|  lipoxygenase 1                                        84.0    3e-15   Capsicum annuum
gb|AET01678.2|  seed linoleate 9S-lipoxygenase                        84.0    3e-15   Medicago truncatula
ref|XP_002891934.1|  hypothetical protein ARALYDRAFT_474776           84.0    3e-15   Arabidopsis lyrata subsp. lyrata
ref|XP_010480214.1|  PREDICTED: linoleate 9S-lipoxygenase 1           84.0    3e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010511239.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like      84.0    3e-15   Camelina sativa [gold-of-pleasure]
ref|NP_175900.1|  lipoxygenase 1                                      84.0    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010102744.1|  putative linoleate 9S-lipoxygenase 5             84.0    3e-15   Morus notabilis
gb|AAZ04411.1|  lipoxygenase                                          84.0    3e-15   Adelostemma gracillimum
gb|AHX56188.1|  lipoxygenase                                          84.0    3e-15   Diospyros kaki [Japanese persimmon]
ref|XP_009349294.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like      83.6    3e-15   Pyrus x bretschneideri [bai li]
ref|XP_009625816.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  83.6    3e-15   Nicotiana tomentosiformis
ref|XP_003627201.1|  Seed lipoxygenase                                84.0    4e-15   
ref|XP_003627202.1|  Seed lipoxygenase                                84.0    4e-15   
ref|XP_006359917.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  83.6    4e-15   Solanum tuberosum [potatoes]
ref|XP_006359918.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  83.6    4e-15   Solanum tuberosum [potatoes]
ref|XP_010553735.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like      83.6    4e-15   Tarenaya hassleriana [spider flower]
emb|CBI33054.3|  unnamed protein product                              82.8    5e-15   Vitis vinifera
ref|XP_010414944.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like      83.2    5e-15   Camelina sativa [gold-of-pleasure]
ref|XP_008364642.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like ...  83.2    5e-15   Malus domestica [apple tree]
ref|XP_009407551.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  83.2    5e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN02707.1|  Linoleate 9S-lipoxygenase 5, chloroplastic            83.2    5e-15   Glycine soja [wild soybean]
gb|AGI16404.1|  lipoxygenase                                          83.2    5e-15   Malus domestica [apple tree]
gb|AGI16405.1|  lipoxygenase                                          83.2    5e-15   Malus domestica [apple tree]
ref|XP_008364640.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like ...  83.2    5e-15   Malus domestica [apple tree]
ref|XP_010935040.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...  83.2    6e-15   Elaeis guineensis
ref|XP_008235887.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like      82.8    6e-15   Prunus mume [ume]
gb|AGI16403.1|  lipoxygenase                                          82.8    6e-15   Malus domestica [apple tree]
emb|CDO99039.1|  unnamed protein product                              82.8    6e-15   Coffea canephora [robusta coffee]
gb|AAK50778.4|AF361893_1  bacterial-induced lipoxygenase              82.8    6e-15   Gossypium hirsutum [American cotton]
gb|AIC82456.1|  lipoxygenase                                          82.8    7e-15   Cocos nucifera
gb|AAD09202.1|  lipoxygenase                                          82.8    7e-15   Solanum tuberosum [potatoes]
ref|XP_009385775.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  82.4    7e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK35600.1|  hypothetical protein AALP_AA4G012300                  82.4    8e-15   Arabis alpina [alpine rockcress]
gb|KFK35599.1|  hypothetical protein AALP_AA4G012300                  82.4    8e-15   Arabis alpina [alpine rockcress]
ref|XP_003626860.1|  Lipoxygenase                                     82.4    8e-15   Medicago truncatula
ref|XP_009406999.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4  82.4    8e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH18418.1|  seed linoleate 9S-lipoxygenase                        82.0    8e-15   Medicago truncatula
ref|XP_002527266.1|  lipoxygenase, putative                           82.4    9e-15   
gb|AHI86055.1|  lipoxygenase                                          82.4    9e-15   Cucumis melo var. makuwa
ref|XP_008449553.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  82.4    9e-15   Cucumis melo [Oriental melon]
ref|NP_001267584.1|  probable linoleate 9S-lipoxygenase 5-like        82.4    1e-14   Cucumis sativus [cucumbers]
ref|XP_007144726.1|  hypothetical protein PHAVU_007G179600g           82.0    1e-14   Phaseolus vulgaris [French bean]
ref|XP_009779646.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  82.0    1e-14   Nicotiana sylvestris
ref|XP_008454526.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  82.0    1e-14   
gb|AAC61785.1|  lipoxygenase 1                                        82.0    1e-14   Cucumis sativus [cucumbers]
ref|XP_009358958.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like      82.0    1e-14   Pyrus x bretschneideri [bai li]
ref|XP_009779645.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  82.0    1e-14   Nicotiana sylvestris
ref|XP_006433338.1|  hypothetical protein CICLE_v10000236mg           82.0    1e-14   Citrus clementina
emb|CAA63483.1|  lipoxygenase                                         82.0    1e-14   Cucumis sativus [cucumbers]
gb|KJB38136.1|  hypothetical protein B456_006G238200                  81.6    1e-14   Gossypium raimondii
ref|XP_004231274.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  82.0    1e-14   Solanum lycopersicum
ref|XP_004156415.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like      82.0    1e-14   
gb|EPS73035.1|  hypothetical protein M569_01717                       82.4    1e-14   Genlisea aurea
ref|XP_004139170.1|  PREDICTED: LOW QUALITY PROTEIN: linoleate 9S...  82.0    1e-14   
gb|KJB38135.1|  hypothetical protein B456_006G238200                  81.3    1e-14   Gossypium raimondii
ref|XP_007143236.1|  hypothetical protein PHAVU_007G055600g           82.0    1e-14   Phaseolus vulgaris [French bean]
ref|XP_006472029.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  82.0    1e-14   Citrus sinensis [Valencia orange]
gb|EYU26430.1|  hypothetical protein MIMGU_mgv1a023655mg              82.0    1e-14   Erythranthe guttata [common monkey flower]
gb|KHN30070.1|  Linoleate 9S-lipoxygenase-4                           81.6    2e-14   Glycine soja [wild soybean]
sp|P38417.1|LOX4_SOYBN  RecName: Full=Linoleate 9S-lipoxygenase-4...  81.6    2e-14   Glycine max [soybeans]
gb|ABX60409.1|  lipoxygease L-4                                       81.6    2e-14   Glycine max [soybeans]
ref|XP_004139173.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  81.6    2e-14   Cucumis sativus [cucumbers]
ref|NP_001235250.1|  lipoxygenase                                     81.6    2e-14   Glycine max [soybeans]
ref|XP_004156418.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  81.6    2e-14   
ref|XP_007200849.1|  hypothetical protein PRUPE_ppa026489mg           81.6    2e-14   Prunus persica
ref|NP_001238692.1|  lipoxygenase                                     81.6    2e-14   Glycine max [soybeans]
ref|XP_009119596.1|  PREDICTED: linoleate 9S-lipoxygenase 1           81.6    2e-14   Brassica rapa
ref|XP_003597559.1|  Seed lipoxygenase-3                              81.6    2e-14   Medicago truncatula
ref|XP_010667400.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  81.3    2e-14   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|KJB38137.1|  hypothetical protein B456_006G238200                  81.3    2e-14   Gossypium raimondii
gb|KJB38138.1|  hypothetical protein B456_006G238200                  81.3    2e-14   Gossypium raimondii
gb|ACD43483.1|  lipoxygenase 1                                        81.3    2e-14   Olea europaea
ref|XP_006447980.1|  hypothetical protein CICLE_v10014260mg           81.3    2e-14   Citrus clementina
ref|XP_009621679.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  80.9    3e-14   Nicotiana tomentosiformis
ref|XP_006300394.1|  hypothetical protein CARUB_v10019783mg           80.9    3e-14   Capsella rubella
gb|KJB26432.1|  hypothetical protein B456_004G241300                  80.9    3e-14   Gossypium raimondii
emb|CDY46325.1|  BnaC01g31590D                                        80.9    3e-14   Brassica napus [oilseed rape]
emb|CBI35577.3|  unnamed protein product                              80.5    3e-14   Vitis vinifera
ref|XP_008454513.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like ...  80.9    3e-14   Cucumis melo [Oriental melon]
gb|KJB80989.1|  hypothetical protein B456_013G124500                  80.9    3e-14   Gossypium raimondii
ref|XP_008454503.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like ...  80.9    3e-14   
gb|KJB80990.1|  hypothetical protein B456_013G124500                  80.9    3e-14   Gossypium raimondii
emb|CBI26229.3|  unnamed protein product                              80.5    4e-14   Vitis vinifera
ref|XP_009376663.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  80.5    4e-14   Pyrus x bretschneideri [bai li]
gb|KDO58557.1|  hypothetical protein CISIN_1g003050mg                 80.5    4e-14   Citrus sinensis [Valencia orange]
ref|XP_010905215.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4  80.5    5e-14   Elaeis guineensis
ref|XP_006858673.1|  hypothetical protein AMTR_s00066p00077770        80.1    5e-14   
ref|XP_002278007.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  80.1    5e-14   Vitis vinifera
ref|XP_004496744.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...  80.1    5e-14   Cicer arietinum [garbanzo]
ref|XP_010674738.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  80.1    5e-14   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009418148.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  79.7    6e-14   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGI16415.1|  lipoxygenase                                          79.7    7e-14   Malus domestica [apple tree]
ref|NP_001281022.1|  probable linoleate 9S-lipoxygenase 5             79.7    7e-14   Malus domestica [apple tree]
gb|AGI16413.1|  lipoxygenase                                          79.7    7e-14   Malus domestica [apple tree]
gb|AGI16414.1|  lipoxygenase                                          79.7    7e-14   Malus domestica [apple tree]
ref|XP_006344624.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  79.7    7e-14   Solanum tuberosum [potatoes]
sp|P09918.1|LOX3_PEA  RecName: Full=Seed linoleate 9S-lipoxygenas...  79.7    8e-14   Pisum sativum [garden pea]
ref|XP_006344625.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  79.7    8e-14   Solanum tuberosum [potatoes]
ref|XP_004230207.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  79.7    8e-14   Solanum lycopersicum
ref|XP_006392468.1|  hypothetical protein EUTSA_v10023267mg           79.3    9e-14   Eutrema salsugineum
ref|XP_003591120.1|  Lipoxygenase                                     79.3    9e-14   Medicago truncatula
ref|XP_007134262.1|  hypothetical protein PHAVU_010G032300g           79.3    1e-13   Phaseolus vulgaris [French bean]
ref|XP_003627173.1|  Seed lipoxygenase-3                              79.3    1e-13   Medicago truncatula
gb|KHG06114.1|  putative linoleate 9S-lipoxygenase 5                  79.3    1e-13   Gossypium arboreum [tree cotton]
ref|XP_008245950.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  79.3    1e-13   
ref|XP_008246452.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  79.3    1e-13   
ref|XP_008246451.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  79.3    1e-13   
ref|XP_007208102.1|  hypothetical protein PRUPE_ppa001216mg           79.3    1e-13   
ref|XP_003612346.1|  Seed lipoxygenase                                78.6    1e-13   
emb|CDP20619.1|  unnamed protein product                              79.0    1e-13   
ref|XP_010674744.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  79.0    1e-13   
gb|KDO56302.1|  hypothetical protein CISIN_1g002839mg                 79.0    1e-13   
gb|AGI16416.1|  lipoxygenase                                          79.0    1e-13   
ref|XP_003627310.1|  Lipoxygenase                                     79.0    1e-13   
gb|KHN11253.1|  Seed linoleate 9S-lipoxygenase-2                      79.0    1e-13   
gb|KHF98566.1|  Linoleate 9S-lipoxygenase 5, chloroplastic            79.0    1e-13   
ref|XP_009385766.1|  PREDICTED: linoleate 9S-lipoxygenase A isofo...  79.0    1e-13   
gb|KJB28315.1|  hypothetical protein B456_005G041900                  79.0    1e-13   
gb|KHF98567.1|  Linoleate 9S-lipoxygenase 5, chloroplastic            79.0    1e-13   
ref|XP_008801705.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4  79.0    2e-13   
ref|XP_010268333.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like      78.6    2e-13   
ref|XP_004486857.1|  PREDICTED: seed linoleate 9S-lipoxygenase-3-...  78.6    2e-13   
ref|XP_006492220.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  78.6    2e-13   
ref|XP_006492221.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  78.6    2e-13   
gb|AES95304.2|  seed linoleate 9S-lipoxygenase                        78.6    2e-13   
ref|XP_004510413.1|  PREDICTED: linoleate 9S-lipoxygenase-like        78.6    2e-13   
gb|AEZ50136.1|  lipoxygenase                                          78.6    2e-13   
ref|XP_003612345.1|  Seed lipoxygenase                                78.6    2e-13   
gb|ABF60002.1|  lipoxygenase 2                                        78.6    2e-13   
ref|XP_009790810.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  78.2    2e-13   
ref|XP_004169568.1|  PREDICTED: LOW QUALITY PROTEIN: linoleate 9S...  78.2    2e-13   
ref|XP_004150982.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like      78.2    2e-13   
ref|XP_010652618.1|  PREDICTED: probable linoleate 9S-lipoxygenase 7  76.6    3e-13   
gb|KHG03761.1|  Linoleate 9S-lipoxygenase 5, chloroplastic -like ...  78.2    3e-13   
gb|ADG03094.1|  mutant lipoxygenase 1                                 77.4    3e-13   
ref|XP_007150488.1|  hypothetical protein PHAVU_005G1568000g          76.6    3e-13   
ref|XP_008388961.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  77.8    3e-13   
gb|AFU51542.1|  lipoxygenase 3                                        77.8    3e-13   
emb|CAG44501.1|  lipoxygenase LOXN3                                   77.8    3e-13   
emb|CAG44503.1|  lipoxygenase LOXN3                                   77.8    3e-13   
gb|KHG15901.1|  putative linoleate 9S-lipoxygenase 5                  77.8    3e-13   
ref|XP_003626279.1|  Chalcone synthase                                78.2    3e-13   
gb|AEI71780.1|  bacterial-induced lipoxygenase                        77.8    3e-13   
gb|AES82497.2|  linoleate 9S-lipoxygenase-like protein                77.8    3e-13   
ref|XP_007225308.1|  hypothetical protein PRUPE_ppa001207mg           77.8    3e-13   
ref|XP_008454442.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  77.8    4e-13   
gb|KEH18417.1|  seed linoleate 9S-lipoxygenase                        77.4    4e-13   
gb|KJB80991.1|  hypothetical protein B456_013G124500                  77.0    4e-13   
ref|XP_004247367.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  77.4    5e-13   
ref|XP_004302419.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  77.4    5e-13   
ref|XP_008454430.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like      77.0    5e-13   
ref|XP_003627177.1|  Lipoxygenase                                     75.9    5e-13   
ref|XP_003556040.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...  77.0    5e-13   
gb|KHN15782.1|  Linoleate 9S-lipoxygenase 5, chloroplastic            77.0    6e-13   
ref|XP_009626060.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  77.0    6e-13   
pdb|4WHA|A  Chain A, Lipoxygenase-1 (soybean) L546a/l754a Mutant      77.0    6e-13   
gb|ADG03093.1|  lipoxygenase 1                                        77.0    6e-13   
pdb|3BND|A  Chain A, Lipoxygenase-1 (Soybean), I553v Mutant           77.0    6e-13   
pdb|3BNB|A  Chain A, Lipoxygenase-1 (Soybean) I553l Mutant            77.0    6e-13   
pdb|3PZW|A  Chain A, Soybean Lipoxygenase-1 - Re-Refinement           77.0    6e-13   
ref|XP_003627187.1|  Lipoxygenase                                     77.0    6e-13   
pdb|3BNE|A  Chain A, Lipoxygenase-1 (Soybean) I553a Mutant            77.0    6e-13   
ref|XP_006599136.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  77.0    6e-13   
pdb|1FGR|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, Q697e Mutant   77.0    7e-13   
pdb|1FGQ|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, Q495e Mutant   77.0    7e-13   
pdb|3BNC|A  Chain A, Lipoxygenase-1 (Soybean) I553g Mutant            77.0    7e-13   
ref|XP_006576654.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...  77.0    7e-13   
pdb|1FGT|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, Q697n Mutant   76.6    7e-13   
pdb|1FGO|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, Q495a Mutant   76.6    7e-13   
ref|NP_001236153.1|  seed linoleate 13S-lipoxygenase-1                76.6    7e-13   
pdb|1FGM|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, N694h Mutant   76.6    7e-13   
ref|XP_004151736.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  76.3    7e-13   
pdb|1Y4K|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, N694g Mutant   76.6    7e-13   
gb|AAB71759.1|  lipoxygenase                                          76.6    7e-13   
ref|XP_006576655.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...  76.6    7e-13   
gb|AAA79186.1|  lipoxygenase                                          76.6    8e-13   
emb|CAA53730.1|  lipoxygenase                                         76.6    8e-13   
sp|P27480.1|LOXA_PHAVU  RecName: Full=Linoleate 9S-lipoxygenase 1...  76.6    8e-13   
ref|XP_004510411.1|  PREDICTED: linoleate 9S-lipoxygenase-like        76.6    8e-13   
gb|ABB82552.1|  13S-lipoxygenase                                      76.6    8e-13   
ref|XP_008454470.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like      76.6    8e-13   
gb|AGS94394.3|  lipoxygenase                                          76.6    8e-13   
gb|KJB26434.1|  hypothetical protein B456_004G241400                  76.6    8e-13   
gb|ACU81176.1|  13S-lipoxygenase                                      76.6    8e-13   
ref|XP_010466519.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...  76.6    9e-13   
sp|P38414.1|LOX1_LENCU  RecName: Full=Linoleate 9S-lipoxygenase; ...  76.6    9e-13   
gb|KJB26433.1|  hypothetical protein B456_004G241400                  76.3    9e-13   
ref|XP_010934565.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  76.6    9e-13   
gb|AAF15296.2|AF204210_1  lipoxygenase                                76.3    9e-13   
gb|KHN22174.1|  Linoleate 9S-lipoxygenase 5, chloroplastic            76.3    9e-13   
ref|XP_006359922.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  76.3    9e-13   
gb|ACF74339.1|  lipoxygenase 1                                        73.2    1e-12   
ref|XP_010431179.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...  76.3    1e-12   
gb|KHN32739.1|  Linoleate 9S-lipoxygenase 5, chloroplastic            76.3    1e-12   
ref|XP_004512262.1|  PREDICTED: seed linoleate 9S-lipoxygenase-like   76.3    1e-12   
ref|XP_004169780.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...  76.3    1e-12   
ref|XP_003627174.1|  Lipoxygenase                                     76.3    1e-12   
ref|XP_004139356.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  76.3    1e-12   
ref|XP_004144826.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  76.3    1e-12   
ref|XP_003634834.2|  PREDICTED: linoleate 9S-lipoxygenase 6           75.9    1e-12   
gb|ADJ67988.1|  lipoxygenase                                          75.9    1e-12   
ref|XP_010674739.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  75.9    1e-12   
ref|XP_004158761.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  75.9    1e-12   
ref|XP_010674737.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  75.9    1e-12   
ref|XP_007030815.1|  Lipoxygenase 1                                   75.9    1e-12   
ref|XP_010674740.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  75.9    1e-12   
gb|AGI37654.1|  lipoxygenase                                          75.9    1e-12   
ref|XP_004510412.1|  PREDICTED: linoleate 9S-lipoxygenase-like        75.9    2e-12   
gb|ACJ83328.1|  unknown                                               72.8    2e-12   
ref|XP_004510414.1|  PREDICTED: seed linoleate 9S-lipoxygenase-like   75.9    2e-12   
ref|XP_003627189.1|  Lipoxygenase                                     75.5    2e-12   
gb|KGN54137.1|  hypothetical protein Csa_4G288080                     74.7    2e-12   
gb|KDP45238.1|  hypothetical protein JCGZ_15103                       75.5    2e-12   
ref|XP_004510208.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...  75.5    2e-12   
emb|CAA75609.1|  lipoxygenase                                         75.5    2e-12   
ref|XP_004156417.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...  75.5    2e-12   
ref|XP_004139172.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  75.5    2e-12   
gb|KHN11251.1|  Seed linoleate 9S-lipoxygenase-2                      75.5    2e-12   
ref|XP_003531596.1|  PREDICTED: seed linoleate 9S-lipoxygenase-3      75.5    2e-12   
gb|AEQ30071.1|  lipoxygenase                                          75.5    2e-12   
ref|XP_002883361.1|  lipoxygenase                                     75.5    2e-12   
ref|NP_001234856.1|  linoleate 9S-lipoxygenase A                      75.5    2e-12   
ref|XP_009407000.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4  75.5    2e-12   
emb|CAA64764.1|  lipoxygenase                                         74.3    2e-12   
ref|XP_003601325.1|  Lipoxygenase                                     75.1    2e-12   
ref|XP_004162096.1|  PREDICTED: linoleate 13S-lipoxygenase 2-1, c...  73.9    2e-12   
gb|AET01652.2|  seed linoleate 9S-lipoxygenase                        75.1    2e-12   
ref|NP_188879.2|  lipoxygenase 5                                      75.1    2e-12   
ref|XP_009774215.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  75.1    2e-12   
dbj|BAB01777.1|  lipoxygenase                                         75.1    2e-12   
gb|AET01658.2|  seed linoleate 9S-lipoxygenase                        75.1    2e-12   
emb|CAC19365.1|  lipoxygenase                                         75.1    3e-12   
ref|XP_007030814.1|  Lipoxygenase 1                                   75.1    3e-12   
ref|XP_004486858.1|  PREDICTED: seed linoleate 9S-lipoxygenase-2-...  75.1    3e-12   
ref|XP_003627185.1|  Lipoxygenase                                     75.1    3e-12   
gb|KHN39329.1|  Linoleate 9S-lipoxygenase                             73.2    3e-12   
ref|XP_003627182.1|  Lipoxygenase                                     74.7    3e-12   
ref|XP_003627181.1|  Lipoxygenase                                     75.1    3e-12   
gb|KFK39531.1|  hypothetical protein AALP_AA3G256400                  75.1    3e-12   
ref|XP_004139169.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  74.7    3e-12   
gb|ABQ10187.1|  lipoxygenase                                          74.7    3e-12   
gb|AET01657.2|  seed linoleate 9S-lipoxygenase                        74.7    3e-12   
ref|XP_004156414.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  74.7    3e-12   
ref|XP_008449748.1|  PREDICTED: linoleate 13S-lipoxygenase 2-1, c...  74.7    3e-12   
ref|XP_008454481.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like      74.7    3e-12   
emb|CAA64767.1|  lipoxygenase                                         73.9    4e-12   
ref|XP_003592410.1|  Lipoxygenase                                     74.7    4e-12   
ref|XP_009108895.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...  74.7    4e-12   
ref|XP_006296682.1|  hypothetical protein CARUB_v10012957mg           74.7    4e-12   
ref|XP_010094673.1|  putative linoleate 9S-lipoxygenase 5             74.3    4e-12   
gb|AFY08518.1|  lipoxygenase                                          69.7    4e-12   
ref|XP_010091999.1|  Linoleate 13S-lipoxygenase 2-1                   74.3    4e-12   
emb|CDY64191.1|  BnaA01g36630D                                        74.3    4e-12   
ref|XP_007135516.1|  hypothetical protein PHAVU_010G135900g           74.3    4e-12   
gb|KEH35114.1|  linoleate 13S-lipoxygenase 2-1, related protein       73.9    5e-12   
sp|O22507.1|LOX17_SOLTU  RecName: Full=Probable linoleate 9S-lipo...  74.3    5e-12   
sp|O22508.1|LOX18_SOLTU  RecName: Full=Probable linoleate 9S-lipo...  74.3    5e-12   
ref|NP_001275169.1|  probable linoleate 9S-lipoxygenase 8-like        73.9    5e-12   
gb|AIL90390.1|  lipoxygenase                                          73.9    6e-12   
sp|P37831.1|LOX11_SOLTU  RecName: Full=Linoleate 9S-lipoxygenase ...  73.9    6e-12   
gb|ADL41189.1|  lipoxygenase                                          73.9    6e-12   
sp|Q43190.1|LOX14_SOLTU  RecName: Full=Probable linoleate 9S-lipo...  73.9    6e-12   
gb|KDO64919.1|  hypothetical protein CISIN_1g002617mg                 73.2    6e-12   
ref|XP_011080242.1|  PREDICTED: linoleate 13S-lipoxygenase 2-1, c...  73.9    6e-12   
ref|NP_001275351.1|  5-lipoxygenase                                   73.9    6e-12   
ref|XP_008791769.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4  73.9    6e-12   
ref|XP_007135505.1|  hypothetical protein PHAVU_010G134800g           73.9    6e-12   
ref|XP_008777614.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like      73.9    6e-12   
gb|KHN11257.1|  Linoleate 9S-lipoxygenase                             73.9    7e-12   
ref|XP_006406169.1|  hypothetical protein EUTSA_v10020023mg           73.9    7e-12   
ref|XP_008454500.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  73.9    7e-12   
gb|ABA98924.2|  Lipoxygenase 2.1, chloroplast precursor, putative     71.6    7e-12   
ref|XP_006355846.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...  73.6    8e-12   
ref|NP_001275357.1|  linoleate 9S-lipoxygenase 2                      73.6    8e-12   
ref|XP_004169303.1|  PREDICTED: LOW QUALITY PROTEIN: linoleate 13...  73.6    8e-12   
ref|XP_004142137.1|  PREDICTED: linoleate 13S-lipoxygenase 2-1, c...  73.6    8e-12   
ref|XP_008449749.1|  PREDICTED: linoleate 13S-lipoxygenase 2-1, c...  73.6    8e-12   
ref|XP_003597558.1|  Lipoxygenase                                     73.6    8e-12   
ref|XP_003531600.2|  PREDICTED: LOW QUALITY PROTEIN: linoleate 9S...  73.6    9e-12   
ref|XP_010556753.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...  73.2    1e-11   
gb|AES71576.2|  linoleate 13S-lipoxygenase 2-1, related protein       73.2    1e-11   
ref|XP_010511287.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...  73.2    1e-11   
emb|CAC04380.1|  lipoxygenase                                         73.2    1e-11   
gb|KDO64916.1|  hypothetical protein CISIN_1g002617mg                 72.8    1e-11   
sp|Q43189.1|LOX13_SOLTU  RecName: Full=Probable linoleate 9S-lipo...  73.2    1e-11   
emb|CAA64765.1|  lipoxygenase                                         73.2    1e-11   
gb|KDO64915.1|  hypothetical protein CISIN_1g002617mg                 72.8    1e-11   
gb|KDO64917.1|  hypothetical protein CISIN_1g002617mg                 72.8    1e-11   
emb|CDY38326.1|  BnaC05g30190D                                        73.2    1e-11   
ref|XP_010488264.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...  73.2    1e-11   
ref|XP_010488263.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...  73.2    1e-11   
dbj|BAA13542.1|  CPRD46 protein                                       73.2    1e-11   
ref|XP_003627196.1|  Lipoxygenase                                     72.8    1e-11   
sp|P24095.1|LOXX_SOYBN  RecName: Full=Seed linoleate 9S-lipoxygen...  72.8    1e-11   
sp|Q41238.1|LOX16_SOLTU  RecName: Full=Linoleate 9S-lipoxygenase ...  72.8    1e-11   
ref|NP_001237323.1|  lipoxygenase-9                                   72.8    1e-11   
gb|KHN39332.1|  Seed linoleate 9S-lipoxygenase                        72.8    2e-11   
ref|XP_009364725.1|  PREDICTED: linoleate 13S-lipoxygenase 2-1, c...  72.8    2e-11   
ref|XP_009364716.1|  PREDICTED: linoleate 13S-lipoxygenase 2-1, c...  72.8    2e-11   
ref|XP_008358861.1|  PREDICTED: linoleate 13S-lipoxygenase 2-1, c...  72.8    2e-11   
gb|AGK82790.1|  lipoxygenase                                          72.8    2e-11   
gb|KHN01371.1|  Linoleate 9S-lipoxygenase 1                           72.8    2e-11   
gb|AGK82791.1|  lipoxygenase                                          72.8    2e-11   
ref|XP_007135506.1|  hypothetical protein PHAVU_010G134900g           72.8    2e-11   
gb|AET01667.2|  seed linoleate 9S-lipoxygenase                        72.8    2e-11   
ref|NP_001238676.1|  seed linoleate 9S-lipoxygenase                   72.8    2e-11   
ref|XP_010530359.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...  72.8    2e-11   
sp|P14856.1|LOX2_PEA  RecName: Full=Seed linoleate 9S-lipoxygenas...  72.8    2e-11   
ref|XP_003627191.1|  Lipoxygenase                                     72.4    2e-11   
emb|CAA55318.1|  lipoxygenase                                         72.4    2e-11   
gb|EPS66745.1|  lipoxygenase                                          72.0    2e-11   
ref|XP_006494720.1|  PREDICTED: linoleate 13S-lipoxygenase 2-1, c...  72.4    2e-11   
ref|NP_001067014.2|  Os12g0560100                                     71.2    2e-11   
gb|KDO56504.1|  hypothetical protein CISIN_1g0471311mg                72.4    2e-11   
ref|XP_006445970.1|  hypothetical protein CICLE_v10014199mg           72.4    2e-11   
gb|AEU04516.1|  lipoxygenase 1                                        72.4    2e-11   
gb|KDO64920.1|  hypothetical protein CISIN_1g002617mg                 72.4    2e-11   
ref|XP_002442620.1|  hypothetical protein SORBIDRAFT_08g023120        72.4    2e-11   
ref|XP_011029656.1|  PREDICTED: lipoxygenase 6, chloroplastic-like    72.0    3e-11   
ref|XP_003601322.1|  Lipoxygenase                                     72.0    3e-11   
emb|CAA64769.1|  lipoxygenase                                         71.6    3e-11   
ref|XP_004172829.1|  PREDICTED: linoleate 13S-lipoxygenase 2-1, c...  71.6    3e-11   
ref|XP_004172896.1|  PREDICTED: LOW QUALITY PROTEIN: linoleate 13...  71.6    3e-11   
gb|AES71573.2|  linoleate 13S-lipoxygenase 2-1, related protein       71.6    3e-11   
ref|XP_009145332.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...  71.6    3e-11   



>gb|KCW61801.1| hypothetical protein EUGRSUZ_H044981, partial [Eucalyptus grandis]
Length=795

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPSQTPAPL KYR+EELV+LRG GTGEL+EWDRVYDYAYYNDLGDPDKG++
Sbjct  97   TYLPSQTPAPLVKYREEELVNLRGDGTGELQEWDRVYDYAYYNDLGDPDKGSK  149



>ref|XP_011023610.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=871

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             +LP +TPAPL+KYR+EELVHLRG G GELKEWDRVYDYAYYNDLGDPDKG E
Sbjct  173  TFLPHETPAPLRKYREEELVHLRGNGEGELKEWDRVYDYAYYNDLGDPDKGPE  225



>ref|XP_010025194.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
Length=871

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPSQTPAPL KYR+EELV+LRG GTGEL+EWDRVYDYAYYNDLGDPDKG++
Sbjct  173  TYLPSQTPAPLVKYREEELVNLRGDGTGELQEWDRVYDYAYYNDLGDPDKGSK  225



>emb|CDP15504.1| unnamed protein product [Coffea canephora]
Length=856

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLPS TP PL++YR EELV+LRG GTGELKEWDRVYDYAYYNDLGDPDKG E
Sbjct  158  AYLPSDTPEPLRQYRAEELVNLRGDGTGELKEWDRVYDYAYYNDLGDPDKGKE  210



>gb|ADN92993.2| lipoxygenase LOX1 [Ipomoea nil]
Length=857

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLPSQTP  LK YR+EEL++LRGTGTGE KEWDRVYDYAYYNDLGDPD+GAE
Sbjct  159  AYLPSQTPDLLKTYREEELLNLRGTGTGERKEWDRVYDYAYYNDLGDPDRGAE  211



>ref|XP_011036799.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=866

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  YLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            YLP +TPAPL+KYR+EELV LRG G GELKEWDRVYDYAYYNDLGDPDKGA+
Sbjct  169  YLPHETPAPLRKYREEELVKLRGDGKGELKEWDRVYDYAYYNDLGDPDKGAK  220



>ref|XP_006382593.1| hypothetical protein POPTR_0005s03550g [Populus trichocarpa]
 gb|ERP60390.1| hypothetical protein POPTR_0005s03550g [Populus trichocarpa]
Length=847

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  YLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            YLP +TPAPL+KYR+EELV LRG G GELKEWDRVYDYAYYNDLGDPDKGA+
Sbjct  150  YLPHETPAPLRKYREEELVKLRGDGKGELKEWDRVYDYAYYNDLGDPDKGAK  201



>ref|XP_006382594.1| hypothetical protein POPTR_0005s03560g [Populus trichocarpa]
 gb|ERP60391.1| hypothetical protein POPTR_0005s03560g [Populus trichocarpa]
Length=866

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  YLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            YLP +TPAPL+KYR+EELV LRG G GELKEWDRVYDYAYYNDLGDPDKGA+
Sbjct  169  YLPHETPAPLRKYREEELVKLRGDGKGELKEWDRVYDYAYYNDLGDPDKGAK  220



>ref|XP_007208096.1| hypothetical protein PRUPE_ppa001287mg [Prunus persica]
 gb|EMJ09295.1| hypothetical protein PRUPE_ppa001287mg [Prunus persica]
Length=862

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             +LPS+TP PL+KYR+EELVHLRG G GEL+EWDRVYDYAYYNDLG+PDKG++
Sbjct  165  TFLPSETPLPLRKYREEELVHLRGNGKGELQEWDRVYDYAYYNDLGNPDKGSK  217



>ref|XP_008370477.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Malus 
domestica]
Length=963

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS+TP PL+KYR+EELVHLRG G GEL+EWDRVYDYAYYNDLG PD+GA+
Sbjct  266  TYLPSETPLPLRKYREEELVHLRGNGKGELQEWDRVYDYAYYNDLGKPDEGAK  318



>ref|XP_002319014.2| lipoxygenase family protein [Populus trichocarpa]
 gb|EEE94937.2| lipoxygenase family protein [Populus trichocarpa]
Length=836

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             ++P +TP PL+KYR+EELVHLRG G GELKEWDRVYDYAYYNDLGDPDKG
Sbjct  138  TFMPHETPTPLRKYREEELVHLRGNGEGELKEWDRVYDYAYYNDLGDPDKG  188



>ref|XP_008370478.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Malus 
domestica]
Length=835

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS+TP PL+KYR+EELVHLRG G GEL+EWDRVYDYAYYNDLG PD+GA+
Sbjct  138  TYLPSETPLPLRKYREEELVHLRGNGKGELQEWDRVYDYAYYNDLGKPDEGAK  190



>emb|CAD10779.2| lipoxygenase [Prunus dulcis]
 gb|AGT02046.1| lipoxygenase [synthetic construct]
Length=862

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             +LPS+TP PL+KYR+EELVHLRG G GEL+EWDRVYDYAYYNDLG+PDKG++
Sbjct  165  TFLPSETPLPLRKYREEELVHLRGDGKGELQEWDRVYDYAYYNDLGNPDKGSK  217



>ref|XP_008246456.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=915

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             +LPS+TP PL+KYR+EELVHLRG G GEL+EWDRVYDYAYYNDLG+PDKG++
Sbjct  218  TFLPSETPLPLQKYREEELVHLRGDGKGELQEWDRVYDYAYYNDLGNPDKGSK  270



>gb|KDO74650.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
 gb|KDO74651.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=555

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLP QTP PL+KYR EELV+LRG G GELKEWDRVYDYA+YNDLG+PDKG E
Sbjct  180  TYLPCQTPEPLRKYRREELVNLRGNGKGELKEWDRVYDYAFYNDLGNPDKGPE  232



>ref|XP_006419896.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
 gb|ESR33136.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
Length=627

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLP QTP PL+KYR EELV+LRG G GELKEWDRVYDYA+YNDLG+PDKG E
Sbjct  180  TYLPCQTPEPLRKYRREELVNLRGNGKGELKEWDRVYDYAFYNDLGNPDKGPE  232



>ref|XP_006344623.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=864

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLPS+TP PL+KYR+ ELV LRG GTG+L+EWDRVYDYAYYNDLGDPDKG E
Sbjct  164  AYLPSETPEPLRKYRENELVTLRGDGTGKLEEWDRVYDYAYYNDLGDPDKGEE  216



>gb|KDO74649.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=627

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLP QTP PL+KYR EELV+LRG G GELKEWDRVYDYA+YNDLG+PDKG E
Sbjct  180  TYLPCQTPEPLRKYRREELVNLRGNGKGELKEWDRVYDYAFYNDLGNPDKGPE  232



>gb|KCW44986.1| hypothetical protein EUGRSUZ_L01433 [Eucalyptus grandis]
Length=636

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  YLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            YLP QTPAPL KYR+EELV+LRG GTGEL+EWDRVYDYAYYNDLG+PDK A+
Sbjct  168  YLPGQTPAPLVKYREEELVNLRGDGTGELQEWDRVYDYAYYNDLGNPDKDAK  219



>ref|XP_010025195.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61798.1| hypothetical protein EUGRSUZ_H04496 [Eucalyptus grandis]
Length=871

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLP +TPAPL KYR+EELV+LRG GTGEL+EWDRVYDYAYYNDLGDPDKG +
Sbjct  173  TYLPRETPAPLVKYREEELVNLRGDGTGELQEWDRVYDYAYYNDLGDPDKGTK  225



>ref|XP_006419897.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
 gb|ESR33137.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
Length=656

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLP QTP PL+KYR EELV+LRG G GELKEWDRVYDYA+YNDLG+PDKG E
Sbjct  180  TYLPCQTPEPLRKYRREELVNLRGNGKGELKEWDRVYDYAFYNDLGNPDKGPE  232



>ref|XP_009376659.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
 ref|XP_009376682.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=862

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS+TP PL+KYR+EELVHLRG G GEL+EW+RVYDYAYYNDLG PDKGA+
Sbjct  165  TYLPSETPLPLQKYREEELVHLRGDGKGELQEWERVYDYAYYNDLGKPDKGAK  217



>ref|XP_010040715.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
Length=656

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  YLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            YLP QTPAPL KYR+EELV+LRG GTGEL+EWDRVYDYAYYNDLG+PDK A+
Sbjct  168  YLPGQTPAPLVKYREEELVNLRGDGTGELQEWDRVYDYAYYNDLGNPDKDAK  219



>emb|CAB94852.1| lipoxygenase [Prunus dulcis]
Length=862

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             +LPS+TP PL+KYR+EELVHLRG G GEL+EWDRVYDYAYYNDLG+PDKG
Sbjct  165  TFLPSETPLPLRKYREEELVHLRGDGKGELQEWDRVYDYAYYNDLGNPDKG  215



>ref|XP_008246453.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=947

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             +LPS+TP PL+KYR+EELVHLRG G GEL+EWDRVYDYAYYNDLG+PDKG
Sbjct  250  TFLPSETPLPLQKYREEELVHLRGDGKGELQEWDRVYDYAYYNDLGNPDKG  300



>gb|KCW61797.1| hypothetical protein EUGRSUZ_H04495 [Eucalyptus grandis]
Length=443

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDK  11
             YLP QTPAPL KYR+EELV+LRG GTGEL+EWDRVYDYAYYNDLG+PDK
Sbjct  167  TYLPGQTPAPLVKYREEELVNLRGDGTGELQEWDRVYDYAYYNDLGNPDK  216



>ref|XP_007208098.1| hypothetical protein PRUPE_ppa001293mg [Prunus persica]
 gb|EMJ09297.1| hypothetical protein PRUPE_ppa001293mg [Prunus persica]
Length=862

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             +LPS+TP PL+KYR+EELVHLRG G GEL+EWDRVYDYAYYNDLG+PDKG
Sbjct  165  TFLPSETPLPLRKYREEELVHLRGDGKGELQEWDRVYDYAYYNDLGNPDKG  215



>ref|XP_007204937.1| hypothetical protein PRUPE_ppa001311mg [Prunus persica]
 gb|EMJ06136.1| hypothetical protein PRUPE_ppa001311mg [Prunus persica]
Length=856

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             +LPS+TP PL+KYR+EELVHLRG G GEL+EWDRVYDYAYYNDLG+PDKG
Sbjct  160  TFLPSETPLPLQKYREEELVHLRGDGKGELQEWDRVYDYAYYNDLGNPDKG  210



>ref|XP_010025193.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61802.1| hypothetical protein EUGRSUZ_H04499 [Eucalyptus grandis]
Length=871

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDK  11
             YLPSQTPAPL KYR+EELV+LRG GT EL+EWDRVYDYAYYNDLGDPDK
Sbjct  173  TYLPSQTPAPLVKYREEELVNLRGDGTAELQEWDRVYDYAYYNDLGDPDK  222



>gb|KDO74647.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=882

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLP QTP PL+KYR EELV+LRG G GELKEWDRVYDYA+YNDLG+PDKG E
Sbjct  180  TYLPCQTPEPLRKYRREELVNLRGNGKGELKEWDRVYDYAFYNDLGNPDKGPE  232



>ref|XP_006419898.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
 ref|XP_006489365.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Citrus 
sinensis]
 gb|ESR33138.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
Length=882

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLP QTP PL+KYR EELV+LRG G GELKEWDRVYDYA+YNDLG+PDKG E
Sbjct  180  TYLPCQTPEPLRKYRREELVNLRGNGKGELKEWDRVYDYAFYNDLGNPDKGPE  232



>gb|KDO74648.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=803

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLP QTP PL+KYR EELV+LRG G GELKEWDRVYDYA+YNDLG+PDKG E
Sbjct  101  TYLPCQTPEPLRKYRREELVNLRGNGKGELKEWDRVYDYAFYNDLGNPDKGPE  153



>gb|ACG56281.1| lipoxygenase [Olea europaea]
Length=864

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS+TP PL KYR+EELV+LRG G+G+L+EWDRVYDYAYYNDLGDPDKG++
Sbjct  166  TYLPSETPEPLVKYREEELVNLRGNGSGQLEEWDRVYDYAYYNDLGDPDKGSD  218



>ref|XP_010256003.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nelumbo nucifera]
 ref|XP_010256004.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nelumbo nucifera]
 ref|XP_010256005.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nelumbo nucifera]
Length=874

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            +YLP++TP PL+KYR+EELV+LRG GT EL+EWDRVYDYAYYNDLGDPDKG E
Sbjct  171  SYLPAKTPEPLRKYREEELVNLRGDGTEELQEWDRVYDYAYYNDLGDPDKGPE  223



>gb|KCW61796.1| hypothetical protein EUGRSUZ_H04495 [Eucalyptus grandis]
Length=614

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDK  11
             YLP QTPAPL KYR+EELV+LRG GTGEL+EWDRVYDYAYYNDLG+PDK
Sbjct  167  TYLPGQTPAPLVKYREEELVNLRGDGTGELQEWDRVYDYAYYNDLGNPDK  216



>emb|CDP20618.1| unnamed protein product [Coffea canephora]
Length=857

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLPS TP PL++YR+EEL+ LRG GTGEL+EWDRVYDYAYYNDL DPDKG++
Sbjct  159  AYLPSDTPEPLRRYREEELLTLRGDGTGELQEWDRVYDYAYYNDLADPDKGSD  211



>emb|CBI16430.3| unnamed protein product [Vitis vinifera]
Length=335

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDK  11
             YLPS+TP PL+KYR+ ELV+LRG GTGELKEWDRVYDYAYYNDLG+PD+
Sbjct  9    TYLPSETPGPLRKYREGELVNLRGDGTGELKEWDRVYDYAYYNDLGNPDR  58



>ref|XP_009774054.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana sylvestris]
Length=844

 Score = 91.7 bits (226),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            A+LPS+TPAPL+ YR+EEL++LRG GTG+L+EWDRVYDYAYYNDLGDP+KG++
Sbjct  151  AWLPSETPAPLRWYREEELLNLRGNGTGKLEEWDRVYDYAYYNDLGDPEKGSD  203



>ref|XP_010025196.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61795.1| hypothetical protein EUGRSUZ_H04495 [Eucalyptus grandis]
Length=864

 Score = 91.7 bits (226),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDK  11
             YLP QTPAPL KYR+EELV+LRG GTGEL+EWDRVYDYAYYNDLG+PDK
Sbjct  167  TYLPGQTPAPLVKYREEELVNLRGDGTGELQEWDRVYDYAYYNDLGNPDK  216



>ref|XP_010094672.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXB56580.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=792

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPS+TPA L+KYR+EELV+LRG G GELKEWDRVYDYAYYNDLG+PDKG
Sbjct  95   TYLPSETPATLRKYREEELVNLRGDGKGELKEWDRVYDYAYYNDLGNPDKG  145



>ref|XP_009625817.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=844

 Score = 91.3 bits (225),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            A+LPS+TPAPL+ YR+EEL++LRG GTG+L+EWDR+YDYAYYNDLGDP+KG++
Sbjct  151  AWLPSETPAPLRWYREEELLNLRGNGTGKLEEWDRIYDYAYYNDLGDPEKGSD  203



>ref|XP_010651467.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Vitis vinifera]
Length=372

 Score = 89.0 bits (219),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDK  11
             YLPS+TP PL+KYR+ ELV+LRG GTGELKEWDRVYDYAYYNDLG+PD+
Sbjct  46   TYLPSETPGPLRKYREGELVNLRGDGTGELKEWDRVYDYAYYNDLGNPDR  95



>ref|XP_010277584.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nelumbo 
nucifera]
Length=883

 Score = 91.3 bits (225),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLP+ TP PL+KYR+EE+V+LRG GTGEL+EWDRVYDYAYYNDLG+PDKG
Sbjct  182  TYLPANTPEPLRKYREEEIVNLRGDGTGELQEWDRVYDYAYYNDLGNPDKG  232



>ref|XP_011087404.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Sesamum indicum]
Length=867

 Score = 91.3 bits (225),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            +YLPS+TPAPL  YR+EELV+LRG G+G+L+EWDRVYDYAYYNDLGDPDKG +
Sbjct  169  SYLPSETPAPLLPYREEELVNLRGDGSGQLEEWDRVYDYAYYNDLGDPDKGQD  221



>ref|XP_010277588.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Nelumbo 
nucifera]
Length=703

 Score = 90.9 bits (224),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLP+ TP PL+KYR+EE+V+LRG GTGEL+EWDRVYDYAYYNDLG+PDKG
Sbjct  2    TYLPANTPEPLRKYREEEIVNLRGDGTGELQEWDRVYDYAYYNDLGNPDKG  52



>ref|XP_010324011.1| PREDICTED: linoleate 9S-lipoxygenase B isoform X1 [Solanum lycopersicum]
Length=859

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLPS+TP PL+KYR+ ELV LRG GTG+L+EWDRVYDYA YNDLGDPDKG E
Sbjct  161  AYLPSETPQPLRKYRENELVALRGDGTGKLEEWDRVYDYACYNDLGDPDKGEE  213



>gb|KDP40158.1| hypothetical protein JCGZ_02156 [Jatropha curcas]
Length=867

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLP QTP  L+KYR+EEL++LRG G GELKEWDRVYDYAYYNDLG PDKG E
Sbjct  165  TYLPCQTPESLRKYREEELINLRGNGKGELKEWDRVYDYAYYNDLGSPDKGKE  217



>ref|XP_008246455.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=849

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             +LPS+TP PL+KYR+EELVHLRG G GEL+EWDRVYDYAYYNDLG+PD G
Sbjct  165  TFLPSETPLPLQKYREEELVHLRGDGKGELQEWDRVYDYAYYNDLGNPDMG  215



>ref|NP_001281030.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82778.1| lipoxygenase [Malus domestica]
Length=862

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS+TP PL+KY +EELVHLRG G GEL+EW+RVYDYAYYNDLG PDKGA+
Sbjct  165  TYLPSETPLPLRKYIEEELVHLRGDGKGELQEWERVYDYAYYNDLGKPDKGAK  217



>gb|AGL96414.1| 9-lipoxygenase, partial [Nicotiana benthamiana]
Length=862

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLPS+TP PL+K R+ ELV LRG GTG+L+EWDRVYDYAYYNDLGDPDKG E
Sbjct  163  AYLPSETPEPLRKCRENELVTLRGDGTGKLEEWDRVYDYAYYNDLGDPDKGKE  215



>ref|XP_009774053.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana sylvestris]
Length=862

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLPS+TP PL+K R+ ELV LRG GTG+L+EWDRVYDYAYYNDLGDPDKG E
Sbjct  163  AYLPSETPEPLRKCRENELVTLRGDGTGKLEEWDRVYDYAYYNDLGDPDKGKE  215



>ref|XP_002516771.1| lipoxygenase, putative [Ricinus communis]
 gb|EEF45385.1| lipoxygenase, putative [Ricinus communis]
Length=868

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLP QTP PL+KYR+EEL++LRG G G+L+EWDRVYDYAYYNDLG PDKG E
Sbjct  166  TYLPCQTPKPLRKYREEELINLRGNGKGKLEEWDRVYDYAYYNDLGSPDKGKE  218



>ref|XP_010323952.1| PREDICTED: lipoxygenase isoform X3 [Solanum lycopersicum]
Length=853

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLPS+TP PL+KYR+ EL  LRG GTG+L+EWDRVYDYAYYNDLGDPDKG E
Sbjct  153  AYLPSETPQPLRKYRENELETLRGDGTGKLEEWDRVYDYAYYNDLGDPDKGEE  205



>ref|XP_004230206.1| PREDICTED: lipoxygenase isoform X2 [Solanum lycopersicum]
Length=854

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLPS+TP PL+KYR+ EL  LRG GTG+L+EWDRVYDYAYYNDLGDPDKG E
Sbjct  154  AYLPSETPQPLRKYRENELETLRGDGTGKLEEWDRVYDYAYYNDLGDPDKGEE  206



>ref|XP_010323943.1| PREDICTED: lipoxygenase isoform X1 [Solanum lycopersicum]
Length=862

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLPS+TP PL+KYR+ EL  LRG GTG+L+EWDRVYDYAYYNDLGDPDKG E
Sbjct  162  AYLPSETPQPLRKYRENELETLRGDGTGKLEEWDRVYDYAYYNDLGDPDKGEE  214



>emb|CAD10740.1| lipoxygenase [Corylus avellana]
Length=873

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             +LP++TP PL KYR+EELV+LRG GTGEL+EWDRVYDYAYYNDLG+PDKG
Sbjct  176  TFLPNETPGPLLKYREEELVNLRGDGTGELQEWDRVYDYAYYNDLGNPDKG  226



>ref|XP_011026284.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Populus 
euphratica]
Length=881

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLP QTP PL+ YR+EEL++LRG G GELKEWDRVYDY YYNDLG PDKG E
Sbjct  179  AYLPCQTPEPLRLYREEELINLRGNGKGELKEWDRVYDYDYYNDLGSPDKGEE  231



>ref|XP_011026291.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Populus 
euphratica]
Length=880

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLP QTP PL+ YR+EEL++LRG G GELKEWDRVYDY YYNDLG PDKG E
Sbjct  178  AYLPCQTPEPLRLYREEELINLRGNGKGELKEWDRVYDYDYYNDLGSPDKGEE  230



>gb|AAD09861.1| lipoxygenase [Persea americana]
Length=858

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YL S  P PL+KYR+EELVHLRG G GELKEWDRVYDYA+YNDLGDPDKG
Sbjct  162  TYLSSDMPEPLRKYREEELVHLRGDGEGELKEWDRVYDYAFYNDLGDPDKG  212



>ref|XP_011092040.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X4 [Sesamum 
indicum]
Length=866

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLPSQTPAPL+ YR+EEL +LRG GTG+L+EWDRVYDY  YNDLGDPDKG E
Sbjct  168  AYLPSQTPAPLRGYREEELENLRGNGTGKLEEWDRVYDYDIYNDLGDPDKGPE  220



>ref|XP_011092039.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X3 [Sesamum 
indicum]
Length=867

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLPSQTPAPL+ YR+EEL +LRG GTG+L+EWDRVYDY  YNDLGDPDKG E
Sbjct  169  AYLPSQTPAPLRGYREEELENLRGNGTGKLEEWDRVYDYDIYNDLGDPDKGPE  221



>ref|NP_001234098.1| lipoxygenase [Solanum lycopersicum]
 gb|AAG21691.1| lipoxygenase [Solanum lycopersicum]
Length=862

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLPS+TP  L+KYR+ ELV LRG GTG+L+EWDRVYDYAYYNDLGDPDKG E
Sbjct  162  AYLPSETPELLRKYRENELVALRGDGTGKLEEWDRVYDYAYYNDLGDPDKGQE  214



>ref|XP_011092038.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Sesamum 
indicum]
Length=906

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLPSQTPAPL+ YR+EEL +LRG GTG+L+EWDRVYDY  YNDLGDPDKG E
Sbjct  208  AYLPSQTPAPLRGYREEELENLRGNGTGKLEEWDRVYDYDIYNDLGDPDKGPE  260



>ref|XP_011092037.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Sesamum 
indicum]
Length=907

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLPSQTPAPL+ YR+EEL +LRG GTG+L+EWDRVYDY  YNDLGDPDKG E
Sbjct  209  AYLPSQTPAPLRGYREEELENLRGNGTGKLEEWDRVYDYDIYNDLGDPDKGPE  261



>ref|XP_006344621.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=862

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLPS+TP  L+KYR+ ELV LRG GTG+L+EWDRVYDYAYYNDLGDPDKG E
Sbjct  162  AYLPSETPELLRKYRENELVALRGDGTGKLEEWDRVYDYAYYNDLGDPDKGEE  214



>ref|XP_009597615.1| PREDICTED: linoleate 9S-lipoxygenase 6 [Nicotiana tomentosiformis]
Length=861

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS+TPAPL+KYR+ EL+ LRG GTG+L+ WDRVYDYA+YNDLGDPD+GA+
Sbjct  163  TYLPSETPAPLRKYRENELLTLRGGGTGKLEAWDRVYDYAFYNDLGDPDQGAQ  215



>ref|XP_009787604.1| PREDICTED: linoleate 9S-lipoxygenase 6 [Nicotiana sylvestris]
Length=861

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS+TPAPL+KYR+ EL+ LRG GTG+L+ WDRVYDYA+YNDLGDPD+GA+
Sbjct  163  TYLPSETPAPLRKYRENELLTLRGDGTGKLEAWDRVYDYAFYNDLGDPDQGAQ  215



>ref|XP_003521704.2| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Glycine 
max]
Length=858

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS+TP PL KYR+EEL +LRG G G L+EWDRVYDYAYYNDLGDPDKGA+
Sbjct  161  TYLPSETPVPLLKYREEELENLRGDGKGTLQEWDRVYDYAYYNDLGDPDKGAQ  213



>gb|KHN03989.1| Putative linoleate 9S-lipoxygenase 5 [Glycine soja]
Length=855

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS+TP PL KYR+EEL +LRG G G L+EWDRVYDYAYYNDLGDPDKGA+
Sbjct  161  TYLPSETPVPLLKYREEELENLRGDGKGTLQEWDRVYDYAYYNDLGDPDKGAQ  213



>ref|XP_006382595.1| hypothetical protein POPTR_0005s03580g [Populus trichocarpa]
 gb|ERP60392.1| hypothetical protein POPTR_0005s03580g [Populus trichocarpa]
Length=863

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             +LP   PAPL+KYR+EELV LRG G GELKEWDRVYDYAYYNDLGDPD+GA+
Sbjct  165  THLPQDAPAPLRKYREEELVKLRGDGKGELKEWDRVYDYAYYNDLGDPDEGAK  217



>gb|AAA74393.1| lipoxygenase [Solanum lycopersicum]
Length=859

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLPS+TP PL+KYR+ ELV LRG GTG+L+EWDRVYDYA YNDLG+PDKG E
Sbjct  161  AYLPSETPQPLRKYRENELVALRGDGTGKLEEWDRVYDYACYNDLGEPDKGEE  213



>ref|NP_001234873.1| linoleate 9S-lipoxygenase B [Solanum lycopersicum]
 sp|P38416.1|LOXB_SOLLC RecName: Full=Linoleate 9S-lipoxygenase B; AltName: Full=Lipoxygenase 
B [Solanum lycopersicum]
 gb|AAA53183.1| lipoxygenase [Solanum lycopersicum]
Length=859

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLPS+TP PL+KYR+ ELV LRG GTG+L+EWDRVYDYA YNDLG+PDKG E
Sbjct  161  AYLPSETPQPLRKYRENELVALRGDGTGKLEEWDRVYDYACYNDLGEPDKGEE  213



>ref|XP_011021549.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Populus 
euphratica]
Length=880

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLP QTP PL+ YR+EEL++LRG G GELKEWDRVYDY YYNDLG+PDKG E
Sbjct  178  AYLPCQTPEPLRLYREEELLNLRGHGKGELKEWDRVYDYDYYNDLGNPDKGEE  230



>ref|XP_002315780.1| lipoxygenase family protein [Populus trichocarpa]
 gb|EEF01951.1| lipoxygenase family protein [Populus trichocarpa]
Length=880

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLP QTP PL+ YR+EEL++LRG G GELKEWDRVYDY YYNDLG+PDKG E
Sbjct  178  AYLPCQTPEPLRLYREEELLNLRGHGKGELKEWDRVYDYDYYNDLGNPDKGEE  230



>ref|XP_011021548.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Populus 
euphratica]
Length=881

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLP QTP PL+ YR+EEL++LRG G GELKEWDRVYDY YYNDLG+PDKG E
Sbjct  179  AYLPCQTPEPLRLYREEELLNLRGHGKGELKEWDRVYDYDYYNDLGNPDKGEE  231



>ref|XP_009610900.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=862

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLPS+TP  L+KYR+ ELV LRG GTG+L+EWDRVYDYAYYNDLGDPDKG +
Sbjct  163  AYLPSETPETLRKYRENELVTLRGDGTGKLEEWDRVYDYAYYNDLGDPDKGQD  215



>emb|CAE17327.1| lipoxygenase [Fragaria x ananassa]
Length=884

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLPSQTP  L  YR+EEL +LRG G+GELKEWDRVYDYAYYNDLG PDKG E
Sbjct  182  AYLPSQTPELLLPYREEELTNLRGIGSGELKEWDRVYDYAYYNDLGSPDKGPE  234



>ref|XP_004296897.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=884

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLPSQTP  L  YR+EEL +LRG G+GELKEWDRVYDYAYYNDLG PDKG E
Sbjct  182  AYLPSQTPELLLPYREEELTNLRGIGSGELKEWDRVYDYAYYNDLGSPDKGPE  234



>gb|AHX56187.1| lipoxygenase [Diospyros kaki]
Length=872

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGA  5
             YLP +TPAPL  YR+EELV LRG G+GEL+EWDRVYDYAYYNDLGDPDKG+
Sbjct  174  TYLPLETPAPLIPYREEELVSLRGDGSGELEEWDRVYDYAYYNDLGDPDKGS  225



>ref|XP_002311617.1| lipoxygenase family protein [Populus trichocarpa]
 gb|EEE88984.1| lipoxygenase family protein [Populus trichocarpa]
Length=880

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            AYLP QTP PL+ YR+EEL++LRG G GELKEWDRVYDY YYNDLG PDKG
Sbjct  178  AYLPCQTPEPLRLYREEELINLRGNGKGELKEWDRVYDYDYYNDLGSPDKG  228



>ref|XP_010674736.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Beta vulgaris 
subsp. vulgaris]
Length=861

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLP QTPAPL+KYR+EEL  LRG G G+L+EWDRVYDYAYYNDLGDPDKG
Sbjct  163  TYLPHQTPAPLRKYREEELEILRGNGEGKLEEWDRVYDYAYYNDLGDPDKG  213



>ref|XP_006344622.1| PREDICTED: linoleate 9S-lipoxygenase B-like [Solanum tuberosum]
Length=860

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLPS+TP PL+ YR+ ELV LRG GTG+L+EWDRVYDYA YNDLGDPDKG E
Sbjct  161  AYLPSETPEPLRNYRENELVVLRGDGTGKLEEWDRVYDYACYNDLGDPDKGEE  213



>emb|CAA58859.1| lipoxygenase [Nicotiana tabacum]
Length=862

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLPS+TP  L+KYR+ ELV LRG GTG+L+EWDRVYDYAYYNDLGDPDKG +
Sbjct  163  AYLPSETPDTLRKYRENELVTLRGDGTGKLEEWDRVYDYAYYNDLGDPDKGQD  215



>gb|AGK82776.1| lipoxygenase [Malus domestica]
Length=900

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            AYLPSQTP  L  YR+EEL +LRG+G+GELKEWDRVYDYAYYNDLG PDKG
Sbjct  174  AYLPSQTPELLHPYREEELANLRGSGSGELKEWDRVYDYAYYNDLGSPDKG  224



>ref|XP_009344082.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=894

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            AYLPSQTP  L  YR+EEL +LRG+G+GELKEWDRVYDYAYYNDLG PDKG
Sbjct  189  AYLPSQTPELLHPYREEELANLRGSGSGELKEWDRVYDYAYYNDLGSPDKG  239



>gb|AGK82775.1| lipoxygenase [Malus domestica]
Length=900

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            AYLPSQTP  L  YR+EEL +LRG+G+GELKEWDRVYDYAYYNDLG PDKG
Sbjct  174  AYLPSQTPELLHPYREEELANLRGSGSGELKEWDRVYDYAYYNDLGSPDKG  224



>gb|AGK82774.1| lipoxygenase [Malus domestica]
Length=900

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            AYLPSQTP  L  YR+EEL +LRG+G+GELKEWDRVYDYAYYNDLG PDKG
Sbjct  174  AYLPSQTPELLHPYREEELANLRGSGSGELKEWDRVYDYAYYNDLGSPDKG  224



>ref|NP_001280980.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82784.1| lipoxygenase [Malus domestica]
Length=879

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            AYLPSQTP  L  YR+EEL +LRG+G+GELKEWDRVYDYAYYNDLG PDKG
Sbjct  174  AYLPSQTPELLHPYREEELANLRGSGSGELKEWDRVYDYAYYNDLGSPDKG  224



>gb|AGK82783.1| lipoxygenase [Malus domestica]
Length=879

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            AYLPSQTP  L  YR+EEL +LRG+G+GELKEWDRVYDYAYYNDLG PDKG
Sbjct  174  AYLPSQTPELLHPYREEELANLRGSGSGELKEWDRVYDYAYYNDLGSPDKG  224



>ref|XP_009366923.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=884

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLPS+TP  L  YR++ELV+LRG+G+GELKEWDRVYDYAYYNDLG PDKG E
Sbjct  179  AYLPSKTPELLHPYREDELVNLRGSGSGELKEWDRVYDYAYYNDLGSPDKGPE  231



>gb|AGU28274.1| lipoxygenase 1 [Vitis vinifera]
Length=859

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDK  11
             YLPS+TP PL+KYR  ELV+LRG GTGELKEWDRVYDYAYYNDLG+PD+
Sbjct  161  TYLPSETPGPLRKYRKGELVNLRGDGTGELKEWDRVYDYAYYNDLGNPDR  210



>ref|XP_007150490.1| hypothetical protein PHAVU_005G157000g [Phaseolus vulgaris]
 gb|ESW22484.1| hypothetical protein PHAVU_005G157000g [Phaseolus vulgaris]
Length=860

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -2

Query  157  YLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            YLPS+TPAPL KYR+EELV++RG GTGE KEWDR+YDY  YNDLGDPDKG
Sbjct  170  YLPSETPAPLVKYREEELVNMRGDGTGERKEWDRIYDYDVYNDLGDPDKG  219



>ref|NP_001268178.1| lipoxygenase [Vitis vinifera]
 gb|ACZ17392.1| lipoxygenase [Vitis vinifera]
Length=859

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDK  11
             YLPS+TP PL+KYR  ELV+LRG GTGELKEWDRVYDYAYYNDLG+PD+
Sbjct  161  TYLPSETPGPLRKYRKGELVNLRGDGTGELKEWDRVYDYAYYNDLGNPDR  210



>gb|AGK82798.1| lipoxygenase [Malus domestica]
Length=864

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS+ P PL+KY +EELV LRG G G+L+EWDRVYDYAYYNDLGDPDKG+E
Sbjct  166  TYLPSEVPLPLRKYIEEELVELRGDGKGKLEEWDRVYDYAYYNDLGDPDKGSE  218



>gb|AGI16379.1| lipoxygenase [Malus domestica]
 gb|AGK82797.1| lipoxygenase [Malus domestica]
Length=863

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS+ P PL+KY +EELV LRG G G+L+EWDRVYDYAYYNDLGDPDKG+E
Sbjct  166  TYLPSEVPLPLRKYIEEELVELRGDGKGKLEEWDRVYDYAYYNDLGDPDKGSE  218



>gb|AGI16378.1| lipoxygenase [Malus domestica]
 gb|AGI16381.1| lipoxygenase [Malus domestica]
 gb|AGK82777.1| lipoxygenase [Malus domestica]
 gb|AGK82799.1| lipoxygenase [Malus domestica]
Length=863

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS+ P PL+KY +EELV LRG G G+L+EWDRVYDYAYYNDLGDPDKG+E
Sbjct  166  TYLPSEVPLPLRKYIEEELVELRGDGKGKLEEWDRVYDYAYYNDLGDPDKGSE  218



>ref|XP_004309944.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=860

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS TP PL+KYR +EL  LRG GTGEL+EWDRVYDYA YNDLGDPDKG++
Sbjct  161  TYLPSDTPLPLRKYRQQELEQLRGNGTGELEEWDRVYDYACYNDLGDPDKGSK  213



>ref|XP_010024349.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW60798.1| hypothetical protein EUGRSUZ_H03535 [Eucalyptus grandis]
Length=899

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLP QTP  L KYR+EELV+L+G+G+GELKEWDRVYDYAYYNDLG PDKG
Sbjct  196  TYLPCQTPLALLKYREEELVNLQGSGSGELKEWDRVYDYAYYNDLGSPDKG  246



>ref|XP_007147045.1| hypothetical protein PHAVU_006G091400g [Phaseolus vulgaris]
 gb|ESW19039.1| hypothetical protein PHAVU_006G091400g [Phaseolus vulgaris]
Length=863

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLPS+TP PL KYR+EEL  LRG G G L+EWDRVYDYAYYNDL DPDKGA+
Sbjct  166  AYLPSETPEPLLKYREEELESLRGDGRGTLQEWDRVYDYAYYNDLSDPDKGAQ  218



>gb|EYU42168.1| hypothetical protein MIMGU_mgv1a001215mg [Erythranthe guttata]
Length=864

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLP+QTPAPL++YR+EEL +LRG GTG+L+EWDRVYDY  YNDLGDPDKG
Sbjct  166  TYLPNQTPAPLRRYREEELQNLRGNGTGKLEEWDRVYDYDIYNDLGDPDKG  216



>ref|XP_007143238.1| hypothetical protein PHAVU_007G055800g [Phaseolus vulgaris]
 gb|ESW15232.1| hypothetical protein PHAVU_007G055800g [Phaseolus vulgaris]
Length=856

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            AYLP QTP PL+++R++EL+ LRG G G LKEWDRVYDYAYYNDLG PD G
Sbjct  153  AYLPCQTPEPLRRFREQELIVLRGKGFGRLKEWDRVYDYAYYNDLGSPDNG  203



>gb|AGH13205.1| lipoxygenase [Salvia miltiorrhiza]
Length=856

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPSQTP PL+ YR+EEL +LRGTGTG+L+EWDRVYDY  YNDLGDPDKG E
Sbjct  158  TYLPSQTPPPLRGYREEELENLRGTGTGKLEEWDRVYDYDIYNDLGDPDKGPE  210



>emb|CBI36802.3| unnamed protein product [Vitis vinifera]
Length=900

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDK  11
             YLPS+TP PL+KYR+ ELV+LRG GTG+LKEWDRVYDYAYYNDLG+PD+
Sbjct  202  TYLPSETPGPLRKYREGELVNLRGDGTGKLKEWDRVYDYAYYNDLGNPDR  251



>emb|CBI36801.3| unnamed protein product [Vitis vinifera]
Length=738

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDK  11
             YLPS+TP PL+KYR  ELV+LRG GTGELKEWDRVYDYAYYNDLG PD+
Sbjct  161  TYLPSETPGPLRKYRKGELVNLRGDGTGELKEWDRVYDYAYYNDLGKPDR  210



>ref|XP_010659859.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Vitis vinifera]
Length=875

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDK  11
             YLPS+TP PL+KYR+ ELV+LRG GTG+LKEWDRVYDYAYYNDLG+PD+
Sbjct  177  TYLPSETPGPLRKYREGELVNLRGDGTGKLKEWDRVYDYAYYNDLGNPDR  226



>ref|XP_010659819.1| PREDICTED: lipoxygenase isoform X1 [Vitis vinifera]
Length=859

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDK  11
             YLPS+TP PL+KYR  ELV+LRG GTGELKEWDRVYDYAYYNDLG PD+
Sbjct  161  TYLPSETPGPLRKYRKGELVNLRGDGTGELKEWDRVYDYAYYNDLGKPDR  210



>ref|XP_011023611.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=861

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLP +TPAPL+KYR+EEL HLRG G GELKEWDRVYDY +YNDLG   KG+E
Sbjct  165  TYLPHETPAPLRKYREEELFHLRGNGEGELKEWDRVYDYDFYNDLGSSKKGSE  217



>ref|XP_009626059.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Nicotiana 
tomentosiformis]
Length=876

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS TP PL+ YR+EEL++LRG+G+G LKEWDRVYDYA+YNDLG PDKG E
Sbjct  175  TYLPSNTPEPLRPYREEELLNLRGSGSGMLKEWDRVYDYAFYNDLGFPDKGPE  227



>ref|XP_002319015.2| hypothetical protein POPTR_0013s02310g [Populus trichocarpa]
 gb|EEE94938.2| hypothetical protein POPTR_0013s02310g [Populus trichocarpa]
Length=862

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLP +TPAPL+KYR+EEL HLRG G GELKEWDRVYDY +YNDLG   KG+E
Sbjct  165  TYLPHETPAPLRKYREEELFHLRGNGEGELKEWDRVYDYDFYNDLGSSKKGSE  217



>ref|XP_011458135.1| PREDICTED: linoleate 9S-lipoxygenase 6-like [Fragaria vesca subsp. 
vesca]
Length=845

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  YLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            YLPSQTP  L K R EEL  LRG G+GE KEW+R+YDY YYNDLGDPDKGAE
Sbjct  158  YLPSQTPQALIKLRKEELSSLRGNGSGERKEWERIYDYDYYNDLGDPDKGAE  209



>ref|XP_009626058.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nicotiana 
tomentosiformis]
Length=886

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS TP PL+ YR+EEL++LRG+G+G LKEWDRVYDYA+YNDLG PDKG E
Sbjct  185  TYLPSNTPEPLRPYREEELLNLRGSGSGMLKEWDRVYDYAFYNDLGFPDKGPE  237



>ref|XP_002512386.1| lipoxygenase, putative [Ricinus communis]
 gb|EEF49838.1| lipoxygenase, putative [Ricinus communis]
Length=871

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            AYLP +TP PL+KYR+EELV LRG G  ELKEWDRVYDYA YNDL DPDKG
Sbjct  172  AYLPHETPMPLRKYREEELVSLRGDGKAELKEWDRVYDYACYNDLADPDKG  222



>emb|CDP20620.1| unnamed protein product [Coffea canephora]
Length=772

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            AYLP  TP PLK YR+ ELV+LRG GTGE KEWDR+YDYAYYNDLGDPDK 
Sbjct  105  AYLPHNTPEPLKFYREAELVNLRGDGTGERKEWDRIYDYAYYNDLGDPDKN  155



>ref|XP_008359964.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
5 [Malus domestica]
Length=326

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS+TP PL+K+ +E LVHLRG G GE ++WDRVYDYAYYNDLG PDKGA+
Sbjct  104  TYLPSETPLPLRKHXEEXLVHLRGDGKGEPQKWDRVYDYAYYNDLGKPDKGAK  156



>ref|XP_011036801.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=863

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             +LP  +PAPL+KYR+ ELV LRG G GELKEWDRVYDYAYYNDLGDPD+G +
Sbjct  165  THLPQDSPAPLRKYREAELVKLRGDGKGELKEWDRVYDYAYYNDLGDPDEGTK  217



>ref|XP_008340970.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Malus 
domestica]
Length=850

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLPS+TP  L  YR++ELV+LRG+G+GE KEWDRVYDYAYYNDLG PDKG E
Sbjct  145  AYLPSETPELLHPYREDELVNLRGSGSGEXKEWDRVYDYAYYNDLGSPDKGPE  197



>gb|AAP83135.1| lipoxygenase [Nicotiana attenuata]
Length=861

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS+TPAPL KYR+ EL+ LRG GTG+L+ WDRVYDYA YNDLGDPD+GA+
Sbjct  163  TYLPSETPAPLLKYRENELLTLRGDGTGKLEAWDRVYDYALYNDLGDPDQGAQ  215



>gb|AAP83134.1| lipoxygenase [Nicotiana attenuata]
 gb|AAP83136.1| lipoxygenase [Nicotiana attenuata]
Length=861

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS+TPAPL KYR+ EL+ LRG GTG+L+ WDRVYDYA YNDLGDPD+GA+
Sbjct  163  TYLPSETPAPLLKYRENELLTLRGDGTGKLEAWDRVYDYALYNDLGDPDQGAQ  215



>ref|XP_008388563.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Malus domestica]
Length=912

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 47/56 (84%), Gaps = 3/56 (5%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRG---TGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS+TP PL+KYR+EELVHLRG    G GEL+EWDRVYDY  YNDLG+PDKGA+
Sbjct  252  TYLPSETPLPLRKYREEELVHLRGDDEKGKGELQEWDRVYDYDCYNDLGNPDKGAK  307



>gb|ABF19103.2| 9-lipoxygenase [Capsicum annuum]
Length=876

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS TP PL+ YR+EEL+ LRG+G+G LKEWDRVYDYA+YNDLG PDKG E
Sbjct  175  TYLPSNTPEPLRPYREEELLSLRGSGSGMLKEWDRVYDYAFYNDLGFPDKGPE  227



>dbj|BAH57745.1| lipoxygenase [Actinidia arguta]
Length=886

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLP QTP PL+ YR++ELV+LRG G+GELK+WDRVYDYAYYN+LG P+KG E
Sbjct  184  TYLPGQTPEPLRDYREQELVNLRGNGSGELKKWDRVYDYAYYNNLGMPNKGKE  236



>gb|AGK82779.1| lipoxygenase [Malus domestica]
Length=952

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 47/56 (84%), Gaps = 3/56 (5%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRG---TGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS+TP PL+KYR+EELVHLRG    G GEL+EWDRVYDY  YNDLG+PDKGA+
Sbjct  252  TYLPSETPLPLRKYREEELVHLRGDDEKGKGELQEWDRVYDYDCYNDLGNPDKGAK  307



>ref|XP_006850111.1| hypothetical protein AMTR_s00022p00225700 [Amborella trichopoda]
 gb|ERN11692.1| hypothetical protein AMTR_s00022p00225700 [Amborella trichopoda]
Length=618

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPD  14
            +YLPS+TP  LKK R+EEL++LRG G GELKEWDRVYDYAYYNDLG+PD
Sbjct  169  SYLPSETPLALKKLREEELLNLRGNGVGELKEWDRVYDYAYYNDLGNPD  217



>emb|CCD74473.1| lipoxygenase 1, partial [Arabidopsis halleri subsp. halleri]
Length=381

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLP +TPA L KYR+EELV LRGTG GELKEWDRVYDYAYYNDLG P K 
Sbjct  162  TYLPHETPATLLKYREEELVSLRGTGEGELKEWDRVYDYAYYNDLGAPPKN  212



>gb|KCW61804.1| hypothetical protein EUGRSUZ_H04500 [Eucalyptus grandis]
Length=633

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPS+TPAPL KYR+EEL +LRG GTGE KEW+RVYDYAYYNDL +P KG
Sbjct  184  TYLPSETPAPLNKYREEELENLRGDGTGERKEWERVYDYAYYNDLSEPQKG  234



>ref|XP_010549787.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Tarenaya hassleriana]
Length=861

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPSQTP PL  YR+EELV LRGTG GELKEWDRVYDYAYYNDLG P K 
Sbjct  164  TYLPSQTPEPLLTYREEELVALRGTGEGELKEWDRVYDYAYYNDLGVPPKN  214



>ref|XP_007030817.1| Lipoxygenase 1 [Theobroma cacao]
 gb|EOY11319.1| Lipoxygenase 1 [Theobroma cacao]
Length=866

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLP + P PL+KYR+EEL  LRG G GEL+EWDRVYDYAYYNDLG+PDKG E
Sbjct  168  TYLPHEMPEPLRKYREEELRALRGNGEGELQEWDRVYDYAYYNDLGNPDKGPE  220



>gb|KDP23726.1| hypothetical protein JCGZ_23559 [Jatropha curcas]
Length=868

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDK  11
            AY+P +TP PL KYR+EEL +LRG+G GEL+E DRVYDYAYYNDLGDPDK
Sbjct  173  AYIPQKTPTPLHKYREEELENLRGSGKGELQEADRVYDYAYYNDLGDPDK  222



>gb|AGI16380.1| lipoxygenase [Malus domestica]
Length=863

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS+ P PL+KY +EELV LRG G  +L+EWDRVYDYAYYNDLGDPDKG+E
Sbjct  166  TYLPSEVPLPLRKYIEEELVELRGDGKRKLEEWDRVYDYAYYNDLGDPDKGSE  218



>gb|AGI16382.1| lipoxygenase [Malus domestica]
Length=863

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS+ P PL+KY +EELV LRG G  +L+EWDRVYDYAYYNDLGDPDKG+E
Sbjct  166  TYLPSEVPLPLRKYIEEELVELRGDGKRKLEEWDRVYDYAYYNDLGDPDKGSE  218



>gb|AGI16377.1| lipoxygenase [Malus domestica]
Length=863

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS+ P PL+KY +EELV LRG G  +L+EWDRVYDYAYYNDLGDPDKG+E
Sbjct  166  TYLPSEVPLPLRKYIEEELVELRGDGKRKLEEWDRVYDYAYYNDLGDPDKGSE  218



>ref|XP_009604140.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=234

 Score = 82.0 bits (201),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            A+LPS+TPA L+ YR+EEL+ LRG GTG+L+EWDRVYDY  YNDLGDPD G
Sbjct  152  AWLPSETPAALRVYREEELLMLRGNGTGKLQEWDRVYDYDCYNDLGDPDNG  202



>ref|XP_009365900.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=863

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS+ P PL+KY +EELV LRG G  +L+EWDRVYDYAYYNDLGDPDKG+E
Sbjct  166  TYLPSEVPLPLRKYIEEELVELRGDGKRKLEEWDRVYDYAYYNDLGDPDKGSE  218



>ref|XP_008348093.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Malus domestica]
Length=863

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS+ P PL+KY +EELV LRG G  +L+EWDRVYDYAYYNDLGDPDKG+E
Sbjct  166  TYLPSEVPLPLRKYIEEELVELRGDGKRKLEEWDRVYDYAYYNDLGDPDKGSE  218



>ref|NP_001274916.1| probable linoleate 9S-lipoxygenase 5 [Solanum tuberosum]
 sp|Q43191.1|LOX15_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 5; AltName: 
Full=Leaf lipoxygenase [Solanum tuberosum]
 gb|AAB67865.1| lipoxygenase [Solanum tuberosum]
Length=862

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLP +TP PL+ YR++ELV+LRG G G+L+EWDRVYDYA YNDLGDP+KG +
Sbjct  164  AYLPGETPEPLRNYREKELVNLRGNGNGKLEEWDRVYDYALYNDLGDPEKGKQ  216



>gb|AAG00881.1|AC064840_12 lipoxygenase - partial coding sequence [Arabidopsis thaliana]
Length=391

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLP +TPA L KYR+EELV LRGTG GELKEWDRVYDYAYYNDLG P K 
Sbjct  164  TYLPHETPATLLKYREEELVSLRGTGEGELKEWDRVYDYAYYNDLGVPPKN  214



>ref|XP_010108010.1| Linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXC17575.1| Linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=884

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLP QTP  L+ YR+EEL +LRG GTGELKEWDRVYDYAYYNDLG PDKG
Sbjct  182  TYLPCQTPDLLRYYREEELKNLRGNGTGELKEWDRVYDYAYYNDLGSPDKG  232



>gb|KDP23508.1| hypothetical protein JCGZ_23341 [Jatropha curcas]
Length=870

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             +LP +TP PL+KYR+EEL +LRG G GEL+EWDRVYDYAYYNDLGDP KG
Sbjct  172  TFLPHETPMPLRKYREEELENLRGDGKGELQEWDRVYDYAYYNDLGDPKKG  222



>ref|XP_007030811.1| Lipoxygenase 1 [Theobroma cacao]
 gb|EOY11313.1| Lipoxygenase 1 [Theobroma cacao]
Length=843

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLP++ P PL+KYR+EEL  LRG G GELKEWDRVYDYA YNDLGDPDKG +
Sbjct  162  TYLPNEMPGPLRKYREEELKVLRGNGEGELKEWDRVYDYALYNDLGDPDKGQD  214



>ref|XP_006344836.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=845

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGA  5
            A+LPS+TP  L+ YR+EEL++LRG G G+L+EWDRVYDYAYYNDLGDP+KG+
Sbjct  152  AWLPSETPVKLRWYREEELLNLRGNGIGKLEEWDRVYDYAYYNDLGDPEKGS  203



>ref|XP_011090733.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Sesamum 
indicum]
Length=881

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            AYLPS TP PL+ YR++EL++L+G G+G LKEWDRVYDYAYYNDLG P+KG
Sbjct  179  AYLPSDTPEPLRVYREQELINLQGNGSGMLKEWDRVYDYAYYNDLGSPEKG  229



>ref|XP_011090735.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Sesamum 
indicum]
Length=870

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            AYLPS TP PL+ YR++EL++L+G G+G LKEWDRVYDYAYYNDLG P+KG
Sbjct  168  AYLPSDTPEPLRVYREQELINLQGNGSGMLKEWDRVYDYAYYNDLGSPEKG  218



>gb|ABW75772.2| lipoxygenase [Camellia sinensis]
Length=861

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YL S+TPAPL +YR +ELV+LRG G G+L+EWDRVYDYAYYNDLGDPDKG++
Sbjct  163  TYLLSETPAPLIEYRKQELVNLRGDGKGKLEEWDRVYDYAYYNDLGDPDKGSK  215



>ref|XP_007030813.1| Lipoxygenase 1 [Theobroma cacao]
 gb|EOY11315.1| Lipoxygenase 1 [Theobroma cacao]
Length=843

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLP++ P PL+KYR+EEL  LRG G GELKEWDRVYDYA YNDLGDPDKG +
Sbjct  162  TYLPNEMPGPLRKYREEELKVLRGNGEGELKEWDRVYDYALYNDLGDPDKGQD  214



>gb|KHN32712.1| Linoleate 9S-lipoxygenase-4 [Glycine soja]
Length=720

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPS+TPAPL KYR+EEL ++RG GTGE KEWDR+YDY  YNDLGDPDKG
Sbjct  162  TYLPSETPAPLVKYREEELKNVRGDGTGERKEWDRIYDYDVYNDLGDPDKG  212



>gb|ABF19102.2| 9-lipoxygenase [Capsicum annuum]
Length=862

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLPS+TP  L+KYR+ ELV LRG GTG+L+EWDRVYDYAYYNDLG PD G E
Sbjct  162  AYLPSETPEALRKYRENELVTLRGDGTGKLEEWDRVYDYAYYNDLGYPDNGEE  214



>ref|XP_010025191.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61803.1| hypothetical protein EUGRSUZ_H04500 [Eucalyptus grandis]
Length=877

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPS+TPAPL KYR+EEL +LRG GTGE KEW+RVYDYAYYNDL +P KG
Sbjct  184  TYLPSETPAPLNKYREEELENLRGDGTGERKEWERVYDYAYYNDLSEPQKG  234



>gb|ABX60410.1| lipoxygenase L-5 [Glycine max]
Length=801

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPS+TPAPL KYR+EEL ++RG GTGE KEWDR+YDY  YNDLGDPDKG
Sbjct  125  TYLPSETPAPLVKYREEELKNVRGDGTGERKEWDRIYDYDVYNDLGDPDKG  175



>ref|XP_009763875.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Nicotiana 
sylvestris]
Length=873

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS TP PL+ YR+EEL++L G+G+G LKEWDRVYDYA+YNDLG PDKG E
Sbjct  172  TYLPSNTPEPLRPYREEELLNLHGSGSGMLKEWDRVYDYAFYNDLGFPDKGPE  224



>ref|XP_009763870.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nicotiana 
sylvestris]
Length=883

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS TP PL+ YR+EEL++L G+G+G LKEWDRVYDYA+YNDLG PDKG E
Sbjct  182  TYLPSNTPEPLRPYREEELLNLHGSGSGMLKEWDRVYDYAFYNDLGFPDKGPE  234



>ref|XP_010326548.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326549.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326550.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Solanum 
lycopersicum]
Length=891

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPS TP PL+ YR++EL+ LRG+G+G+LKEWDRVYDYA+YNDLG PDKG
Sbjct  190  TYLPSNTPEPLRPYREQELLSLRGSGSGKLKEWDRVYDYAFYNDLGFPDKG  240



>ref|XP_003546741.1| PREDICTED: linoleate 9S-lipoxygenase-4-like isoform 1 [Glycine 
max]
 gb|ABX60411.1| lipoxygease-like protein [Glycine max]
Length=856

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPS+TPAPL KYR+EEL ++RG GTGE KEWDR+YDY  YNDLGDPDKG
Sbjct  165  TYLPSETPAPLVKYREEELKNVRGDGTGERKEWDRIYDYDVYNDLGDPDKG  215



>ref|XP_010326551.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010326552.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Solanum 
lycopersicum]
Length=874

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPS TP PL+ YR++EL+ LRG+G+G+LKEWDRVYDYA+YNDLG PDKG
Sbjct  173  TYLPSNTPEPLRPYREQELLSLRGSGSGKLKEWDRVYDYAFYNDLGFPDKG  223



>emb|CAA31664.1| unnamed protein product [Glycine max]
Length=857

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPS+TPAPL KYR+EEL +LRG GTGE KEW+RVYDY  YNDLGDPDKG
Sbjct  166  TYLPSETPAPLVKYREEELHNLRGDGTGERKEWERVYDYDVYNDLGDPDKG  216



>ref|XP_004302420.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=863

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YL S TP PL++YR EELVHLRG G GEL+E+DRVYDYAYYNDLG+PDKG++
Sbjct  165  TYLLSDTPLPLQQYRKEELVHLRGDGKGELQEYDRVYDYAYYNDLGNPDKGSD  217



>ref|NP_001238203.1| lipoxygenase L-5 [Glycine max]
 pdb|2IUJ|A Chain A, Crystal Structure Of Soybean Lipoxygenase-B
 gb|AAB67732.1| lipoxygenase L-5 [Glycine max]
Length=853

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPS+TPAPL KYR+EEL ++RG GTGE KEWDR+YDY  YNDLGDPDKG
Sbjct  162  TYLPSETPAPLVKYREEELKNVRGDGTGERKEWDRIYDYDVYNDLGDPDKG  212



>prf||1502333A lipoxygenase 3
Length=858

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPS+TPAPL KYR+EEL +LRG GTGE KEW+RVYDY  YNDLGDPDKG
Sbjct  167  TYLPSETPAPLVKYREEELHNLRGDGTGERKEWERVYDYDVYNDLGDPDKG  217



>sp|P09186.1|LOX3_SOYBN RecName: Full=Seed linoleate 9S-lipoxygenase-3; AltName: Full=Lipoxygenase-3; 
Short=L-3 [Glycine max]
 emb|CAA30016.1| lipoxygenase [Glycine max]
Length=857

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPS+TPAPL KYR+EEL +LRG GTGE KEW+RVYDY  YNDLGDPDKG
Sbjct  166  TYLPSETPAPLVKYREEELHNLRGDGTGERKEWERVYDYDVYNDLGDPDKG  216



>gb|KHN16119.1| Putative linoleate 9S-lipoxygenase 5 [Glycine soja]
Length=852

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS+TP PL KYR+EEL +LRG G G+L+EWDRVYDYA YNDLG+PDKG +
Sbjct  168  TYLPSETPMPLLKYREEELENLRGNGKGQLQEWDRVYDYALYNDLGNPDKGPQ  220



>gb|KHN32711.1| Linoleate 9S-lipoxygenase-4 [Glycine soja]
Length=856

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPS+TPAPL KYR+EEL ++RG GTGE KEWDR+YDY  YNDLGDPDKG
Sbjct  165  TYLPSETPAPLLKYREEELKNVRGDGTGERKEWDRIYDYDVYNDLGDPDKG  215



>ref|XP_003536076.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Glycine 
max]
Length=865

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS+TP PL KYR+EEL +LRG G G+L+EWDRVYDYA YNDLG+PDKG +
Sbjct  168  TYLPSETPMPLLKYREEELENLRGNGKGQLQEWDRVYDYALYNDLGNPDKGPQ  220



>ref|XP_004244890.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Solanum lycopersicum]
Length=861

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            AYLP +TP PL+ YR++ELV+LRG G G+L+EWDRVYDYA YNDLGDP+KG +
Sbjct  163  AYLPGETPEPLRNYREKELVNLRGDGNGKLEEWDRVYDYALYNDLGDPEKGKQ  215



>pdb|1ROV|A Chain A, Lipoxygenase-3 Treated With Cumene Hydroperoxide
Length=857

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPS+TPAPL KYR+EEL +LRG GTGE KEW+R+YDY  YNDLGDPDKG
Sbjct  166  TYLPSETPAPLVKYREEELHNLRGDGTGERKEWERIYDYDVYNDLGDPDKG  216



>gb|ADG03095.1| lipoxygenase 3 [Glycine max]
Length=857

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPS+TPAPL KYR+EEL +LRG GTGE KEW+R+YDY  YNDLGDPDKG
Sbjct  166  TYLPSETPAPLVKYREEELHNLRGDGTGERKEWERIYDYDVYNDLGDPDKG  216



>gb|AAO03558.1| lipoxygenase 1 [Brassica napus]
Length=857

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLP +TP PL KYR+EELV LRGTG GELKEWDRVYDYAYYNDLG P K 
Sbjct  162  TYLPRETPEPLLKYREEELVSLRGTGEGELKEWDRVYDYAYYNDLGVPPKN  212



>gb|KHN32710.1| Seed linoleate 9S-lipoxygenase-3 [Glycine soja]
Length=857

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPS+TPAPL KYR+EEL +LRG GTGE KEW+R+YDY  YNDLGDPDKG
Sbjct  166  TYLPSETPAPLVKYREEELHNLRGDGTGERKEWERIYDYDVYNDLGDPDKG  216



>ref|NP_001235383.1| seed linoleate 9S-lipoxygenase-3 [Glycine max]
 pdb|1IK3|A Chain A, Lipoxygenase-3 (Soybean) Complex With 13(S)-Hydroperoxy- 
9(Z),11(E)-Octadecadienoic Acid
 pdb|1HU9|A Chain A, Lipoxygenase-3 (Soybean) Complex With 4-Hydroperoxy-2- 
Methoxy-Phenol
 pdb|1JNQ|A Chain A, Lipoxygenase-3 (Soybean) Complex With Epigallocathechin 
(Egc)
 pdb|1N8Q|A Chain A, Lipoxygenase In Complex With Protocatechuic Acid
 pdb|1NO3|A Chain A, Refined Structure Of Soybean Lipoxygenase-3 With 4-nitrocatechol 
At 2.15 Angstrom Resolution
 pdb|1RRH|A Chain A, Soybean Lipoxygenase (Lox-3) At Ambient Temperatures 
At 2.0 A Resolution
 pdb|1RRL|A Chain A, Soybean Lipoxygenase (Lox-3) At 93k At 2.0 A Resolution
 pdb|1RRL|B Chain B, Soybean Lipoxygenase (Lox-3) At 93k At 2.0 A Resolution
 pdb|1LNH|A Chain A, Lipoxygenase-3(Soybean) Non-Heme Fe(Ii) Metalloprotein
 gb|AAB41272.1| lipoxygenase-3 [Glycine max]
Length=857

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPS+TPAPL KYR+EEL +LRG GTGE KEW+R+YDY  YNDLGDPDKG
Sbjct  166  TYLPSETPAPLVKYREEELHNLRGDGTGERKEWERIYDYDVYNDLGDPDKG  216



>gb|ABX60408.1| lipoxygenase L-3 [Glycine max]
 gb|ADG03096.1| lipoxygenase 3 [Glycine max]
Length=857

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPS+TPAPL KYR+EEL +LRG GTGE KEW+R+YDY  YNDLGDPDKG
Sbjct  166  TYLPSETPAPLVKYREEELHNLRGDGTGERKEWERIYDYDVYNDLGDPDKG  216



>ref|XP_006838255.1| hypothetical protein AMTR_s00103p00053790 [Amborella trichopoda]
 gb|ERN00824.1| hypothetical protein AMTR_s00103p00053790 [Amborella trichopoda]
Length=259

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            +YLP +TP  LK  R+EEL++LRG G GELKEWDRVYDYAYYNDLG PD G
Sbjct  165  SYLPGETPLALKNLREEELLNLRGNGVGELKEWDRVYDYAYYNDLGKPDDG  215



>ref|XP_007150489.1| hypothetical protein PHAVU_005G156900g [Phaseolus vulgaris]
 gb|ESW22483.1| hypothetical protein PHAVU_005G156900g [Phaseolus vulgaris]
Length=856

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGA  5
             YLPS+TPAPL KYR+EEL ++RG G+GE KEWDRVYDY  YNDLG+PDKGA
Sbjct  165  TYLPSETPAPLLKYREEELKNVRGDGSGERKEWDRVYDYDVYNDLGNPDKGA  216



>gb|AGL76509.1| lipoxygenase, partial [Phaseolus coccineus]
Length=725

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGA  5
             YLPS+TPAPL KYR+EEL ++RG G+GE KEWDRVYDY  YNDLG+PDKGA
Sbjct  48   TYLPSETPAPLLKYREEELKNVRGDGSGERKEWDRVYDYDVYNDLGNPDKGA  99



>sp|P27481.1|LOXB_PHAVU RecName: Full=Linoleate 9S-lipoxygenase; AltName: Full=Lipoxygenase, 
partial [Phaseolus vulgaris]
 emb|CAA45086.1| lipoxygenase [Phaseolus vulgaris]
Length=741

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGA  5
             YLPS+TPAPL KYR+EEL ++RG G+GE KEWDRVYDY  YNDLG+PDKGA
Sbjct  56   TYLPSETPAPLLKYREEELKNVRGDGSGERKEWDRVYDYDVYNDLGNPDKGA  107



>ref|XP_006607065.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like, partial 
[Glycine max]
Length=436

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            AYLP QTP PL+K+R++EL+ LRG G G+L EWDRVYDYAYYNDLG PD G
Sbjct  149  AYLPYQTPEPLRKFREQELIALRGKGFGKLNEWDRVYDYAYYNDLGLPDDG  199



>emb|CDY43490.1| BnaA01g21450D [Brassica napus]
Length=1203

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLP +TP PL KYR+EELV LRGTG GELKEWDRVYDYAYYNDLG P K 
Sbjct  508  TYLPHETPEPLLKYREEELVSLRGTGEGELKEWDRVYDYAYYNDLGVPPKN  558


 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLP +TP  L KYR+EELV LRGTG GELKEWDRVYDYAYYNDLG P K 
Sbjct  162  TYLPHETPEALLKYREEELVSLRGTGEGELKEWDRVYDYAYYNDLGVPPKN  212



>gb|AET01677.2| seed linoleate 9S-lipoxygenase [Medicago truncatula]
Length=864

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            AYLPSQTPAPL  +R+EEL +LRG GTGE KEWDR+YDY  YNDLG+PD G
Sbjct  174  AYLPSQTPAPLNHFREEELQNLRGDGTGERKEWDRIYDYDVYNDLGNPDGG  224



>gb|ACO57136.1| lipoxygenase 1 [Capsicum annuum]
Length=861

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            AYLP +TP PL++YR++ELV LRG G G+L+EWDRVYDYA+YNDLGDP++G
Sbjct  163  AYLPHETPEPLREYREKELVTLRGDGNGKLEEWDRVYDYAFYNDLGDPERG  213



>gb|AET01678.2| seed linoleate 9S-lipoxygenase [Medicago truncatula]
Length=834

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            AYLPSQTPAPL  +R+EEL +LRG GTGE KEWDR+YDY  YNDLG+PD G
Sbjct  174  AYLPSQTPAPLNHFREEELQNLRGDGTGERKEWDRIYDYDVYNDLGNPDGG  224



>ref|XP_002891934.1| hypothetical protein ARALYDRAFT_474776 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68193.1| hypothetical protein ARALYDRAFT_474776 [Arabidopsis lyrata subsp. 
lyrata]
Length=857

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLP +TPA L KYR+EELV LRGTG GELKEWDRVYDYAYYNDLG P K 
Sbjct  162  TYLPHETPATLLKYREEELVSLRGTGEGELKEWDRVYDYAYYNDLGVPPKN  212



>ref|XP_010480214.1| PREDICTED: linoleate 9S-lipoxygenase 1 [Camelina sativa]
Length=860

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLP +TPA L KYR+EELV LRGTG GELKEWDRVYDYAYYNDLG P K 
Sbjct  165  TYLPHETPATLLKYREEELVELRGTGEGELKEWDRVYDYAYYNDLGVPPKN  215



>ref|XP_010511239.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Camelina sativa]
Length=860

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLP +TPA L KYR+EELV LRGTG GELKEWDRVYDYAYYNDLG P K 
Sbjct  165  TYLPHETPATLLKYREEELVELRGTGEGELKEWDRVYDYAYYNDLGVPPKN  215



>ref|NP_175900.1| lipoxygenase 1 [Arabidopsis thaliana]
 sp|Q06327.1|LOX1_ARATH RecName: Full=Linoleate 9S-lipoxygenase 1; AltName: Full=Lipoxygenase 
1; Short=AtLOX1 [Arabidopsis thaliana]
 gb|AAG51123.1|AC069144_20 lipoxygenase, putative [Arabidopsis thaliana]
 gb|AAA32827.1| lipoxygenase [Arabidopsis thaliana]
 gb|AAA17036.1| lipoxygenase 1 [Arabidopsis thaliana]
 gb|AAM13103.1| lipoxygenase, putative [Arabidopsis thaliana]
 gb|AAQ56801.1| At1g55020 [Arabidopsis thaliana]
 gb|AEE33175.1| lipoxygenase 1 [Arabidopsis thaliana]
Length=859

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLP +TPA L KYR+EELV LRGTG GELKEWDRVYDYAYYNDLG P K 
Sbjct  164  TYLPHETPATLLKYREEELVSLRGTGEGELKEWDRVYDYAYYNDLGVPPKN  214



>ref|XP_010102744.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXB94013.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=882

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             Y PS+TP+ L KYR+EEL  LRG G GELKEWDRVYDYAYYNDLG+PD G E
Sbjct  166  TYFPSETPSSLIKYREEELEILRGNGKGELKEWDRVYDYAYYNDLGNPDDGQE  218



>gb|AAZ04411.1| lipoxygenase [Adelostemma gracillimum]
Length=863

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGA  5
             YLPS+TP  L+KYR+EELV LRG G GELKEWDRVYDYA YNDLG PD G+
Sbjct  165  TYLPSETPTALRKYREEELVELRGDGNGELKEWDRVYDYALYNDLGVPDLGS  216



>gb|AHX56188.1| lipoxygenase [Diospyros kaki]
Length=876

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             +LP  TP PL+ YR++EL+ LRG G+G LKEWDRVYDYAYYNDLG PDKG E
Sbjct  174  TFLPCNTPEPLRYYREQELIGLRGNGSGMLKEWDRVYDYAYYNDLGMPDKGPE  226



>ref|XP_009349294.1| PREDICTED: linoleate 9S-lipoxygenase 6-like [Pyrus x bretschneideri]
 ref|XP_009349295.1| PREDICTED: linoleate 9S-lipoxygenase 6-like [Pyrus x bretschneideri]
Length=848

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  YLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            YLP+QTP  L + R EEL+ LRG GTGE KEW+R+YDY YYNDLGDPDKG E
Sbjct  153  YLPNQTPQALIELRKEELISLRGDGTGERKEWERIYDYDYYNDLGDPDKGEE  204



>ref|XP_009625816.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=832

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPSQTP PL+ YR+EEL +LRG G G+L+EWDR+YDY  YNDLGDPDKG
Sbjct  137  TYLPSQTPEPLRSYREEELENLRGNGIGKLEEWDRIYDYDVYNDLGDPDKG  187



>ref|XP_003627201.1| Seed lipoxygenase [Medicago truncatula]
Length=1884

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  160   AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             AYLPSQTPAPL  +R+EEL +LRG GTGE KEWDR+YDY  YNDLG+PD G
Sbjct  1194  AYLPSQTPAPLNHFREEELQNLRGDGTGERKEWDRIYDYDVYNDLGNPDGG  1244


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPSQTPAPL  YR+EEL  LRG GTGE KE DRVYDY  YNDLG+PD G
Sbjct  175  TYLPSQTPAPLNHYREEELQTLRGDGTGERKEADRVYDYDIYNDLGNPDGG  225



>ref|XP_003627202.1| Seed lipoxygenase [Medicago truncatula]
Length=1854

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  160   AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             AYLPSQTPAPL  +R+EEL +LRG GTGE KEWDR+YDY  YNDLG+PD G
Sbjct  1194  AYLPSQTPAPLNHFREEELQNLRGDGTGERKEWDRIYDYDVYNDLGNPDGG  1244


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPSQTPAPL  YR+EEL  LRG GTGE KE DRVYDY  YNDLG+PD G
Sbjct  175  TYLPSQTPAPLNHYREEELQTLRGDGTGERKEADRVYDYDIYNDLGNPDGG  225



>ref|XP_006359917.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X1 [Solanum tuberosum]
Length=887

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLP  TP PL+ YR++EL+ LRG+G+G+LKEWDRVYDYA+YNDLG PDKG
Sbjct  186  TYLPCNTPEPLRPYREQELLSLRGSGSGKLKEWDRVYDYAFYNDLGFPDKG  236



>ref|XP_006359918.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006359919.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X3 [Solanum tuberosum]
 ref|XP_006359920.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X4 [Solanum tuberosum]
 ref|XP_006359921.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X5 [Solanum tuberosum]
Length=877

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLP  TP PL+ YR++EL+ LRG+G+G+LKEWDRVYDYA+YNDLG PDKG
Sbjct  176  TYLPCNTPEPLRPYREQELLSLRGSGSGKLKEWDRVYDYAFYNDLGFPDKG  226



>ref|XP_010553735.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Tarenaya hassleriana]
Length=859

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPSQTP PL +YR++ELV LRGTG GELKE DRVYDYAYYNDLGDP K 
Sbjct  164  TYLPSQTPEPLVQYREKELVSLRGTGKGELKEGDRVYDYAYYNDLGDPPKN  214



>emb|CBI33054.3| unnamed protein product [Vitis vinifera]
Length=641

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  YLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            YLP++TP  L + R EEL  LRG GTGE KEWDRVY+Y YYNDLG+PDKG E
Sbjct  154  YLPNETPEALDELRKEELESLRGHGTGERKEWDRVYEYDYYNDLGNPDKGQE  205



>ref|XP_010414944.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Camelina sativa]
Length=860

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLP +TPA L KYR+EELV LRGTG GELKEWDRVYDYAYYNDLG P K 
Sbjct  165  TYLPHETPATLLKYREEELVDLRGTGEGELKEWDRVYDYAYYNDLGVPPKN  215



>ref|XP_008364642.1| PREDICTED: linoleate 9S-lipoxygenase 6-like isoform X2 [Malus 
domestica]
Length=848

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  YLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            YLP QTP  L + R EEL+ LRG GTGE KEW+R+YDY YYNDLGDPDKG E
Sbjct  147  YLPHQTPXALIELRKEELISLRGDGTGERKEWERIYDYDYYNDLGDPDKGEE  198



>ref|XP_009407551.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Musa acuminata 
subsp. malaccensis]
Length=872

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 1/52 (2%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTG-TGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPS+TP PLK+YR+EELVHLRG   TGELKE DR+Y+YAYYNDLG+PDKG
Sbjct  169  TYLPSKTPEPLKRYREEELVHLRGDDVTGELKEHDRIYNYAYYNDLGNPDKG  220



>gb|KHN02707.1| Linoleate 9S-lipoxygenase 5, chloroplastic [Glycine soja]
Length=850

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            AYLP QTP PL+K+R++EL+ LRG G G+L EWDRVYDYAYYNDLG PD G
Sbjct  149  AYLPYQTPEPLRKFREQELIALRGKGFGKLNEWDRVYDYAYYNDLGLPDDG  199



>gb|AGI16404.1| lipoxygenase [Malus domestica]
Length=842

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  YLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            YLP QTP  L + R EEL+ LRG GTGE KEW+R+YDY YYNDLGDPDKG E
Sbjct  147  YLPHQTPQALIELRKEELISLRGDGTGERKEWERIYDYDYYNDLGDPDKGEE  198



>gb|AGI16405.1| lipoxygenase [Malus domestica]
Length=842

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  YLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            YLP QTP  L + R EEL+ LRG GTGE KEW+R+YDY YYNDLGDPDKG E
Sbjct  147  YLPHQTPQALIELRKEELISLRGDGTGERKEWERIYDYDYYNDLGDPDKGEE  198



>ref|XP_008364640.1| PREDICTED: linoleate 9S-lipoxygenase 6-like isoform X1 [Malus 
domestica]
Length=842

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  YLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            YLP QTP  L + R EEL+ LRG GTGE KEW+R+YDY YYNDLGDPDKG E
Sbjct  147  YLPHQTPXALIELRKEELISLRGDGTGERKEWERIYDYDYYNDLGDPDKGEE  198



>ref|XP_010935040.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
5 [Elaeis guineensis]
Length=851

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 1/53 (2%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTG-TGELKEWDRVYDYAYYNDLGDPDKGA  5
             YLP+ TPAPL+ YR+EELVHLRG   TGELKE+ RVYDYAYYNDLG+PD G+
Sbjct  148  TYLPTNTPAPLQAYRNEELVHLRGDNVTGELKEFQRVYDYAYYNDLGNPDNGS  200



>ref|XP_008235887.1| PREDICTED: linoleate 9S-lipoxygenase 6-like [Prunus mume]
Length=840

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  YLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            YLP+QTP  L K R++EL+ LRG G+GE KEWDR+YDY YYNDLG+PDKG E
Sbjct  144  YLPNQTPQGLMKLRNKELISLRGDGSGERKEWDRIYDYDYYNDLGNPDKGPE  195



>gb|AGI16403.1| lipoxygenase [Malus domestica]
Length=842

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  YLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            YLP QTP  L + R EEL+ LRG GTGE KEW+R+YDY YYNDLGDPDKG E
Sbjct  147  YLPHQTPKALIELRKEELISLRGDGTGERKEWERIYDYDYYNDLGDPDKGEE  198



>emb|CDO99039.1| unnamed protein product [Coffea canephora]
Length=882

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS TP  L+ YR+EEL +LRG GTG LKEWDRVYDYAYYNDLG+PD G E
Sbjct  181  TYLPSNTPEALRPYREEELDNLRGNGTGMLKEWDRVYDYAYYNDLGNPDGGPE  233



>gb|AAK50778.4|AF361893_1 bacterial-induced lipoxygenase [Gossypium hirsutum]
Length=865

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLP   P PL +YR++EL+ LRG G GEL+EWDRVYDYAYYNDLG+PDKG E
Sbjct  167  TYLPHDMPKPLLQYREQELMALRGNGQGELQEWDRVYDYAYYNDLGNPDKGPE  219



>gb|AIC82456.1| lipoxygenase [Cocos nucifera]
Length=852

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 1/53 (2%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTG-TGELKEWDRVYDYAYYNDLGDPDKGA  5
             YLP  TPAPL+ YR+EELVHLRG   TGELKE+ R+YDYAYYNDLGDPD G+
Sbjct  149  TYLPINTPAPLQAYRNEELVHLRGDNITGELKEFQRIYDYAYYNDLGDPDNGS  201



>gb|AAD09202.1| lipoxygenase [Solanum tuberosum]
Length=876

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPS TP PL+ YR++EL+ LRG+G+G+LKEWDRVYDY +YNDLG PDKG
Sbjct  174  TYLPSNTPEPLRPYREQELLSLRGSGSGKLKEWDRVYDYRFYNDLGFPDKG  224



>ref|XP_009385775.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=693

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            +YLPSQTPA L+  R EEL  LRG G GE KEW+R+YDY  YNDLGDPDKG
Sbjct  155  SYLPSQTPAALQSLRQEELASLRGNGRGERKEWERIYDYDRYNDLGDPDKG  205



>gb|KFK35600.1| hypothetical protein AALP_AA4G012300 [Arabis alpina]
Length=857

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDP  17
             YLP +TPA L KYR+EELV LRGTG GELKEWDRVYDYAYYNDLG P
Sbjct  162  TYLPHETPATLLKYREEELVSLRGTGKGELKEWDRVYDYAYYNDLGVP  209



>gb|KFK35599.1| hypothetical protein AALP_AA4G012300 [Arabis alpina]
Length=856

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDP  17
             YLP +TPA L KYR+EELV LRGTG GELKEWDRVYDYAYYNDLG P
Sbjct  161  TYLPHETPATLLKYREEELVSLRGTGKGELKEWDRVYDYAYYNDLGVP  208



>ref|XP_003626860.1| Lipoxygenase [Medicago truncatula]
 gb|AET01336.1| PLAT/LH2 domain lipoxygenase family protein [Medicago truncatula]
Length=834

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  YLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            YLPSQTP  L + R EEL  LRG G  E KEWDR+YDY YYNDLGDPDKG+E
Sbjct  174  YLPSQTPRALAELRKEELDKLRGNGMEERKEWDRIYDYDYYNDLGDPDKGSE  225



>ref|XP_009406999.1| PREDICTED: probable linoleate 9S-lipoxygenase 4 [Musa acuminata 
subsp. malaccensis]
Length=686

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTG-TGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLP  TPAPLK YR +EL++LRG   TGELKEWDRVYDYAYYNDLG PD+GA 
Sbjct  175  TYLPGDTPAPLKPYRQDELLNLRGQDVTGELKEWDRVYDYAYYNDLGSPDQGAN  228



>gb|KEH18418.1| seed linoleate 9S-lipoxygenase [Medicago truncatula]
Length=642

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -2

Query  157  YLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            YLPSQTPAPL  YR+EEL  LRG GTGE KE DRVYDY  YNDLG+PD G
Sbjct  176  YLPSQTPAPLNHYREEELQTLRGDGTGERKEADRVYDYDIYNDLGNPDGG  225



>ref|XP_002527266.1| lipoxygenase, putative [Ricinus communis]
 gb|EEF35110.1| lipoxygenase, putative [Ricinus communis]
Length=852

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            +YLP+QTP+PL++ R  EL+ LRG GTGE  EWDR+YDY YYNDLG PDKG
Sbjct  156  SYLPNQTPSPLEELRKSELISLRGDGTGERNEWDRIYDYDYYNDLGRPDKG  206



>gb|AHI86055.1| lipoxygenase, partial [Cucumis melo var. makuwa]
Length=880

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            +YLPS+TP  L+KYR+EELV+LRG   GELKEWDRVYDYA YNDLG PD G
Sbjct  179  SYLPSETPESLRKYREEELVNLRGNDKGELKEWDRVYDYACYNDLGMPDSG  229



>ref|XP_008449553.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Cucumis melo]
Length=881

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            +YLPS+TP  L+KYR+EELV+LRG   GELKEWDRVYDYA YNDLG PD G
Sbjct  180  SYLPSETPESLRKYREEELVNLRGNDKGELKEWDRVYDYACYNDLGMPDSG  230



>ref|NP_001267584.1| probable linoleate 9S-lipoxygenase 5-like [Cucumis sativus]
 emb|CAB83038.1| lipoxygenase-9 [Cucumis sativus]
Length=881

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            +YLPS+TP  L+KYR+EELV+LRG   GELKEWDRVYDYA YNDLG PD G
Sbjct  180  SYLPSETPESLRKYREEELVNLRGDNRGELKEWDRVYDYACYNDLGMPDSG  230



>ref|XP_007144726.1| hypothetical protein PHAVU_007G179600g [Phaseolus vulgaris]
 gb|ESW16720.1| hypothetical protein PHAVU_007G179600g [Phaseolus vulgaris]
Length=861

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLPS+TP PL KYR+EEL +LRG G G+L+EWDRVYDY  YNDLG+PDKG +
Sbjct  164  TYLPSETPMPLLKYREEELENLRGNGKGQLQEWDRVYDYDLYNDLGNPDKGPQ  216



>ref|XP_009779646.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Nicotiana 
sylvestris]
Length=822

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            A+LPS+TPA L+ YR+EEL+ LRG GTG+L+EWDRVYDY  YNDLGDPD G
Sbjct  152  AWLPSETPAALRVYREEELLLLRGNGTGKLQEWDRVYDYDCYNDLGDPDNG  202



>ref|XP_008454526.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Cucumis melo]
Length=852

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            +YLPS+TP PL+K+R++EL  LRG G GEL+EWDRVYDYA YNDL DPDK  +
Sbjct  155  SYLPSETPEPLRKFREDELQSLRGDGNGELQEWDRVYDYALYNDLADPDKAPQ  207



>gb|AAC61785.1| lipoxygenase 1 [Cucumis sativus]
Length=878

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPSQTP PL+KYR+EEL +LRG GTGE KEWDR+YDY  YND+ DPD G
Sbjct  183  VYLPSQTPNPLRKYREEELWNLRGDGTGERKEWDRIYDYDVYNDIADPDVG  233



>ref|XP_009358958.1| PREDICTED: linoleate 9S-lipoxygenase 6-like [Pyrus x bretschneideri]
Length=848

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  YLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            YLP+QTP  L + R EEL+ LRG GTGE KEW+R+YDY YYNDLGDP+KG E
Sbjct  153  YLPNQTPQALIELRKEELISLRGDGTGERKEWERIYDYDYYNDLGDPEKGEE  204



>ref|XP_009779645.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nicotiana 
sylvestris]
Length=849

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            A+LPS+TPA L+ YR+EEL+ LRG GTG+L+EWDRVYDY  YNDLGDPD G
Sbjct  152  AWLPSETPAALRVYREEELLLLRGNGTGKLQEWDRVYDYDCYNDLGDPDNG  202



>ref|XP_006433338.1| hypothetical protein CICLE_v10000236mg [Citrus clementina]
 ref|XP_006472028.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X1 [Citrus sinensis]
 gb|ESR46578.1| hypothetical protein CICLE_v10000236mg [Citrus clementina]
Length=874

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLP+QTP PL+ YR++ELV+LRG GT EL+E DRVYDYAYYNDLGDP KG
Sbjct  180  TYLPTQTPGPLRYYREQELVNLRGDGTTELQEHDRVYDYAYYNDLGDPKKG  230



>emb|CAA63483.1| lipoxygenase [Cucumis sativus]
Length=878

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPSQTP PL+KYR+EEL +LRG GTGE KEWDR+YDY  YND+ DPD G
Sbjct  183  VYLPSQTPNPLRKYREEELWNLRGDGTGERKEWDRIYDYDVYNDIADPDVG  233



>gb|KJB38136.1| hypothetical protein B456_006G238200 [Gossypium raimondii]
Length=645

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLP Q P PL+KYR+EELV+LRG G G LKEWDRVYDY +YNDL  PD+G
Sbjct  198  TYLPCQMPVPLRKYREEELVNLRGDGKGCLKEWDRVYDYDFYNDLAMPDRG  248



>ref|XP_004231274.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Solanum lycopersicum]
Length=841

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGA  5
            A+LPS+TP  L  YR+EEL++LRG G G+L+EWDRVYDYAYYNDLG+P+KG+
Sbjct  148  AWLPSETPVKLCWYREEELLNLRGNGIGKLEEWDRVYDYAYYNDLGEPEKGS  199



>ref|XP_004156415.1| PREDICTED: linoleate 9S-lipoxygenase 6-like [Cucumis sativus]
Length=878

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPSQTP PL+KYR+EEL +LRG GTGE KEWDR+YDY  YND+ DPD G
Sbjct  183  VYLPSQTPNPLRKYREEELWNLRGDGTGERKEWDRIYDYDVYNDIADPDVG  233



>gb|EPS73035.1| hypothetical protein M569_01717 [Genlisea aurea]
Length=1711

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -2

Query  160   AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             +YLP  TP  L  YR +ELV+LRG GTG+L++WDRVYDYAYYNDLGDPDKG E
Sbjct  1014  SYLPGDTPDALVDYRRQELVNLRGNGTGQLEKWDRVYDYAYYNDLGDPDKGQE  1066



>ref|XP_004139170.1| PREDICTED: LOW QUALITY PROTEIN: linoleate 9S-lipoxygenase 6-like 
[Cucumis sativus]
Length=867

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPSQTP PL+KYR+EEL +LRG GTGE KEWDR+YDY  YND+ DPD G
Sbjct  183  VYLPSQTPNPLRKYREEELWNLRGDGTGERKEWDRIYDYDVYNDIADPDVG  233



>gb|KJB38135.1| hypothetical protein B456_006G238200 [Gossypium raimondii]
Length=570

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLP Q P PL+KYR+EELV+LRG G G LKEWDRVYDY +YNDL  PD+G
Sbjct  198  TYLPCQMPVPLRKYREEELVNLRGDGKGCLKEWDRVYDYDFYNDLAMPDRG  248



>ref|XP_007143236.1| hypothetical protein PHAVU_007G055600g [Phaseolus vulgaris]
 gb|ESW15230.1| hypothetical protein PHAVU_007G055600g [Phaseolus vulgaris]
Length=855

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            AYLP QTP PL+K R++EL  LRG G G+L EWDRVYDYAYYNDLG PD G
Sbjct  154  AYLPCQTPGPLRKLREQELEVLRGKGVGKLNEWDRVYDYAYYNDLGTPDDG  204



>ref|XP_006472029.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X2 [Citrus sinensis]
Length=808

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLP+QTP PL+ YR++ELV+LRG GT EL+E DRVYDYAYYNDLGDP KG
Sbjct  114  TYLPTQTPGPLRYYREQELVNLRGDGTTELQEHDRVYDYAYYNDLGDPKKG  164



>gb|EYU26430.1| hypothetical protein MIMGU_mgv1a023655mg [Erythranthe guttata]
Length=963

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLP+QTPA L++YR+EEL +LRG GTG+L+EWDRVYDY  YNDLGDPDK 
Sbjct  265  TYLPNQTPARLRRYREEELQNLRGNGTGKLEEWDRVYDYDIYNDLGDPDKS  315



>gb|KHN30070.1| Linoleate 9S-lipoxygenase-4 [Glycine soja]
Length=746

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPS+TPAPL KYR+EEL ++RG GTGE KEWDR+YDY  YNDLG+PD G
Sbjct  162  TYLPSETPAPLLKYREEELKNVRGDGTGERKEWDRIYDYDVYNDLGNPDSG  212



>sp|P38417.1|LOX4_SOYBN RecName: Full=Linoleate 9S-lipoxygenase-4; AltName: Full=Lipoxygenase-4; 
Short=L-4; AltName: Full=VSP94 [Glycine max]
 dbj|BAA03101.1| lipxygenase L-4 [Glycine max]
Length=853

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPS+TPAPL KYR+EEL ++RG GTGE KEWDR+YDY  YNDLG+PD G
Sbjct  162  TYLPSETPAPLLKYREEELKNVRGDGTGERKEWDRIYDYDVYNDLGNPDSG  212



>gb|ABX60409.1| lipoxygease L-4 [Glycine max]
Length=853

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPS+TPAPL KYR+EEL ++RG GTGE KEWDR+YDY  YNDLG+PD G
Sbjct  162  TYLPSETPAPLLKYREEELKNVRGDGTGERKEWDRIYDYDVYNDLGNPDSG  212



>ref|XP_004139173.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=852

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            +YLPS+TP PL+K+R++EL  LRG G GEL+EWDRVYDYA YNDL DPDK  +
Sbjct  155  SYLPSETPDPLRKFREDELQSLRGGGNGELQEWDRVYDYALYNDLADPDKAPQ  207



>ref|NP_001235250.1| lipoxygenase [Glycine max]
 gb|AAC49159.1| lipoxygenase [Glycine max]
 prf||2208476A lipoxygenase
Length=856

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPS+TPAPL KYR+EEL ++RG GTGE KEWDR+YDY  YNDLG+PD G
Sbjct  165  TYLPSETPAPLLKYREEELKNVRGDGTGERKEWDRIYDYDVYNDLGNPDSG  215



>ref|XP_004156418.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=852

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            +YLPS+TP PL+K+R++EL  LRG G GEL+EWDRVYDYA YNDL DPDK  +
Sbjct  155  SYLPSETPDPLRKFREDELQSLRGGGNGELQEWDRVYDYALYNDLADPDKAPQ  207



>ref|XP_007200849.1| hypothetical protein PRUPE_ppa026489mg [Prunus persica]
 gb|EMJ02048.1| hypothetical protein PRUPE_ppa026489mg [Prunus persica]
Length=840

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  157  YLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            YLP+QTP  L K R++EL+ LRG G GE KEWDR+YDY YYNDLG+PDKG E
Sbjct  145  YLPNQTPQGLMKLRNKELISLRGDGGGERKEWDRIYDYDYYNDLGNPDKGPE  196



>ref|NP_001238692.1| lipoxygenase [Glycine max]
 gb|AAA03726.1| lipoxygenase [Glycine max]
Length=839

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLPS+TPAPL KYR+EEL ++RG GTGE KEWDR+YDY  YNDLG+PD G
Sbjct  148  TYLPSETPAPLLKYREEELKNVRGDGTGERKEWDRIYDYDVYNDLGNPDSG  198



>ref|XP_009119596.1| PREDICTED: linoleate 9S-lipoxygenase 1 [Brassica rapa]
Length=857

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLP +TP  L KYR+EELV LRGTG GELKEWDRVYDYAYYNDLG P K 
Sbjct  162  TYLPHETPEALLKYREEELVSLRGTGEGELKEWDRVYDYAYYNDLGVPPKN  212



>ref|XP_003597559.1| Seed lipoxygenase-3 [Medicago truncatula]
 gb|AES67810.1| seed linoleate 9S-lipoxygenase [Medicago truncatula]
Length=861

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            AYLPS+TPAPL  YR+EEL +LRG GTGE KEW+R+YDY  YNDLG+P+KG
Sbjct  169  AYLPSETPAPLVHYREEELNNLRGDGTGERKEWERIYDYDVYNDLGNPEKG  219



>ref|XP_010667400.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Beta vulgaris 
subsp. vulgaris]
Length=895

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLP QTP  L+ YR+EELV+LRG G G LKEWDRVYDY YYNDLG PDKG E
Sbjct  194  TYLPHQTPEALRIYREEELVNLRGDGKGMLKEWDRVYDYDYYNDLGMPDKGEE  246



>gb|KJB38137.1| hypothetical protein B456_006G238200 [Gossypium raimondii]
Length=900

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLP Q P PL+KYR+EELV+LRG G G LKEWDRVYDY +YNDL  PD+G
Sbjct  198  TYLPCQMPVPLRKYREEELVNLRGDGKGCLKEWDRVYDYDFYNDLAMPDRG  248



>gb|KJB38138.1| hypothetical protein B456_006G238200 [Gossypium raimondii]
Length=869

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
             YLP Q P PL+KYR+EELV+LRG G G LKEWDRVYDY +YNDL  PD+G
Sbjct  167  TYLPCQMPVPLRKYREEELVNLRGDGKGCLKEWDRVYDYDFYNDLAMPDRG  217



>gb|ACD43483.1| lipoxygenase 1 [Olea europaea]
Length=869

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
             YLP  TP PL+ YR++EL +LRG G+G LKEWDRVYDYA YNDLG P+KG E
Sbjct  168  TYLPCNTPEPLRAYREDELTNLRGDGSGTLKEWDRVYDYALYNDLGSPEKGQE  220



>ref|XP_006447980.1| hypothetical protein CICLE_v10014260mg [Citrus clementina]
 gb|ESR61220.1| hypothetical protein CICLE_v10014260mg [Citrus clementina]
Length=842

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  2
            +YLPS+TP+ LK  R +EL+ LRG G GE KEW+R+YDY YYNDLGDPD G E
Sbjct  159  SYLPSETPSTLKDLRKQELISLRGDGIGERKEWERIYDYDYYNDLGDPDIGPE  211



>ref|XP_009621679.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=822

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKG  8
            A+LPS+TPA L  YR+EEL+ LRG GTG+L+EWDRVYDY  YNDLGDPD G
Sbjct  152  AWLPSETPAALLVYREEELLSLRGNGTGKLQEWDRVYDYDCYNDLGDPDNG  202



>ref|XP_006300394.1| hypothetical protein CARUB_v10019783mg [Capsella rubella]
 gb|EOA33292.1| hypothetical protein CARUB_v10019783mg [Capsella rubella]
Length=859

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  160  AYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDP  17
             YLP +TPA L KYR+EEL+ LRGTG GELKEWDRVYDYAYYNDLG P
Sbjct  164  TYLPHETPATLLKYREEELLDLRGTGEGELKEWDRVYDYAYYNDLGVP  211



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556507818200