BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP009H01 367 bp,:Filtered

Length=323
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006828094.1|  hypothetical protein AMTR_s00151p00074930        99.8    9e-24   
emb|CAN61508.1|  hypothetical protein VITISV_000627                   72.4    3e-13   Vitis vinifera
gb|AFW86910.1|  putative cytochrome C oxidase subunit II family p...  65.5    2e-11   Zea mays [maize]
tpg|DAA38266.1|  TPA: putative cytochrome C oxidase subunit II fa...  65.1    8e-10   Zea mays [maize]



>ref|XP_006828094.1| hypothetical protein AMTR_s00151p00074930 [Amborella trichopoda]
 gb|ERM95510.1| hypothetical protein AMTR_s00151p00074930 [Amborella trichopoda]
Length=160

 Score = 99.8 bits (247),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  7    NLSEWGIPVGNNHGSSCGTTGLGEDNLLFLPLFLRFGDGGPTVGNSRHKQVDRRGPALLL  186
            +LS+WGIP+GNNHGSSC TTG GE+N LFL L LRFGDGGPTV NSRHK +DRRGPALLL
Sbjct  87   DLSKWGIPIGNNHGSSCETTGPGEENQLFLVLCLRFGDGGPTVCNSRHKALDRRGPALLL  146

Query  187  L  189
            L
Sbjct  147  L  147



>emb|CAN61508.1| hypothetical protein VITISV_000627 [Vitis vinifera]
Length=201

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +1

Query  1    PSNLSEWGIPVGNNHGSSCGTTGLGEDNLLFLPLFLRFGDGGPT  132
            PSNLSEWGIPVGNNHGSSCGTTG GEDNLLFL LFLRFGDGGPT
Sbjct  65   PSNLSEWGIPVGNNHGSSCGTTGPGEDNLLFLLLFLRFGDGGPT  108



>gb|AFW86910.1| putative cytochrome C oxidase subunit II family protein [Zea 
mays]
Length=70

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    VTFRNGGSPLAtttvvvvELLGWERTTSCSCPSFFASGTEVLR  133
            VTFRNGGSPLATTTVVV ELLG ERTT CSC SFFASGTEVLR
Sbjct  28   VTFRNGGSPLATTTVVVAELLGQERTTCCSCSSFFASGTEVLR  70



>tpg|DAA38266.1| TPA: putative cytochrome C oxidase subunit II family protein 
[Zea mays]
Length=510

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    PSNLSEWGIPVGNNHGSSCGTTGLGEDNLLFLPLFLRFGDGGPTVGN  141
            P  LSEWGIPVGNNHGSSCGTTG  EDNLLFL L LRFGDGG TV N
Sbjct  370  PRYLSEWGIPVGNNHGSSCGTTGPREDNLLFLLLLLRFGDGGHTVSN  416



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 551001054360