BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP009D08 547 bp,

Length=547
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP08062.1|  unnamed protein product                                231   3e-67   Coffea canephora [robusta coffee]
ref|XP_004251998.1|  PREDICTED: formin-like protein 2                   215   2e-61   Solanum lycopersicum
ref|XP_006365943.1|  PREDICTED: formin-like protein 2-like              215   2e-61   Solanum tuberosum [potatoes]
ref|XP_008243047.1|  PREDICTED: formin-like protein 1                   209   1e-60   
ref|XP_007203238.1|  hypothetical protein PRUPE_ppa001116mg             209   2e-59   Prunus persica
ref|XP_007033683.1|  Actin-binding FH2 family protein isoform 1         206   4e-58   Theobroma cacao [chocolate]
ref|XP_011464576.1|  PREDICTED: formin-like protein 2                   203   2e-57   Fragaria vesca subsp. vesca
ref|XP_002275001.1|  PREDICTED: formin-like protein 1                   202   7e-57   Vitis vinifera
gb|KJB27765.1|  hypothetical protein B456_005G008700                    200   4e-56   Gossypium raimondii
ref|XP_009366228.1|  PREDICTED: formin-like protein 2                   199   5e-56   Pyrus x bretschneideri [bai li]
ref|XP_009358391.1|  PREDICTED: formin-like protein 2                   199   7e-56   Pyrus x bretschneideri [bai li]
gb|KHG03146.1|  Formin-like protein 1                                   199   9e-56   Gossypium arboreum [tree cotton]
ref|XP_011001822.1|  PREDICTED: formin-like protein 2                   199   1e-55   Populus euphratica
ref|XP_010251389.1|  PREDICTED: formin-like protein 1                   198   3e-55   Nelumbo nucifera [Indian lotus]
ref|XP_002310397.1|  formin homology 2 domain-containing family p...    195   3e-54   Populus trichocarpa [western balsam poplar]
ref|XP_011085043.1|  PREDICTED: LOW QUALITY PROTEIN: formin-like ...    194   3e-54   Sesamum indicum [beniseed]
ref|XP_011047650.1|  PREDICTED: formin-like protein 1                   195   3e-54   Populus euphratica
ref|XP_009759791.1|  PREDICTED: formin-like protein 1                   194   3e-54   Nicotiana sylvestris
gb|KJB71603.1|  hypothetical protein B456_011G132600                    192   2e-53   Gossypium raimondii
gb|KDO43529.1|  hypothetical protein CISIN_1g001663mg                   191   2e-52   Citrus sinensis [Valencia orange]
ref|XP_006447920.1|  hypothetical protein CICLE_v10014120mg             191   2e-52   Citrus clementina
ref|XP_006469362.1|  PREDICTED: formin-like protein 1-like              191   2e-52   Citrus sinensis [Valencia orange]
gb|KDP35139.1|  hypothetical protein JCGZ_10673                         187   1e-51   Jatropha curcas
ref|XP_002323708.2|  hypothetical protein POPTR_0017s04260g             187   2e-51   Populus trichocarpa [western balsam poplar]
ref|XP_010069230.1|  PREDICTED: formin-like protein 1                   187   2e-51   Eucalyptus grandis [rose gum]
ref|XP_009627839.1|  PREDICTED: formin-like protein 1                   185   4e-51   Nicotiana tomentosiformis
ref|XP_010242489.1|  PREDICTED: formin-like protein 1                   185   2e-50   Nelumbo nucifera [Indian lotus]
ref|XP_007049520.1|  Formin isoform 1                                   184   9e-50   Theobroma cacao [chocolate]
ref|XP_010646093.1|  PREDICTED: formin-like protein 1                   181   2e-49   Vitis vinifera
gb|KJB82868.1|  hypothetical protein B456_013G218400                    171   6e-49   Gossypium raimondii
ref|XP_004140451.1|  PREDICTED: formin-like protein 2-like              179   1e-48   Cucumis sativus [cucumbers]
ref|XP_008460245.1|  PREDICTED: formin-like protein 1                   179   2e-48   Cucumis melo [Oriental melon]
ref|XP_011024723.1|  PREDICTED: formin-like protein 1                   179   3e-48   Populus euphratica
emb|CBI24709.3|  unnamed protein product                                176   3e-48   Vitis vinifera
ref|XP_007135217.1|  hypothetical protein PHAVU_010G110900g             176   8e-48   Phaseolus vulgaris [French bean]
ref|XP_006442143.1|  hypothetical protein CICLE_v10018774mg             177   9e-48   Citrus clementina
ref|XP_008338227.1|  PREDICTED: formin-like protein 1                   177   1e-47   Malus domestica [apple tree]
ref|XP_002532454.1|  conserved hypothetical protein                     177   1e-47   Ricinus communis
ref|XP_007135216.1|  hypothetical protein PHAVU_010G110900g             177   1e-47   Phaseolus vulgaris [French bean]
gb|KDP45195.1|  hypothetical protein JCGZ_15060                         177   1e-47   Jatropha curcas
ref|XP_011010334.1|  PREDICTED: formin-like protein 1                   177   1e-47   Populus euphratica
ref|XP_004517290.1|  PREDICTED: formin-like protein 1-like              175   2e-47   Cicer arietinum [garbanzo]
ref|XP_010101357.1|  Formin-like protein 1                              176   2e-47   Morus notabilis
ref|XP_002320557.2|  hypothetical protein POPTR_0014s17310g             177   2e-47   Populus trichocarpa [western balsam poplar]
ref|XP_006492756.1|  PREDICTED: formin-like protein 2-like isofor...    175   3e-47   Citrus sinensis [Valencia orange]
gb|KDO47987.1|  hypothetical protein CISIN_1g002497mg                   175   3e-47   Citrus sinensis [Valencia orange]
ref|XP_010532932.1|  PREDICTED: formin-like protein 1                   175   6e-47   Tarenaya hassleriana [spider flower]
ref|XP_004492891.1|  PREDICTED: formin-like protein 1-like              175   7e-47   Cicer arietinum [garbanzo]
ref|XP_009359000.1|  PREDICTED: formin-like protein 1                   174   1e-46   Pyrus x bretschneideri [bai li]
gb|KCW57954.1|  hypothetical protein EUGRSUZ_H006891                    171   2e-46   Eucalyptus grandis [rose gum]
ref|XP_003529900.1|  PREDICTED: formin-like protein 1-like              173   3e-46   
ref|XP_007049521.1|  Formin isoform 2                                   174   3e-46   Theobroma cacao [chocolate]
ref|XP_007201761.1|  hypothetical protein PRUPE_ppa000494mg             174   3e-46   Prunus persica
gb|KJB14806.1|  hypothetical protein B456_002G144100                    162   3e-46   Gossypium raimondii
ref|XP_008372668.1|  PREDICTED: formin-like protein 1                   173   3e-46   
ref|XP_008235862.1|  PREDICTED: formin-like protein 1                   173   4e-46   Prunus mume [ume]
ref|XP_010025994.1|  PREDICTED: formin-like protein 1                   171   5e-46   Eucalyptus grandis [rose gum]
emb|CDP03997.1|  unnamed protein product                                172   8e-46   Coffea canephora [robusta coffee]
ref|XP_010927915.1|  PREDICTED: formin-like protein 1                   171   1e-45   Elaeis guineensis
ref|XP_008807250.1|  PREDICTED: formin-like protein 1                   171   1e-45   Phoenix dactylifera
ref|XP_011458124.1|  PREDICTED: formin-like protein 1                   172   1e-45   Fragaria vesca subsp. vesca
ref|XP_002303028.2|  hypothetical protein POPTR_0002s24130g             171   2e-45   Populus trichocarpa [western balsam poplar]
ref|XP_008788161.1|  PREDICTED: formin-like protein 1                   170   3e-45   Phoenix dactylifera
ref|XP_010908735.1|  PREDICTED: formin-like protein 1                   169   5e-45   Elaeis guineensis
ref|XP_008800921.1|  PREDICTED: LOW QUALITY PROTEIN: formin-like ...    169   7e-45   Phoenix dactylifera
ref|XP_010466964.1|  PREDICTED: formin-like protein 1                   169   9e-45   Camelina sativa [gold-of-pleasure]
ref|XP_006296866.1|  hypothetical protein CARUB_v10012854mg             169   1e-44   Capsella rubella
ref|XP_004246983.1|  PREDICTED: formin-like protein 1                   168   2e-44   Solanum lycopersicum
gb|KFK39846.1|  hypothetical protein AALP_AA3G295700                    168   2e-44   Arabis alpina [alpine rockcress]
ref|XP_010488652.1|  PREDICTED: formin-like protein 1                   168   2e-44   Camelina sativa [gold-of-pleasure]
gb|KEH18708.1|  formin-like 2 domain protein                            167   3e-44   Medicago truncatula
dbj|BAE98844.1|  formin-like protein AHF1                               167   3e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010672466.1|  PREDICTED: formin-like protein 1                   166   3e-44   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|NP_189177.1|  formin-like protein 1                                 167   3e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010557746.1|  PREDICTED: formin-like protein 1                   167   3e-44   Tarenaya hassleriana [spider flower]
ref|XP_002885725.1|  predicted protein                                  167   4e-44   Arabidopsis lyrata subsp. lyrata
ref|XP_009402682.1|  PREDICTED: formin-like protein 1                   166   4e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010514197.1|  PREDICTED: formin-like protein 1                   167   4e-44   Camelina sativa [gold-of-pleasure]
ref|XP_006350433.1|  PREDICTED: formin-like protein 1-like              166   6e-44   Solanum tuberosum [potatoes]
gb|KHN15960.1|  Formin-like protein 1                                   165   1e-43   Glycine soja [wild soybean]
ref|XP_006351093.1|  PREDICTED: formin-like protein 2-like              164   1e-43   Solanum tuberosum [potatoes]
gb|KHN06284.1|  Formin-like protein 1                                   165   1e-43   Glycine soja [wild soybean]
ref|XP_003624247.1|  Formin-like protein                                166   1e-43   Medicago truncatula
ref|XP_006602854.1|  PREDICTED: formin-like protein 1-like              166   1e-43   Glycine max [soybeans]
gb|KHN40514.1|  Formin-like protein 1                                   162   2e-43   Glycine soja [wild soybean]
ref|XP_003548427.1|  PREDICTED: formin-like protein 1-like              165   2e-43   Glycine max [soybeans]
ref|XP_006366813.1|  PREDICTED: formin-like protein 1-like              164   5e-43   Solanum tuberosum [potatoes]
gb|KHN22146.1|  Formin-like protein 1                                   160   1e-42   Glycine soja [wild soybean]
gb|AAF24496.1|AF213695_1  FH protein NFH1                               162   2e-42   Nicotiana tabacum [American tobacco]
ref|XP_004970904.1|  PREDICTED: formin-like protein 1-like              162   3e-42   Setaria italica
ref|XP_011080563.1|  PREDICTED: formin-like protein 1                   162   3e-42   Sesamum indicum [beniseed]
ref|XP_004242448.1|  PREDICTED: formin-like protein 1                   161   3e-42   Solanum lycopersicum
gb|KJB34194.1|  hypothetical protein B456_006G052500                    153   3e-42   Gossypium raimondii
ref|XP_007139684.1|  hypothetical protein PHAVU_008G050300g             162   3e-42   Phaseolus vulgaris [French bean]
ref|XP_009767868.1|  PREDICTED: formin-like protein 1                   160   4e-42   Nicotiana sylvestris
gb|KJB08743.1|  hypothetical protein B456_001G100900                    161   5e-42   Gossypium raimondii
ref|XP_006418616.1|  hypothetical protein EUTSA_v10002383mg             161   6e-42   Eutrema salsugineum
ref|XP_010930463.1|  PREDICTED: LOW QUALITY PROTEIN: formin-like ...    160   7e-42   Elaeis guineensis
ref|XP_006587792.1|  PREDICTED: formin-like protein 1-like              160   1e-41   Glycine max [soybeans]
ref|XP_010517960.1|  PREDICTED: formin-like protein 2                   159   1e-41   Camelina sativa [gold-of-pleasure]
gb|KHG09398.1|  Formin-like protein 1                                   160   1e-41   Gossypium arboreum [tree cotton]
gb|AFW84304.1|  hypothetical protein ZEAMMB73_342974                    156   3e-41   Zea mays [maize]
ref|XP_006858820.1|  hypothetical protein AMTR_s00066p00173780          159   3e-41   Amborella trichopoda
ref|XP_004244823.1|  PREDICTED: formin-like protein 2                   157   3e-41   Solanum lycopersicum
ref|XP_006646564.1|  PREDICTED: formin-like protein 1-like              156   4e-41   
gb|EMT33349.1|  Formin-like protein 1                                   155   4e-41   Aegilops tauschii
gb|KJB42647.1|  hypothetical protein B456_007G161600                    158   8e-41   Gossypium raimondii
ref|XP_002458919.1|  hypothetical protein SORBIDRAFT_03g042700          157   9e-41   Sorghum bicolor [broomcorn]
gb|KJB42646.1|  hypothetical protein B456_007G161600                    157   1e-40   Gossypium raimondii
gb|KJB42648.1|  hypothetical protein B456_007G161600                    157   1e-40   Gossypium raimondii
ref|XP_009761393.1|  PREDICTED: formin-like protein 1                   157   1e-40   Nicotiana sylvestris
ref|XP_009587321.1|  PREDICTED: formin-like protein 1 isoform X1        157   1e-40   Nicotiana tomentosiformis
gb|KJB42649.1|  hypothetical protein B456_007G161600                    157   1e-40   Gossypium raimondii
ref|XP_009619665.1|  PREDICTED: formin-like protein 2                   156   2e-40   Nicotiana tomentosiformis
ref|XP_003564841.1|  PREDICTED: formin-like protein 1                   156   2e-40   Brachypodium distachyon [annual false brome]
ref|XP_009389163.1|  PREDICTED: formin-like protein 1                   155   3e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006293646.1|  hypothetical protein CARUB_v10022602mg             155   4e-40   Capsella rubella
ref|XP_002880068.1|  hypothetical protein ARALYDRAFT_483497             155   4e-40   Arabidopsis lyrata subsp. lyrata
gb|KHG03223.1|  Formin-like protein 1                                   156   4e-40   Gossypium arboreum [tree cotton]
gb|ACN34363.1|  unknown                                                 154   4e-40   Zea mays [maize]
emb|CDM85287.1|  unnamed protein product                                155   5e-40   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009420139.1|  PREDICTED: formin-like protein 1                   155   5e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_181908.1|  formin-like protein 2                                 155   5e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010524188.1|  PREDICTED: formin-like protein 2                   155   6e-40   Tarenaya hassleriana [spider flower]
emb|CDY52291.1|  BnaA03g57840D                                          155   7e-40   Brassica napus [oilseed rape]
ref|XP_009136119.1|  PREDICTED: formin-like protein 1                   155   8e-40   Brassica rapa
ref|XP_010508372.1|  PREDICTED: formin-like protein 2                   154   9e-40   Camelina sativa [gold-of-pleasure]
ref|XP_006397554.1|  hypothetical protein EUTSA_v10001716mg             153   9e-40   Eutrema salsugineum
tpg|DAA56340.1|  TPA: hypothetical protein ZEAMMB73_371007              154   1e-39   Zea mays [maize]
gb|KJB34193.1|  hypothetical protein B456_006G052500                    144   1e-39   Gossypium raimondii
ref|XP_007153716.1|  hypothetical protein PHAVU_003G059000g             154   1e-39   Phaseolus vulgaris [French bean]
emb|CDY15092.1|  BnaC03g44530D                                          154   2e-39   Brassica napus [oilseed rape]
gb|AAF24497.1|AF213696_1  FH protein NFH2                               153   2e-39   Nicotiana tabacum [American tobacco]
ref|XP_006849329.1|  hypothetical protein AMTR_s00164p00033930          153   2e-39   Amborella trichopoda
ref|XP_010679014.1|  PREDICTED: formin-like protein 1                   154   2e-39   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|EYU46079.1|  hypothetical protein MIMGU_mgv1a0011872mg               151   4e-39   Erythranthe guttata [common monkey flower]
ref|XP_007047509.1|  Formin                                             152   4e-39   Theobroma cacao [chocolate]
sp|Q8S0F0.1|FH1_ORYSJ  RecName: Full=Formin-like protein 1; AltNa...    152   5e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009410734.1|  PREDICTED: formin-like protein 1                   152   6e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010942818.1|  PREDICTED: LOW QUALITY PROTEIN: formin-like ...    151   9e-39   Elaeis guineensis
ref|XP_010272423.1|  PREDICTED: formin-like protein 6                   151   1e-38   Nelumbo nucifera [Indian lotus]
dbj|BAJ89494.1|  predicted protein                                      151   1e-38   Hordeum vulgare subsp. vulgare [barley]
ref|XP_008787184.1|  PREDICTED: formin-like protein 8                   150   2e-38   Phoenix dactylifera
ref|XP_010559076.1|  PREDICTED: LOW QUALITY PROTEIN: formin-like ...    150   2e-38   Tarenaya hassleriana [spider flower]
gb|EYU40678.1|  hypothetical protein MIMGU_mgv1a000530mg                151   2e-38   Erythranthe guttata [common monkey flower]
ref|XP_010506281.1|  PREDICTED: formin-like protein 2                   150   2e-38   Camelina sativa [gold-of-pleasure]
gb|EMS67119.1|  Formin-like protein 1                                   147   2e-38   Triticum urartu
ref|XP_009404931.1|  PREDICTED: formin-like protein 1                   150   3e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004505397.1|  PREDICTED: formin-like protein 2-like              149   5e-38   Cicer arietinum [garbanzo]
ref|XP_010247659.1|  PREDICTED: formin-like protein 6                   149   5e-38   Nelumbo nucifera [Indian lotus]
ref|XP_010102774.1|  Formin-like protein 6                              149   6e-38   Morus notabilis
ref|XP_008338434.1|  PREDICTED: formin-like protein 6                   149   8e-38   Malus domestica [apple tree]
dbj|BAJ87196.1|  predicted protein                                      149   9e-38   Hordeum vulgare subsp. vulgare [barley]
ref|XP_004144462.1|  PREDICTED: uncharacterized protein LOC101211678    149   9e-38   
ref|XP_004162652.1|  PREDICTED: uncharacterized LOC101211678            149   9e-38   
gb|KGN58390.1|  hypothetical protein Csa_3G636390                       149   9e-38   Cucumis sativus [cucumbers]
emb|CDX83457.1|  BnaA03g20490D                                          148   1e-37   Brassica napus [oilseed rape]
ref|XP_008341046.1|  PREDICTED: formin-like protein 6                   148   1e-37   Malus domestica [apple tree]
gb|KJB42650.1|  hypothetical protein B456_007G161600                    147   1e-37   Gossypium raimondii
ref|XP_011099366.1|  PREDICTED: formin-like protein 6                   148   2e-37   Sesamum indicum [beniseed]
gb|KDP32067.1|  hypothetical protein JCGZ_12528                         148   2e-37   Jatropha curcas
ref|XP_008460409.1|  PREDICTED: LOW QUALITY PROTEIN: formin-like ...    148   2e-37   
tpg|DAA40550.1|  TPA: hypothetical protein ZEAMMB73_701061              140   2e-37   Zea mays [maize]
ref|XP_009135921.1|  PREDICTED: formin-like protein 2                   147   3e-37   Brassica rapa
ref|XP_009384269.1|  PREDICTED: formin-like protein 1                   145   3e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_201548.1|  formin-like protein 6                                 147   4e-37   Arabidopsis thaliana [mouse-ear cress]
gb|KJB43902.1|  hypothetical protein B456_007G222600                    147   4e-37   Gossypium raimondii
emb|CDP02594.1|  unnamed protein product                                147   4e-37   Coffea canephora [robusta coffee]
gb|KHN23239.1|  Formin-like protein 6                                   144   4e-37   Glycine soja [wild soybean]
ref|XP_004985288.1|  PREDICTED: formin-like protein 8-like              147   5e-37   Setaria italica
emb|CDY17909.1|  BnaC04g03100D                                          146   5e-37   Brassica napus [oilseed rape]
ref|XP_004957365.1|  PREDICTED: formin-like protein 15-like             146   6e-37   Setaria italica
ref|NP_001145885.1|  uncharacterized protein LOC100279401               144   8e-37   Zea mays [maize]
ref|XP_002866702.1|  hypothetical protein ARALYDRAFT_919956             146   8e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_009411057.1|  PREDICTED: formin-like protein 8                   145   8e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008650145.1|  PREDICTED: formin-like protein 1                   142   9e-37   Zea mays [maize]
ref|XP_009379328.1|  PREDICTED: formin-like protein 6                   146   9e-37   Pyrus x bretschneideri [bai li]
ref|XP_002460529.1|  hypothetical protein SORBIDRAFT_02g030000          145   9e-37   Sorghum bicolor [broomcorn]
ref|XP_002279613.1|  PREDICTED: formin-like protein 6                   145   1e-36   Vitis vinifera
ref|XP_002525264.1|  conserved hypothetical protein                     145   1e-36   Ricinus communis
emb|CBI33699.3|  unnamed protein product                                145   1e-36   Vitis vinifera
ref|XP_007155835.1|  hypothetical protein PHAVU_003G235600g             145   1e-36   Phaseolus vulgaris [French bean]
ref|XP_010463998.1|  PREDICTED: formin-like protein 6                   145   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_011089583.1|  PREDICTED: formin-like protein 1                   146   2e-36   Sesamum indicum [beniseed]
ref|XP_008660427.1|  PREDICTED: formin-like protein 8                   145   2e-36   Zea mays [maize]
ref|XP_010444642.1|  PREDICTED: formin-like protein 6                   145   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010484489.1|  PREDICTED: formin-like protein 6                   145   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_006393951.1|  hypothetical protein EUTSA_v10003621mg             145   2e-36   Eutrema salsugineum
ref|XP_007156724.1|  hypothetical protein PHAVU_002G011800g             145   2e-36   Phaseolus vulgaris [French bean]
ref|XP_003550976.1|  PREDICTED: formin-like protein 6-like              145   2e-36   Glycine max [soybeans]
gb|KHG19871.1|  Formin-like protein 6                                   145   2e-36   Gossypium arboreum [tree cotton]
ref|XP_007207141.1|  hypothetical protein PRUPE_ppa001809mg             144   2e-36   Prunus persica
tpg|DAA40547.1|  TPA: hypothetical protein ZEAMMB73_701061              142   2e-36   Zea mays [maize]
tpg|DAA40549.1|  TPA: hypothetical protein ZEAMMB73_701061              142   2e-36   Zea mays [maize]
gb|ACR34861.1|  unknown                                                 142   3e-36   Zea mays [maize]
ref|XP_008238053.1|  PREDICTED: formin-like protein 6                   144   3e-36   Prunus mume [ume]
ref|XP_004147079.1|  PREDICTED: formin-like protein 6-like              144   3e-36   
tpg|DAA62315.1|  TPA: hypothetical protein ZEAMMB73_843831              144   3e-36   Zea mays [maize]
emb|CDX79799.1|  BnaA05g03570D                                          144   3e-36   Brassica napus [oilseed rape]
ref|XP_011011006.1|  PREDICTED: formin-like protein 6                   144   3e-36   Populus euphratica
gb|KGN61953.1|  hypothetical protein Csa_2G271460                       144   3e-36   Cucumis sativus [cucumbers]
ref|XP_010317777.1|  PREDICTED: formin-like protein 6 isoform X1        144   3e-36   Solanum lycopersicum
ref|XP_008457732.1|  PREDICTED: formin-like protein 6                   144   3e-36   Cucumis melo [Oriental melon]
ref|XP_004234650.1|  PREDICTED: formin-like protein 6 isoform X2        144   3e-36   Solanum lycopersicum
ref|XP_006279973.1|  hypothetical protein CARUB_v10025843mg             144   3e-36   Capsella rubella
ref|XP_010028101.1|  PREDICTED: formin-like protein 6                   144   3e-36   Eucalyptus grandis [rose gum]
ref|XP_010550332.1|  PREDICTED: formin-like protein 6                   144   4e-36   Tarenaya hassleriana [spider flower]
ref|XP_006651144.1|  PREDICTED: formin-like protein 8-like              142   4e-36   Oryza brachyantha
ref|XP_006380616.1|  hypothetical protein POPTR_0007s09870g             144   4e-36   Populus trichocarpa [western balsam poplar]
ref|XP_009142971.1|  PREDICTED: formin-like protein 2                   144   4e-36   Brassica rapa
gb|KJB48710.1|  hypothetical protein B456_008G082700                    144   5e-36   Gossypium raimondii
emb|CDY44259.1|  BnaC03g24510D                                          143   6e-36   Brassica napus [oilseed rape]
ref|XP_003608126.1|  Formin-like protein                                143   7e-36   
ref|XP_003608108.1|  Formin-like protein                                142   8e-36   
ref|NP_001147313.1|  AFH1 precursor                                     142   8e-36   
gb|KFK37202.1|  hypothetical protein AALP_AA4G227400                    143   9e-36   Arabis alpina [alpine rockcress]
ref|XP_002468314.1|  hypothetical protein SORBIDRAFT_01g043600          143   9e-36   Sorghum bicolor [broomcorn]
gb|AES90323.2|  formin-like 2 domain protein                            142   1e-35   Medicago truncatula
ref|XP_008667457.1|  PREDICTED: uncharacterized protein LOC100272...    142   1e-35   
emb|CDY08720.1|  BnaA06g25040D                                          142   1e-35   Brassica napus [oilseed rape]
gb|EPS68181.1|  hypothetical protein M569_06587                         142   1e-35   Genlisea aurea
ref|XP_003611598.1|  Formin-like protein                                142   1e-35   Medicago truncatula
ref|XP_010938950.1|  PREDICTED: formin-like protein 8                   142   2e-35   Elaeis guineensis
ref|XP_003538791.1|  PREDICTED: formin-like protein 6-like              142   3e-35   Glycine max [soybeans]
ref|XP_009150703.1|  PREDICTED: formin-like protein 6                   142   3e-35   Brassica rapa
ref|XP_006380617.1|  hypothetical protein POPTR_0007s09870g             139   3e-35   Populus trichocarpa [western balsam poplar]
ref|XP_004289343.1|  PREDICTED: formin-like protein 6                   141   4e-35   Fragaria vesca subsp. vesca
ref|NP_001049309.1|  Os03g0204100                                       141   4e-35   
emb|CDY36494.1|  BnaC03g48530D                                          140   6e-35   Brassica napus [oilseed rape]
gb|KFK28433.1|  hypothetical protein AALP_AA8G514000                    140   7e-35   Arabis alpina [alpine rockcress]
gb|EMT17710.1|  Formin-like protein 15                                  138   7e-35   Aegilops tauschii
ref|XP_003578447.1|  PREDICTED: formin-like protein 15                  140   7e-35   Brachypodium distachyon [annual false brome]
ref|XP_006583848.1|  PREDICTED: formin-like protein 2-like              140   7e-35   
ref|XP_006466473.1|  PREDICTED: formin-like protein 6-like              140   8e-35   Citrus sinensis [Valencia orange]
gb|KDO78945.1|  hypothetical protein CISIN_1g038630mg                   140   9e-35   Citrus sinensis [Valencia orange]
ref|XP_006426080.1|  hypothetical protein CICLE_v10024805mg             140   9e-35   Citrus clementina
ref|XP_009619755.1|  PREDICTED: formin-like protein 6 isoform X2        139   1e-34   Nicotiana tomentosiformis
ref|XP_009619754.1|  PREDICTED: formin-like protein 6 isoform X1        139   2e-34   Nicotiana tomentosiformis
ref|XP_003558554.1|  PREDICTED: formin-like protein 8                   139   2e-34   Brachypodium distachyon [annual false brome]
ref|XP_009787754.1|  PREDICTED: formin-like protein 6                   139   2e-34   Nicotiana sylvestris
ref|XP_009790006.1|  PREDICTED: formin-like protein 6                   139   3e-34   Nicotiana sylvestris
ref|XP_010525272.1|  PREDICTED: formin-like protein 10                  137   3e-34   Tarenaya hassleriana [spider flower]
ref|XP_003516616.1|  PREDICTED: formin-like protein 6-like              138   4e-34   Glycine max [soybeans]
emb|CDY43578.1|  BnaC02g16750D                                          138   5e-34   Brassica napus [oilseed rape]
gb|KHN06016.1|  Formin-like protein 6                                   135   8e-34   Glycine soja [wild soybean]
ref|XP_009394348.1|  PREDICTED: formin-like protein 8                   137   9e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006343211.1|  PREDICTED: formin-like protein 6-like              137   1e-33   Solanum tuberosum [potatoes]
gb|EAZ45377.1|  hypothetical protein OsJ_30023                          136   1e-33   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK04488.1|  predicted protein                                      136   2e-33   Hordeum vulgare subsp. vulgare [barley]
dbj|BAJ96451.1|  predicted protein                                      136   2e-33   Hordeum vulgare subsp. vulgare [barley]
gb|EAZ09765.1|  hypothetical protein OsI_32053                          136   2e-33   Oryza sativa Indica Group [Indian rice]
ref|NP_001063680.1|  Os09g0517600                                       136   2e-33   
ref|XP_004231916.1|  PREDICTED: formin-like protein 6                   136   2e-33   Solanum lycopersicum
ref|XP_008805689.1|  PREDICTED: formin-like protein 8                   134   2e-33   
gb|KEH31531.1|  formin-like 2 domain protein                            135   3e-33   Medicago truncatula
ref|XP_009604069.1|  PREDICTED: formin-like protein 6                   135   4e-33   Nicotiana tomentosiformis
gb|AFW89297.1|  hypothetical protein ZEAMMB73_801948                    135   6e-33   Zea mays [maize]
ref|XP_008652259.1|  PREDICTED: formin-like protein 8 isoform X2        135   6e-33   Zea mays [maize]
ref|XP_008652255.1|  PREDICTED: formin-like protein 8 isoform X1        135   6e-33   Zea mays [maize]
ref|XP_003525865.1|  PREDICTED: formin-like protein 6-like isofor...    135   7e-33   Glycine max [soybeans]
gb|EPS73587.1|  hypothetical protein M569_01164                         134   7e-33   Genlisea aurea
ref|XP_004511845.1|  PREDICTED: formin-like protein 6-like              134   1e-32   Cicer arietinum [garbanzo]
ref|XP_006661441.1|  PREDICTED: formin-like protein 15-like             132   1e-32   Oryza brachyantha
ref|XP_008664791.1|  PREDICTED: formin-like protein 4                   134   1e-32   Zea mays [maize]
gb|EYU44483.1|  hypothetical protein MIMGU_mgv1a002194mg                133   2e-32   Erythranthe guttata [common monkey flower]
ref|XP_004509068.1|  PREDICTED: formin-like protein 6-like              134   2e-32   Cicer arietinum [garbanzo]
ref|XP_010679625.1|  PREDICTED: formin-like protein 6                   132   5e-32   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|AFW68466.1|  hypothetical protein ZEAMMB73_614045                    131   1e-31   Zea mays [maize]
ref|XP_008644745.1|  PREDICTED: formin-like protein 4                   131   2e-31   Zea mays [maize]
ref|NP_001064402.1|  Os10g0347800                                       130   2e-31   
ref|XP_006661709.1|  PREDICTED: formin-like protein 4-like              128   3e-31   
ref|XP_009395610.1|  PREDICTED: formin-like protein 8                   130   3e-31   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS59732.1|  formin-like protein 1                                   122   1e-29   Genlisea aurea
tpg|DAA43913.1|  TPA: hypothetical protein ZEAMMB73_482138              124   5e-29   Zea mays [maize]
ref|XP_011073693.1|  PREDICTED: formin-like protein 6                   122   3e-28   Sesamum indicum [beniseed]
ref|XP_004983260.1|  PREDICTED: formin-like protein 4-like              119   2e-27   
ref|XP_002464424.1|  hypothetical protein SORBIDRAFT_01g018000          117   9e-27   Sorghum bicolor [broomcorn]
gb|EAY88952.1|  hypothetical protein OsI_10435                          117   1e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_010547176.1|  PREDICTED: formin-like protein 10                  116   2e-26   Tarenaya hassleriana [spider flower]
ref|XP_008656982.1|  PREDICTED: formin-like protein 1                   113   3e-26   
tpg|DAA49416.1|  TPA: hypothetical protein ZEAMMB73_724144              116   4e-26   
gb|EAY76828.1|  hypothetical protein OsI_04788                          108   1e-24   
ref|NP_001131233.1|  uncharacterized protein LOC100192542               108   1e-24   
ref|XP_006830070.1|  hypothetical protein AMTR_s00125p00077260          110   2e-24   
gb|KHN32343.1|  Formin-like protein 1                                   107   3e-24   
ref|XP_006395193.1|  hypothetical protein EUTSA_v10003660mg             110   3e-24   
ref|XP_010674037.1|  PREDICTED: formin-like protein 11                  109   4e-24   
gb|KJB45299.1|  hypothetical protein B456_007G299400                    109   5e-24   
gb|KHG13937.1|  Formin-like protein 11                                  109   5e-24   
ref|XP_003591140.1|  Formin-like protein                                108   9e-24   
ref|XP_010269484.1|  PREDICTED: formin-like protein 11                  108   1e-23   
gb|KHN43295.1|  Formin-like protein 11                                  108   1e-23   
ref|XP_006604816.1|  PREDICTED: formin-like protein 11-like             108   1e-23   
ref|XP_006433402.1|  hypothetical protein CICLE_v10000203mg             108   1e-23   
ref|XP_006472079.1|  PREDICTED: formin-like protein 11-like             108   1e-23   
gb|KHN03980.1|  Formin-like protein 11                                  107   2e-23   
ref|XP_006589133.1|  PREDICTED: formin-like protein 11-like isofo...    108   2e-23   
ref|XP_009622356.1|  PREDICTED: formin-like protein 11                  108   2e-23   
ref|XP_003520804.1|  PREDICTED: formin-like protein 11-like             107   2e-23   
ref|XP_010051227.1|  PREDICTED: formin-like protein 3 isoform X2        108   2e-23   
ref|XP_010051232.1|  PREDICTED: formin-like protein 3 isoform X3        107   2e-23   
ref|XP_003535334.1|  PREDICTED: formin-like protein 11-like isofo...    108   2e-23   
ref|XP_004505472.1|  PREDICTED: formin-like protein 5-like              108   2e-23   
gb|KHN16106.1|  Formin-like protein 11                                  107   2e-23   
ref|XP_010051221.1|  PREDICTED: formin-like protein 3 isoform X1        107   2e-23   
ref|XP_007147030.1|  hypothetical protein PHAVU_006G090300g             107   2e-23   
gb|KHN20241.1|  Formin-like protein 11                                  107   3e-23   
ref|XP_003555611.1|  PREDICTED: formin-like protein 11-like             107   3e-23   
gb|KHG02657.1|  Formin-like protein 5                                   107   3e-23   
gb|KHG02656.1|  Formin-like protein 5                                   107   3e-23   
emb|CDP15490.1|  unnamed protein product                                107   3e-23   
ref|XP_011466280.1|  PREDICTED: formin-like protein 11                  107   3e-23   
ref|XP_003541874.2|  PREDICTED: formin-like protein 5-like              107   3e-23   
ref|XP_004959731.1|  PREDICTED: formin-like protein 11-like             107   3e-23   
gb|KJB22083.1|  hypothetical protein B456_004G028300                    107   4e-23   
gb|KJB45300.1|  hypothetical protein B456_007G299400                    107   4e-23   
ref|XP_010928405.1|  PREDICTED: formin-like protein 11 isoform X2       107   5e-23   
ref|XP_010928383.1|  PREDICTED: formin-like protein 11 isoform X1       106   5e-23   
ref|XP_008388955.1|  PREDICTED: formin-like protein 11                  106   6e-23   
ref|XP_007030986.1|  Actin-binding FH2 family protein                   106   6e-23   
gb|AES89904.2|  formin-like 2 domain protein                            106   6e-23   
ref|XP_011092074.1|  PREDICTED: formin-like protein 11                  106   6e-23   
gb|KEH30757.1|  formin-like 2 domain protein                            106   6e-23   
ref|XP_002512421.1|  conserved hypothetical protein                     106   6e-23   
ref|XP_007144945.1|  hypothetical protein PHAVU_007G196700g             106   6e-23   
ref|XP_003607707.1|  Formin-like protein                                106   7e-23   
ref|XP_008246446.1|  PREDICTED: formin-like protein 11                  106   7e-23   
ref|XP_007208106.1|  hypothetical protein PRUPE_ppa000943mg             106   7e-23   
ref|XP_008350742.1|  PREDICTED: LOW QUALITY PROTEIN: formin-like ...    106   8e-23   
ref|XP_008370446.1|  PREDICTED: formin-like protein 11                  106   8e-23   
ref|XP_002462976.1|  hypothetical protein SORBIDRAFT_02g035660          106   9e-23   
ref|XP_009416027.1|  PREDICTED: formin-like protein 1                   103   9e-23   
gb|EPS65762.1|  hypothetical protein M569_09014                         105   9e-23   
dbj|BAK05555.1|  predicted protein                                      105   1e-22   
ref|XP_006592507.1|  PREDICTED: formin-like protein 5-like              105   1e-22   
ref|XP_009376632.1|  PREDICTED: formin-like protein 11                  105   2e-22   
gb|EYU29634.1|  hypothetical protein MIMGU_mgv1a018916mg                103   2e-22   
gb|KDP23485.1|  hypothetical protein JCGZ_23318                         104   2e-22   
ref|XP_010259647.1|  PREDICTED: formin-like protein 11 isoform X1       105   2e-22   
ref|XP_008793774.1|  PREDICTED: formin-like protein 11                  104   2e-22   
ref|NP_001059916.1|  Os07g0545500                                       104   2e-22   
ref|XP_004495712.1|  PREDICTED: formin-like protein 11-like             104   2e-22   
ref|XP_010060442.1|  PREDICTED: formin-like protein 5                   104   3e-22   
gb|EEE67358.1|  hypothetical protein OsJ_24637                          105   3e-22   
ref|XP_008670473.1|  PREDICTED: formin-like protein 11                  104   3e-22   
tpg|DAA41067.1|  TPA: hypothetical protein ZEAMMB73_539189              104   3e-22   
ref|XP_011079028.1|  PREDICTED: formin-like protein 3                   104   3e-22   
ref|XP_003579909.1|  PREDICTED: formin-like protein 2                   104   3e-22   
ref|XP_010239671.1|  PREDICTED: formin-like protein 18                  104   3e-22   
gb|EYU43100.1|  hypothetical protein MIMGU_mgv1a002374mg                103   3e-22   
gb|KHN27983.1|  Formin-like protein 5                                   103   3e-22   
ref|XP_011095788.1|  PREDICTED: formin-like protein 5                   104   3e-22   
ref|XP_008776710.1|  PREDICTED: formin-like protein 11                  104   4e-22   
gb|EEC82226.1|  hypothetical protein OsI_26382                          104   4e-22   
ref|XP_007021096.1|  Formin-like protein 5 isoform 1                    104   4e-22   
ref|XP_006838410.1|  hypothetical protein AMTR_s00002p00097480          104   4e-22   
ref|XP_004975864.1|  PREDICTED: formin-like protein 2-like              103   4e-22   
ref|XP_006408071.1|  hypothetical protein EUTSA_v10020037mg             103   4e-22   
ref|XP_010533507.1|  PREDICTED: formin-like protein 5                   103   5e-22   
ref|XP_009766973.1|  PREDICTED: formin-like protein 11                  103   5e-22   
ref|XP_007149686.1|  hypothetical protein PHAVU_005G090500g             103   6e-22   
ref|XP_010923994.1|  PREDICTED: formin-like protein 11 isoform X2       103   6e-22   
gb|KHN20445.1|  Formin-like protein 5                                   103   6e-22   
ref|XP_010923992.1|  PREDICTED: formin-like protein 11 isoform X1       103   6e-22   
ref|XP_003526177.1|  PREDICTED: formin-like protein 5-like              103   7e-22   
ref|XP_009358078.1|  PREDICTED: formin-like protein 5                   103   7e-22   
ref|XP_006408072.1|  hypothetical protein EUTSA_v10020037mg             103   9e-22   
gb|KCW85088.1|  hypothetical protein EUGRSUZ_B01920                     103   9e-22   
gb|EMT29483.1|  Formin-like protein 2                                   102   1e-21   
ref|XP_010237311.1|  PREDICTED: formin-like protein 11                  103   1e-21   
ref|XP_010043062.1|  PREDICTED: formin-like protein 11                  103   1e-21   
tpg|DAA57114.1|  TPA: hypothetical protein ZEAMMB73_471516            99.4    1e-21   
ref|XP_002884514.1|  hypothetical protein ARALYDRAFT_317406             102   1e-21   
ref|XP_006296949.1|  hypothetical protein CARUB_v10012942mg             102   1e-21   
ref|NP_187198.1|  Actin-binding protein FH2                             102   1e-21   
ref|XP_003539566.2|  PREDICTED: formin-like protein 5-like              102   1e-21   
ref|XP_007132587.1|  hypothetical protein PHAVU_011G107500g             102   1e-21   
ref|XP_006370606.1|  formin homology 2 domain-containing family p...    102   2e-21   
ref|XP_010313078.1|  PREDICTED: formin-like protein 11                  102   2e-21   
ref|XP_010427712.1|  PREDICTED: formin-like protein 11                  102   2e-21   
emb|CDY05170.1|  BnaC05g46330D                                          102   2e-21   
ref|XP_010546713.1|  PREDICTED: formin-like protein 11                  102   2e-21   
ref|XP_008801139.1|  PREDICTED: formin-like protein 11                  101   2e-21   
ref|XP_010485995.1|  PREDICTED: formin-like protein 11                  102   2e-21   
emb|CDP05810.1|  unnamed protein product                                102   2e-21   
ref|XP_010267817.1|  PREDICTED: formin-like protein 3                   102   2e-21   
ref|XP_004135779.1|  PREDICTED: formin-like protein 11-like             102   2e-21   
ref|XP_010464070.1|  PREDICTED: formin-like protein 11                  102   2e-21   
ref|XP_011023676.1|  PREDICTED: formin-like protein 11                  102   2e-21   
gb|AGT16960.1|  actin binding protein precursor                         102   2e-21   
ref|XP_011030898.1|  PREDICTED: formin-like protein 5                   102   2e-21   
ref|XP_008450639.1|  PREDICTED: formin-like protein 11                  102   2e-21   
ref|XP_002318992.2|  formin homology 2 domain-containing family p...    101   2e-21   
ref|XP_011048274.1|  PREDICTED: formin-like protein 5                   102   3e-21   
ref|XP_009132431.1|  PREDICTED: formin-like protein 5                   101   3e-21   
ref|XP_006377823.1|  formin homology 2 domain-containing family p...    102   3e-21   
emb|CDY43029.1|  BnaA03g11760D                                          101   3e-21   
ref|XP_003596576.1|  Formin-like protein                                101   3e-21   
emb|CDY43811.1|  BnaC03g14440D                                          101   3e-21   
ref|XP_002447970.1|  hypothetical protein SORBIDRAFT_06g019060          101   3e-21   
gb|EYU19201.1|  hypothetical protein MIMGU_mgv1a001171mg                101   3e-21   
gb|KDO46384.1|  hypothetical protein CISIN_1g002439mg                   100   4e-21   
ref|XP_008665960.1|  PREDICTED: uncharacterized protein LOC103644550  98.6    4e-21   
ref|XP_004240139.1|  PREDICTED: formin-like protein 3                   100   5e-21   
gb|KGN57957.1|  hypothetical protein Csa_3G408550                       100   5e-21   
emb|CDY18346.1|  BnaC09g30960D                                          100   5e-21   
gb|EYU42172.1|  hypothetical protein MIMGU_mgv1a018539mg                100   5e-21   
ref|XP_004152031.1|  PREDICTED: uncharacterized protein LOC101213072    100   6e-21   
ref|XP_006652069.1|  PREDICTED: formin-like protein 18-like             100   6e-21   
gb|EPS61801.1|  hypothetical protein M569_12988                         100   6e-21   
ref|XP_004168186.1|  PREDICTED: uncharacterized LOC101213072            100   6e-21   
ref|XP_010550984.1|  PREDICTED: formin-like protein 11                  100   6e-21   
ref|XP_010909490.1|  PREDICTED: formin-like protein 2                   100   7e-21   
tpg|DAA37440.1|  TPA: hypothetical protein ZEAMMB73_836901              100   7e-21   
gb|EPS61155.1|  hypothetical protein M569_13644                       99.0    7e-21   
ref|XP_006279976.1|  hypothetical protein CARUB_v10025846mg             100   7e-21   
ref|XP_009147237.1|  PREDICTED: formin-like protein 11                  100   7e-21   
emb|CDY27766.1|  BnaA05g31750D                                          100   8e-21   
gb|EPS68939.1|  hypothetical protein M569_05828                         100   8e-21   
ref|XP_010520874.1|  PREDICTED: formin-like protein 5                 97.8    9e-21   
gb|KDO46383.1|  hypothetical protein CISIN_1g002439mg                   100   9e-21   
gb|EMS60086.1|  Formin-like protein 11                                  100   9e-21   
ref|XP_010092306.1|  Formin-like protein 5                              100   1e-20   
ref|XP_011463046.1|  PREDICTED: formin-like protein 3 isoform X2        100   1e-20   
ref|XP_010247025.1|  PREDICTED: formin-like protein 5                 99.8    1e-20   
ref|XP_002515709.1|  conserved hypothetical protein                   99.8    1e-20   
ref|XP_011003252.1|  PREDICTED: formin-like protein 3                 99.8    1e-20   
gb|KJB81016.1|  hypothetical protein B456_013G125400                  99.8    1e-20   
ref|XP_004289149.1|  PREDICTED: formin-like protein 3 isoform X1      99.8    1e-20   
ref|XP_006382491.1|  hypothetical protein POPTR_0005s02640g           99.8    1e-20   
ref|XP_004248308.2|  PREDICTED: formin-like protein 5                 99.8    1e-20   
emb|CDY42470.1|  BnaA10g08460D                                        99.4    2e-20   
ref|NP_001148197.1|  actin binding protein precursor                  99.4    2e-20   
gb|KFK37939.1|  hypothetical protein AALP_AA3G049900                  99.4    2e-20   
ref|XP_011097932.1|  PREDICTED: LOW QUALITY PROTEIN: formin-like ...  99.8    2e-20   
ref|XP_002309847.2|  hypothetical protein POPTR_0007s02780g           98.6    2e-20   
ref|XP_008454572.1|  PREDICTED: formin-like protein 5 isoform X2      99.4    2e-20   
ref|XP_009119994.1|  PREDICTED: formin-like protein 5                 99.4    2e-20   
gb|ACN33820.1|  unknown                                               99.0    2e-20   
ref|XP_008355363.1|  PREDICTED: formin-like protein 5                 99.0    2e-20   
ref|XP_008454571.1|  PREDICTED: formin-like protein 5 isoform X1      99.0    2e-20   
ref|XP_006360682.1|  PREDICTED: formin-like protein 3-like            99.0    2e-20   
ref|XP_008667946.1|  PREDICTED: actin binding protein isoform X1      98.6    3e-20   
ref|XP_006452138.1|  hypothetical protein CICLE_v100106842mg          99.0    3e-20   
ref|XP_002522822.1|  actin binding protein, putative                  99.0    3e-20   
emb|CBI39504.3|  unnamed protein product                              96.7    4e-20   
ref|XP_004977675.1|  PREDICTED: formin-like protein 18-like           97.8    4e-20   
ref|XP_006475297.1|  PREDICTED: formin-like protein 5-like            98.6    4e-20   
ref|XP_009630423.1|  PREDICTED: formin-like protein 5 isoform X1      98.2    4e-20   
ref|XP_010694271.1|  PREDICTED: formin-like protein 5                 98.2    4e-20   
ref|XP_007132989.1|  hypothetical protein PHAVU_011G141900g           98.2    4e-20   
ref|XP_010520873.1|  PREDICTED: formin-like protein 5                 98.2    5e-20   
ref|XP_008342105.1|  PREDICTED: formin-like protein 3                 98.2    5e-20   
gb|EYU30334.1|  hypothetical protein MIMGU_mgv1a022598mg              97.4    5e-20   
ref|XP_006401549.1|  hypothetical protein EUTSA_v10012631mg           98.2    5e-20   
ref|XP_006653484.1|  PREDICTED: LOW QUALITY PROTEIN: formin-like ...  97.8    5e-20   
ref|XP_009397782.1|  PREDICTED: formin-like protein 5 isoform X2      97.8    6e-20   
tpg|DAA38789.1|  TPA: hypothetical protein ZEAMMB73_078162            97.8    6e-20   
ref|XP_008669741.1|  PREDICTED: formin-like protein 18                97.8    6e-20   
ref|XP_002866054.1|  hypothetical protein ARALYDRAFT_495546           97.8    6e-20   
tpg|DAA38788.1|  TPA: hypothetical protein ZEAMMB73_078162            97.4    6e-20   
ref|XP_009397781.1|  PREDICTED: formin-like protein 5 isoform X1      97.8    6e-20   
ref|XP_006344840.1|  PREDICTED: formin-like protein 11-like           97.8    6e-20   
gb|KJB62650.1|  hypothetical protein B456_009G427600                  97.8    6e-20   
ref|XP_008663014.1|  PREDICTED: formin-like protein 18                97.8    6e-20   
gb|KDP39038.1|  hypothetical protein JCGZ_00795                       97.8    7e-20   
gb|AAK68741.1|  Unknown protein                                       97.8    7e-20   
ref|XP_006658666.1|  PREDICTED: formin-like protein 11-like           97.8    7e-20   
ref|NP_200276.1|  formin-like protein 5                               97.8    7e-20   
dbj|BAJ88086.1|  predicted protein                                    97.4    7e-20   
gb|EMT26648.1|  Formin-like protein 11                                97.8    7e-20   
ref|XP_008790964.1|  PREDICTED: formin-like protein 5                 97.8    7e-20   
ref|XP_010448449.1|  PREDICTED: formin-like protein 5                 97.4    7e-20   
emb|CDX74146.1|  BnaA03g29010D                                        97.4    8e-20   
gb|AAS93430.1|  formin homology 2 domain-containing protein 5         97.4    8e-20   
gb|EYU33593.1|  hypothetical protein MIMGU_mgv1a019958mg              97.1    8e-20   
ref|XP_002279574.3|  PREDICTED: formin-like protein 11                97.4    8e-20   
emb|CDY40709.1|  BnaC03g34250D                                        97.4    9e-20   
ref|XP_010689650.1|  PREDICTED: formin-like protein 3                 97.1    9e-20   
ref|XP_010482871.1|  PREDICTED: formin-like protein 5                 97.4    9e-20   
ref|XP_009134824.1|  PREDICTED: formin-like protein 11                97.1    1e-19   
ref|XP_009355570.1|  PREDICTED: formin-like protein 5                 97.4    1e-19   
ref|XP_010907237.1|  PREDICTED: formin-like protein 5 isoform X2      96.7    1e-19   
emb|CAN77532.1|  hypothetical protein VITISV_009172                   97.1    1e-19   
ref|XP_006360101.1|  PREDICTED: formin-like protein 5-like            97.1    1e-19   
gb|KFK27079.1|  hypothetical protein AALP_AA8G331200                  97.1    1e-19   
gb|EMT12986.1|  Formin-like protein 13                                96.3    1e-19   
ref|XP_010907227.1|  PREDICTED: formin-like protein 3 isoform X1      96.7    1e-19   
sp|Q6MWG9.1|FH18_ORYSJ  RecName: Full=Formin-like protein 18; Alt...  96.7    2e-19   
ref|XP_009803708.1|  PREDICTED: formin-like protein 5                 96.7    2e-19   
ref|XP_003540858.1|  PREDICTED: formin-like protein 3-like            96.3    2e-19   
gb|KDP35641.1|  hypothetical protein JCGZ_09079                       96.7    2e-19   
emb|CBI28978.3|  unnamed protein product                              95.9    2e-19   
gb|KHN22862.1|  Formin-like protein 3                                 96.3    2e-19   
ref|XP_011036857.1|  PREDICTED: formin-like protein 11                96.3    2e-19   
gb|KEH29556.1|  formin-like 2 domain protein                          96.3    2e-19   
ref|XP_010657337.1|  PREDICTED: formin-like protein 3 isoform X2      96.3    2e-19   
gb|EEC76617.1|  hypothetical protein OsI_14494                        95.9    2e-19   
ref|XP_010657336.1|  PREDICTED: formin-like protein 3 isoform X1      96.3    2e-19   
ref|XP_004487366.1|  PREDICTED: formin-like protein 5-like            95.9    3e-19   



>emb|CDP08062.1| unnamed protein product [Coffea canephora]
Length=888

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 145/184 (79%), Gaps = 2/184 (1%)
 Frame = +1

Query  1    DFLAQISESPVSQLADSGRYDGSLKAppppppppppRFWEPPVMDGGPPMLVPPSRPVVS  180
            D+     ESP   L  SGR+ G    PPPPPPPPPPRFW+ P ++ GPP LV PSRPVV 
Sbjct  357  DYSGITMESPGENLDLSGRFAGMRTVPPPPPPPPPPRFWDTPELNAGPPELVAPSRPVVG  416

Query  181  QNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIET  360
            QN++    ++EA+E RNE  +KPKLKPLHWDKVRASSDR MVWD +KSSSFQLNEEMIET
Sbjct  417  QNLSNGLGNTEALEGRNENGVKPKLKPLHWDKVRASSDRAMVWDQMKSSSFQLNEEMIET  476

Query  361  LFMV-NSNS-DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTAD  534
            LF   NSN+ DG +RPLMP LNQEN+VLDPKKSQNIAILLRALNVT EEVCEAL+EG AD
Sbjct  477  LFTASNSNARDGTRRPLMPPLNQENQVLDPKKSQNIAILLRALNVTIEEVCEALLEGNAD  536

Query  535  SLGT  546
             LGT
Sbjct  537  MLGT  540



>ref|XP_004251998.1| PREDICTED: formin-like protein 2 [Solanum lycopersicum]
Length=932

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 144/190 (76%), Gaps = 12/190 (6%)
 Frame = +1

Query  1    DFLAQISESPVSQLADSGRYDGSLKAppppppppppRFWEPPVM-------DGGPPMLVP  159
            D  A+ISES +  L     Y  S+K PPPPPP PPPRFWE P +       +GGPP+LV 
Sbjct  395  DSSARISESSLRNLGGFRSY-VSMKVPPPPPPAPPPRFWEAPQVPKSVEAENGGPPVLVA  453

Query  160  PSRPVVSQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQL  339
            PS PV+  +V     SSEAVE+RN+E +KPKLKPLHWDKVRA+SDR MVWD LKSSSFQL
Sbjct  454  PSMPVLGHHVNGNIKSSEAVERRNDEIIKPKLKPLHWDKVRATSDRAMVWDQLKSSSFQL  513

Query  340  NEEMIETLFMVN-SNS---DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVC  507
            NEEMIETLF  N SNS   DG+ R + P+LNQENRVLDPKKSQNIAILLRALNVT EEVC
Sbjct  514  NEEMIETLFTANCSNSNPKDGITRLVQPVLNQENRVLDPKKSQNIAILLRALNVTNEEVC  573

Query  508  EALVEGTADS  537
            EAL+EG AD+
Sbjct  574  EALLEGNADT  583



>ref|XP_006365943.1| PREDICTED: formin-like protein 2-like [Solanum tuberosum]
Length=944

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 144/190 (76%), Gaps = 12/190 (6%)
 Frame = +1

Query  1    DFLAQISESPVSQLADSGRYDGSLKAppppppppppRFWEPPVM-------DGGPPMLVP  159
            D  A+ISES +  L   G Y  S+K PPPPPP PPPRFWE P +       +GGPP+L+ 
Sbjct  407  DSSARISESSLRNLGGFGSY-VSMKVPPPPPPAPPPRFWEAPQVPKSVEAENGGPPVLMA  465

Query  160  PSRPVVSQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQL  339
            PS PV+  +V+    SSEAVE+RN+E  KPKLKPLHWDKVRA+SDR MVWD LK SSFQL
Sbjct  466  PSMPVLGHHVSGNIKSSEAVERRNDEITKPKLKPLHWDKVRATSDRAMVWDQLKFSSFQL  525

Query  340  NEEMIETLFMVN-SNS---DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVC  507
            NEEMIETLF  N SNS   DG+ R + P+LNQENRVLDPKKSQNIAILLRALNVT EEVC
Sbjct  526  NEEMIETLFTANCSNSNPKDGITRLVQPVLNQENRVLDPKKSQNIAILLRALNVTNEEVC  585

Query  508  EALVEGTADS  537
            EAL+EG AD+
Sbjct  586  EALLEGNADT  595



>ref|XP_008243047.1| PREDICTED: formin-like protein 1 [Prunus mume]
Length=573

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 123/157 (78%), Gaps = 11/157 (7%)
 Frame = +1

Query  109  RFWE---PPVMDGGPPMLVPPSRPVVSQNVAEV----KHSSEAVEKRNEETMKPKLKPLH  267
            RFWE    P  + GPP LV PSRP V QN   V       S+A+ ++NEET KPKLKPLH
Sbjct  65   RFWEITAGPRPNSGPPALVMPSRPRVFQNSGPVLGGEGSQSDAIVEKNEETPKPKLKPLH  124

Query  268  WDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLNQENRV  435
            WDKVRASSDR MVWD LKSSSFQLNEEMIETLFMVN++S    D V+R ++P LNQENRV
Sbjct  125  WDKVRASSDRAMVWDQLKSSSFQLNEEMIETLFMVNNSSLAPNDNVRRQILPSLNQENRV  184

Query  436  LDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            LDPKKSQNIAILLRALNVT +EVCEALVEG +D+LGT
Sbjct  185  LDPKKSQNIAILLRALNVTIDEVCEALVEGNSDALGT  221



>ref|XP_007203238.1| hypothetical protein PRUPE_ppa001116mg [Prunus persica]
 gb|EMJ04437.1| hypothetical protein PRUPE_ppa001116mg [Prunus persica]
Length=906

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 123/157 (78%), Gaps = 11/157 (7%)
 Frame = +1

Query  109  RFWE---PPVMDGGPPMLVPPSRPVVSQNVAEV----KHSSEAVEKRNEETMKPKLKPLH  267
            RFWE    P+ + GPP LV PSRP V QN   V       S A+ ++N+ET KPKLKPLH
Sbjct  399  RFWEVPAGPMPNSGPPALVMPSRPRVFQNSGPVLGGEGSQSNAIVEKNQETPKPKLKPLH  458

Query  268  WDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLNQENRV  435
            WDKVRASSDR MVWD LKSSSFQLNEEMIETLFMVN++S    D V+R ++P LNQENRV
Sbjct  459  WDKVRASSDRAMVWDQLKSSSFQLNEEMIETLFMVNNSSLAPNDNVRRQILPSLNQENRV  518

Query  436  LDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            LDPKKSQNIAILLRALNVT +EVCEALVEG +D+LGT
Sbjct  519  LDPKKSQNIAILLRALNVTIDEVCEALVEGNSDALGT  555



>ref|XP_007033683.1| Actin-binding FH2 family protein isoform 1 [Theobroma cacao]
 ref|XP_007033684.1| Actin-binding FH2 family protein isoform 1 [Theobroma cacao]
 gb|EOY04609.1| Actin-binding FH2 family protein isoform 1 [Theobroma cacao]
 gb|EOY04610.1| Actin-binding FH2 family protein isoform 1 [Theobroma cacao]
Length=933

 Score =   206 bits (523),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 127/160 (79%), Gaps = 15/160 (9%)
 Frame = +1

Query  109  RFWEPPVM--------DGGPPMLVPPSRPVVSQNVAEVKH--SSEAVEKRNEETMKPKLK  258
            RFWE PV          GGPP+LV PSRP+V QN+A  +H   +E +E R+EET KPKLK
Sbjct  429  RFWEVPVAVKAVSEANPGGPPVLVAPSRPLVLQNLAVDEHLKKNEGIE-RSEETPKPKLK  487

Query  259  PLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLNQE  426
            PLHWDKVRASSDR MVWD +K+SSFQLNEEMIETLFMVN+++    D  +R ++P +NQE
Sbjct  488  PLHWDKVRASSDRAMVWDQIKASSFQLNEEMIETLFMVNNSNLATKDHGRRQILPSVNQE  547

Query  427  NRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            NRVLDPKKSQNIAILLRALNVT +EVCEAL+EG +D+LGT
Sbjct  548  NRVLDPKKSQNIAILLRALNVTIDEVCEALMEGNSDTLGT  587



>ref|XP_011464576.1| PREDICTED: formin-like protein 2 [Fragaria vesca subsp. vesca]
Length=910

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 145/193 (75%), Gaps = 12/193 (6%)
 Frame = +1

Query  1    DFLAQISESPVSQLADSGRYDGSLKAppppppppppRFWE---PPVMDGGPPMLVPPSRP  171
            DFL Q+ +S +   +   R+   ++ PPPPPPPPPPRFWE    PV++ GPP LV P+R 
Sbjct  373  DFLTQMKQSLLRNNSAPKRFV-PIRLPPPPPPPPPPRFWEGPVSPVVNAGPPALVTPTRA  431

Query  172  VVSQNVAEV----KHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQL  339
             V QN+  V          VE+++EET +PKLKPLHWDKVRASSDR MVWD LKSSSFQL
Sbjct  432  GVFQNMGPVLAGEPSEKNGVEEKSEETPRPKLKPLHWDKVRASSDRAMVWDQLKSSSFQL  491

Query  340  NEEMIETLFMVNSNS----DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVC  507
            NEEMIETLF+VN++S    +  +R ++P LNQENRVLDPKKSQNIAILLRALNVT +EVC
Sbjct  492  NEEMIETLFVVNNSSLTPKENARRQILPSLNQENRVLDPKKSQNIAILLRALNVTIDEVC  551

Query  508  EALVEGTADSLGT  546
            EAL+EG +DSLGT
Sbjct  552  EALLEGNSDSLGT  564



>ref|XP_002275001.1| PREDICTED: formin-like protein 1 [Vitis vinifera]
Length=932

 Score =   202 bits (514),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 122/162 (75%), Gaps = 17/162 (10%)
 Frame = +1

Query  109  RFWEPPV-------MDGGPPMLVPPSRPVVSQNV-----AEVKHSSEAVEKRNEETMKPK  252
            RFWE P         + GPP LVPPSRPVV QN      +E     EA+E RN ET KPK
Sbjct  424  RFWEIPADPTPIHEPNFGPPALVPPSRPVVFQNPGLEAPSEQPQGIEALE-RNGETPKPK  482

Query  253  LKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLN  420
            LKPLHWDKVRASSDR MVWD +KSSSFQLNEEMIETLFMVN+++    D ++R ++P  N
Sbjct  483  LKPLHWDKVRASSDRAMVWDQMKSSSFQLNEEMIETLFMVNASNLTPKDNLRRQILPTPN  542

Query  421  QENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            QENRVLDPKKSQNIAILLRALNVT +EVCEAL+EG  D+LGT
Sbjct  543  QENRVLDPKKSQNIAILLRALNVTIDEVCEALLEGNTDTLGT  584



>gb|KJB27765.1| hypothetical protein B456_005G008700 [Gossypium raimondii]
Length=932

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 116/154 (75%), Gaps = 15/154 (10%)
 Frame = +1

Query  109  RFWEPPVMD----GGPPMLVPPSRPVVSQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDK  276
            RFWE P       GGPP+LV PSRPVV QN       +E++EK   ET KPKLKPLHWDK
Sbjct  441  RFWEVPAAKNPEPGGPPVLVAPSRPVVLQN-------NESIEKTTAETPKPKLKPLHWDK  493

Query  277  VRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVK----RPLMPLLNQENRVLDP  444
            VRASSDR MVWD +K+SSFQLNEEMIETLF  N+ +   K    R  +P +NQENRVLDP
Sbjct  494  VRASSDRAMVWDQIKASSFQLNEEMIETLFTANNLNSATKENGRRQSLPSVNQENRVLDP  553

Query  445  KKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            KKSQNIAILLRALNVT EEVCEAL+EG +D+LGT
Sbjct  554  KKSQNIAILLRALNVTIEEVCEALMEGNSDTLGT  587



>ref|XP_009366228.1| PREDICTED: formin-like protein 2 [Pyrus x bretschneideri]
Length=910

 Score =   199 bits (507),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 120/158 (76%), Gaps = 12/158 (8%)
 Frame = +1

Query  109  RFWEPPVM---DGGPPMLVPPSRPVVSQNVA-----EVKHSSEAVEKRNEETMKPKLKPL  264
            RFWE PV    + GPP+L+ PSRP V Q  A     E   S+E VEK  E   KPKLKPL
Sbjct  405  RFWEAPVGRTPNTGPPVLITPSRPAVVQTSAPILAGESSESNEMVEKNEETPTKPKLKPL  464

Query  265  HWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSN----SDGVKRPLMPLLNQENR  432
            HWDKVRASSD  MVWD LKSSSFQLNEEMIETLF+VN++    +D V+R ++P ++QENR
Sbjct  465  HWDKVRASSDHAMVWDRLKSSSFQLNEEMIETLFVVNNSGLAPNDNVRRQILPSVDQENR  524

Query  433  VLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            VLDPKKSQNIAILLRALNVT +EVCEAL+EG +D LGT
Sbjct  525  VLDPKKSQNIAILLRALNVTLDEVCEALLEGNSDGLGT  562



>ref|XP_009358391.1| PREDICTED: formin-like protein 2 [Pyrus x bretschneideri]
Length=910

 Score =   199 bits (506),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 117/158 (74%), Gaps = 12/158 (8%)
 Frame = +1

Query  109  RFWEPPV---MDGGPPMLVPPSRPVVSQN-----VAEVKHSSEAVEKRNEETMKPKLKPL  264
            RFWE P     + GPP+L+ PSR  V QN       E   S+E VEK  E   KPKLKPL
Sbjct  403  RFWEAPAGPSHNTGPPVLITPSRQAVPQNSGPILAGESSESNEMVEKNEETPTKPKLKPL  462

Query  265  HWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLNQENR  432
            HWDKVRASSDR MVWDHLKSSSFQLNEEMIETLFMVN+++    D V+R  +  +NQEN 
Sbjct  463  HWDKVRASSDRAMVWDHLKSSSFQLNEEMIETLFMVNNSTLTPNDNVRRQTLSSVNQENC  522

Query  433  VLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            VLDPKKSQNIAILLRALNVT +EVCEAL+EG +D LGT
Sbjct  523  VLDPKKSQNIAILLRALNVTIDEVCEALLEGNSDGLGT  560



>gb|KHG03146.1| Formin-like protein 1 [Gossypium arboreum]
Length=932

 Score =   199 bits (506),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 116/154 (75%), Gaps = 15/154 (10%)
 Frame = +1

Query  109  RFWEPPVMD----GGPPMLVPPSRPVVSQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDK  276
            RFWE P       GGPP+LV PSRPVV QN       +E++EK   ET KPKLKPLHWDK
Sbjct  441  RFWEVPAAKNPEPGGPPVLVAPSRPVVLQN-------NESIEKTTAETPKPKLKPLHWDK  493

Query  277  VRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVK----RPLMPLLNQENRVLDP  444
            VRASSDR MVWD +K+SSFQLNEEMIETLF  N+ +   K    R  +P +NQENRVLDP
Sbjct  494  VRASSDRAMVWDQIKASSFQLNEEMIETLFTANNLNSATKENGRRQSLPSVNQENRVLDP  553

Query  445  KKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            KKSQNIAILLRALNVT EEVCEAL+EG +D+LGT
Sbjct  554  KKSQNIAILLRALNVTIEEVCEALMEGNSDTLGT  587



>ref|XP_011001822.1| PREDICTED: formin-like protein 2 [Populus euphratica]
Length=970

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 123/166 (74%), Gaps = 20/166 (12%)
 Frame = +1

Query  109  RFWEPP----------VMDGGPPMLVPPSRPVVSQN-----VAEVKHSSEAVEKRNEETM  243
            RFWE P          +   GPP+LV P+R V+ QN     +A  +  S+   +RNEE+M
Sbjct  458  RFWEMPMGVRATREMNLGSSGPPVLVTPTRSVLVQNHAMPVLANEQMQSKGSVERNEESM  517

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVK-----RPLM  408
            KPKLKPLHWDKVRASSDR MVWD +KSSSFQLNEEMIETLFMVN+++  VK     R  +
Sbjct  518  KPKLKPLHWDKVRASSDRAMVWDQIKSSSFQLNEEMIETLFMVNNSNFNVKDHNGRRLSL  577

Query  409  PLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            PLLNQEN VLDPKKSQNIAILLRALNVT EEVCEAL+EG +D+LGT
Sbjct  578  PLLNQENTVLDPKKSQNIAILLRALNVTIEEVCEALLEGNSDTLGT  623



>ref|XP_010251389.1| PREDICTED: formin-like protein 1 [Nelumbo nucifera]
Length=964

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 124/162 (77%), Gaps = 17/162 (10%)
 Frame = +1

Query  109  RFWE-----PPVMD--GGPPMLVPPSRPVVSQNV-----AEVKHSSEAVEKRNEETMKPK  252
            RFWE     PP+ +    PP L+ PSRPVV QN      + +  +S  +E R+EET KPK
Sbjct  456  RFWEAPTRPPPIHEPLSRPPELITPSRPVVFQNSQALSPSGLTQNSHNLE-RSEETPKPK  514

Query  253  LKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLN  420
            LKPLHWDKVRASSDR MVWD LKSSSFQLNEEMIETLF+VN++S    +  +RP++P  N
Sbjct  515  LKPLHWDKVRASSDRAMVWDQLKSSSFQLNEEMIETLFVVNASSLNPKEMTRRPVLPSSN  574

Query  421  QENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            QENRVLDPKKSQNIAILLRALNVT EEVCEAL+EG AD+LGT
Sbjct  575  QENRVLDPKKSQNIAILLRALNVTIEEVCEALLEGNADTLGT  616



>ref|XP_002310397.1| formin homology 2 domain-containing family protein [Populus trichocarpa]
 gb|EEE90847.1| formin homology 2 domain-containing family protein [Populus trichocarpa]
Length=948

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 124/167 (74%), Gaps = 22/167 (13%)
 Frame = +1

Query  109  RFWEPPVMDG----------GPPMLVPPSRPVVSQNVA------EVKHSSEAVEKRNEET  240
            RFWE PV             GPP+LV P++PV+ Q+ A      E   S+ +VE RNEE+
Sbjct  431  RFWEMPVGFRMAQEVNLGIPGPPVLVMPAKPVLVQDHAMPVMANEQMQSNGSVE-RNEES  489

Query  241  MKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVK-----RPL  405
            MKPKLKPLHWDKVRASSDR MVWD +KSSSFQLNEEMIETLF+VN+ +  VK     R  
Sbjct  490  MKPKLKPLHWDKVRASSDRAMVWDQIKSSSFQLNEEMIETLFVVNNPNFNVKDHNGRRQS  549

Query  406  MPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            +PLLNQENRVLDPKKSQNIAILLRALNVT EEVC+AL+EG  D+LGT
Sbjct  550  LPLLNQENRVLDPKKSQNIAILLRALNVTIEEVCDALLEGNLDTLGT  596



>ref|XP_011085043.1| PREDICTED: LOW QUALITY PROTEIN: formin-like protein 2 [Sesamum 
indicum]
Length=916

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 131/169 (78%), Gaps = 10/169 (6%)
 Frame = +1

Query  58   YDGSLKAppppppppppRFWE--PPVMDGGPPMLVPPSRPVVSQNVAEVKHSSEAVEKRN  231
            + G+ KAPPPPPPPPP RFWE  PP    GPP LV PSR VV Q++ E K         +
Sbjct  417  FSGTGKAPPPPPPPPPARFWEGAPP---SGPPELVAPSRKVV-QSLNEEKGGLGRSGSNS  472

Query  232  EETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKR  399
            EE MKPKLKPLHWDKVRASSDR MVWD LKSSSFQLNEEMIETLF V++++    DG +R
Sbjct  473  EEMMKPKLKPLHWDKVRASSDRAMVWDQLKSSSFQLNEEMIETLFTVSASTVNAKDGGRR  532

Query  400  PLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
             ++P +NQ+N VLDPKKSQNIAILLRALNVT +EVCEALVEG AD+LGT
Sbjct  533  HIIPDMNQQNLVLDPKKSQNIAILLRALNVTVDEVCEALVEGNADTLGT  581



>ref|XP_011047650.1| PREDICTED: formin-like protein 1 [Populus euphratica]
Length=948

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 121/166 (73%), Gaps = 20/166 (12%)
 Frame = +1

Query  109  RFWEPPVMDG----------GPPMLVPPSRPVVSQN-----VAEVKHSSEAVEKRNEETM  243
            RFWE PV             GPP+LV P +PV+ Q+     +A  +  S    +RNEE+M
Sbjct  431  RFWEMPVGFRMAQEVNLGIPGPPVLVMPEKPVLVQDHAMPVMANDQMQSNGSVERNEESM  490

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVK-----RPLM  408
            KPKLKPLHWDKVRASSDR MVWD +KSSSFQLNEEMIETLFMVN+ +  VK     R  +
Sbjct  491  KPKLKPLHWDKVRASSDRAMVWDQIKSSSFQLNEEMIETLFMVNNPNFNVKDHNGRRQSL  550

Query  409  PLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            PLLNQENRVLDPKKSQNIAILLRALNVT EEVC+AL+EG  D+LGT
Sbjct  551  PLLNQENRVLDPKKSQNIAILLRALNVTIEEVCDALLEGNLDTLGT  596



>ref|XP_009759791.1| PREDICTED: formin-like protein 1 [Nicotiana sylvestris]
Length=814

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 142/188 (76%), Gaps = 10/188 (5%)
 Frame = +1

Query  1    DFLAQISESPVSQLADSGRYDGSLKAppppppppppRFWEPPVMDGGPPMLVPP---SRP  171
            +F  QI ES + + ++SGRY  S+K PPPPP PP PRF E   +    P++V     S P
Sbjct  326  NFSVQIPESSMRKFSNSGRY-VSIKLPPPPPLPPRPRFCEGSTV--TEPLVVENCERSVP  382

Query  172  VVSQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEM  351
            V+ +       SSEAVE+RNEE MKPKLKPLHWDKVRASSDR MVWD L SS+FQLNEEM
Sbjct  383  VLIKKATGNSESSEAVERRNEENMKPKLKPLHWDKVRASSDRAMVWDQLNSSTFQLNEEM  442

Query  352  IETLFMVNSNS----DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALV  519
            I+TLF VNS++    D V+RP++P++NQEN+VLD KKSQNIAILLRA+ +T++EVCEAL+
Sbjct  443  IQTLFTVNSSNLNSKDVVRRPMIPVMNQENQVLDLKKSQNIAILLRAIQITSDEVCEALL  502

Query  520  EGTADSLG  543
            EG AD+LG
Sbjct  503  EGDADTLG  510



>gb|KJB71603.1| hypothetical protein B456_011G132600 [Gossypium raimondii]
Length=918

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 121/157 (77%), Gaps = 16/157 (10%)
 Frame = +1

Query  109  RFWEPPVM--------DGGPPMLVPPSRPVVSQNVAEVKHSSEAVEKRNEETMKPKLKPL  264
            RFWE PV           GPP+LV PSRP+V   V     ++E +  R+EET+KPKLKPL
Sbjct  422  RFWEVPVAVNSVSETKSRGPPVLVAPSRPMV---VNGQSKNNEGL-GRSEETLKPKLKPL  477

Query  265  HWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLNQENR  432
            HWDKVRASSDR MVWD +K+SSFQLNEEMIETLFMVN+++    D  ++P++  +NQENR
Sbjct  478  HWDKVRASSDRAMVWDQIKASSFQLNEEMIETLFMVNNSNLATKDNARKPILAAVNQENR  537

Query  433  VLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
            +LDPKKSQNIAILLRALNVT +EVCEAL+EG +D+LG
Sbjct  538  ILDPKKSQNIAILLRALNVTIDEVCEALMEGNSDTLG  574



>gb|KDO43529.1| hypothetical protein CISIN_1g001663mg [Citrus sinensis]
Length=1035

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 115/160 (72%), Gaps = 16/160 (10%)
 Frame = +1

Query  115  WEPPVMD-------GGPPMLVPPSRPVVSQNVAEVKH-----SSEAVEKRNEETMKPKLK  258
            WE PV+          PP L+PPSRP V QN  +V       SS+  E   EE +KPKLK
Sbjct  535  WELPVVSTPAGQAVSQPPALIPPSRPFVMQNTTKVSPVELPPSSKTEESVEEEALKPKLK  594

Query  259  PLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSD----GVKRPLMPLLNQE  426
            PLHWDKVRASSDR MVWDHL+SSSF+LNEEMIETLF+VN+ S        R ++P  N E
Sbjct  595  PLHWDKVRASSDREMVWDHLRSSSFKLNEEMIETLFIVNTPSSKPSQTTPRTVLPTPNSE  654

Query  427  NRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            NRVLDPKKSQNIAILLRALNVT EEVCEAL+EG AD+LGT
Sbjct  655  NRVLDPKKSQNIAILLRALNVTIEEVCEALLEGNADTLGT  694



>ref|XP_006447920.1| hypothetical protein CICLE_v10014120mg [Citrus clementina]
 gb|ESR61160.1| hypothetical protein CICLE_v10014120mg [Citrus clementina]
Length=1033

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 115/160 (72%), Gaps = 16/160 (10%)
 Frame = +1

Query  115  WEPPVMD-------GGPPMLVPPSRPVVSQNVAEVKH-----SSEAVEKRNEETMKPKLK  258
            WE PV+          PP L+PPSRP V QN  +V       SS+  E   EE +KPKLK
Sbjct  533  WELPVVSTPAGQAVSQPPALIPPSRPFVMQNTTKVSPVELPPSSKTEESVEEEALKPKLK  592

Query  259  PLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSD----GVKRPLMPLLNQE  426
            PLHWDKVRASSDR MVWDHL+SSSF+LNEEMIETLF+VN+ S        R ++P  N E
Sbjct  593  PLHWDKVRASSDREMVWDHLRSSSFKLNEEMIETLFIVNTPSSKPSQTTPRTVLPTPNSE  652

Query  427  NRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            NRVLDPKKSQNIAILLRALNVT EEVCEAL+EG AD+LGT
Sbjct  653  NRVLDPKKSQNIAILLRALNVTIEEVCEALLEGNADTLGT  692



>ref|XP_006469362.1| PREDICTED: formin-like protein 1-like [Citrus sinensis]
Length=1034

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 115/160 (72%), Gaps = 16/160 (10%)
 Frame = +1

Query  115  WEPPVMD-------GGPPMLVPPSRPVVSQNVAEVKH-----SSEAVEKRNEETMKPKLK  258
            WE PV+          PP L+PPSRP V QN  +V       SS+  E   EE +KPKLK
Sbjct  534  WELPVVSTPAGQAVSQPPALIPPSRPFVMQNTTKVSPVELPPSSKTEESVEEEALKPKLK  593

Query  259  PLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSD----GVKRPLMPLLNQE  426
            PLHWDKVRASSDR MVWDHL+SSSF+LNEEMIETLF+VN+ S        R ++P  N E
Sbjct  594  PLHWDKVRASSDREMVWDHLRSSSFKLNEEMIETLFIVNTPSSKPSQTTPRTVLPTPNSE  653

Query  427  NRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            NRVLDPKKSQNIAILLRALNVT EEVCEAL+EG AD+LGT
Sbjct  654  NRVLDPKKSQNIAILLRALNVTIEEVCEALLEGNADTLGT  693



>gb|KDP35139.1| hypothetical protein JCGZ_10673 [Jatropha curcas]
Length=940

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 120/164 (73%), Gaps = 19/164 (12%)
 Frame = +1

Query  112  FWEPP----------VMDGGPPMLVPPSRPVVSQN----VAEVKHSSEAVEKRNEETMKP  249
            FWE P          +   GPP+LV PSR V+ Q+    + + +  + A  +R+EE +KP
Sbjct  432  FWEIPAEARVGGEVNLASSGPPVLVTPSRHVLIQSAMPILGDEQLQTNASVERSEENLKP  491

Query  250  KLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVK-----RPLMPL  414
            KLKPLHWDKVRASSDR MVWD +KSSSFQLNEEMIETLFMVN+++  VK     R  +PL
Sbjct  492  KLKPLHWDKVRASSDRAMVWDQIKSSSFQLNEEMIETLFMVNNSNLNVKDNNGRRQSLPL  551

Query  415  LNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
             NQENRVLDPKKSQN+AILLRALNVT +EVCE L+EG +D+LGT
Sbjct  552  QNQENRVLDPKKSQNVAILLRALNVTIDEVCEGLLEGNSDTLGT  595



>ref|XP_002323708.2| hypothetical protein POPTR_0017s04260g [Populus trichocarpa]
 gb|EEF03841.2| hypothetical protein POPTR_0017s04260g [Populus trichocarpa]
Length=982

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 117/163 (72%), Gaps = 22/163 (13%)
 Frame = +1

Query  109  RFWEPP----------VMDGGPPMLVPPSRPVVSQNVA------EVKHSSEAVEKRNEET  240
            RFWE P          +   GPP+LV P+R V+ QN A      E   S  +VE RNEE+
Sbjct  452  RFWEMPMGVRVTREMNLGSSGPPVLVTPTRSVLVQNHAMPVFANEQMQSKGSVE-RNEES  510

Query  241  MKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVK-----RPL  405
            MKPKLKPLHWDKVRASSDR MVWD +KSSSFQLNEEMIETLF VN+++  VK     R  
Sbjct  511  MKPKLKPLHWDKVRASSDRAMVWDQIKSSSFQLNEEMIETLFTVNNSNFNVKDHNGRRLS  570

Query  406  MPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTAD  534
            +PLLNQEN VLDPKKSQNIAILLRALNVT EEVCEAL+E  +D
Sbjct  571  LPLLNQENTVLDPKKSQNIAILLRALNVTIEEVCEALLEANSD  613



>ref|XP_010069230.1| PREDICTED: formin-like protein 1 [Eucalyptus grandis]
 ref|XP_010069231.1| PREDICTED: formin-like protein 1 [Eucalyptus grandis]
 ref|XP_010069232.1| PREDICTED: formin-like protein 1 [Eucalyptus grandis]
 ref|XP_010069233.1| PREDICTED: formin-like protein 1 [Eucalyptus grandis]
 gb|KCW57509.1| hypothetical protein EUGRSUZ_H00282 [Eucalyptus grandis]
Length=968

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 118/155 (76%), Gaps = 13/155 (8%)
 Frame = +1

Query  109  RFWEPPV-----MDGGPPMLVPPSRPVVSQNVA--EVKHSSEAVE--KRNEETMKPKLKP  261
            RFWE PV     + G PP+LV P RP V QN+A  E++  S  VE  + ++ET +PKLKP
Sbjct  462  RFWEKPVPIHDPITGRPPVLVAPLRPPVFQNLANDEMQSGSCNVEATRPSDETPRPKLKP  521

Query  262  LHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSN----SDGVKRPLMPLLNQEN  429
            LHWDKVRASSDR MVWD L+SSSFQL+EEMIETLFMVNS+     D + R ++  LN EN
Sbjct  522  LHWDKVRASSDRAMVWDQLRSSSFQLDEEMIETLFMVNSSKLGPKDSIPRSVLTSLNPEN  581

Query  430  RVLDPKKSQNIAILLRALNVTAEEVCEALVEGTAD  534
            RVLDPKKSQNIAILLRALNVT EEVCEAL+EG AD
Sbjct  582  RVLDPKKSQNIAILLRALNVTIEEVCEALLEGNAD  616



>ref|XP_009627839.1| PREDICTED: formin-like protein 1 [Nicotiana tomentosiformis]
Length=821

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 141/188 (75%), Gaps = 10/188 (5%)
 Frame = +1

Query  1    DFLAQISESPVSQLADSGRYDGSLKAppppppppppRFWEPPVMDGGPPMLVPP---SRP  171
            +F  QI ES + + ++SG Y  S+K PPPPP PP PRFW+   +    P++V     S P
Sbjct  333  NFSVQIPESSMRKFSNSGSY-ISIKLPPPPPLPPRPRFWDGSTV--AEPLVVKNFDRSVP  389

Query  172  VVSQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEM  351
            V+ +       SSEAVE+ NEE+MKP+LKPLHWDKVRASSDR MVWD LKSS+FQLNE+M
Sbjct  390  VLMKKDNGNSESSEAVERSNEESMKPRLKPLHWDKVRASSDRAMVWDQLKSSTFQLNEKM  449

Query  352  IETLFMVNSNS----DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALV  519
            IETLF V+S++    D V+RP++P++NQEN+VLD  KS+NIAILLRAL +T++EVCEAL+
Sbjct  450  IETLFTVDSSNLNSKDVVRRPMIPVMNQENQVLDLNKSRNIAILLRALQITSDEVCEALL  509

Query  520  EGTADSLG  543
            EG  D+LG
Sbjct  510  EGNTDTLG  517



>ref|XP_010242489.1| PREDICTED: formin-like protein 1 [Nelumbo nucifera]
Length=1027

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 115/162 (71%), Gaps = 17/162 (10%)
 Frame = +1

Query  109  RFWEPPVMD-------GGPPMLVPPSRPVVSQNVAEVK-----HSSEAVEKRNEETMKPK  252
            RFW  P+           PP LV P   VV QN   +       +SE  E RNEET KPK
Sbjct  519  RFWNTPIHRPPAREPVTRPPKLVNPVASVVCQNSPGISPNGLPQNSETNE-RNEETPKPK  577

Query  253  LKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVN-SNS---DGVKRPLMPLLN  420
            LKPLHWDKVRASSDR MVWD LKSSSF+LNEEMIETLF+VN SNS   +  + P++P  N
Sbjct  578  LKPLHWDKVRASSDRAMVWDQLKSSSFKLNEEMIETLFVVNTSNSTPKEMTRHPILPSPN  637

Query  421  QENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            QENRVLDPKKSQNIAILLRALNVT EEVCEAL+EG  D+LGT
Sbjct  638  QENRVLDPKKSQNIAILLRALNVTVEEVCEALLEGNTDTLGT  679



>ref|XP_007049520.1| Formin isoform 1 [Theobroma cacao]
 gb|EOX93677.1| Formin isoform 1 [Theobroma cacao]
Length=1192

 Score =   184 bits (466),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 120/164 (73%), Gaps = 19/164 (12%)
 Frame = +1

Query  109  RFWEPPVMD-------GGPPMLVPPSRPVVSQNV-----AEVKHSSE--AVEKRNEETMK  246
            R WE PV           PP L+PPS P ++QN       E+  SSE  AVE+ +E + K
Sbjct  676  RLWEKPVSSVSFAQQISKPPTLMPPSMPFMTQNSIKISPVELPTSSEPEAVEEVDEAS-K  734

Query  247  PKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVK----RPLMPL  414
            PKLKPLHWDKVRASSDR MVWDHL+SSSF+LNEEMIETLF+VN+ +   K    R ++P 
Sbjct  735  PKLKPLHWDKVRASSDREMVWDHLRSSSFKLNEEMIETLFVVNTPNSKPKQTTPRSVLPS  794

Query  415  LNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
             NQENRVLDPKK+QNIAILLRALNVT EEVCEAL+EG AD+LGT
Sbjct  795  PNQENRVLDPKKAQNIAILLRALNVTVEEVCEALLEGNADTLGT  838



>ref|XP_010646093.1| PREDICTED: formin-like protein 1 [Vitis vinifera]
Length=869

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 111/144 (77%), Gaps = 9/144 (6%)
 Frame = +1

Query  142  PPMLVPPSRPVVS-QNVAEVK----HSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMV  306
            PP L  PSRP V  QN + +      SS   E++ EET KPKLKPLHWDKVRASSDR MV
Sbjct  384  PPALTTPSRPFVFFQNPSRLSPVALESSSKTEEKTEETPKPKLKPLHWDKVRASSDREMV  443

Query  307  WDHLKSSSFQLNEEMIETLFMVN-SNSDGV---KRPLMPLLNQENRVLDPKKSQNIAILL  474
            WD LKSSSF+L+EEMIETLF+VN SNSD     +R ++P  NQENRVLDPKKSQNIAILL
Sbjct  444  WDQLKSSSFKLDEEMIETLFVVNTSNSDSKDTNRRVVIPSPNQENRVLDPKKSQNIAILL  503

Query  475  RALNVTAEEVCEALVEGTADSLGT  546
            RALNVT EEVCEAL EG AD+LGT
Sbjct  504  RALNVTTEEVCEALFEGNADALGT  527



>gb|KJB82868.1| hypothetical protein B456_013G218400 [Gossypium raimondii]
Length=260

 Score =   171 bits (432),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 101/125 (81%), Gaps = 1/125 (1%)
 Frame = +1

Query  175  VSQNVAEVKHSSEAVEKRN-EETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEM  351
            +SQ     +  SEAVE+++ EE  KPKLKPLHWDKVRASSDR MVWDHL+SSSF+LNEEM
Sbjct  57   ISQVELPTRSESEAVEEKDAEEASKPKLKPLHWDKVRASSDREMVWDHLRSSSFKLNEEM  116

Query  352  IETLFMVNSNSDGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTA  531
            IETLF+  +      R ++P  NQ+NRVLDPKK+QNIAILLRA+NVT EEVCEAL+EG A
Sbjct  117  IETLFVAKTPKQATPRSVLPSPNQDNRVLDPKKAQNIAILLRAINVTVEEVCEALLEGNA  176

Query  532  DSLGT  546
            D+LGT
Sbjct  177  DTLGT  181



>ref|XP_004140451.1| PREDICTED: formin-like protein 2-like [Cucumis sativus]
 ref|XP_004160528.1| PREDICTED: formin-like protein 2-like [Cucumis sativus]
 gb|KGN50788.1| hypothetical protein Csa_5G262260 [Cucumis sativus]
Length=960

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 117/164 (71%), Gaps = 19/164 (12%)
 Frame = +1

Query  112  FWEPPVMDG--------GPPMLVPPSRPVVSQNVAEV---KHSSEAVE-KRNEETMKPKL  255
            FWE P            GPP+L  P+RP++SQN+A +   + S+  V+ +R EET+KPKL
Sbjct  448  FWEIPQSSSLLNKEPNLGPPVLTVPTRPILSQNIAHMSAGEQSNTIVDAERAEETLKPKL  507

Query  256  KPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVN-------SNSDGVKRPLMPL  414
            K LHWDKVR SSDR MVWD +KSSSFQLNEEMIE+LFMVN       S  +G     MPL
Sbjct  508  KALHWDKVRMSSDRAMVWDQIKSSSFQLNEEMIESLFMVNNHNSNIMSKENGSVHQNMPL  567

Query  415  LNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
             +QENRVLDPKKSQNIAILLRALNVT EEV EAL+EG +D+L T
Sbjct  568  GSQENRVLDPKKSQNIAILLRALNVTIEEVLEALLEGNSDALCT  611



>ref|XP_008460245.1| PREDICTED: formin-like protein 1 [Cucumis melo]
Length=956

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 114/164 (70%), Gaps = 19/164 (12%)
 Frame = +1

Query  112  FWEPPVMDG--------GPPMLVPPSRPVVSQNVAEVKHSSE----AVEKRNEETMKPKL  255
            FWE P            GPP+L  P+RP++SQN+  +    +       +R EET+KPKL
Sbjct  444  FWEIPQSSSLLNKDPNLGPPILTLPTRPILSQNIGHMSAGEQLNTIVDAERMEETLKPKL  503

Query  256  KPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS-------DGVKRPLMPL  414
            K LHWDKVR SSDR MVWD +KSSSFQLNEEMIE+LFMVN+N+       +G     MPL
Sbjct  504  KALHWDKVRTSSDRAMVWDQIKSSSFQLNEEMIESLFMVNNNNSNIMSKENGSVHQNMPL  563

Query  415  LNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
             +QENRVLDPKKSQNIAILLRALNVT EEV EAL+EG +D+L T
Sbjct  564  GSQENRVLDPKKSQNIAILLRALNVTIEEVFEALLEGNSDALCT  607



>ref|XP_011024723.1| PREDICTED: formin-like protein 1 [Populus euphratica]
Length=1098

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 111/163 (68%), Gaps = 18/163 (11%)
 Frame = +1

Query  109  RFWEPPVMDGG----------PPMLVPPSRPVVSQNVA-----EVKHSSEAVEKRNEETM  243
            R WE P +D            PP L+PPSRP V Q+       E+   S+ VE   +ET 
Sbjct  588  RQWEAPSVDASSTPTDQPISKPPALIPPSRPFVLQSTTNVSPIELPACSKTVEDA-DETP  646

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVKRP--LMPLL  417
            KPKLKPLHWDKVRASSDR MVWDHLKSSSFQLNEEMIETLF+VN        P  + P  
Sbjct  647  KPKLKPLHWDKVRASSDREMVWDHLKSSSFQLNEEMIETLFVVNKPKPKATTPHSVSPTT  706

Query  418  NQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            ++ENR LDPKK+QNIAILLRALNVT EEVCE L+EG  D+LGT
Sbjct  707  SRENRALDPKKAQNIAILLRALNVTIEEVCEGLLEGNVDTLGT  749



>emb|CBI24709.3| unnamed protein product [Vitis vinifera]
Length=651

 Score =   176 bits (446),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 100/116 (86%), Gaps = 5/116 (4%)
 Frame = +1

Query  211  EAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS--  384
            EA+E RN ET KPKLKPLHWDKVRASSDR MVWD +KSSSFQLNEEMIETLFMVN+++  
Sbjct  383  EALE-RNGETPKPKLKPLHWDKVRASSDRAMVWDQMKSSSFQLNEEMIETLFMVNASNLT  441

Query  385  --DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
              D ++R ++P  NQENRVLDPKKSQNIAILLRALNVT +EVCEAL+EG  D+LGT
Sbjct  442  PKDNLRRQILPTPNQENRVLDPKKSQNIAILLRALNVTIDEVCEALLEGNTDTLGT  497



>ref|XP_007135217.1| hypothetical protein PHAVU_010G110900g [Phaseolus vulgaris]
 gb|ESW07211.1| hypothetical protein PHAVU_010G110900g [Phaseolus vulgaris]
Length=859

 Score =   176 bits (447),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 111/146 (76%), Gaps = 11/146 (8%)
 Frame = +1

Query  142  PPMLVPPSRPVVSQN----VAEVK---HSSEAVEKRNEETMKPKLKPLHWDKVRASSDRV  300
            PP L PPSRP V Q     V+ V+    SS   E+ +EET KPKLKPLHWDKVRASSDR 
Sbjct  371  PPALTPPSRPFVLQTPNTMVSPVELPPGSSLNFEESSEETSKPKLKPLHWDKVRASSDRE  430

Query  301  MVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLNQENRVLDPKKSQNIAI  468
            MVWD L+SSSF+LNEEMIETLF+VN+ +    D   RP++   NQE+RVLDPKKSQNIAI
Sbjct  431  MVWDQLRSSSFKLNEEMIETLFVVNTPNPKPKDTAPRPVLSSHNQEDRVLDPKKSQNIAI  490

Query  469  LLRALNVTAEEVCEALVEGTADSLGT  546
            LLRALNVT EEVCE+L+EG  D+LGT
Sbjct  491  LLRALNVTVEEVCESLLEGITDTLGT  516



>ref|XP_006442143.1| hypothetical protein CICLE_v10018774mg [Citrus clementina]
 gb|ESR55383.1| hypothetical protein CICLE_v10018774mg [Citrus clementina]
Length=909

 Score =   177 bits (448),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 116/159 (73%), Gaps = 15/159 (9%)
 Frame = +1

Query  109  RFWEPPVM---DGGPPMLVPPS--RPVVSQNVA-----EVKHSSEAVEKRNEETMKPKLK  258
            RFWE P+      G P+LV PS  RPV  +N+      E    +E VEK +EET +PKLK
Sbjct  405  RFWEVPMAAPKSSGHPVLVAPSSLRPVGLKNLGLSLGNEELMKNENVEK-SEETPRPKLK  463

Query  259  PLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLNQE  426
            PLHWDKVRASSDR MVWD  KS SFQLNEEMIETLF VNS++    D  ++ ++ + NQE
Sbjct  464  PLHWDKVRASSDRAMVWDQFKSGSFQLNEEMIETLFTVNSSNLNSKDNGRKQVLSVPNQE  523

Query  427  NRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
            NRVLDPKKSQNIAILLRALNVT +EVCE L+EG +D+LG
Sbjct  524  NRVLDPKKSQNIAILLRALNVTVDEVCEGLLEGNSDTLG  562



>ref|XP_008338227.1| PREDICTED: formin-like protein 1 [Malus domestica]
Length=1127

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 114/160 (71%), Gaps = 14/160 (9%)
 Frame = +1

Query  109  RFWEPPV-------MDGGPPMLVPPSRPVVSQNVAEVKHS------SEAVEKRNEETMKP  249
            R WE P        +   PP L+PPSRP V QN  +V  S      S    +  EET KP
Sbjct  608  RLWETPSPRTPVGQVISRPPALIPPSRPFVIQNPGKVPVSPVELPPSSTPLEPIEETPKP  667

Query  250  KLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNS-NSDGVKRPLMPLLNQE  426
            KLKPLHWDKVRASSDR MVWD L+SSSF+LNEEMIETLF+V + N +  +  ++P LNQE
Sbjct  668  KLKPLHWDKVRASSDREMVWDQLRSSSFKLNEEMIETLFVVKTPNPNPKETAVLPSLNQE  727

Query  427  NRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            NRVLDPKKSQNIAI LRALNVT EEVCEAL+EG +D+LGT
Sbjct  728  NRVLDPKKSQNIAISLRALNVTIEEVCEALLEGNSDALGT  767



>ref|XP_002532454.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29940.1| conserved hypothetical protein [Ricinus communis]
Length=1140

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 114/163 (70%), Gaps = 17/163 (10%)
 Frame = +1

Query  109  RFWEPPVMD-------GGPPMLVPPSRPVVSQNVA------EVKHSSEAVEKRNEETMKP  249
            R WE PV           PP+L+PPSRP V Q  +      E+  SS+  E   E   KP
Sbjct  637  RHWESPVASTPTGQSISRPPVLIPPSRPFVLQGTSSMISPIELPPSSKPTEDFEETPSKP  696

Query  250  KLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNS----NSDGVKRPLMPLL  417
            KLKPLHWDKVRASSDR MVWD L+SSSF+LNEEM+E+LF+VN+     +    R ++P L
Sbjct  697  KLKPLHWDKVRASSDREMVWDQLRSSSFKLNEEMMESLFVVNTPYQKPNQTTPRSVVPSL  756

Query  418  NQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            NQ+NRVLDPKK+QNIAILLRALNVT EEVCEAL+EG  ++LGT
Sbjct  757  NQDNRVLDPKKAQNIAILLRALNVTIEEVCEALLEGNTETLGT  799



>ref|XP_007135216.1| hypothetical protein PHAVU_010G110900g [Phaseolus vulgaris]
 gb|ESW07210.1| hypothetical protein PHAVU_010G110900g [Phaseolus vulgaris]
Length=1047

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 111/146 (76%), Gaps = 11/146 (8%)
 Frame = +1

Query  142  PPMLVPPSRPVVSQN----VAEVK---HSSEAVEKRNEETMKPKLKPLHWDKVRASSDRV  300
            PP L PPSRP V Q     V+ V+    SS   E+ +EET KPKLKPLHWDKVRASSDR 
Sbjct  559  PPALTPPSRPFVLQTPNTMVSPVELPPGSSLNFEESSEETSKPKLKPLHWDKVRASSDRE  618

Query  301  MVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLNQENRVLDPKKSQNIAI  468
            MVWD L+SSSF+LNEEMIETLF+VN+ +    D   RP++   NQE+RVLDPKKSQNIAI
Sbjct  619  MVWDQLRSSSFKLNEEMIETLFVVNTPNPKPKDTAPRPVLSSHNQEDRVLDPKKSQNIAI  678

Query  469  LLRALNVTAEEVCEALVEGTADSLGT  546
            LLRALNVT EEVCE+L+EG  D+LGT
Sbjct  679  LLRALNVTVEEVCESLLEGITDTLGT  704



>gb|KDP45195.1| hypothetical protein JCGZ_15060 [Jatropha curcas]
Length=1110

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 113/143 (79%), Gaps = 10/143 (7%)
 Frame = +1

Query  145  PMLVPPSRPVVSQNVA-----EVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVW  309
            P+L+PPSRP V Q+ +     E+  +SE +E   +ET KPKLKPLHWDKVRASSDR MVW
Sbjct  628  PILIPPSRPFVLQSTSMVSPFELPPNSETIEDV-DETPKPKLKPLHWDKVRASSDREMVW  686

Query  310  DHLKSSSFQLNEEMIETLFMVNS----NSDGVKRPLMPLLNQENRVLDPKKSQNIAILLR  477
            D L+SSSF+LNEEM+E+LF+VN+    ++    RP++P  NQENRVLDPKK+QNIAILLR
Sbjct  687  DQLRSSSFKLNEEMMESLFVVNTAKPKSNQTTPRPVIPSPNQENRVLDPKKAQNIAILLR  746

Query  478  ALNVTAEEVCEALVEGTADSLGT  546
            ALNVT EEVCEAL+EG  D+LGT
Sbjct  747  ALNVTIEEVCEALLEGNTDTLGT  769



>ref|XP_011010334.1| PREDICTED: formin-like protein 1 [Populus euphratica]
Length=1105

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 114/165 (69%), Gaps = 22/165 (13%)
 Frame = +1

Query  109  RFWEPPVMDG----------GPPMLVPPSRPVVSQNVA-----EVKHSSEAVEKRNEETM  243
            R WE P ++            PP L+PPSRP V Q+ A     E+  SS+ +E   EET 
Sbjct  595  RQWESPSVNALSTPTDQPISKPPALIPPSRPFVLQSTANVSPIELPPSSKTMEDA-EETP  653

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVKRP----LMP  411
            KPKLKPLHWDKVRASSDR MVWDHL+SSSF+LNEEMIETLF+VN+       P    L P
Sbjct  654  KPKLKPLHWDKVRASSDREMVWDHLRSSSFKLNEEMIETLFVVNTPKPKPATPHSVSLTP  713

Query  412  LLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
              NQENRVLDPKK+QNIAILLRA NVT EEVCE L+EG  D+LGT
Sbjct  714  --NQENRVLDPKKAQNIAILLRAFNVTIEEVCEGLLEGNVDTLGT  756



>ref|XP_004517290.1| PREDICTED: formin-like protein 1-like, partial [Cicer arietinum]
Length=800

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 108/143 (76%), Gaps = 8/143 (6%)
 Frame = +1

Query  142  PPMLVPPSRPVVSQNVAEVKHSS----EAVEKRNEETMKPKLKPLHWDKVRASSDRVMVW  309
            PP L PPSRP V Q  +    S      + E+ +EE +KPKLKPLHWDKVRASSDR MVW
Sbjct  591  PPELKPPSRPFVLQTPSNAMVSPVELPPSFEENSEEALKPKLKPLHWDKVRASSDREMVW  650

Query  310  DHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLNQENRVLDPKKSQNIAILLR  477
            DHL+SSSF+LNEEMIETLF+VN+ +    D   R ++   NQE+RVLDPKKSQNIAILLR
Sbjct  651  DHLRSSSFKLNEEMIETLFVVNTPNPKPKDATPRSVLAPQNQEDRVLDPKKSQNIAILLR  710

Query  478  ALNVTAEEVCEALVEGTADSLGT  546
            A+NVT EEVCEAL+EG  D+LGT
Sbjct  711  AVNVTVEEVCEALLEGVTDTLGT  733



>ref|XP_010101357.1| Formin-like protein 1 [Morus notabilis]
 gb|EXB88304.1| Formin-like protein 1 [Morus notabilis]
Length=936

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 112/167 (67%), Gaps = 21/167 (13%)
 Frame = +1

Query  109  RFWEPPV-----MDGGPPMLVPP-----SRPVVSQNVAEVKHSSEAVEKRNEE----TMK  246
            RFWE           GPP+LV P     S   VS+   E +     V +RNEE      K
Sbjct  414  RFWELAADTRRPSSEGPPVLVTPWRAFQSSETVSKERQEEEGEEHNVLERNEEENPNKTK  473

Query  247  PKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSN-------SDGVKRPL  405
             KLKPLHWDKVRASSDR MVWDHLKSSSFQLNEEMIETLF  N+N        D  +R +
Sbjct  474  LKLKPLHWDKVRASSDRAMVWDHLKSSSFQLNEEMIETLFTANNNVNMVMMGKDNGRRQV  533

Query  406  MPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            MP L QENRVLDPKKSQNIAILLRALNVT +EVCEAL+EG +D+LGT
Sbjct  534  MPSLVQENRVLDPKKSQNIAILLRALNVTIDEVCEALLEGNSDALGT  580



>ref|XP_002320557.2| hypothetical protein POPTR_0014s17310g [Populus trichocarpa]
 gb|EEE98872.2| hypothetical protein POPTR_0014s17310g [Populus trichocarpa]
Length=1105

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 114/165 (69%), Gaps = 22/165 (13%)
 Frame = +1

Query  109  RFWEPPVMDG----------GPPMLVPPSRPVVSQNVA-----EVKHSSEAVEKRNEETM  243
            R WE P ++            PP L+PPSRP V Q+       E+  SS+ +E   EET 
Sbjct  595  RQWESPSVNALSTPTDQPISKPPALIPPSRPFVLQSTTNVSPIELPPSSKTMEDA-EETP  653

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVKRP----LMP  411
            KPKLKPLHWDKVRASSDR MVWDHL+SSSF+LNEEMIETLF+VN+       P    L P
Sbjct  654  KPKLKPLHWDKVRASSDREMVWDHLRSSSFKLNEEMIETLFVVNTPKPKPATPHSVSLTP  713

Query  412  LLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
              NQENRVLDPKK+QNIAILLRALNVT EEVCE L+EG  D+LGT
Sbjct  714  --NQENRVLDPKKAQNIAILLRALNVTIEEVCEGLLEGNVDALGT  756



>ref|XP_006492756.1| PREDICTED: formin-like protein 2-like isoform X1 [Citrus sinensis]
 ref|XP_006492757.1| PREDICTED: formin-like protein 2-like isoform X2 [Citrus sinensis]
Length=909

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 116/159 (73%), Gaps = 15/159 (9%)
 Frame = +1

Query  109  RFWEPPVM---DGGPPMLVPPS--RPVVSQNVA-----EVKHSSEAVEKRNEETMKPKLK  258
            RFWE P+      G P+LV PS  RPV  +N+      E    +E VEK +EET +PKLK
Sbjct  405  RFWEVPMAAPKSSGHPVLVAPSSLRPVGLKNLGPSLGNEELMKNENVEK-SEETPRPKLK  463

Query  259  PLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLNQE  426
            PLHWDKVRASSDR MVWD  KS SFQLNEEMIETLF VN+++    D  ++ ++ + NQE
Sbjct  464  PLHWDKVRASSDRAMVWDQFKSGSFQLNEEMIETLFTVNNSNLNSKDNGRKQVLSVPNQE  523

Query  427  NRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
            NRVLDPKKSQNIAILLRALNVT +EVCE L+EG +D+LG
Sbjct  524  NRVLDPKKSQNIAILLRALNVTVDEVCEGLLEGNSDTLG  562



>gb|KDO47987.1| hypothetical protein CISIN_1g002497mg [Citrus sinensis]
Length=915

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 116/159 (73%), Gaps = 15/159 (9%)
 Frame = +1

Query  109  RFWEPPVM---DGGPPMLVPPS--RPVVSQNVA-----EVKHSSEAVEKRNEETMKPKLK  258
            RFWE P+      G P+LV PS  RPV  +N+      E    +E VEK +EET +PKLK
Sbjct  411  RFWEVPMAAPKSSGHPVLVAPSSLRPVGLKNLGLSLGNEELMKNENVEK-SEETPRPKLK  469

Query  259  PLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLNQE  426
            PLHWDKVRASSDR MVWD  KS SFQLNEEMIETLF VN+++    D  ++ ++ + NQE
Sbjct  470  PLHWDKVRASSDRAMVWDQFKSGSFQLNEEMIETLFTVNNSNLNSKDNGRKQVLSVPNQE  529

Query  427  NRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
            NRVLDPKKSQNIAILLRALNVT +EVCE L+EG +D+LG
Sbjct  530  NRVLDPKKSQNIAILLRALNVTVDEVCEGLLEGNSDTLG  568



>ref|XP_010532932.1| PREDICTED: formin-like protein 1 [Tarenaya hassleriana]
Length=1086

 Score =   175 bits (444),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 110/146 (75%), Gaps = 11/146 (8%)
 Frame = +1

Query  142  PPMLVPPSRPVV--SQNVAEVKHS-----SEAVEKRNEETMKPKLKPLHWDKVRASSDRV  300
            PP+L PPSRP V  +QNV+    S     S +  +  EET KPKLK LHWDKVRASSDR 
Sbjct  603  PPLLTPPSRPFVIQNQNVSIASSSVLPPESSSASEPMEETSKPKLKALHWDKVRASSDRE  662

Query  301  MVWDHLKSSSFQLNEEMIETLFMVNS----NSDGVKRPLMPLLNQENRVLDPKKSQNIAI  468
            MVWDHL+SSSF+LNEEMIETLF+  +     +    R ++P  NQENRVLDPKK+QNIAI
Sbjct  663  MVWDHLRSSSFKLNEEMIETLFVAKTPDPKPNQITPRTVLPSPNQENRVLDPKKAQNIAI  722

Query  469  LLRALNVTAEEVCEALVEGTADSLGT  546
            LLRALNVT EEVCEALVEG+AD++GT
Sbjct  723  LLRALNVTIEEVCEALVEGSADTIGT  748



>ref|XP_004492891.1| PREDICTED: formin-like protein 1-like [Cicer arietinum]
Length=1035

 Score =   175 bits (443),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 110/158 (70%), Gaps = 18/158 (11%)
 Frame = +1

Query  109  RFWEPPVMDGG---------PPMLVPPSRPVVSQNVAEVKHSSEAVEKRNEETMKPKLKP  261
            R+WE P              PP LVPPSRP V QN      ++       EET+KPKLKP
Sbjct  540  RYWEMPAASAAVDKLPSILRPPELVPPSRPFVLQN-----QTTNECLGEIEETLKPKLKP  594

Query  262  LHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLNQEN  429
            LHWDKVR SSD  MVWD + SSSF+LNEE IETLF+VN+++    D   R ++P  NQE+
Sbjct  595  LHWDKVRTSSDHQMVWDQMNSSSFKLNEERIETLFVVNTSNQKPMDAAPRSVLPFPNQED  654

Query  430  RVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
            RVLDPKKSQNI+ILL+ALNVT EEVCEAL+EG++D+LG
Sbjct  655  RVLDPKKSQNISILLKALNVTVEEVCEALLEGSSDTLG  692



>ref|XP_009359000.1| PREDICTED: formin-like protein 1 [Pyrus x bretschneideri]
Length=885

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 112/163 (69%), Gaps = 17/163 (10%)
 Frame = +1

Query  109  RFWEPPV-------MDGGPPMLVPPSRPVVSQNVAEVKHSSEAVEKRN------EETMKP  249
            R WE P        +   PP L+PPSRP V QN  +V  S   +   +      EET KP
Sbjct  372  RLWEKPSPRTPVGQVISRPPALIPPSRPFVFQNPGKVSVSPVKLTPSSTPLEPIEETPKP  431

Query  250  KLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLL  417
            KLKPLHWDKVRASSDR MVWD  +SSSF+LNEEMIETLF+V + +    +   R ++P  
Sbjct  432  KLKPLHWDKVRASSDREMVWDQFRSSSFKLNEEMIETLFVVKTPNPNPRETTPRAVLPSP  491

Query  418  NQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            NQENRVLDPKKSQNIAI LRALNVT EEVCEAL+EG +D+LGT
Sbjct  492  NQENRVLDPKKSQNIAISLRALNVTIEEVCEALLEGNSDALGT  534



>gb|KCW57954.1| hypothetical protein EUGRSUZ_H006891 [Eucalyptus grandis]
Length=708

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 108/146 (74%), Gaps = 13/146 (9%)
 Frame = +1

Query  142  PPMLVPPSRPVVSQNVAEVK--------HSSEAVEKRNEETMKPKLKPLHWDKVRASSDR  297
            PP L+PPSRP V QN+ EV          ++E  EK ++ T K KLKPLHWDKVRASSDR
Sbjct  214  PPRLIPPSRPFVLQNLTEVSPVQLPPIVETAEKAEKMDD-TPKLKLKPLHWDKVRASSDR  272

Query  298  VMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVK----RPLMPLLNQENRVLDPKKSQNIA  465
             MVWD L+SSSF+L+EEMIETLF+VN+ +   K    R ++P  N ENRVLDPKKSQNIA
Sbjct  273  EMVWDQLRSSSFKLDEEMIETLFVVNAPNSKAKETTPRSVLPFPNLENRVLDPKKSQNIA  332

Query  466  ILLRALNVTAEEVCEALVEGTADSLG  543
            ILLRALNVT EEVCE L+EG  D+LG
Sbjct  333  ILLRALNVTIEEVCEGLLEGNVDALG  358



>ref|XP_003529900.1| PREDICTED: formin-like protein 1-like [Glycine max]
Length=1026

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 110/145 (76%), Gaps = 11/145 (8%)
 Frame = +1

Query  145  PMLVPPSRPVVSQN----VAEVK---HSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVM  303
            P L PPSRP V Q     V+ V+    SS+  E+ +EET KPKLKPLHWDKVRASSDR M
Sbjct  539  PPLTPPSRPFVLQTPNTKVSPVELPPASSQNFEEGSEETSKPKLKPLHWDKVRASSDREM  598

Query  304  VWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLNQENRVLDPKKSQNIAIL  471
            VWD L+SSSF+LNEEMIETLF+VN+ +    D   R ++   NQE+RVLDPKKSQNIAIL
Sbjct  599  VWDQLRSSSFKLNEEMIETLFVVNTPNPKPKDTTPRSVLAPQNQEDRVLDPKKSQNIAIL  658

Query  472  LRALNVTAEEVCEALVEGTADSLGT  546
            LRALNVT EEVCEAL+EG  D+LGT
Sbjct  659  LRALNVTIEEVCEALLEGITDTLGT  683



>ref|XP_007049521.1| Formin isoform 2 [Theobroma cacao]
 gb|EOX93678.1| Formin isoform 2 [Theobroma cacao]
Length=1189

 Score =   174 bits (440),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 118/164 (72%), Gaps = 22/164 (13%)
 Frame = +1

Query  109  RFWEPPVMD-------GGPPMLVPPSRPVVSQNV-----AEVKHSSE--AVEKRNEETMK  246
            R WE PV           PP L+PPS P ++QN       E+  SSE  AVE+ +E + K
Sbjct  676  RLWEKPVSSVSFAQQISKPPTLMPPSMPFMTQNSIKISPVELPTSSEPEAVEEVDEAS-K  734

Query  247  PKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVK----RPLMPL  414
            PKLKPLHWDKVRASSDR MVWDHL+SSSF+LNEEMIETLF+VN+ +   K    R ++P 
Sbjct  735  PKLKPLHWDKVRASSDREMVWDHLRSSSFKLNEEMIETLFVVNTPNSKPKQTTPRSVLPS  794

Query  415  LNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
             NQENRVLDPKK+QNIAILLRALNVT EEVCEAL+E   D+LGT
Sbjct  795  PNQENRVLDPKKAQNIAILLRALNVTVEEVCEALLE---DTLGT  835



>ref|XP_007201761.1| hypothetical protein PRUPE_ppa000494mg [Prunus persica]
 gb|EMJ02960.1| hypothetical protein PRUPE_ppa000494mg [Prunus persica]
Length=1129

 Score =   174 bits (440),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 114/164 (70%), Gaps = 19/164 (12%)
 Frame = +1

Query  109  RFWEPP--------VMDGGPPMLVPPSRPVVSQNVAEVKHSSEAVEKRN------EETMK  246
            R WE P        VM   PP LVPPSRP V QN A+V  S   +   +      EE  K
Sbjct  616  RLWETPSPKTPVGQVM-CKPPALVPPSRPFVFQNPAKVSVSPVELPPSSNPLEPIEENPK  674

Query  247  PKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVK----RPLMPL  414
            PKLKPLHWDKVRASSDR MVWD L+SSSF+LNEEMIETLF+V + +   K    R ++P 
Sbjct  675  PKLKPLHWDKVRASSDREMVWDQLRSSSFKLNEEMIETLFVVKTPNPNPKETTPRTVLPS  734

Query  415  LNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
             NQENRVLDPKKSQNIAI LRALNVT +EVCEAL+EG +D+LGT
Sbjct  735  PNQENRVLDPKKSQNIAISLRALNVTIDEVCEALLEGNSDALGT  778



>gb|KJB14806.1| hypothetical protein B456_002G144100 [Gossypium raimondii]
Length=203

 Score =   162 bits (409),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 98/125 (78%), Gaps = 1/125 (1%)
 Frame = +1

Query  175  VSQNVAEVKHSSEAVEKRN-EETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEM  351
            +SQ     +  SEAVE+++ EE  KPKLKPLHWDKVRASSDR MVWDHL+SSSF+LNEEM
Sbjct  8    ISQVELPTRSESEAVEEKDAEEASKPKLKPLHWDKVRASSDREMVWDHLRSSSFKLNEEM  67

Query  352  IETLFMVNSNSDGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTA  531
            IETLF+  +      R ++P  NQ+N +LDPKK+QNI ILLR +NVT EEVCEAL+EG A
Sbjct  68   IETLFVAKTPKQTTPRSVLPSPNQDNIMLDPKKAQNIVILLRVINVTVEEVCEALLEGNA  127

Query  532  DSLGT  546
            D+LGT
Sbjct  128  DTLGT  132



>ref|XP_008372668.1| PREDICTED: formin-like protein 1 [Malus domestica]
Length=1187

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 112/163 (69%), Gaps = 17/163 (10%)
 Frame = +1

Query  109  RFWEPPV-------MDGGPPMLVPPSRPVVSQNVAEVKHSSEAVEKRN------EETMKP  249
            R WE P        +   PP L+PPSRP V QN  +V  S   +   +      EET KP
Sbjct  674  RLWEKPSPRTPAGQVFSRPPALIPPSRPFVLQNPGKVSVSPVKLTPSSTPLEPIEETPKP  733

Query  250  KLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLL  417
            KLKPLHWDKVRASSDR MVWD  +SSSF+LNEEMIETLF+V + +    +   R ++P  
Sbjct  734  KLKPLHWDKVRASSDREMVWDQFRSSSFKLNEEMIETLFVVKTPNPNPRETTPRAVLPSP  793

Query  418  NQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            NQENRVLDPKKSQNIAI LRALNVT EEVCEAL+EG +D+LGT
Sbjct  794  NQENRVLDPKKSQNIAISLRALNVTIEEVCEALLEGNSDALGT  836



>ref|XP_008235862.1| PREDICTED: formin-like protein 1 [Prunus mume]
Length=1191

 Score =   173 bits (439),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 114/164 (70%), Gaps = 19/164 (12%)
 Frame = +1

Query  109  RFWEPP--------VMDGGPPMLVPPSRPVVSQNVAEVKHSSEAVEKRN------EETMK  246
            R WE P        VM   PP L+PPSRP V QN A+V  S   +   +      EE  K
Sbjct  680  RLWETPSPKTPVGQVM-CKPPALIPPSRPFVLQNPAKVSVSPVELPPSSNPLEPIEENPK  738

Query  247  PKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVK----RPLMPL  414
            PKLKPLHWDKVRASSDR MVWD L+SSSF+LNEEMIETLF+V + +   K    R ++P 
Sbjct  739  PKLKPLHWDKVRASSDREMVWDQLRSSSFKLNEEMIETLFVVKTPNPNPKETTPRTVLPS  798

Query  415  LNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
             NQENRVLDPKKSQNIAI LRALNVT +EVCEAL+EG +D+LGT
Sbjct  799  PNQENRVLDPKKSQNIAISLRALNVTIDEVCEALLEGNSDALGT  842



>ref|XP_010025994.1| PREDICTED: formin-like protein 1 [Eucalyptus grandis]
Length=871

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 108/146 (74%), Gaps = 13/146 (9%)
 Frame = +1

Query  142  PPMLVPPSRPVVSQNVAEVK--------HSSEAVEKRNEETMKPKLKPLHWDKVRASSDR  297
            PP L+PPSRP V QN+ EV          ++E  EK ++ T K KLKPLHWDKVRASSDR
Sbjct  377  PPRLIPPSRPFVLQNLTEVSPVQLPPIVETAEKAEKMDD-TPKLKLKPLHWDKVRASSDR  435

Query  298  VMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVK----RPLMPLLNQENRVLDPKKSQNIA  465
             MVWD L+SSSF+L+EEMIETLF+VN+ +   K    R ++P  N ENRVLDPKKSQNIA
Sbjct  436  EMVWDQLRSSSFKLDEEMIETLFVVNAPNSKAKETTPRSVLPFPNLENRVLDPKKSQNIA  495

Query  466  ILLRALNVTAEEVCEALVEGTADSLG  543
            ILLRALNVT EEVCE L+EG  D+LG
Sbjct  496  ILLRALNVTIEEVCEGLLEGNVDALG  521



>emb|CDP03997.1| unnamed protein product [Coffea canephora]
Length=1001

 Score =   172 bits (435),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 117/184 (64%), Gaps = 38/184 (21%)
 Frame = +1

Query  109  RFWEPPVMDGG--------PPMLVPPSRPVVSQN------------VAEVKHSSEAVEKR  228
            + WE P             PP ++ P RP+  QN            +  V+ + E +E +
Sbjct  476  KHWESPATPSAAAIRILTEPPAIITPLRPLSMQNPTVISPMQLPSNLEAVEKTEETIETQ  535

Query  229  --------------NEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLF  366
                          NEET KPKLKPLHWDKVRASSDR MVWD LKSSSF+L+EEMIETLF
Sbjct  536  GRPVTENVVKDEETNEETPKPKLKPLHWDKVRASSDREMVWDQLKSSSFKLDEEMIETLF  595

Query  367  MVNSNS----DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTAD  534
            +V + +    +  +RP++P  +QENRVLDPKKSQNIAILLRALNVT +EVCEAL+EG AD
Sbjct  596  VVKTPTQVPKETTRRPILPSPSQENRVLDPKKSQNIAILLRALNVTVDEVCEALIEGNAD  655

Query  535  SLGT  546
            +LGT
Sbjct  656  NLGT  659



>ref|XP_010927915.1| PREDICTED: formin-like protein 1 [Elaeis guineensis]
Length=929

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 112/157 (71%), Gaps = 15/157 (10%)
 Frame = +1

Query  112  FWEPPVMD---GGPPMLVPPSRPVVSQNV------AEVKHSSEAVEKRNEETMKPKLKPL  264
            +WE  V     G  P L PP RP   +N       AE   SS+ VEK +EET +PKLKPL
Sbjct  434  YWESRVRKPQAGQAPALTPP-RPTGMKNSSVSVFPAESPVSSDEVEK-SEETSRPKLKPL  491

Query  265  HWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLNQENR  432
            HWDKVRASSDR MVWD LK+SSFQ+NEEMIETLF+ N+ +    +  KR ++P  N ENR
Sbjct  492  HWDKVRASSDRAMVWDQLKTSSFQVNEEMIETLFVCNAANTAPKETNKRQVLPSPNLENR  551

Query  433  VLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
            VLDPKKSQNIAILLRALNVT EEVCEAL+EG  DSLG
Sbjct  552  VLDPKKSQNIAILLRALNVTKEEVCEALLEGNTDSLG  588



>ref|XP_008807250.1| PREDICTED: formin-like protein 1 [Phoenix dactylifera]
Length=937

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 113/155 (73%), Gaps = 15/155 (10%)
 Frame = +1

Query  112  FWEPPVMD---GGPPMLVPPSRPVVSQNV------AEVKHSSEAVEKRNEETMKPKLKPL  264
            +WE  V     G PP+L PP RP   +N       AE   +S+ VEK +EE  +PKLKPL
Sbjct  442  YWESRVRKPQAGQPPVLTPP-RPTGMKNSSAAVFPAESPVNSDPVEK-SEEAPRPKLKPL  499

Query  265  HWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLNQENR  432
            HWDKVRASSDR MVWD LK+SSFQ+NEEMIETLF+ N+++    +  KR ++P  NQENR
Sbjct  500  HWDKVRASSDRAMVWDQLKTSSFQVNEEMIETLFVCNASNTAPKETNKRQVLPSPNQENR  559

Query  433  VLDPKKSQNIAILLRALNVTAEEVCEALVEGTADS  537
            VLDPKKSQNIAILLRALNVT EEVCEAL+EG  DS
Sbjct  560  VLDPKKSQNIAILLRALNVTKEEVCEALLEGNTDS  594



>ref|XP_011458124.1| PREDICTED: formin-like protein 1 [Fragaria vesca subsp. vesca]
Length=1108

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 110/163 (67%), Gaps = 17/163 (10%)
 Frame = +1

Query  109  RFWEPPV--MDGG-----PPMLVPPSRPVVSQNVAEVKHS------SEAVEKRNEETMKP  249
            R WE P      G     PP L+PPSRP V Q    V  S      S A  +  EE  KP
Sbjct  573  RLWETPSPKTPAGQPISRPPALIPPSRPFVFQTPGGVSVSPVELPPSSAPLETIEEIPKP  632

Query  250  KLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVK----RPLMPLL  417
            KLKPLHWDKVRASSDR MVWD L+SSSF+LNEEMIETLF+VN+     K    R ++   
Sbjct  633  KLKPLHWDKVRASSDREMVWDQLRSSSFKLNEEMIETLFVVNTPKPNPKETTPRSVILSP  692

Query  418  NQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
             QENRVLDPKKSQNIAILLRALNVT EEVCEAL+EG AD+LGT
Sbjct  693  KQENRVLDPKKSQNIAILLRALNVTTEEVCEALLEGNADALGT  735



>ref|XP_002303028.2| hypothetical protein POPTR_0002s24130g [Populus trichocarpa]
 gb|EEE82301.2| hypothetical protein POPTR_0002s24130g [Populus trichocarpa]
Length=1110

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 113/175 (65%), Gaps = 30/175 (17%)
 Frame = +1

Query  109  RFWEPPVMDGG----------PPMLVPPSRPVVSQNVA-----EVKHSSEAVEKRNEETM  243
            R WE P +D            PP L+PPSRP V Q+       E+  SS+ VE   EET 
Sbjct  588  RQWEAPSVDASSTPTDQPISKPPALIPPSRPFVLQSTTNVSPIELPPSSKTVEDA-EETP  646

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVKRP--LMPLL  417
            KPKLKPLHWDKVRASSDR MVWDHLKSSSF+LNEEMIETLF+V +       P  + P  
Sbjct  647  KPKLKPLHWDKVRASSDREMVWDHLKSSSFKLNEEMIETLFVVKTPKPKATTPNSVSPTT  706

Query  418  NQENRVLDPKKSQNIAILLRALNVTAEEVCEALVE------------GTADSLGT  546
            ++ENRVLDPKK+QNIAILLRALNVT EEVCE L+E            G  D+LGT
Sbjct  707  SRENRVLDPKKAQNIAILLRALNVTIEEVCEGLLEATKVSPAGACYAGNVDTLGT  761



>ref|XP_008788161.1| PREDICTED: formin-like protein 1 [Phoenix dactylifera]
Length=947

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 114/155 (74%), Gaps = 15/155 (10%)
 Frame = +1

Query  112  FWEPPVMD---GGPPMLVPPSRPVVSQNVA------EVKHSSEAVEKRNEETMKPKLKPL  264
            +WE  V       PP+L PP RP  ++N +      E+  +S+AVEK +E+T +PKLKPL
Sbjct  447  YWESRVRKPQASQPPVLTPP-RPTGTKNSSAAIFPTELPVNSDAVEK-SEDTPRPKLKPL  504

Query  265  HWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVK----RPLMPLLNQENR  432
            HWDKVRASSDR MVWD LK+SSFQ+NEEMIETLF+ N+ +   K    R ++P  N++NR
Sbjct  505  HWDKVRASSDRAMVWDQLKTSSFQVNEEMIETLFVCNATNTAPKETNRRQVLPTPNEDNR  564

Query  433  VLDPKKSQNIAILLRALNVTAEEVCEALVEGTADS  537
            VLDPKKSQNIAILLRALNVT EEVCEAL+EG  DS
Sbjct  565  VLDPKKSQNIAILLRALNVTKEEVCEALLEGNTDS  599



>ref|XP_010908735.1| PREDICTED: formin-like protein 1 [Elaeis guineensis]
Length=957

 Score =   169 bits (429),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 114/155 (74%), Gaps = 15/155 (10%)
 Frame = +1

Query  112  FWEPPVMD---GGPPMLVPPSRPVVSQNV------AEVKHSSEAVEKRNEETMKPKLKPL  264
            +WE  +       PP+L PP RP   +N       AE   +S+AVEK +EET +PKLKPL
Sbjct  457  YWESRIRKPQASQPPVLTPP-RPTGMKNSSTAAFPAESPVNSDAVEK-SEETPRPKLKPL  514

Query  265  HWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLNQENR  432
            HWDKVRASSDR MVWD LKSSSFQ+NEEMIETLF+ N+ +    +  KR ++P+ N++NR
Sbjct  515  HWDKVRASSDREMVWDQLKSSSFQVNEEMIETLFVCNATNTAPKETNKRQVLPIPNEDNR  574

Query  433  VLDPKKSQNIAILLRALNVTAEEVCEALVEGTADS  537
            VLDPKKSQNIAILLRALNVT EEVCEAL+EG  DS
Sbjct  575  VLDPKKSQNIAILLRALNVTKEEVCEALLEGNIDS  609



>ref|XP_008800921.1| PREDICTED: LOW QUALITY PROTEIN: formin-like protein 1 [Phoenix 
dactylifera]
Length=920

 Score =   169 bits (427),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 110/157 (70%), Gaps = 13/157 (8%)
 Frame = +1

Query  112  FWE---PPVMDGGPPMLVPPSRPVVSQNVAEV-----KHSSEAVEKRNEETMKPKLKPLH  267
            +WE   P +    PP+LVPP    +  + A V       +S  +EK ++  ++PKLKPLH
Sbjct  423  YWEGQNPKMPACQPPVLVPPRTSGMRTSSATVFPAGPPENSNGMEK-SQRNIRPKLKPLH  481

Query  268  WDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVK----RPLMPLLNQENRV  435
            WDKVRASSDR MVWD LKSSSFQLNEEMIETLF+ N+N    K    R  +P +N ENR+
Sbjct  482  WDKVRASSDRAMVWDQLKSSSFQLNEEMIETLFVCNTNDGASKETSGRHFVPSVNPENRI  541

Query  436  LDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            LDPKKSQNIAILLRALNVT EEVCEAL+EG   SLG+
Sbjct  542  LDPKKSQNIAILLRALNVTKEEVCEALLEGNTVSLGS  578



>ref|XP_010466964.1| PREDICTED: formin-like protein 1 [Camelina sativa]
Length=1076

 Score =   169 bits (428),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 106/152 (70%), Gaps = 21/152 (14%)
 Frame = +1

Query  142  PPMLVPPSRPVVSQN-----------VAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRAS  288
            PP L PPS P V Q+           VAE   +SE  E    ET KPKLK LHWDKVRAS
Sbjct  581  PPSLTPPSHPFVIQSENHPVMNSPVEVAETVSASEPAE----ETPKPKLKALHWDKVRAS  636

Query  289  SDRVMVWDHLKSSSFQLNEEMIETLFMVNS------NSDGVKRPLMPLLNQENRVLDPKK  450
            SDR MVWDHL+SSSF+L+EEMIETLF+  +       S    R ++P  NQENRVLDPKK
Sbjct  637  SDREMVWDHLRSSSFKLDEEMIETLFVAKTLDNKPNQSQTTPRSVVPNPNQENRVLDPKK  696

Query  451  SQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            +QNIAILLRALNVT EEVCEAL+EG AD+LGT
Sbjct  697  AQNIAILLRALNVTIEEVCEALLEGNADTLGT  728



>ref|XP_006296866.1| hypothetical protein CARUB_v10012854mg, partial [Capsella rubella]
 gb|EOA29764.1| hypothetical protein CARUB_v10012854mg, partial [Capsella rubella]
Length=1127

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 108/149 (72%), Gaps = 15/149 (10%)
 Frame = +1

Query  142  PPMLVPPSRPVV--------SQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDR  297
            PP L+PPS P V        S +V EV  +  +V +  EET KPKLK LHWDKVRASSDR
Sbjct  634  PPSLMPPSHPFVIQSENLQVSSSVEEVPETV-SVSEPAEETPKPKLKALHWDKVRASSDR  692

Query  298  VMVWDHLKSSSFQLNEEMIETLFMVNS------NSDGVKRPLMPLLNQENRVLDPKKSQN  459
             MVWDHL+SSSF+L+EEMIETLF+  S       S    R ++P  NQENRVLDPKK+QN
Sbjct  693  EMVWDHLRSSSFKLDEEMIETLFVAKSLDNKPNQSQTTPRSVVPNPNQENRVLDPKKAQN  752

Query  460  IAILLRALNVTAEEVCEALVEGTADSLGT  546
            IAILLRALNVT EEVCEAL+EG AD+LGT
Sbjct  753  IAILLRALNVTIEEVCEALLEGNADTLGT  781



>ref|XP_004246983.1| PREDICTED: formin-like protein 1 [Solanum lycopersicum]
Length=909

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 106/138 (77%), Gaps = 4/138 (3%)
 Frame = +1

Query  145  PMLVPPSRPVVSQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKS  324
            PM +P ++  + +N   ++  S      NEET KPKLK LHWDKVRASSDR MVWD LKS
Sbjct  426  PMELPCNKQTIEKNEQSIEGLSSDSGGNNEETPKPKLKTLHWDKVRASSDREMVWDQLKS  485

Query  325  SSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVT  492
            SSF+L+EEMIE+LF+V + +    +  +RPL+P  +QENRVLDPKKSQNIAILLRALNVT
Sbjct  486  SSFKLDEEMIESLFIVKNPTLNPKEMTRRPLLPSQSQENRVLDPKKSQNIAILLRALNVT  545

Query  493  AEEVCEALVEGTADSLGT  546
             EEVCEAL+EG AD+LGT
Sbjct  546  VEEVCEALLEGNADALGT  563



>gb|KFK39846.1| hypothetical protein AALP_AA3G295700 [Arabis alpina]
Length=1046

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 107/147 (73%), Gaps = 12/147 (8%)
 Frame = +1

Query  142  PPMLVPPSRPVV--SQNVAEV--KHSSEAV--EKRNEETMKPKLKPLHWDKVRASSDRVM  303
            PP L PPS P V  S+N+A    K + E     +  EET KPKLK LHWDKVRASSDR M
Sbjct  556  PPSLTPPSHPFVIPSENLAVTSPKDTPEMFCDTEPAEETPKPKLKALHWDKVRASSDREM  615

Query  304  VWDHLKSSSFQLNEEMIETLFMVNS------NSDGVKRPLMPLLNQENRVLDPKKSQNIA  465
            VWDHL+SSSF+L+EEMIETLF+  S       S    R ++P  NQENRVLDPKK+QNIA
Sbjct  616  VWDHLRSSSFKLDEEMIETLFVAKSVDHKPNQSQTTPRCVLPSYNQENRVLDPKKAQNIA  675

Query  466  ILLRALNVTAEEVCEALVEGTADSLGT  546
            ILLRALNVT EEVCEAL+EG AD+LGT
Sbjct  676  ILLRALNVTIEEVCEALLEGNADTLGT  702



>ref|XP_010488652.1| PREDICTED: formin-like protein 1 [Camelina sativa]
Length=1064

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 105/151 (70%), Gaps = 20/151 (13%)
 Frame = +1

Query  142  PPMLVPPSRPVVSQN----------VAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASS  291
            PP L PPS P V Q+          VAE    SE  E    ET KPKLK LHWDKVRASS
Sbjct  571  PPSLTPPSHPFVIQSENHPVTSPVEVAETVSVSEPAE----ETPKPKLKALHWDKVRASS  626

Query  292  DRVMVWDHLKSSSFQLNEEMIETLFMVNS------NSDGVKRPLMPLLNQENRVLDPKKS  453
            DR MVWDHL+SSSF+L+EEMIETLF+  +       S    R ++P  NQENRVLDPKK+
Sbjct  627  DREMVWDHLRSSSFKLDEEMIETLFVAKTLDNKPNQSQTTPRSVVPNPNQENRVLDPKKA  686

Query  454  QNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            QNIAILLRALNVT EEVCEAL+EG AD+LGT
Sbjct  687  QNIAILLRALNVTIEEVCEALLEGNADTLGT  717



>gb|KEH18708.1| formin-like 2 domain protein [Medicago truncatula]
Length=1071

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 105/142 (74%), Gaps = 7/142 (5%)
 Frame = +1

Query  142  PPMLVPPSRPVVSQNVAEVKHSSEAVE---KRNEETMKPKLKPLHWDKVRASSDRVMVWD  312
            PP L PPSRP V Q  +    S   +    + NEE  KPKLKPLHWDKVRASSDR MVWD
Sbjct  587  PPELKPPSRPFVLQTPSNTLVSPVELPPSFEENEEVSKPKLKPLHWDKVRASSDREMVWD  646

Query  313  HLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLNQENRVLDPKKSQNIAILLRA  480
            HL+SSSF+LNEEMIETLF+VN+ +    D   R ++   + E+RVLDPKKSQNIAILLRA
Sbjct  647  HLRSSSFKLNEEMIETLFVVNTPNPKPKDATPRSVLTPPSHEDRVLDPKKSQNIAILLRA  706

Query  481  LNVTAEEVCEALVEGTADSLGT  546
            +NVT EEVCEAL+EG  D+LGT
Sbjct  707  VNVTVEEVCEALLEGVTDTLGT  728



>dbj|BAE98844.1| formin-like protein AHF1 [Arabidopsis thaliana]
Length=1047

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 107/152 (70%), Gaps = 21/152 (14%)
 Frame = +1

Query  142  PPMLVPPSRPVV--SQNVA---------EVKHSSEAVEKRNEETMKPKLKPLHWDKVRAS  288
            PP L PPS P V  S+N+          E   +SEA E    ET KPKLK LHWDKVRAS
Sbjct  550  PPSLTPPSHPFVIPSENLPVTSSPMETPETVCASEAAE----ETPKPKLKALHWDKVRAS  605

Query  289  SDRVMVWDHLKSSSFQLNEEMIETLFMVNS------NSDGVKRPLMPLLNQENRVLDPKK  450
            SDR MVWDHL+SSSF+L+EEMIETLF+  S       S    R ++P  NQENRVLDPKK
Sbjct  606  SDREMVWDHLRSSSFKLDEEMIETLFVAKSLNNKPNQSQTTPRCVLPSPNQENRVLDPKK  665

Query  451  SQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            +QNIAILLRALNVT EEVCEAL+EG AD+LGT
Sbjct  666  AQNIAILLRALNVTIEEVCEALLEGNADTLGT  697



>ref|XP_010672466.1| PREDICTED: formin-like protein 1 [Beta vulgaris subsp. vulgaris]
Length=788

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 96/128 (75%), Gaps = 8/128 (6%)
 Frame = +1

Query  175  VSQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMI  354
             S N+ E K S E    R EE  K KLK LHWDKVRASSDR MVWD LK  SFQLNEEMI
Sbjct  322  TSGNLGERKSSGE----RKEEIGKTKLKALHWDKVRASSDRAMVWDQLKPGSFQLNEEMI  377

Query  355  ETLFMVN----SNSDGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVE  522
            ETLF  N    +  DG +R ++PLL++E RVLDPKKSQNIAILL+ALNVT EEVCEAL+E
Sbjct  378  ETLFKANGPNIATKDGPRRSILPLLDEEYRVLDPKKSQNIAILLKALNVTEEEVCEALLE  437

Query  523  GTADSLGT  546
            G AD+LGT
Sbjct  438  GNADALGT  445



>ref|NP_189177.1| formin-like protein 1 [Arabidopsis thaliana]
 sp|Q9SE97.1|FH1_ARATH RecName: Full=Formin-like protein 1; Short=AtFH1; Short=AtFORMIN-8; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAF14548.1| formin-like protein AHF1 [Arabidopsis thaliana]
 dbj|BAB01320.1| formin-like protein [Arabidopsis thaliana]
 gb|AAL87275.1| putative formin protein AHF1 [Arabidopsis thaliana]
 gb|AAN13148.1| putative formin protein AHF1 [Arabidopsis thaliana]
 gb|AEE77017.1| formin-like protein 1 [Arabidopsis thaliana]
Length=1051

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 107/152 (70%), Gaps = 21/152 (14%)
 Frame = +1

Query  142  PPMLVPPSRPVV--SQNVA---------EVKHSSEAVEKRNEETMKPKLKPLHWDKVRAS  288
            PP L PPS P V  S+N+          E   +SEA E    ET KPKLK LHWDKVRAS
Sbjct  554  PPSLTPPSHPFVIPSENLPVTSSPMETPETVCASEAAE----ETPKPKLKALHWDKVRAS  609

Query  289  SDRVMVWDHLKSSSFQLNEEMIETLFMVNS------NSDGVKRPLMPLLNQENRVLDPKK  450
            SDR MVWDHL+SSSF+L+EEMIETLF+  S       S    R ++P  NQENRVLDPKK
Sbjct  610  SDREMVWDHLRSSSFKLDEEMIETLFVAKSLNNKPNQSQTTPRCVLPSPNQENRVLDPKK  669

Query  451  SQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            +QNIAILLRALNVT EEVCEAL+EG AD+LGT
Sbjct  670  AQNIAILLRALNVTIEEVCEALLEGNADTLGT  701



>ref|XP_010557746.1| PREDICTED: formin-like protein 1 [Tarenaya hassleriana]
Length=1079

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 108/146 (74%), Gaps = 17/146 (12%)
 Frame = +1

Query  142  PPMLVPPSRPVVSQNVA--------EVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDR  297
            PP L PPSR + +QNV+        E   +SE+VE    E+ KPKLK LHWDKVRASSDR
Sbjct  602  PPPLNPPSR-IQNQNVSMTSPNKLPENFSASESVE----ESPKPKLKALHWDKVRASSDR  656

Query  298  VMVWDHLKSSSFQLNEEMIETLFMVNS----NSDGVKRPLMPLLNQENRVLDPKKSQNIA  465
             MVWDHL+SSSF+LNEEMIETLFM  +     +    R ++P LNQENRVLDPKK+QNIA
Sbjct  657  EMVWDHLRSSSFKLNEEMIETLFMAKTPDPKTNQITPRSVLPPLNQENRVLDPKKAQNIA  716

Query  466  ILLRALNVTAEEVCEALVEGTADSLG  543
            ILLRALNVT EEVCE L+EG AD+LG
Sbjct  717  ILLRALNVTIEEVCETLLEGNADTLG  742



>ref|XP_002885725.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61984.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1054

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 105/147 (71%), Gaps = 12/147 (8%)
 Frame = +1

Query  142  PPMLVPPSRPVV--SQN--VAEVKHSSEAVEKRN--EETMKPKLKPLHWDKVRASSDRVM  303
            PP L PPS P V  S+N  V     + E V      EET KPKLK LHWDKVRASSDR M
Sbjct  564  PPSLTPPSHPFVISSENLPVTSPMETPETVSASEPAEETPKPKLKALHWDKVRASSDREM  623

Query  304  VWDHLKSSSFQLNEEMIETLFMVNS------NSDGVKRPLMPLLNQENRVLDPKKSQNIA  465
            VWDHL+SSSF+L+EEMIETLF+  S       S    R ++P  NQENRVLDPKK+QNIA
Sbjct  624  VWDHLRSSSFKLDEEMIETLFVAKSLDNKPNQSQTTPRCVLPSPNQENRVLDPKKAQNIA  683

Query  466  ILLRALNVTAEEVCEALVEGTADSLGT  546
            ILLRALNVT EEVCEAL+EG AD+LGT
Sbjct  684  ILLRALNVTIEEVCEALLEGNADTLGT  710



>ref|XP_009402682.1| PREDICTED: formin-like protein 1 [Musa acuminata subsp. malaccensis]
Length=887

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 112/151 (74%), Gaps = 8/151 (5%)
 Frame = +1

Query  112  FWEPPV---MDGGPPMLVPPSRPVVSQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVR  282
            +WE  +   +D  P  LV P    V ++ + ++ SS+ V  ++EET +PKLKPL WDKVR
Sbjct  397  YWESRIKKPVDLQPSDLVLPKLGSV-KDPSSLEESSKNVVGKSEETPRPKLKPLLWDKVR  455

Query  283  ASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVK----RPLMPLLNQENRVLDPKK  450
            ASSDR MVWD LKSSSFQ+NEEMIETLF+ N+ +   K    R ++P L QENRVLDPKK
Sbjct  456  ASSDRAMVWDQLKSSSFQVNEEMIETLFISNATNTAPKEMNRRQVLPSLTQENRVLDPKK  515

Query  451  SQNIAILLRALNVTAEEVCEALVEGTADSLG  543
            SQNIAILLRALNVT EEVCEAL+EG ADSLG
Sbjct  516  SQNIAILLRALNVTKEEVCEALLEGNADSLG  546



>ref|XP_010514197.1| PREDICTED: formin-like protein 1 [Camelina sativa]
Length=1063

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 105/149 (70%), Gaps = 15/149 (10%)
 Frame = +1

Query  142  PPMLVPPSRPVVSQNV--------AEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDR  297
            PP L PPS P V Q+          EV  +  A E   EET KPKLK LHWDKVRASSDR
Sbjct  569  PPSLTPPSHPFVLQSENHPVMTSPVEVPETVSASEP-TEETPKPKLKALHWDKVRASSDR  627

Query  298  VMVWDHLKSSSFQLNEEMIETLFMVNS------NSDGVKRPLMPLLNQENRVLDPKKSQN  459
             MVWDHL+SSSF+L+EEMIETLF+  +       S    R ++P  NQENRVLDPKK+QN
Sbjct  628  EMVWDHLRSSSFKLDEEMIETLFVAKTLDNKPNQSQTTPRSVVPNPNQENRVLDPKKAQN  687

Query  460  IAILLRALNVTAEEVCEALVEGTADSLGT  546
            IAILLRALNVT EEVCEAL+EG AD+LGT
Sbjct  688  IAILLRALNVTIEEVCEALLEGNADTLGT  716



>ref|XP_006350433.1| PREDICTED: formin-like protein 1-like [Solanum tuberosum]
Length=941

 Score =   166 bits (421),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 108/149 (72%), Gaps = 8/149 (5%)
 Frame = +1

Query  124  PVMDGGPPMLVPPSRPVVSQNVAEVKHSSEAVEK----RNEETMKPKLKPLHWDKVRASS  291
            P+    P ++ P   P   Q + +++ S E +       NEET KPKLK LHWDKVRASS
Sbjct  450  PIELESPVLISPMELPCNKQPIEKIEQSIEGLSSDTGGNNEETPKPKLKTLHWDKVRASS  509

Query  292  DRVMVWDHLKSSSFQLNEEMIETLFMVNS----NSDGVKRPLMPLLNQENRVLDPKKSQN  459
            DR MVWD LKSSSF+L+EEMIE+LF+V +      +  +RP++P  +QENRVLDPKKSQN
Sbjct  510  DREMVWDQLKSSSFKLDEEMIESLFIVKTPTLNRKEMTRRPVLPSQSQENRVLDPKKSQN  569

Query  460  IAILLRALNVTAEEVCEALVEGTADSLGT  546
            IAILLRALNVT EEVCEAL+EG AD+LGT
Sbjct  570  IAILLRALNVTVEEVCEALLEGNADALGT  598



>gb|KHN15960.1| Formin-like protein 1 [Glycine soja]
Length=840

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 97/118 (82%), Gaps = 4/118 (3%)
 Frame = +1

Query  205  SSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS  384
            SS+  E+ +EET KPKLKPLHWDKVRASSDR MVWD L+SSSF+LNEEMIETLF+VN+ +
Sbjct  381  SSQNFEEGSEETSKPKLKPLHWDKVRASSDREMVWDQLRSSSFKLNEEMIETLFVVNTPN  440

Query  385  ----DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
                D   R ++   NQE+RVLDPKKSQNIAILLRALNVT EEVCEAL+EG  D+LGT
Sbjct  441  PKPKDTTPRSVLAPQNQEDRVLDPKKSQNIAILLRALNVTIEEVCEALLEGVTDTLGT  498



>ref|XP_006351093.1| PREDICTED: formin-like protein 2-like [Solanum tuberosum]
Length=755

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 95/107 (89%), Gaps = 4/107 (4%)
 Frame = +1

Query  235  ETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRP  402
            E +KPKLKPLHWDKVRA+SDR MVWD LKS+SFQLNEEMIETLF +NS++    DGV+ P
Sbjct  356  ENIKPKLKPLHWDKVRANSDRAMVWDQLKSNSFQLNEEMIETLFTINSSNLNSKDGVRLP  415

Query  403  LMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
            ++P++NQE ++LD KKSQNIAILLRAL +T++EVCEAL+EG+AD+LG
Sbjct  416  IIPVMNQEKQLLDLKKSQNIAILLRALQITSDEVCEALLEGSADTLG  462



>gb|KHN06284.1| Formin-like protein 1 [Glycine soja]
Length=875

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 97/118 (82%), Gaps = 4/118 (3%)
 Frame = +1

Query  205  SSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS  384
            SS+  E+ +EET KPKLKPLHWDKVRASSDR MVWD L+SSSF+LNEEMIETLF+VN+ +
Sbjct  415  SSQNFEEGSEETSKPKLKPLHWDKVRASSDREMVWDQLRSSSFKLNEEMIETLFVVNTPN  474

Query  385  ----DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
                D   R ++   NQE+RVLDPKKSQNIAILLRALNVT EEVCEAL+EG  D+LGT
Sbjct  475  PKPKDTTPRSVLAPQNQEDRVLDPKKSQNIAILLRALNVTIEEVCEALLEGITDTLGT  532



>ref|XP_003624247.1| Formin-like protein [Medicago truncatula]
 gb|ABN08988.1| Actin-binding FH2 [Medicago truncatula]
 gb|AES80465.1| formin-like 2 domain protein [Medicago truncatula]
Length=1012

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 106/138 (77%), Gaps = 9/138 (7%)
 Frame = +1

Query  142  PPMLVPPSRPVVSQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLK  321
            PP L PPSRP V QN    + ++E+V +  EE+ KPKLKPLHWDKVR SS+R MVWD + 
Sbjct  537  PPELAPPSRPFVLQN----QMTNESVGE-TEESSKPKLKPLHWDKVRTSSEREMVWDQMN  591

Query  322  SSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNV  489
            S SF+LNEEMIETLF+V + +    D   R ++PL NQE RVLDPKKSQNIAILL+ALNV
Sbjct  592  SMSFKLNEEMIETLFVVKTANQKPKDAAPRSVLPLPNQEGRVLDPKKSQNIAILLKALNV  651

Query  490  TAEEVCEALVEGTADSLG  543
            T E VCEAL+EG++D+LG
Sbjct  652  TIEGVCEALLEGSSDTLG  669



>ref|XP_006602854.1| PREDICTED: formin-like protein 1-like [Glycine max]
Length=1039

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 105/142 (74%), Gaps = 11/142 (8%)
 Frame = +1

Query  142  PPMLVPPSRPVVSQNVA---EVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWD  312
            PP LVPPSR  V QN     E+  S   +E    E  KPKLKPLHWDKVR +SDR MVWD
Sbjct  558  PPELVPPSRSFVLQNQGTNVELPASLGEIE----EISKPKLKPLHWDKVRTTSDREMVWD  613

Query  313  HLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLNQENRVLDPKKSQNIAILLRA  480
             +KSSSF+LNE+MIETLF+VN+++    D     + PL NQE R+LDPKKSQNI+ILL+A
Sbjct  614  QMKSSSFKLNEKMIETLFVVNTSNPKPKDATTNSVFPLPNQEERILDPKKSQNISILLKA  673

Query  481  LNVTAEEVCEALVEGTADSLGT  546
            LNVT EEVCEAL+EG+ D+LGT
Sbjct  674  LNVTIEEVCEALLEGSTDTLGT  695



>gb|KHN40514.1| Formin-like protein 1 [Glycine soja]
Length=601

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 104/142 (73%), Gaps = 11/142 (8%)
 Frame = +1

Query  142  PPMLVPPSRPVVSQNVA---EVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWD  312
            PP LVPPSR  V QN     E+  S   +E    E  KPKLKPLHWDKVR +SDR MVWD
Sbjct  120  PPELVPPSRSFVLQNQGTNVELPASLGEIE----EISKPKLKPLHWDKVRTTSDREMVWD  175

Query  313  HLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLNQENRVLDPKKSQNIAILLRA  480
             +KSSSF+LNE+MIETLF+VN+++    D     +  L NQE R+LDPKKSQNI+ILL+A
Sbjct  176  QMKSSSFKLNEKMIETLFVVNTSNPKPKDATTNSVFHLPNQEERILDPKKSQNISILLKA  235

Query  481  LNVTAEEVCEALVEGTADSLGT  546
            LNVT EEVCEAL+EG+ D+LGT
Sbjct  236  LNVTIEEVCEALLEGSTDTLGT  257



>ref|XP_003548427.1| PREDICTED: formin-like protein 1-like [Glycine max]
Length=1079

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 97/118 (82%), Gaps = 4/118 (3%)
 Frame = +1

Query  205  SSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS  384
            SS+  E+ +EET KPKLKPLHWDKVRASSDR MVWD L+SSSF+LNEEMIETLF+VN+ +
Sbjct  620  SSQNFEEGSEETSKPKLKPLHWDKVRASSDREMVWDQLRSSSFKLNEEMIETLFVVNTPN  679

Query  385  ----DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
                D   R ++   NQE+RVLDPKKSQNIAILLRALNVT EEVCEAL+EG  D+LGT
Sbjct  680  PKPKDTTPRSVLAPQNQEDRVLDPKKSQNIAILLRALNVTIEEVCEALLEGVTDTLGT  737



>ref|XP_006366813.1| PREDICTED: formin-like protein 1-like [Solanum tuberosum]
Length=944

 Score =   164 bits (414),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 110/145 (76%), Gaps = 10/145 (7%)
 Frame = +1

Query  142  PPMLVPPSRPV-----VSQNVAEVKHSSEAVEKRNEETM--KPKLKPLHWDKVRASSDRV  300
            PP+L  P +P+     V  +  E+   SE +EK +E+T   KPKLK LHWDKVRASSDR 
Sbjct  458  PPVLESPLKPIGIESPVLVSPMELPSISEHIEKNDEKTEEPKPKLKTLHWDKVRASSDRE  517

Query  301  MVWDHLKSSSFQLNEEMIETLFMVNS---NSDGVKRPLMPLLNQENRVLDPKKSQNIAIL  471
            MVWD LKSSSF+LNEEMIETLF+V +   N++   R L+P  +QENRVLDPKK+QNIAIL
Sbjct  518  MVWDQLKSSSFKLNEEMIETLFVVKTPTLNANDTARRLVPSPSQENRVLDPKKAQNIAIL  577

Query  472  LRALNVTAEEVCEALVEGTADSLGT  546
            LRA+NVT EE+CEAL+EG A+++GT
Sbjct  578  LRAINVTTEEICEALLEGNAETIGT  602



>gb|KHN22146.1| Formin-like protein 1 [Glycine soja]
Length=590

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 105/140 (75%), Gaps = 14/140 (10%)
 Frame = +1

Query  142  PPMLVPPSRPVVSQNVA---EVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWD  312
            PP L+PPSRP V QN     E+  S   +E    ET KPKLKPLHWDKVR +SDR MVWD
Sbjct  116  PPELLPPSRPFVLQNQGSNVELPASLGEIE----ETSKPKLKPLHWDKVRTTSDRQMVWD  171

Query  313  HLKSSSFQLNEEMIETLFMVNS-NSDGV-KRPLMPLLNQENRVLDPKKSQNIAILLRALN  486
             +KS SF+LNE+MIETLF+VN+ N + V  +P     NQE RVLDPKKSQNI+ILL+ALN
Sbjct  172  QMKSRSFKLNEKMIETLFVVNTPNPNSVFHQP-----NQEERVLDPKKSQNISILLKALN  226

Query  487  VTAEEVCEALVEGTADSLGT  546
            VT EEVCEAL+EG+ D+LGT
Sbjct  227  VTIEEVCEALLEGSTDTLGT  246



>gb|AAF24496.1|AF213695_1 FH protein NFH1 [Nicotiana tabacum]
Length=868

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 111/150 (74%), Gaps = 15/150 (10%)
 Frame = +1

Query  142  PPMLVPPSRPVVSQN------VAEVKHSSEAVEK-----RNEETMKPKLKPLHWDKVRAS  288
            PP+LV P RP+  ++      + ++  +SE +EK      NEET KPKLK LHWDKVRAS
Sbjct  480  PPVLVTPLRPIALESPVLISPMDQLPSNSEPIEKNEQKIENEETPKPKLKTLHWDKVRAS  539

Query  289  SDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLNQENRVLDPKKSQ  456
            SDR  VWD LKSSSF+L+EEMIETLF+V + +    +  +R ++P  +QENRVLDPKKSQ
Sbjct  540  SDRETVWDQLKSSSFKLDEEMIETLFVVKTPTSNPKETTRRAVLPSQSQENRVLDPKKSQ  599

Query  457  NIAILLRALNVTAEEVCEALVEGTADSLGT  546
            NI+I LRAL+VT EEVCEAL+EG AD+LGT
Sbjct  600  NISIQLRALSVTVEEVCEALLEGNADALGT  629



>ref|XP_004970904.1| PREDICTED: formin-like protein 1-like [Setaria italica]
Length=934

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 92/117 (79%), Gaps = 4/117 (3%)
 Frame = +1

Query  205  SSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVN---  375
            SS+  +K  + T +PKLKPLHWDKVRASSDRVMVWD LKSSSFQ+NEEMIETLF+ N   
Sbjct  467  SSDQGDKSEDTTPRPKLKPLHWDKVRASSDRVMVWDQLKSSSFQVNEEMIETLFICNPAN  526

Query  376  -SNSDGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
             +  +  +RP++P    EN+VLDPKK+QNIAILLRALNVT EEVC+AL EG  DS G
Sbjct  527  AAAKEATRRPVLPTPKAENKVLDPKKAQNIAILLRALNVTKEEVCDALCEGNTDSFG  583



>ref|XP_011080563.1| PREDICTED: formin-like protein 1 [Sesamum indicum]
Length=987

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 102/147 (69%), Gaps = 13/147 (9%)
 Frame = +1

Query  145  PMLVPPSRPVVSQN-------VAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVM  303
            P  +PP    V +N       + E +HSSE VE+  E T KPKLKPLHWDKVRASSDR M
Sbjct  501  PFELPPKDSGVGENDEDERSTIKETEHSSEGVERNEEATPKPKLKPLHWDKVRASSDREM  560

Query  304  VWDHLKSSSFQLNEEMIETLFMVNSNSDGVKRP----LMPLLNQE--NRVLDPKKSQNIA  465
            VWD LK SSF+LNEEMIETLF+VN+     K      ++P   Q+  NRVLDPKK+QNIA
Sbjct  561  VWDQLKCSSFKLNEEMIETLFVVNTPKPTPKETNRWQVLPPPGQDNGNRVLDPKKAQNIA  620

Query  466  ILLRALNVTAEEVCEALVEGTADSLGT  546
            ILLRALNVT EEVCE L+EG  D LGT
Sbjct  621  ILLRALNVTVEEVCEGLLEGNTDMLGT  647



>ref|XP_004242448.1| PREDICTED: formin-like protein 1 [Solanum lycopersicum]
Length=936

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 109/145 (75%), Gaps = 10/145 (7%)
 Frame = +1

Query  142  PPMLVPPSRPV-----VSQNVAEVKHSSEAVEKRNEETM--KPKLKPLHWDKVRASSDRV  300
            PP+L  P +P+     V  +  E+   SE +EK +E T   KPKLK LHWDKVRASSDR 
Sbjct  450  PPVLESPLKPIGIESPVLVSPMELPSVSEHIEKDDERTEEPKPKLKTLHWDKVRASSDRE  509

Query  301  MVWDHLKSSSFQLNEEMIETLFMVNS---NSDGVKRPLMPLLNQENRVLDPKKSQNIAIL  471
            MVWD LKSSSF+LNEEMIETLF+V +   N++   R L+P  +QENRVLDPKK+QNIAIL
Sbjct  510  MVWDQLKSSSFKLNEEMIETLFVVKTPTLNANDTTRRLVPSPSQENRVLDPKKAQNIAIL  569

Query  472  LRALNVTAEEVCEALVEGTADSLGT  546
            LRA+NVT EE+CEAL+EG A+++G+
Sbjct  570  LRAINVTTEEICEALLEGNAETIGS  594



>gb|KJB34194.1| hypothetical protein B456_006G052500 [Gossypium raimondii]
Length=257

 Score =   153 bits (387),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 95/125 (76%), Gaps = 7/125 (6%)
 Frame = +1

Query  175  VSQNVAEVKHSSEAVEKRN-EETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEM  351
            +SQ     +  SEAVE+++ EE  KPKLKPLHWDKVRASSDR MVWDHL+SSSF+LNEEM
Sbjct  57   ISQVELPTRSESEAVEEKDAEEASKPKLKPLHWDKVRASSDREMVWDHLRSSSFKLNEEM  116

Query  352  IETLFMVNSNSDGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTA  531
            IETLF+  +      R ++P  NQ+NRVLDPKK+QNIAILLRA+NVT EEVC       A
Sbjct  117  IETLFVAKTPKQATPRSVLPSPNQDNRVLDPKKAQNIAILLRAINVTVEEVC------NA  170

Query  532  DSLGT  546
            D+LGT
Sbjct  171  DTLGT  175



>ref|XP_007139684.1| hypothetical protein PHAVU_008G050300g [Phaseolus vulgaris]
 gb|ESW11678.1| hypothetical protein PHAVU_008G050300g [Phaseolus vulgaris]
Length=1001

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 103/142 (73%), Gaps = 11/142 (8%)
 Frame = +1

Query  142  PPMLVPPSRPVVSQNVA---EVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWD  312
            PP LVPPSRP V QN A   E+  S   +E    ET +PKLKPLHWDKVR SS+R MVWD
Sbjct  544  PPELVPPSRPFVLQNQATNVELPGSLREIE----ETGRPKLKPLHWDKVRTSSEREMVWD  599

Query  313  HLKSSSFQLNEEMIETLFMVNS----NSDGVKRPLMPLLNQENRVLDPKKSQNIAILLRA  480
             +KSSSF+LNE+MIETLF+VN+      D     +    NQE R+LDPKKSQNI+ILL+A
Sbjct  600  QMKSSSFKLNEKMIETLFVVNTPNPKGKDAATNSVSHPPNQEERILDPKKSQNISILLKA  659

Query  481  LNVTAEEVCEALVEGTADSLGT  546
            LNVT EEVCEAL EG+ D+LGT
Sbjct  660  LNVTIEEVCEALSEGSTDALGT  681



>ref|XP_009767868.1| PREDICTED: formin-like protein 1 [Nicotiana sylvestris]
Length=841

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 95/112 (85%), Gaps = 4/112 (4%)
 Frame = +1

Query  223  KRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVN----SNSDG  390
            ++++E +KPKLK LHWDKVRASSDR MVWD LKSSSF+LNEEMIETLF+V     + S  
Sbjct  387  EKSDEILKPKLKTLHWDKVRASSDREMVWDQLKSSSFKLNEEMIETLFVVKNPALNTSAT  446

Query  391  VKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
             + P++P ++QENRVLDPKKSQNIAILLRALNVT EE+CEAL+EG A+++GT
Sbjct  447  ARHPVVPSMSQENRVLDPKKSQNIAILLRALNVTTEEICEALLEGNAENIGT  498



>gb|KJB08743.1| hypothetical protein B456_001G100900 [Gossypium raimondii]
Length=1036

 Score =   161 bits (408),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 104/157 (66%), Gaps = 25/157 (16%)
 Frame = +1

Query  109  RFWEPPV-------MDGGP-PMLVPPSRPVVSQNVAEVKHSSEAVEKRNEETMKPKLKPL  264
            R WE PV           P P L P S P + +                EE +KPKLKPL
Sbjct  542  RLWEKPVPSVSFAQQTSKPLPPLTPSSTPFIME--------------EQEEGLKPKLKPL  587

Query  265  HWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS---DGVKRPLMPLLNQENRV  435
            HWDKVRASS R MVWDHL+SSSF+LNEEMIETLF+VN NS       R ++PL N+ENRV
Sbjct  588  HWDKVRASSGREMVWDHLRSSSFKLNEEMIETLFVVNPNSKPNQTTPRSVLPLPNEENRV  647

Query  436  LDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            LDPKK+QNIAILL+ALNVT EEV EAL+EG  D+LGT
Sbjct  648  LDPKKAQNIAILLKALNVTLEEVSEALLEGNLDTLGT  684



>ref|XP_006418616.1| hypothetical protein EUTSA_v10002383mg [Eutrema salsugineum]
 gb|ESQ37052.1| hypothetical protein EUTSA_v10002383mg [Eutrema salsugineum]
Length=1068

 Score =   161 bits (407),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 103/148 (70%), Gaps = 13/148 (9%)
 Frame = +1

Query  142  PPMLVPPSRPVV--SQNV-----AEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRV  300
            PP L  PS P V  S+N+      E    +       EET KPKLK LHWDKVRASSDR 
Sbjct  578  PPSLTQPSHPFVIPSENLPVTTPKETPPETLCAGDLAEETPKPKLKALHWDKVRASSDRE  637

Query  301  MVWDHLKSSSFQLNEEMIETLFMVNS------NSDGVKRPLMPLLNQENRVLDPKKSQNI  462
            MVWDHL+SSSF+L+EEMIETLF+  +       S    R ++P  NQENRVLDPKK+QNI
Sbjct  638  MVWDHLRSSSFKLDEEMIETLFVAKTLDSKPNQSQTTPRCVLPNPNQENRVLDPKKAQNI  697

Query  463  AILLRALNVTAEEVCEALVEGTADSLGT  546
            AILLRALNVT EEVCEAL+EG AD+LGT
Sbjct  698  AILLRALNVTIEEVCEALLEGNADTLGT  725



>ref|XP_010930463.1| PREDICTED: LOW QUALITY PROTEIN: formin-like protein 1, partial 
[Elaeis guineensis]
Length=922

 Score =   160 bits (405),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 107/157 (68%), Gaps = 14/157 (9%)
 Frame = +1

Query  112  FWE---PPVMDGGPPMLVPPSRPVVSQNVAEVKHSS-----EAVEKRNEETMKPKLKPLH  267
            +WE   P +    PP+L+PP    V  + A V  +        +EK ++  ++PKLKPLH
Sbjct  424  YWEGQNPKMPACQPPVLMPPRTSGVRNSSATVFPAGPPENLNGMEK-SQHNLRPKLKPLH  482

Query  268  WDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVK-----RPLMPLLNQENR  432
            WDKVRASSDR MVWD LKSSSFQLNEEMIETLF+ N+     K     R  +P ++ ENR
Sbjct  483  WDKVRASSDRAMVWDQLKSSSFQLNEEMIETLFVCNTTDTASKEMMGGRQFVPSVSPENR  542

Query  433  VLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
            +LDPKKSQNIAILL+ALNVT EEVCEAL+EG   SLG
Sbjct  543  ILDPKKSQNIAILLKALNVTKEEVCEALLEGNTVSLG  579



>ref|XP_006587792.1| PREDICTED: formin-like protein 1-like [Glycine max]
Length=1037

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 105/140 (75%), Gaps = 14/140 (10%)
 Frame = +1

Query  142  PPMLVPPSRPVVSQNVA---EVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWD  312
            PP L+PPSRP V QN     E+  S   +E    ET KPKLKPLHWDKVR +SDR MVWD
Sbjct  563  PPELLPPSRPFVLQNQGSNVELPASLGEIE----ETSKPKLKPLHWDKVRTTSDRQMVWD  618

Query  313  HLKSSSFQLNEEMIETLFMVNS-NSDGV-KRPLMPLLNQENRVLDPKKSQNIAILLRALN  486
             +KS SF+LNE+MIETLF+VN+ N + V  +P     NQE RVLDPKKSQNI+ILL+ALN
Sbjct  619  QMKSRSFKLNEKMIETLFVVNTPNPNSVFHQP-----NQEERVLDPKKSQNISILLKALN  673

Query  487  VTAEEVCEALVEGTADSLGT  546
            VT EEVCEAL+EG+ D+LGT
Sbjct  674  VTIEEVCEALLEGSTDTLGT  693



>ref|XP_010517960.1| PREDICTED: formin-like protein 2 [Camelina sativa]
Length=907

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +1

Query  223  KRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVKRP  402
            ++ EET+KPKLKPLHWDKVRASS R MVWD +KS+SFQ+NEEMIETLF VN  S   +  
Sbjct  451  EKKEETLKPKLKPLHWDKVRASSSRAMVWDQIKSNSFQVNEEMIETLFKVNDPSSRTREA  510

Query  403  LMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
            ++   NQEN+ LDP+KS NIAILLRALNVTA+EVCEALVEG +D+LG
Sbjct  511  VVQSANQENQFLDPRKSHNIAILLRALNVTADEVCEALVEGNSDTLG  557



>gb|KHG09398.1| Formin-like protein 1 [Gossypium arboreum]
Length=1032

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 103/157 (66%), Gaps = 25/157 (16%)
 Frame = +1

Query  109  RFWEPPV-------MDGGP-PMLVPPSRPVVSQNVAEVKHSSEAVEKRNEETMKPKLKPL  264
            R WE PV           P P L P S P + +                EE +KPKLK L
Sbjct  538  RLWEKPVPSVSFAQQTSKPLPPLTPSSTPFIME--------------EQEEGLKPKLKAL  583

Query  265  HWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS---DGVKRPLMPLLNQENRV  435
            HWDKVRASS R MVWDHL+SSSF+LNEEMIETLF+VN NS       R ++P  NQENRV
Sbjct  584  HWDKVRASSGREMVWDHLRSSSFKLNEEMIETLFVVNPNSKPNQTTPRTVLPSPNQENRV  643

Query  436  LDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            LDPKK+QNIAILL+ALNVT EEV EAL+EG AD+LGT
Sbjct  644  LDPKKAQNIAILLKALNVTVEEVSEALLEGNADTLGT  680



>gb|AFW84304.1| hypothetical protein ZEAMMB73_342974, partial [Zea mays]
Length=541

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 94/117 (80%), Gaps = 4/117 (3%)
 Frame = +1

Query  205  SSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVN-SN  381
            SS+  +K  + T +PKLKPLHWDKVRASSDRVMVWD LKSSSFQ+NEEMIETLF+ N +N
Sbjct  70   SSDQGDKSEDTTPRPKLKPLHWDKVRASSDRVMVWDQLKSSSFQVNEEMIETLFICNPAN  129

Query  382  S---DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
            +   +  +RP++P    EN+VLDPKK+QNIAILLRALNVT EEVC+AL EG  ++ G
Sbjct  130  APAKEATRRPVLPTPRAENKVLDPKKAQNIAILLRALNVTKEEVCDALCEGNTENFG  186



>ref|XP_006858820.1| hypothetical protein AMTR_s00066p00173780 [Amborella trichopoda]
 gb|ERN20287.1| hypothetical protein AMTR_s00066p00173780 [Amborella trichopoda]
Length=1098

 Score =   159 bits (402),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 112/161 (70%), Gaps = 18/161 (11%)
 Frame = +1

Query  109  RFWEPPVMDGGPPMLVPPSRP---VVSQNVAEVKHS--------SEAVEKRNEETMKPKL  255
            RFWEP ++    P+  P SRP   V  ++  E   S        SE   +++++  +PKL
Sbjct  600  RFWEPSLLT---PLPRPMSRPQSLVTPESNGETPSSFLEGDAGISENSGEKSDDNPRPKL  656

Query  256  KPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMV-NSNS---DGVKRPLMPLLNQ  423
            KPLHWDKVRASSDR  VWD LKSSSF+LNEEMIETLF+  N+NS   D  +R ++P  NQ
Sbjct  657  KPLHWDKVRASSDRATVWDRLKSSSFKLNEEMIETLFVCNNANSVQKDTNRRLVLPSPNQ  716

Query  424  ENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            ENR+LDPKKSQNIAILLRALNVT +EVCEAL+E   DS+ +
Sbjct  717  ENRILDPKKSQNIAILLRALNVTKDEVCEALLECNTDSISS  757



>ref|XP_004244823.1| PREDICTED: formin-like protein 2 [Solanum lycopersicum]
Length=757

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 94/106 (89%), Gaps = 4/106 (4%)
 Frame = +1

Query  235  ETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRP  402
            E++KPKLKPLHWDKVRA+SDR MVWD LKS+SFQLNEEMIETLF +NS++    +GV+ P
Sbjct  358  ESIKPKLKPLHWDKVRANSDRAMVWDQLKSNSFQLNEEMIETLFTINSSNLNSKEGVRLP  417

Query  403  LMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSL  540
            ++P++NQE ++LD KKSQNIAI LRAL +T++EVCEAL+EG+AD+L
Sbjct  418  IIPVMNQEKQLLDLKKSQNIAIWLRALQITSDEVCEALLEGSADTL  463



>ref|XP_006646564.1| PREDICTED: formin-like protein 1-like [Oryza brachyantha]
Length=679

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 106/167 (63%), Gaps = 23/167 (14%)
 Frame = +1

Query  112  FWEPPVMDGGP--------PMLVPPSRPVVSQNVAEVK--------HSSEAVEKRNEETM  243
            +WE  V   G         P L PP +P   ++             ++  A +K  E T 
Sbjct  162  YWESRVRKPGTGTSKETRSPALSPPPQPTSFKSALPTDAFPGRLADNADHAGDKSEETTP  221

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVN-SNS------DGVKRP  402
            +PKLKPLHWDKVRASSDRVMVWD LKSSSFQ+NEEMIETLF+ N +NS         +RP
Sbjct  222  RPKLKPLHWDKVRASSDRVMVWDQLKSSSFQVNEEMIETLFICNPANSVPPKEPTATRRP  281

Query  403  LMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
            ++P    +N+VLDPKKSQNIAILLRALNVT E+VCEAL EG  ++ G
Sbjct  282  VLPTPKADNKVLDPKKSQNIAILLRALNVTKEQVCEALCEGNTENFG  328



>gb|EMT33349.1| Formin-like protein 1 [Aegilops tauschii]
Length=501

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 101/145 (70%), Gaps = 12/145 (8%)
 Frame = +1

Query  145  PMLVPPSRPVVSQNV-------AEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVM  303
            P L PP +   S++V         ++ +++ V+K  E T +PKLKPLHWDKVRASSDR M
Sbjct  8    PALSPPPQAANSRSVPPTDAFPGRLQDNADHVDKSEETTPRPKLKPLHWDKVRASSDRAM  67

Query  304  VWDHLKSSSFQLNEEMIETLFMVN----SNSDGVKRPLMPLLNQENRV-LDPKKSQNIAI  468
            VWD LKSSSFQ+NEEMIETLF+ N    +  +  KRP +P    EN+V LDPKK+QNIAI
Sbjct  68   VWDQLKSSSFQVNEEMIETLFICNPANAAPKEATKRPALPTPKAENKVLLDPKKAQNIAI  127

Query  469  LLRALNVTAEEVCEALVEGTADSLG  543
            LLRALNVT EEVCEAL EG   + G
Sbjct  128  LLRALNVTKEEVCEALCEGNTQNFG  152



>gb|KJB42647.1| hypothetical protein B456_007G161600 [Gossypium raimondii]
Length=1073

 Score =   158 bits (399),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 88/105 (84%), Gaps = 4/105 (4%)
 Frame = +1

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMP  411
            KPKLKPLHWDKVRASSDR MVWDHL+SSSF+LNEEMIETLF+  + +        R ++P
Sbjct  656  KPKLKPLHWDKVRASSDREMVWDHLRSSSFKLNEEMIETLFVAKTPNPKPKQATPRSVLP  715

Query  412  LLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
              NQ+NRVLDPKK+QNIAILLRALNVT EEVCEAL+EG AD+LGT
Sbjct  716  SPNQDNRVLDPKKAQNIAILLRALNVTVEEVCEALLEGNADTLGT  760



>ref|XP_002458919.1| hypothetical protein SORBIDRAFT_03g042700 [Sorghum bicolor]
 gb|EES04039.1| hypothetical protein SORBIDRAFT_03g042700 [Sorghum bicolor]
Length=940

 Score =   157 bits (398),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 94/117 (80%), Gaps = 4/117 (3%)
 Frame = +1

Query  205  SSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVN-SN  381
            SS+  +K  + T +PKLKPLHWDKVRASSDRVMVWD LKSSSFQ+NEEMIETLF+ N +N
Sbjct  473  SSDQGDKSEDTTPRPKLKPLHWDKVRASSDRVMVWDQLKSSSFQVNEEMIETLFICNPAN  532

Query  382  S---DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
            +   +  +RP++P    EN+VLDPKK+QNIAILLRALNVT EEVC+AL EG  ++ G
Sbjct  533  APAKEATRRPVLPTPKAENKVLDPKKAQNIAILLRALNVTKEEVCDALCEGNTENFG  589



>gb|KJB42646.1| hypothetical protein B456_007G161600 [Gossypium raimondii]
Length=1114

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 88/105 (84%), Gaps = 4/105 (4%)
 Frame = +1

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMP  411
            KPKLKPLHWDKVRASSDR MVWDHL+SSSF+LNEEMIETLF+  + +        R ++P
Sbjct  656  KPKLKPLHWDKVRASSDREMVWDHLRSSSFKLNEEMIETLFVAKTPNPKPKQATPRSVLP  715

Query  412  LLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
              NQ+NRVLDPKK+QNIAILLRALNVT EEVCEAL+EG AD+LGT
Sbjct  716  SPNQDNRVLDPKKAQNIAILLRALNVTVEEVCEALLEGNADTLGT  760



>gb|KJB42648.1| hypothetical protein B456_007G161600 [Gossypium raimondii]
Length=1087

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 88/105 (84%), Gaps = 4/105 (4%)
 Frame = +1

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMP  411
            KPKLKPLHWDKVRASSDR MVWDHL+SSSF+LNEEMIETLF+  + +        R ++P
Sbjct  656  KPKLKPLHWDKVRASSDREMVWDHLRSSSFKLNEEMIETLFVAKTPNPKPKQATPRSVLP  715

Query  412  LLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
              NQ+NRVLDPKK+QNIAILLRALNVT EEVCEAL+EG AD+LGT
Sbjct  716  SPNQDNRVLDPKKAQNIAILLRALNVTVEEVCEALLEGNADTLGT  760



>ref|XP_009761393.1| PREDICTED: formin-like protein 1 [Nicotiana sylvestris]
Length=975

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 109/148 (74%), Gaps = 15/148 (10%)
 Frame = +1

Query  148  MLVPPSRPVVSQN------VAEVKHSSEAVEK-----RNEETMKPKLKPLHWDKVRASSD  294
            +LV P RP+  ++      + ++  +SE +EK      NEET KPKLK LHWDKVRASSD
Sbjct  486  VLVTPLRPIALESPVLISPMDQLPSNSEPIEKNEQKIENEETPKPKLKTLHWDKVRASSD  545

Query  295  RVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLNQENRVLDPKKSQNI  462
            R  VWD LKSSSF+L+EEMIETLF+V + +    +  +R ++P  +QENRVLDPKKSQNI
Sbjct  546  RETVWDQLKSSSFKLDEEMIETLFVVKTPTSNPKETTRRAVLPSQSQENRVLDPKKSQNI  605

Query  463  AILLRALNVTAEEVCEALVEGTADSLGT  546
            +I LRAL+VT EEVCEAL+EG AD+LGT
Sbjct  606  SIQLRALSVTVEEVCEALLEGNADALGT  633



>ref|XP_009587321.1| PREDICTED: formin-like protein 1 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009587322.1| PREDICTED: formin-like protein 1 isoform X2 [Nicotiana tomentosiformis]
Length=984

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 108/148 (73%), Gaps = 15/148 (10%)
 Frame = +1

Query  148  MLVPPSRPVVSQN------VAEVKHSSEAVEK-----RNEETMKPKLKPLHWDKVRASSD  294
            +LV P RP+  ++      + ++  +SE +EK      NEET KPKLK LHWDKVRASSD
Sbjct  495  VLVTPLRPIALESPVLISPMDQLPSNSEPIEKNEQKIENEETPKPKLKTLHWDKVRASSD  554

Query  295  RVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLNQENRVLDPKKSQNI  462
            R  VWD LKSSSF+L+EEMIETLF+V + +    +  +R ++P  +QENRVLDPKKSQNI
Sbjct  555  RETVWDQLKSSSFKLDEEMIETLFVVKTPTSNPKETTRRSVLPSQSQENRVLDPKKSQNI  614

Query  463  AILLRALNVTAEEVCEALVEGTADSLGT  546
            +I LRALNVT EEVCEAL+EG  D+LGT
Sbjct  615  SIQLRALNVTVEEVCEALLEGNVDALGT  642



>gb|KJB42649.1| hypothetical protein B456_007G161600 [Gossypium raimondii]
Length=1108

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 88/105 (84%), Gaps = 4/105 (4%)
 Frame = +1

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMP  411
            KPKLKPLHWDKVRASSDR MVWDHL+SSSF+LNEEMIETLF+  + +        R ++P
Sbjct  656  KPKLKPLHWDKVRASSDREMVWDHLRSSSFKLNEEMIETLFVAKTPNPKPKQATPRSVLP  715

Query  412  LLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
              NQ+NRVLDPKK+QNIAILLRALNVT EEVCEAL+EG AD+LGT
Sbjct  716  SPNQDNRVLDPKKAQNIAILLRALNVTVEEVCEALLEGNADTLGT  760



>ref|XP_009619665.1| PREDICTED: formin-like protein 2 [Nicotiana tomentosiformis]
Length=835

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 103/138 (75%), Gaps = 7/138 (5%)
 Frame = +1

Query  145  PMLVPPSRPVVSQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKS  324
            P+L+ P      QNV    HS E  E+++EE +KPKLK LHWDKVRASSD  MVWD LKS
Sbjct  358  PVLISPMEKN-DQNVE--NHSIEKNEEKSEEILKPKLKTLHWDKVRASSDCEMVWDQLKS  414

Query  325  SSFQLNEEMIETLFMVN----SNSDGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVT  492
            SSF+LNEEMIETLF+V     + S   K  ++  ++QENRVLDPKKSQNIAILLRALN T
Sbjct  415  SSFKLNEEMIETLFVVKNPTLNTSATAKHLVVSSMSQENRVLDPKKSQNIAILLRALNGT  474

Query  493  AEEVCEALVEGTADSLGT  546
             EE+CEAL+EG A+++GT
Sbjct  475  TEEICEALLEGNAENIGT  492



>ref|XP_003564841.1| PREDICTED: formin-like protein 1 [Brachypodium distachyon]
Length=951

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 102/144 (71%), Gaps = 11/144 (8%)
 Frame = +1

Query  145  PMLVPPSRPVVSQNV-------AEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVM  303
            P L PP +    ++V         +  +++  +K  E T +PKLKPLHWDKVRASSDRVM
Sbjct  459  PALSPPPQAANFRSVPPTDAFPGRLSENADHGDKSEETTPRPKLKPLHWDKVRASSDRVM  518

Query  304  VWDHLKSSSFQLNEEMIETLFMVN-SNS---DGVKRPLMPLLNQENRVLDPKKSQNIAIL  471
            VWD LKSSSFQ+NEEMIETLF+ N +N+   +  KRP +P    EN+VLDPKK+QNIAIL
Sbjct  519  VWDQLKSSSFQVNEEMIETLFICNPANAPPKEAAKRPALPAPKAENKVLDPKKAQNIAIL  578

Query  472  LRALNVTAEEVCEALVEGTADSLG  543
            LRALNVT EEVC+AL EG  ++ G
Sbjct  579  LRALNVTKEEVCDALCEGNTENFG  602



>ref|XP_009389163.1| PREDICTED: formin-like protein 1 [Musa acuminata subsp. malaccensis]
Length=897

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 103/141 (73%), Gaps = 13/141 (9%)
 Frame = +1

Query  142  PPMLVPPSRPVV-SQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHL  318
            PP+LV P  PV  S +VA    +S A EK +EE  +PKLKPLHWDKVRASSD+ MVWD L
Sbjct  419  PPVLVHPRIPVAWSSSVA--PENSNAAEK-HEENPRPKLKPLHWDKVRASSDQAMVWDQL  475

Query  319  KSSSFQLNEEMIETLFMVNSN------SDGVKRPLMPLLNQENRVLDPKKSQNIAILLRA  480
            KS SFQLNEEMIETLF+ N+       S G   P M   NQE+R+L+PKKSQNIAILL+A
Sbjct  476  KSGSFQLNEEMIETLFLSNTGMTTKEMSGGQINPPM---NQESRILEPKKSQNIAILLKA  532

Query  481  LNVTAEEVCEALVEGTADSLG  543
            LNV  E+VCEAL+EG  DSLG
Sbjct  533  LNVNKEDVCEALLEGKVDSLG  553



>ref|XP_006293646.1| hypothetical protein CARUB_v10022602mg [Capsella rubella]
 gb|EOA26544.1| hypothetical protein CARUB_v10022602mg [Capsella rubella]
Length=917

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +1

Query  226  RNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVKRPL  405
            + EE +KPKLKPLHWDKVRASS R MVWD + S+SFQ+NEEMIETLF VN  S   +  +
Sbjct  462  KKEEILKPKLKPLHWDKVRASSSRAMVWDQIISNSFQVNEEMIETLFKVNDPSSRTRDAV  521

Query  406  MPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
            +   NQENR LDP+KS NIAILLRALNVTA+EVCEALVEG +D+LG
Sbjct  522  VQSTNQENRFLDPRKSHNIAILLRALNVTADEVCEALVEGNSDTLG  567



>ref|XP_002880068.1| hypothetical protein ARALYDRAFT_483497 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56327.1| hypothetical protein ARALYDRAFT_483497 [Arabidopsis lyrata subsp. 
lyrata]
Length=891

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  235  ETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVKRPLMPL  414
            ETMKPKLK LHWDKVRA S RVMVWD +KS+SFQ+NEEMIETLF VN  +   +  ++  
Sbjct  439  ETMKPKLKTLHWDKVRARSSRVMVWDQIKSNSFQVNEEMIETLFKVNDTNSRTRDGVVQS  498

Query  415  LNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
             NQENR LDP+KS NIAILLRALNVTA+EVCEALVEG +D+LG
Sbjct  499  ANQENRFLDPRKSHNIAILLRALNVTADEVCEALVEGNSDTLG  541



>gb|KHG03223.1| Formin-like protein 1 [Gossypium arboreum]
Length=1121

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 88/105 (84%), Gaps = 4/105 (4%)
 Frame = +1

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMP  411
            KPKLKPLHWDKVRASSDR MVWDHL+SSSF+LNEEMIETLF+  + +        R ++P
Sbjct  663  KPKLKPLHWDKVRASSDREMVWDHLRSSSFKLNEEMIETLFVAKTPNPKPKQATPRSVLP  722

Query  412  LLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
              NQ+NRVLDPKK+QNIAILLRALNVT EEVCEAL+EG A++LGT
Sbjct  723  SPNQDNRVLDPKKAQNIAILLRALNVTVEEVCEALLEGNAETLGT  767



>gb|ACN34363.1| unknown [Zea mays]
Length=732

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 103/141 (73%), Gaps = 8/141 (6%)
 Frame = +1

Query  145  PMLVPPS-RPVVSQNVAE---VKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWD  312
            P L PPS R V +   A    +  SSE  +K  + T +PKLKPLHWDKVRASSDRVMVWD
Sbjct  241  PALSPPSFRSVPAPTDAFPSWLPESSEQGDKSEDTTPRPKLKPLHWDKVRASSDRVMVWD  300

Query  313  HLKSSSFQLNEEMIETLFMVN-SNS---DGVKRPLMPLLNQENRVLDPKKSQNIAILLRA  480
             LKSSSFQ+NEEMIETLF+ N +N+   +  +RP++P    EN+VLDPKK+QNIAILLRA
Sbjct  301  QLKSSSFQVNEEMIETLFICNPANAPAKEATRRPVLPTPKAENKVLDPKKAQNIAILLRA  360

Query  481  LNVTAEEVCEALVEGTADSLG  543
            LNVT EEV +AL EG  ++ G
Sbjct  361  LNVTKEEVSDALCEGNTENFG  381



>emb|CDM85287.1| unnamed protein product [Triticum aestivum]
Length=954

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 105/162 (65%), Gaps = 18/162 (11%)
 Frame = +1

Query  112  FWEPPVMDGG------PPMLVPPSRPVVSQNV-------AEVKHSSEAVEKRNEETMKPK  252
            +WE  V   G       P L PP +   S++V         ++ +++  +K  E T +PK
Sbjct  444  YWESRVRKPGMSKEAMSPALSPPPQAANSRSVPPTDAFPGRLQDNADHGDKSEETTPRPK  503

Query  253  LKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVN----SNSDGVKRPLMPLLN  420
            LKPLHWDKVRASSDR MVWD LKSSSFQ+NEEMIETLF+ N    +  +  KRP +P   
Sbjct  504  LKPLHWDKVRASSDRAMVWDQLKSSSFQVNEEMIETLFICNPANAAPKEATKRPALPTPK  563

Query  421  QENRV-LDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
             EN+V LDPKK+QNIAILLRALNVT EEVCEAL EG   + G
Sbjct  564  AENKVLLDPKKAQNIAILLRALNVTKEEVCEALCEGNTQNFG  605



>ref|XP_009420139.1| PREDICTED: formin-like protein 1 [Musa acuminata subsp. malaccensis]
Length=826

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 104/152 (68%), Gaps = 23/152 (15%)
 Frame = +1

Query  112  FWEPPVMD---GGPPMLVPPSRPVVSQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVR  282
            +WE  V       PP+LVPP            K  +E    +NEE  +PKLKPLHWDKV+
Sbjct  356  YWESQVRQPQARQPPLLVPP------------KLKTE----KNEEAERPKLKPLHWDKVQ  399

Query  283  ASSDRVMVWDHLKSSSFQLNEEMIETLFMVN----SNSDGVKRPLMPLLNQENRVLDPKK  450
            ASSDR MVWD LKSSSFQ+NEEMIETLF+ N    ++ +  +R ++P   +E RVLDPKK
Sbjct  400  ASSDRAMVWDQLKSSSFQVNEEMIETLFVRNATNATHRETNRRQVLPSSPREKRVLDPKK  459

Query  451  SQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            SQNIAIL+RALN T EEVC+AL EG A+SLGT
Sbjct  460  SQNIAILMRALNATKEEVCDALQEGNAESLGT  491



>ref|NP_181908.1| formin-like protein 2 [Arabidopsis thaliana]
 sp|O22824.1|FH2_ARATH RecName: Full=Formin-like protein 2; Short=AtFH2; Short=AtFORMIN-2; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAB64026.1| unknown protein [Arabidopsis thaliana]
 gb|AEC10328.1| formin-like protein 2 [Arabidopsis thaliana]
Length=894

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +1

Query  235  ETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVKRPLMPL  414
            ETMKPKLK LHWDKVRASS RVMVWD +KS+SFQ+NEEMIETLF VN  +   +  ++  
Sbjct  442  ETMKPKLKTLHWDKVRASSSRVMVWDQIKSNSFQVNEEMIETLFKVNDPTSRTRDGVVQS  501

Query  415  LNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
            ++QENR LDP+KS NIAILLRALNVTA+EVCEAL+EG +D+LG
Sbjct  502  VSQENRFLDPRKSHNIAILLRALNVTADEVCEALIEGNSDTLG  544



>ref|XP_010524188.1| PREDICTED: formin-like protein 2 [Tarenaya hassleriana]
Length=936

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 100/143 (70%), Gaps = 5/143 (3%)
 Frame = +1

Query  130  MDGGPPMLVPPSRPVVS-QNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMV  306
            M  GP M V  S P V+  N  E     E   ++ E+T+KPKLKPLHWDKVRASS+R MV
Sbjct  443  MSAGPTMSVSVSSPPVNPGNGDEELGEKEDDSEKKEDTLKPKLKPLHWDKVRASSNRAMV  502

Query  307  WDHLKSSSFQLNEEMIETLFMVNSNSDGVKRPLM----PLLNQENRVLDPKKSQNIAILL  474
            WD +KSSSFQLNEEMIETLF VN  S   K           +QENR++DPKK+QNIAILL
Sbjct  503  WDQIKSSSFQLNEEMIETLFRVNGPSSRTKDAGFVRNSQSWSQENRLIDPKKAQNIAILL  562

Query  475  RALNVTAEEVCEALVEGTADSLG  543
            RALNVT +EVCEA+ EG +D+LG
Sbjct  563  RALNVTTDEVCEAISEGNSDTLG  585



>emb|CDY52291.1| BnaA03g57840D [Brassica napus]
Length=1076

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 89/111 (80%), Gaps = 6/111 (5%)
 Frame = +1

Query  232  EETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNS------NSDGV  393
            EET KPKLK LHWDKVRASSDR MVWD L+SSSF+L+EEMIETLF+  S       S   
Sbjct  619  EETPKPKLKALHWDKVRASSDREMVWDQLRSSSFKLDEEMIETLFVAKSLDSKPNQSQTT  678

Query  394  KRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
             R ++P  NQENRVLDPKK+QNIAILLRALNVT EEVCEAL+EG A++LGT
Sbjct  679  PRCVLPSPNQENRVLDPKKAQNIAILLRALNVTIEEVCEALLEGNAETLGT  729



>ref|XP_009136119.1| PREDICTED: formin-like protein 1 [Brassica rapa]
Length=1074

 Score =   155 bits (392),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 89/111 (80%), Gaps = 6/111 (5%)
 Frame = +1

Query  232  EETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNS------NSDGV  393
            EET KPKLK LHWDKVRASSDR MVWD L+SSSF+L+EEMIETLF+  S       S   
Sbjct  620  EETPKPKLKALHWDKVRASSDREMVWDQLRSSSFKLDEEMIETLFVAKSLDSKPNQSQTT  679

Query  394  KRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
             R ++P  NQENRVLDPKK+QNIAILLRALNVT EEVCEAL+EG A++LGT
Sbjct  680  PRCVLPSPNQENRVLDPKKAQNIAILLRALNVTIEEVCEALLEGNAETLGT  730



>ref|XP_010508372.1| PREDICTED: formin-like protein 2 [Camelina sativa]
Length=904

 Score =   154 bits (390),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +1

Query  205  SSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS  384
            S ++  ++ EET+KPKLKPLHWDKVRASS   MVWD +KS+SFQ+NEEMIETLF VN  S
Sbjct  442  SGDSDPEKKEETLKPKLKPLHWDKVRASSSHAMVWDQIKSNSFQVNEEMIETLFKVNDPS  501

Query  385  DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
               +  ++   NQE+R LDP+KS NIAILLRALNVTA+EVC+ALVEG +D+LG
Sbjct  502  SRTREAVVQSGNQESRYLDPRKSHNIAILLRALNVTADEVCDALVEGNSDTLG  554



>ref|XP_006397554.1| hypothetical protein EUTSA_v10001716mg, partial [Eutrema salsugineum]
 gb|ESQ39007.1| hypothetical protein EUTSA_v10001716mg, partial [Eutrema salsugineum]
Length=735

 Score =   153 bits (387),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 92/118 (78%), Gaps = 4/118 (3%)
 Frame = +1

Query  202  HSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNS-  378
            H  ++  ++ EET+KPKLKPLHWDKVRASS R MVWD +KS+SFQ+NEEMIETLF  N  
Sbjct  292  HRGDSDPEKKEETLKPKLKPLHWDKVRASSGRGMVWDQIKSNSFQVNEEMIETLFRANDP  351

Query  379  NS---DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
            NS   DG    ++   N EN+ LDP+KS NIAILLRALNVTA+EVCEALVEG +D+LG
Sbjct  352  NSRTRDGGNAGVVQSANHENQFLDPRKSHNIAILLRALNVTADEVCEALVEGNSDTLG  409



>tpg|DAA56340.1| TPA: hypothetical protein ZEAMMB73_371007 [Zea mays]
Length=938

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 101/141 (72%), Gaps = 8/141 (6%)
 Frame = +1

Query  145  PMLVPPS-RPVVSQNVAE---VKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWD  312
            P L PPS R V +   A    +  SSE  +K  + T +PKLKPLHWDKVRASSDRVMVWD
Sbjct  447  PALSPPSFRSVPAPTDAFPSWLPESSEQGDKSEDTTPRPKLKPLHWDKVRASSDRVMVWD  506

Query  313  HLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLNQENRVLDPKKSQNIAILLRA  480
             LKSSSFQ+NEEMIETLF+ N  +    +  +RP++P    EN+VLDPKK+QNIAILLRA
Sbjct  507  QLKSSSFQVNEEMIETLFICNPANAPAKEATRRPVLPTPKAENKVLDPKKAQNIAILLRA  566

Query  481  LNVTAEEVCEALVEGTADSLG  543
            LNVT EEV +AL EG  ++ G
Sbjct  567  LNVTKEEVSDALCEGNTENFG  587



>gb|KJB34193.1| hypothetical protein B456_006G052500 [Gossypium raimondii]
Length=180

 Score =   144 bits (363),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = +1

Query  175  VSQNVAEVKHSSEAVEKRN-EETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEM  351
            +SQ     +  SEAVE+++ EE  KPKLKPLHWDKVRASSDR MVWDHL+SSSF+LNEEM
Sbjct  57   ISQVELPTRSESEAVEEKDAEEASKPKLKPLHWDKVRASSDREMVWDHLRSSSFKLNEEM  116

Query  352  IETLFMVNSNSDGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEV  504
            IETLF+  +      R ++P  NQ+NRVLDPKK+QNIAILLRA+NVT EEV
Sbjct  117  IETLFVAKTPKQATPRSVLPSPNQDNRVLDPKKAQNIAILLRAINVTVEEV  167



>ref|XP_007153716.1| hypothetical protein PHAVU_003G059000g [Phaseolus vulgaris]
 gb|ESW25710.1| hypothetical protein PHAVU_003G059000g [Phaseolus vulgaris]
Length=865

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 94/125 (75%), Gaps = 17/125 (14%)
 Frame = +1

Query  214  AVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGV  393
            +V K +EET+KPKLK LHWDKV+ASSDRVMVWD L+ SSFQLNE+MIETLF+VN++ +G 
Sbjct  402  SVRKESEETLKPKLKALHWDKVKASSDRVMVWDQLRPSSFQLNEDMIETLFVVNNSKEGF  461

Query  394  KRPL--------------MPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTA  531
               +              MPL   ENRVLDPKKSQNIAILLRALNVT +EVC+AL EG  
Sbjct  462  GVAIRDNGRRNIVHSASPMPL---ENRVLDPKKSQNIAILLRALNVTIDEVCDALREGNC  518

Query  532  DSLGT  546
            D+LGT
Sbjct  519  DTLGT  523



>emb|CDY15092.1| BnaC03g44530D [Brassica napus]
Length=1059

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 88/111 (79%), Gaps = 6/111 (5%)
 Frame = +1

Query  232  EETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNS------NSDGV  393
            EET KPKLK LHWDKVRASSDR MVWD L+SSSF+L+EEMIETLF+  S       S   
Sbjct  605  EETPKPKLKALHWDKVRASSDREMVWDQLRSSSFKLDEEMIETLFVAKSLDSKPNQSQTT  664

Query  394  KRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
             R  +P  NQENRVLDPKK+QNIAILLRALNVT EEVCEAL+EG A++LGT
Sbjct  665  PRCALPSPNQENRVLDPKKAQNIAILLRALNVTIEEVCEALLEGNAETLGT  715



>gb|AAF24497.1|AF213696_1 FH protein NFH2 [Nicotiana tabacum]
Length=835

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 101/138 (73%), Gaps = 7/138 (5%)
 Frame = +1

Query  145  PMLVPPSRPVVSQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKS  324
            P+L+ P      QNV    HS E  E+++EE +KPKLK LHWDKVRASSD  MVWD LKS
Sbjct  358  PVLISPMEKN-DQNVE--NHSIEKNEEKSEEILKPKLKTLHWDKVRASSDCEMVWDQLKS  414

Query  325  SSFQLNEEMIETLFMVN----SNSDGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVT  492
            SSF+LNEEMIETLF+V     + S   K  ++  ++QENRVLDPKKSQNIAILLR LN T
Sbjct  415  SSFKLNEEMIETLFVVKNPTLNTSATAKHFVVSSMSQENRVLDPKKSQNIAILLRVLNGT  474

Query  493  AEEVCEALVEGTADSLGT  546
             EE+CEA +EG A+++GT
Sbjct  475  TEEICEAFLEGNAENIGT  492



>ref|XP_006849329.1| hypothetical protein AMTR_s00164p00033930 [Amborella trichopoda]
 gb|ERN10910.1| hypothetical protein AMTR_s00164p00033930 [Amborella trichopoda]
Length=929

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 87/109 (80%), Gaps = 4/109 (4%)
 Frame = +1

Query  229  NEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVK  396
            N ET +P+LKPLHWDKVRASSDR MVWD LK SSFQLNE+MIETLF+ N  +    D  K
Sbjct  485  NGETPRPRLKPLHWDKVRASSDRAMVWDRLKPSSFQLNEDMIETLFVCNPANNVPKDVSK  544

Query  397  RPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
              + PLL QE+RVLDPKKSQNIAILLRALNVT EEVCEAL+EG  + LG
Sbjct  545  ISVPPLLGQESRVLDPKKSQNIAILLRALNVTREEVCEALLEGNPEGLG  593



>ref|XP_010679014.1| PREDICTED: formin-like protein 1 [Beta vulgaris subsp. vulgaris]
Length=1097

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 91/110 (83%), Gaps = 4/110 (4%)
 Frame = +1

Query  229  NEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNS----NSDGVK  396
            +E T K KLKPLHWDKVRASSDR MVWD L+SSSF+LNEEMIETLF+VN+      +  +
Sbjct  640  DETTPKLKLKPLHWDKVRASSDREMVWDQLRSSSFKLNEEMIETLFVVNTPNPNQKEMAR  699

Query  397  RPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            +P+ P   QE+RVLDPKK+QNIAILLRALNVT EEVCEAL+EG A++LGT
Sbjct  700  KPVQPSPLQEDRVLDPKKAQNIAILLRALNVTMEEVCEALLEGNAETLGT  749



>gb|EYU46079.1| hypothetical protein MIMGU_mgv1a0011872mg, partial [Erythranthe 
guttata]
Length=676

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 110/178 (62%), Gaps = 32/178 (18%)
 Frame = +1

Query  109  RFWE------PPVMDGG--PPMLVPPSRPVVSQN------------------VAEVKHSS  210
            + WE      PP    G  PP+L  PSRP+  ++                  +  V+ S 
Sbjct  169  KVWESPQTPTPPSKKPGFQPPVLAVPSRPIALESPTLISPFVFPSHGDVVSPIYNVELSV  228

Query  211  EAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNS---N  381
            +  +  +E T KPKLK LHWDKVRASSDR M+WD LK SSF+LNEEMIETLF+VN+   N
Sbjct  229  QDAKGNDESTPKPKLKTLHWDKVRASSDREMIWDQLKCSSFKLNEEMIETLFVVNTPKPN  288

Query  382  SDGVKR-PLMPLLNQE--NRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            S    R  ++P   QE  N VLDPKK+QNIAILLRALNVT EEVCE L+EG  D+LGT
Sbjct  289  SKETNRWQVLPSPGQENGNNVLDPKKAQNIAILLRALNVTVEEVCEGLLEGNTDTLGT  346



>ref|XP_007047509.1| Formin [Theobroma cacao]
 gb|EOX91666.1| Formin [Theobroma cacao]
Length=915

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 98/129 (76%), Gaps = 8/129 (6%)
 Frame = +1

Query  181  QNVAEVKH----SSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEE  348
            ++  EV H    SSE  +K + ++ KPKLKPLHWDKVRA+S+R  VWD LKSSSFQLNE+
Sbjct  449  KSTEEVNHKGASSSEKTDKDDMDSAKPKLKPLHWDKVRATSERATVWDQLKSSSFQLNED  508

Query  349  MIETLFMVNSNSDG----VKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEAL  516
            M+ETLF  NS +      ++R ++P + QENRVLDPKKSQNIAILLRALNVT +EV EAL
Sbjct  509  MMETLFGCNSTNSAPKEPIRRSVLPPVEQENRVLDPKKSQNIAILLRALNVTRDEVSEAL  568

Query  517  VEGTADSLG  543
            ++G  +SLG
Sbjct  569  LDGNPESLG  577



>sp|Q8S0F0.1|FH1_ORYSJ RecName: Full=Formin-like protein 1; AltName: Full=OsFH1; Flags: 
Precursor [Oryza sativa Japonica Group]
 dbj|BAB86073.1| putative FH protein NFH2 [Oryza sativa Japonica Group]
 dbj|BAC06896.1| putative FH protein NFH2 [Oryza sativa Japonica Group]
Length=960

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 89/113 (79%), Gaps = 6/113 (5%)
 Frame = +1

Query  223  KRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVN-SNSD----  387
            K  E T +PKLKPLHWDKVRASSDRVMVWD LKSSSFQ+NEEMIETLF+ N +NS     
Sbjct  497  KSEETTPRPKLKPLHWDKVRASSDRVMVWDQLKSSSFQVNEEMIETLFICNPANSAPPKE  556

Query  388  -GVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
               +RP++P    +N+VLDPKKSQNIAILLRALNV+ E+VC+AL EG  ++ G
Sbjct  557  PATRRPVLPTPKTDNKVLDPKKSQNIAILLRALNVSKEQVCDALCEGNTENFG  609



>ref|XP_009410734.1| PREDICTED: formin-like protein 1 [Musa acuminata subsp. malaccensis]
Length=928

 Score =   152 bits (384),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 95/117 (81%), Gaps = 5/117 (4%)
 Frame = +1

Query  199  KHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNS  378
            + +S+ +EK  E+T +PKLKPLHWDKV+ASS+R MVWD LKSSSFQ+NEEMIETLF+  +
Sbjct  464  RENSDEMEK-TEDTPRPKLKPLHWDKVQASSNRAMVWDQLKSSSFQVNEEMIETLFISKA  522

Query  379  NS----DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADS  537
             +    +  K  ++PL  QEN+VLDPKKSQNIAILLRALNVT EEVCEAL+EG ADS
Sbjct  523  TNAKPKETTKWQVLPLPTQENKVLDPKKSQNIAILLRALNVTKEEVCEALLEGNADS  579



>ref|XP_010942818.1| PREDICTED: LOW QUALITY PROTEIN: formin-like protein 8 [Elaeis 
guineensis]
Length=850

 Score =   151 bits (382),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 87/108 (81%), Gaps = 4/108 (4%)
 Frame = +1

Query  232  EETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKR  399
            E   KP+LKPLHWD+VRASSDR MVWD LKSS+FQLNE+MIETLF+  + +    D  +R
Sbjct  408  EGDTKPRLKPLHWDRVRASSDRPMVWDQLKSSTFQLNEDMIETLFVNTATTPTPKDNNRR  467

Query  400  PLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
            P++PL  QENRVLDPKKSQNIAILLRALNVT EEV EAL++G  + LG
Sbjct  468  PVLPLFKQENRVLDPKKSQNIAILLRALNVTREEVSEALLDGNPECLG  515



>ref|XP_010272423.1| PREDICTED: formin-like protein 6 [Nelumbo nucifera]
Length=906

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 90/118 (76%), Gaps = 5/118 (4%)
 Frame = +1

Query  205  SSEAVEKRNE-ETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNS-  378
            SSE +   N+ +  KP+LKPLHWDKVRASSDR MVWD LKSSSFQLNE MIETLF  NS 
Sbjct  451  SSEQLNAGNDIDGAKPRLKPLHWDKVRASSDRAMVWDQLKSSSFQLNENMIETLFGCNSA  510

Query  379  ---NSDGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
                 +  +R ++P + QENRVLDPKKSQNIAILLRALNVT +EV EAL++G  D LG
Sbjct  511  NSVQKEATRRSVLPPVEQENRVLDPKKSQNIAILLRALNVTRDEVSEALLDGNPDGLG  568



>dbj|BAJ89494.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=947

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 101/162 (62%), Gaps = 18/162 (11%)
 Frame = +1

Query  112  FWEPPVMDGGP------PMLVPP-------SRPVVSQNVAEVKHSSEAVEKRNEETMKPK  252
            +WE  V   G       P L PP       S P        ++ ++   +K  E T +PK
Sbjct  437  YWESRVRKPGTSKEAMSPALSPPPQAANLRSVPPTDAFPGRLQDNAGHGDKSEETTPRPK  496

Query  253  LKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVN----SNSDGVKRPLMPLLN  420
            LKPLHWDKVRASSDR MVWD LKSSSFQ+NEEMIETLF+ N    +  +  KRP +P   
Sbjct  497  LKPLHWDKVRASSDRAMVWDQLKSSSFQVNEEMIETLFICNPANAAPKEATKRPALPTPK  556

Query  421  QENRV-LDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
             EN+V LDPKK+QNIAILLRALNVT EEVCEAL EG   + G
Sbjct  557  AENKVLLDPKKAQNIAILLRALNVTKEEVCEALCEGNTQNFG  598



>ref|XP_008787184.1| PREDICTED: formin-like protein 8 [Phoenix dactylifera]
Length=845

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 88/108 (81%), Gaps = 4/108 (4%)
 Frame = +1

Query  232  EETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKR  399
            E   KP+LKPLHWD+VRA+SDR MVWD LKSS+FQLNE+M ETLF+ N+ +    D  +R
Sbjct  403  EGDTKPRLKPLHWDRVRATSDRPMVWDQLKSSTFQLNEDMFETLFVNNATTPTPKDNNRR  462

Query  400  PLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
            P++PLL QE+RVLDPKKSQNIAILLRALNVT EEV EAL++G  + LG
Sbjct  463  PVLPLLKQEHRVLDPKKSQNIAILLRALNVTREEVSEALLDGNPECLG  510



>ref|XP_010559076.1| PREDICTED: LOW QUALITY PROTEIN: formin-like protein 6 [Tarenaya 
hassleriana]
Length=925

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 98/133 (74%), Gaps = 5/133 (4%)
 Frame = +1

Query  157  PPSRPVVSQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQ  336
            P S+PV   N ++   SSE       ++ +P+LKPLHWDKVRASSDR  VWD LKSSSFQ
Sbjct  448  PKSKPVEEVN-SKSGGSSEKTGDTETDSGRPRLKPLHWDKVRASSDRATVWDQLKSSSFQ  506

Query  337  LNEEMIETLFMVNS-NS---DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEV  504
            LNE+ +E LF  NS NS   + V+R ++P +  ENRVLDPKKSQNIAILLRALNVT EEV
Sbjct  507  LNEDRMEHLFGCNSANSAPKESVRRSVLPAVENENRVLDPKKSQNIAILLRALNVTREEV  566

Query  505  CEALVEGTADSLG  543
             EAL++G ADSLG
Sbjct  567  SEALLDGNADSLG  579



>gb|EYU40678.1| hypothetical protein MIMGU_mgv1a000530mg [Erythranthe guttata]
Length=1092

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 95/124 (77%), Gaps = 6/124 (5%)
 Frame = +1

Query  193  EVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMV  372
            E ++S+E V++  E T+KPKLKPLHWDKVRASSDR MVWD LK SSF+LNEEMIETLF+V
Sbjct  655  EKEYSTENVDRNEESTLKPKLKPLHWDKVRASSDREMVWDQLKCSSFKLNEEMIETLFIV  714

Query  373  NSNSDGVKRP----LMPLLNQEN--RVLDPKKSQNIAILLRALNVTAEEVCEALVEGTAD  534
            N+     K      ++P   Q+N  RVLDPKK+QNIAILL+AL+VT +EVCE L+EG  D
Sbjct  715  NTPKPNPKEAARWQVLPPPGQDNGDRVLDPKKAQNIAILLKALHVTVDEVCEGLLEGNTD  774

Query  535  SLGT  546
             LGT
Sbjct  775  LLGT  778



>ref|XP_010506281.1| PREDICTED: formin-like protein 2 [Camelina sativa]
Length=914

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 88/111 (79%), Gaps = 4/111 (4%)
 Frame = +1

Query  223  KRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVKRP  402
            ++ EET+KPKLKPLHWDKVRASS   MVWD +KS+SFQ+NEEMIETLF VN  S   +  
Sbjct  455  EKKEETLKPKLKPLHWDKVRASSSHAMVWDQIKSNSFQVNEEMIETLFKVNDPSSRTREA  514

Query  403  LMPLL----NQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
            ++       NQEN+ LDP+KS NIAILLRALNVTA+EVCEALVEG +D+LG
Sbjct  515  VVVQSGNQENQENQFLDPRKSHNIAILLRALNVTADEVCEALVEGNSDTLG  565



>gb|EMS67119.1| Formin-like protein 1 [Triticum urartu]
Length=516

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 99/144 (69%), Gaps = 12/144 (8%)
 Frame = +1

Query  145  PMLVPPSRPVVSQNV-------AEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVM  303
            P L PP +   S++V         ++ +++  +K  E T +PKLKPLHWDKVRASSDR M
Sbjct  8    PALSPPPQAANSRSVPPTDAFPGRLQDNADHGDKSEETTPRPKLKPLHWDKVRASSDRAM  67

Query  304  VWDHLKSSSFQLNEEMIETLFMVN----SNSDGVKRPLMPLLNQENRV-LDPKKSQNIAI  468
            VWD LKSSSFQ+NEEMIETLF+ N    +  +  KRP +P    EN+V LDPKK+QNIAI
Sbjct  68   VWDQLKSSSFQVNEEMIETLFICNPANAAPKEATKRPALPTPKAENKVLLDPKKAQNIAI  127

Query  469  LLRALNVTAEEVCEALVEGTADSL  540
            LLRALNVT EEVCEAL E   + L
Sbjct  128  LLRALNVTKEEVCEALCEAFTNML  151



>ref|XP_009404931.1| PREDICTED: formin-like protein 1 [Musa acuminata subsp. malaccensis]
Length=918

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 108/152 (71%), Gaps = 13/152 (9%)
 Frame = +1

Query  112  FWEPPVMDGGPPMLVPPSRPVVSQNVAEV-----KHSSEAVEKRNEETMKPKLKPLHWDK  276
            +WE  +    PP+++P  +  V  + A V     + +S+ +EK NEET + KLKPLHWDK
Sbjct  423  YWESRIRK--PPVILPHKQVGVKNSSASVYPADSRGNSDEMEK-NEETRRRKLKPLHWDK  479

Query  277  VRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSN----SDGVKRPLMPLLNQEN-RVLD  441
            V+A S+R MVWD L+SSSFQ+NEEMIETLF+ N+      +  K+ L+P   Q N +VLD
Sbjct  480  VQARSNRAMVWDQLQSSSFQVNEEMIETLFVSNATDAKPKETNKQQLLPSQTQANDKVLD  539

Query  442  PKKSQNIAILLRALNVTAEEVCEALVEGTADS  537
            PKKSQNIAILLRALNVT EEVCEAL+EG ADS
Sbjct  540  PKKSQNIAILLRALNVTNEEVCEALLEGNADS  571



>ref|XP_004505397.1| PREDICTED: formin-like protein 2-like, partial [Cicer arietinum]
Length=802

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 102/159 (64%), Gaps = 36/159 (23%)
 Frame = +1

Query  109  RFWEPPVMDGGPPMLVPPSRPVVSQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRAS  288
            RF+E PV +              SQNV      +  V    EE +KPKLK LHWDKV+AS
Sbjct  327  RFYETPVTE--------------SQNV------NVDVRTETEEILKPKLKALHWDKVKAS  366

Query  289  SDRVMVWDHLKSSSFQLNEEMIETLFMVN--------SNSDGVKRPL-----MPLLNQEN  429
            SDR MVWD L+ SSFQLNE+MIE+LFM+N        ++ D  +R +     +PL   EN
Sbjct  367  SDRAMVWDQLRPSSFQLNEDMIESLFMLNNFNGNSGLAHKDNARRQIIHPSSLPL---EN  423

Query  430  RVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            RVLDPKKSQNIAILLRALNVT +EVCE+L EG  D+LGT
Sbjct  424  RVLDPKKSQNIAILLRALNVTIDEVCESLREGNCDTLGT  462



>ref|XP_010247659.1| PREDICTED: formin-like protein 6 [Nelumbo nucifera]
Length=910

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 99/146 (68%), Gaps = 7/146 (5%)
 Frame = +1

Query  118  EPPVMDGGPPMLVPPSRPVVSQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDR  297
            E P+++      +P S   ++Q     KH        + +  KP+LKPLHWDKVRA+SDR
Sbjct  430  EMPILNAASGTKIPVSNSEINQGGNSSKHLDSG---DDLDGAKPRLKPLHWDKVRATSDR  486

Query  298  VMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLNQENRVLDPKKSQNIA  465
             MVWD L SSSFQLNE+MIETLF  NS +    +  +R ++P + QENR+LDPKKSQNIA
Sbjct  487  AMVWDRLNSSSFQLNEDMIETLFGCNSTNVVQKEANRRTVLPRIEQENRILDPKKSQNIA  546

Query  466  ILLRALNVTAEEVCEALVEGTADSLG  543
            ILLRALNVT +EV EAL++G  D LG
Sbjct  547  ILLRALNVTRDEVTEALLDGNPDGLG  572



>ref|XP_010102774.1| Formin-like protein 6 [Morus notabilis]
 gb|EXB94058.1| Formin-like protein 6 [Morus notabilis]
Length=910

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 91/118 (77%), Gaps = 5/118 (4%)
 Frame = +1

Query  205  SSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS  384
            SSEA +  +    KPKLKPLHWDKVRA+SDR  VWD LK+SSFQLNE+M+E+LF  NS +
Sbjct  460  SSEAFDADDSGGTKPKLKPLHWDKVRATSDRATVWDQLKASSFQLNEDMMESLFGCNSTT  519

Query  385  -----DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
                 + ++R ++P + QENRVLDPKKSQNIAILLRALNVT +EV EAL++G  + LG
Sbjct  520  NSAPKEAIRRSVLPPVEQENRVLDPKKSQNIAILLRALNVTRDEVSEALLDGNPEGLG  577



>ref|XP_008338434.1| PREDICTED: formin-like protein 6 [Malus domestica]
Length=888

 Score =   149 bits (375),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 93/124 (75%), Gaps = 4/124 (3%)
 Frame = +1

Query  187  VAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLF  366
            V E   SSE+ E  +    KPKLKPLHWDKVRA+SDR  VWD LKSSSFQLNE+M+ETLF
Sbjct  429  VDESLASSESFENEDSGGAKPKLKPLHWDKVRATSDRATVWDQLKSSSFQLNEDMMETLF  488

Query  367  MVN-SNS---DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTAD  534
              N +NS   +  +R ++P + QENRVLDPKKSQNIAILLRALNV  +EV EAL++G  +
Sbjct  489  GCNPANSVPKETTRRSVLPPVEQENRVLDPKKSQNIAILLRALNVARDEVTEALLDGNPE  548

Query  535  SLGT  546
             LGT
Sbjct  549  GLGT  552



>dbj|BAJ87196.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=888

 Score =   149 bits (375),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 97/141 (69%), Gaps = 7/141 (5%)
 Frame = +1

Query  139  GPPMLVPPSRPVVSQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHL  318
            GP + +P   P+ +   AE   S+    + +     PKLKPLHWDKVRA+SDR MVWD L
Sbjct  419  GPRIAMP--MPITAATAAEYNGSTSMRAEDDAAGGLPKLKPLHWDKVRATSDRAMVWDQL  476

Query  319  KSSSFQLNEEMIETLFMVNS-----NSDGVKRPLMPLLNQENRVLDPKKSQNIAILLRAL  483
            KSSSFQL+E+MIE LFM NS       D  ++P +P   QE RVLDPKK+QNIAILLRAL
Sbjct  477  KSSSFQLDEDMIEALFMNNSMPAAPPRDAGRKPAVPPFRQEERVLDPKKAQNIAILLRAL  536

Query  484  NVTAEEVCEALVEGTADSLGT  546
            NVT EEV +AL++G A+ LG+
Sbjct  537  NVTREEVSDALLDGNAECLGS  557



>ref|XP_004144462.1| PREDICTED: uncharacterized protein LOC101211678 [Cucumis sativus]
Length=1076

 Score =   149 bits (376),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 101/123 (82%), Gaps = 3/123 (2%)
 Frame = +1

Query  184  NVAEVKHSS-EAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIET  360
            NV+ ++ SS ++  + +E+T KPKLKPLHWDKVRASSDR MVWD L+SSSF++NEEMIE+
Sbjct  611  NVSPIQLSSCKSNGESSEDTPKPKLKPLHWDKVRASSDREMVWDQLRSSSFKVNEEMIES  670

Query  361  LFMVN-SNS-DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTAD  534
            LF+VN SNS +   R ++P  NQE  VLDPKKSQNIAI LRA+NVT EEVC+AL+EG A+
Sbjct  671  LFIVNTSNSKETTPRTVLPPPNQEIGVLDPKKSQNIAIALRAINVTIEEVCDALLEGNAE  730

Query  535  SLG  543
            +LG
Sbjct  731  ALG  733



>ref|XP_004162652.1| PREDICTED: uncharacterized LOC101211678 [Cucumis sativus]
Length=1079

 Score =   149 bits (376),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 101/123 (82%), Gaps = 3/123 (2%)
 Frame = +1

Query  184  NVAEVKHSS-EAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIET  360
            NV+ ++ SS ++  + +E+T KPKLKPLHWDKVRASSDR MVWD L+SSSF++NEEMIE+
Sbjct  614  NVSPIQLSSCKSNGESSEDTPKPKLKPLHWDKVRASSDREMVWDQLRSSSFKVNEEMIES  673

Query  361  LFMVN-SNS-DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTAD  534
            LF+VN SNS +   R ++P  NQE  VLDPKKSQNIAI LRA+NVT EEVC+AL+EG A+
Sbjct  674  LFIVNTSNSKETTPRTVLPPPNQEIGVLDPKKSQNIAIALRAINVTIEEVCDALLEGNAE  733

Query  535  SLG  543
            +LG
Sbjct  734  ALG  736



>gb|KGN58390.1| hypothetical protein Csa_3G636390 [Cucumis sativus]
Length=1121

 Score =   149 bits (376),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 101/123 (82%), Gaps = 3/123 (2%)
 Frame = +1

Query  184  NVAEVKHSS-EAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIET  360
            NV+ ++ SS ++  + +E+T KPKLKPLHWDKVRASSDR MVWD L+SSSF++NEEMIE+
Sbjct  656  NVSPIQLSSCKSNGESSEDTPKPKLKPLHWDKVRASSDREMVWDQLRSSSFKVNEEMIES  715

Query  361  LFMVN-SNS-DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTAD  534
            LF+VN SNS +   R ++P  NQE  VLDPKKSQNIAI LRA+NVT EEVC+AL+EG A+
Sbjct  716  LFIVNTSNSKETTPRTVLPPPNQEIGVLDPKKSQNIAIALRAINVTIEEVCDALLEGNAE  775

Query  535  SLG  543
            +LG
Sbjct  776  ALG  778



>emb|CDX83457.1| BnaA03g20490D [Brassica napus]
Length=843

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 86/110 (78%), Gaps = 4/110 (4%)
 Frame = +1

Query  226  RNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVK---  396
            + EET+KPKLK LHWDKVRASS RVMVWD +KS+SFQ+NEEMIETLF  N  S   +   
Sbjct  391  KKEETLKPKLKALHWDKVRASSSRVMVWDQIKSNSFQVNEEMIETLFRANDPSSRARAVG  450

Query  397  -RPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
               ++  +NQEN+ LDP+KS NI ILLRALNVTA+EVCEALVEG AD LG
Sbjct  451  NAGVVQSVNQENQFLDPRKSHNIEILLRALNVTADEVCEALVEGNADMLG  500



>ref|XP_008341046.1| PREDICTED: formin-like protein 6 [Malus domestica]
 ref|XP_008363151.1| PREDICTED: formin-like protein 6 [Malus domestica]
Length=881

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 93/126 (74%), Gaps = 4/126 (3%)
 Frame = +1

Query  178  SQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIE  357
            ++ V E   SSE+ E  +    KPKLKPLHWDKVRA+SDR  VWD LKSSSFQLNE+M+E
Sbjct  419  TEQVVESLASSESFENEDSGGAKPKLKPLHWDKVRATSDRATVWDQLKSSSFQLNEDMME  478

Query  358  TLFMVN-SNS---DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEG  525
            TLF  N  NS   +  +R ++P + QENRVLDPKKSQNIAILLRALNV  +EV EAL++G
Sbjct  479  TLFGCNPGNSVPKETTRRSVLPPVEQENRVLDPKKSQNIAILLRALNVARDEVTEALLDG  538

Query  526  TADSLG  543
              + LG
Sbjct  539  NPEGLG  544



>gb|KJB42650.1| hypothetical protein B456_007G161600 [Gossypium raimondii]
Length=758

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 83/98 (85%), Gaps = 4/98 (4%)
 Frame = +1

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVK----RPLMP  411
            KPKLKPLHWDKVRASSDR MVWDHL+SSSF+LNEEMIETLF+  + +   K    R ++P
Sbjct  656  KPKLKPLHWDKVRASSDREMVWDHLRSSSFKLNEEMIETLFVAKTPNPKPKQATPRSVLP  715

Query  412  LLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEG  525
              NQ+NRVLDPKK+QNIAILLRALNVT EEVCEAL+EG
Sbjct  716  SPNQDNRVLDPKKAQNIAILLRALNVTVEEVCEALLEG  753



>ref|XP_011099366.1| PREDICTED: formin-like protein 6 [Sesamum indicum]
Length=891

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 89/117 (76%), Gaps = 4/117 (3%)
 Frame = +1

Query  205  SSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS  384
            SSE  +  + +  KPKLKPLHWDKVRA+SDR  VWD LKSSSFQLNE+ +E+LF  NS +
Sbjct  447  SSEKADSEDRDGSKPKLKPLHWDKVRATSDRATVWDQLKSSSFQLNEDAMESLFGCNSAN  506

Query  385  DG----VKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
             G     ++  +P++ QENRVLDPKKSQNIAILLRALNVT EEV EAL++G  + LG
Sbjct  507  SGPKEATRKSPLPVVEQENRVLDPKKSQNIAILLRALNVTKEEVSEALLDGNLEGLG  563



>gb|KDP32067.1| hypothetical protein JCGZ_12528 [Jatropha curcas]
Length=919

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 91/117 (78%), Gaps = 4/117 (3%)
 Frame = +1

Query  205  SSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS  384
            SSE V+   ++  KPKLKPLHWDKVRA+SDR  VWD LKSSSFQLNE+M+E+LF   S +
Sbjct  465  SSEKVDAEEQDGAKPKLKPLHWDKVRATSDRATVWDQLKSSSFQLNEDMMESLFGCKSTN  524

Query  385  ----DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
                +  +R ++P + QENRVLDPKKSQNIAILLRALNVT +EV EAL++G  +SLG
Sbjct  525  SVPKEPTRRSVLPPVEQENRVLDPKKSQNIAILLRALNVTRDEVSEALLDGNPESLG  581



>ref|XP_008460409.1| PREDICTED: LOW QUALITY PROTEIN: formin-like protein 1 [Cucumis 
melo]
Length=1078

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = +1

Query  229  NEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVN-SNS-DGVKRP  402
            +E+T KPKLKPLHWDKVRASSDR MVWD L+SSSF++NEEMIE+LF+VN SNS +   R 
Sbjct  629  SEDTPKPKLKPLHWDKVRASSDREMVWDQLRSSSFKVNEEMIESLFIVNTSNSKETTPRT  688

Query  403  LMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
            ++P  NQE  VLDPKKSQNIAI LRA+NVT EEVC+AL+EG A++LG
Sbjct  689  VLPPPNQEIGVLDPKKSQNIAIALRAINVTIEEVCDALLEGNAEALG  735



>tpg|DAA40550.1| TPA: hypothetical protein ZEAMMB73_701061 [Zea mays]
Length=260

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 83/104 (80%), Gaps = 4/104 (4%)
 Frame = +1

Query  247  PKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVN----SNSDGVKRPLMPL  414
            PKLKPLHWDKVRASS R  VWD LK+SSF++NEEMIETLF+ N    S+  G+K P    
Sbjct  78   PKLKPLHWDKVRASSGRPTVWDQLKASSFRVNEEMIETLFVSNSTWRSSKSGIKAPNSSS  137

Query  415  LNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
             +QEN+VLDPKKSQNIAI+LRALN T EEVC AL++G A+SLG+
Sbjct  138  CSQENKVLDPKKSQNIAIMLRALNATKEEVCRALLDGQAESLGS  181



>ref|XP_009135921.1| PREDICTED: formin-like protein 2 [Brassica rapa]
Length=895

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 85/110 (77%), Gaps = 4/110 (4%)
 Frame = +1

Query  226  RNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGV  393
            + EET+KPKLK LHWDKVRASS RVMVWD +KS+SFQ+NEEMIETLF  N  S    D  
Sbjct  437  KKEETLKPKLKALHWDKVRASSSRVMVWDQIKSNSFQVNEEMIETLFRANDPSSRARDVG  496

Query  394  KRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
               ++   NQEN+ LDP+KS NI ILLRALNVTA+EVCEALVEG AD LG
Sbjct  497  NAGVVQSANQENQFLDPRKSHNIEILLRALNVTADEVCEALVEGNADMLG  546



>ref|XP_009384269.1| PREDICTED: formin-like protein 1 [Musa acuminata subsp. malaccensis]
Length=672

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 104/150 (69%), Gaps = 10/150 (7%)
 Frame = +1

Query  109  RFWEPPVMDG---GPPMLVPPSRPVVSQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKV  279
            R WE  V +     PP  + P  P  ++    + + +  VEK+ +E  +PKLKPLHWDKV
Sbjct  178  RHWESQVRESLARKPP--IAPPEPTGTKAPPALVNPTYEVEKK-KEGPRPKLKPLHWDKV  234

Query  280  RASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLNQENRVLDPK  447
            +ASS R MVWD LKSSSF+++EEMIETLF+ N+ +    +  K+ + P+  QENRVLD K
Sbjct  235  QASSKRAMVWDQLKSSSFRVDEEMIETLFVCNATNGTPKETNKQQVRPVPTQENRVLDQK  294

Query  448  KSQNIAILLRALNVTAEEVCEALVEGTADS  537
            KSQNIAILLRALNVT EEVCEAL EG ADS
Sbjct  295  KSQNIAILLRALNVTKEEVCEALSEGNADS  324



>ref|NP_201548.1| formin-like protein 6 [Arabidopsis thaliana]
 sp|Q9FJX6.1|FH6_ARATH RecName: Full=Formin-like protein 6; Short=AtFH6; Short=AtFORMIN-6; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB08455.1| formin-like protein [Arabidopsis thaliana]
 gb|AAQ99143.1| formin-like protein AtFH6 [Arabidopsis thaliana]
 gb|AED98348.1| formin-like protein 6 [Arabidopsis thaliana]
Length=899

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 81/104 (78%), Gaps = 4/104 (4%)
 Frame = +1

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDG----VKRPLMP  411
            KPKLKPLHWDKVRASSDR  VWD LKSSSFQLNE+ +E LF  NS S      V+R ++P
Sbjct  459  KPKLKPLHWDKVRASSDRATVWDQLKSSSFQLNEDRMEHLFGCNSGSSAPKEPVRRSVIP  518

Query  412  LLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
            L   ENRVLDPKKSQNIAILLRALNVT EEV EAL +G  +SLG
Sbjct  519  LAENENRVLDPKKSQNIAILLRALNVTREEVSEALTDGNPESLG  562



>gb|KJB43902.1| hypothetical protein B456_007G222600 [Gossypium raimondii]
Length=923

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 92/118 (78%), Gaps = 5/118 (4%)
 Frame = +1

Query  205  SSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS  384
            SSE  +  + ++ KPKLKPLHWDKVRA+S+R  VWD +KS+SFQLNE+M+ETLF  NS +
Sbjct  468  SSEKTDGDDMDSAKPKLKPLHWDKVRATSERATVWDQIKSNSFQLNEDMMETLFGCNSTT  527

Query  385  DG-----VKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
                   ++R ++P + QENRVLDPKKSQNIAILLRALNVT +EV EAL++G  +SLG
Sbjct  528  AAPPKEPIRRSVLPPVKQENRVLDPKKSQNIAILLRALNVTRDEVSEALLDGNPESLG  585



>emb|CDP02594.1| unnamed protein product [Coffea canephora]
Length=897

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 92/118 (78%), Gaps = 4/118 (3%)
 Frame = +1

Query  202  HSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSN  381
            +SSE  +  + + ++PKLKPLHWDKVRA+SDR  VWD LKSSSFQLNE+M+E+LF  NS 
Sbjct  441  NSSERHDGDDMDGLRPKLKPLHWDKVRATSDRATVWDQLKSSSFQLNEDMMESLFGCNSA  500

Query  382  S----DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
            +    +  ++ ++P + QENRVLDPKKSQNIAILLRALNVT EEV EAL++G  + LG
Sbjct  501  ASVPKEATRKSVLPPVEQENRVLDPKKSQNIAILLRALNVTREEVSEALIDGNPEGLG  558



>gb|KHN23239.1| Formin-like protein 6 [Glycine soja]
Length=549

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 88/123 (72%), Gaps = 9/123 (7%)
 Frame = +1

Query  205  SSEAVEKRNE----ETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMV  372
            SSE V KR E    +  KPKLK LHWDKV A+SDR  VWD LKSSSFQLNE+M+ETLF  
Sbjct  90   SSEEVYKRREGDDVDGAKPKLKALHWDKVSATSDRATVWDQLKSSSFQLNEDMMETLFGC  149

Query  373  NSNSDGVK-----RPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADS  537
             S     K     R ++P +  ENRVLDPKKSQNIAILLRALNVT +EVCEAL++G  + 
Sbjct  150  KSTGSAFKESVTRRSVLPPVEPENRVLDPKKSQNIAILLRALNVTRDEVCEALLDGNPEG  209

Query  538  LGT  546
            LGT
Sbjct  210  LGT  212



>ref|XP_004985288.1| PREDICTED: formin-like protein 8-like [Setaria italica]
Length=948

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 5/106 (5%)
 Frame = +1

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNS-----NSDGVKRPLM  408
            +PKLKPLHWDKVRA+SDR MVWD LKSSSFQL+E+MIE LFM NS     + D  ++  +
Sbjct  508  RPKLKPLHWDKVRATSDRAMVWDQLKSSSFQLDEDMIEALFMNNSTPAVPSRDAGRKATV  567

Query  409  PLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            P L QE+RVLDPKK+QNIAILLRALNVT EEV +AL++G A+ LGT
Sbjct  568  PPLRQEDRVLDPKKAQNIAILLRALNVTREEVSDALLDGNAECLGT  613



>emb|CDY17909.1| BnaC04g03100D [Brassica napus]
Length=848

 Score =   146 bits (369),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 89/109 (82%), Gaps = 1/109 (1%)
 Frame = +1

Query  223  KRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVKRP  402
            ++ EET+KPKLKPLHWDKVRASS RV VWD +KS+SFQ+NEEMIETLF  N  +   K  
Sbjct  389  EKKEETLKPKLKPLHWDKVRASSSRVTVWDQIKSNSFQVNEEMIETLFRANDPTSRTKES  448

Query  403  LMP-LLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            +   +++ +++ LDP+KS NIAILLRALNVTA+EVCEALVEG +D+LG+
Sbjct  449  VTTDVVHSKSQFLDPRKSHNIAILLRALNVTADEVCEALVEGNSDALGS  497



>ref|XP_004957365.1| PREDICTED: formin-like protein 15-like [Setaria italica]
Length=773

 Score =   146 bits (368),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 85/104 (82%), Gaps = 4/104 (4%)
 Frame = +1

Query  247  PKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNS----NSDGVKRPLMPL  414
            PKLKPLHWDKVRASS R  VWD LK+SSF++NEEMIETLF+ NS    +  GV+ P   L
Sbjct  330  PKLKPLHWDKVRASSGRPTVWDQLKASSFRVNEEMIETLFVSNSTRRSSKSGVRGPNSSL  389

Query  415  LNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
             +QEN+VLDPKKSQNIAI+LRALN T EEVC+AL++G A+SLGT
Sbjct  390  CSQENKVLDPKKSQNIAIMLRALNATKEEVCKALLDGQAESLGT  433



>ref|NP_001145885.1| uncharacterized protein LOC100279401 [Zea mays]
 gb|ACL52788.1| unknown [Zea mays]
Length=565

 Score =   144 bits (362),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 83/104 (80%), Gaps = 4/104 (4%)
 Frame = +1

Query  247  PKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVN----SNSDGVKRPLMPL  414
            PKLKPLHWDKVRASS R  VWD LK+SSF++NEEMIETLF+ N    S+  G K P   L
Sbjct  125  PKLKPLHWDKVRASSGRPTVWDQLKASSFRVNEEMIETLFVSNSTRRSSKSGTKGPNSSL  184

Query  415  LNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
             +QEN+VLDPKKSQNIAI+LRA N T EEVC+AL++G A+SLGT
Sbjct  185  CSQENKVLDPKKSQNIAIMLRARNATKEEVCKALLDGQAESLGT  228



>ref|XP_002866702.1| hypothetical protein ARALYDRAFT_919956 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42961.1| hypothetical protein ARALYDRAFT_919956 [Arabidopsis lyrata subsp. 
lyrata]
Length=895

 Score =   146 bits (368),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 80/104 (77%), Gaps = 4/104 (4%)
 Frame = +1

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDG----VKRPLMP  411
            KPKLKPLHWDKVRASSDR  VWD LKSSSFQLNE+ +E LF  NS S      V+R +MP
Sbjct  455  KPKLKPLHWDKVRASSDRATVWDQLKSSSFQLNEDRMEHLFGCNSGSSAPKEPVRRSMMP  514

Query  412  LLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
                ENRVLDPKKSQNIAILLRALNVT EEV EAL +G  +SLG
Sbjct  515  PAENENRVLDPKKSQNIAILLRALNVTREEVSEALTDGNPESLG  558



>ref|XP_009411057.1| PREDICTED: formin-like protein 8 [Musa acuminata subsp. malaccensis]
Length=849

 Score =   145 bits (367),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 97/135 (72%), Gaps = 7/135 (5%)
 Frame = +1

Query  154  VPPSRPVVSQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSF  333
            +PPS+     + +  + + EA E   E   KPKLKPLHWDKVRASSDR MVWD LKSSSF
Sbjct  382  LPPSKLGNGVSASSSRRNDEAGEDL-EGDAKPKLKPLHWDKVRASSDRAMVWDQLKSSSF  440

Query  334  QLNEEMIETLFMVNS-----NSDGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAE  498
            QLNE++IETLF+ N+     N    +R ++P   QENRVLDPKKSQNIAILLRALNVT E
Sbjct  441  QLNEDVIETLFVNNATTSIPNDANRRRGVLP-FKQENRVLDPKKSQNIAILLRALNVTRE  499

Query  499  EVCEALVEGTADSLG  543
            EV EAL++G  + LG
Sbjct  500  EVSEALLDGNPECLG  514



>ref|XP_008650145.1| PREDICTED: formin-like protein 1 [Zea mays]
Length=377

 Score =   142 bits (357),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 88/126 (70%), Gaps = 13/126 (10%)
 Frame = +1

Query  160  PSRPVVSQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQL  339
            PSRP  S N  +         K  + T + KLKPLHWDKV+ASSDRVMVWD LKSSSFQ+
Sbjct  255  PSRPPESSNQGD---------KSEDTTPRSKLKPLHWDKVQASSDRVMVWDQLKSSSFQV  305

Query  340  NEEMIETLFMVN----SNSDGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVC  507
            NEEMIETLF+ N       +  +RP++     EN+VLDPKK+QNIAILLRALNVT EEVC
Sbjct  306  NEEMIETLFICNPANAPTKEATRRPVLLTPRAENKVLDPKKAQNIAILLRALNVTKEEVC  365

Query  508  EALVEG  525
            + L EG
Sbjct  366  DVLCEG  371



>ref|XP_009379328.1| PREDICTED: formin-like protein 6 [Pyrus x bretschneideri]
Length=888

 Score =   146 bits (368),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 92/124 (74%), Gaps = 4/124 (3%)
 Frame = +1

Query  187  VAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLF  366
            V E   SSE+ E  +    KPKLKPLHWDKVRA+SDR  VWD LKSSSFQLNE+M+ETLF
Sbjct  429  VDESLASSESFENEDSGGAKPKLKPLHWDKVRATSDRATVWDQLKSSSFQLNEDMMETLF  488

Query  367  MVN-SNS---DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTAD  534
              N +NS   +  +R ++P +  ENRVLDPKKSQNIAILLRALNV  +EV EAL++G  +
Sbjct  489  GCNPANSVPKETTRRSVLPPVELENRVLDPKKSQNIAILLRALNVARDEVTEALLDGNPE  548

Query  535  SLGT  546
             LGT
Sbjct  549  GLGT  552



>ref|XP_002460529.1| hypothetical protein SORBIDRAFT_02g030000 [Sorghum bicolor]
 gb|EER97050.1| hypothetical protein SORBIDRAFT_02g030000 [Sorghum bicolor]
Length=850

 Score =   145 bits (367),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 84/104 (81%), Gaps = 4/104 (4%)
 Frame = +1

Query  247  PKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNS----NSDGVKRPLMPL  414
            PKLKPLHWDKVRASS R  VWD LK+SSF++NEEMIETLF+ NS    +  G K P   L
Sbjct  409  PKLKPLHWDKVRASSGRPTVWDQLKASSFRVNEEMIETLFVSNSTWRSSKSGTKGPNSSL  468

Query  415  LNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
             +QEN+VLDPKKSQNIAI+LRALN T EEVC+AL++G A+SLGT
Sbjct  469  CSQENKVLDPKKSQNIAIMLRALNATKEEVCKALLDGQAESLGT  512



>ref|XP_002279613.1| PREDICTED: formin-like protein 6 [Vitis vinifera]
Length=886

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 84/104 (81%), Gaps = 4/104 (4%)
 Frame = +1

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSN----SDGVKRPLMP  411
            KPKLKPLHWDKVRA+SDR  VWD LKSSSFQLNE+M+ETLF  NS      +  ++ ++P
Sbjct  446  KPKLKPLHWDKVRATSDRATVWDQLKSSSFQLNEDMMETLFGCNSAVSIPKEATRKSVLP  505

Query  412  LLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
             + QENRVLDPKKSQNIAILLRALNVT +EV EAL++G  +SLG
Sbjct  506  PVEQENRVLDPKKSQNIAILLRALNVTRDEVSEALLDGNPESLG  549



>ref|XP_002525264.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37092.1| conserved hypothetical protein [Ricinus communis]
Length=903

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 95/138 (69%), Gaps = 8/138 (6%)
 Frame = +1

Query  154  VPPSRPVVSQN--VAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSS  327
             P  R  +S+N  V      S+  +    +  +PKLKPLHWDKVRA+SDR  VWDHL SS
Sbjct  428  TPSPRAAISKNESVNRGVSLSDKTDAEEHDGGRPKLKPLHWDKVRATSDRATVWDHLNSS  487

Query  328  SFQLNEEMIETLFMVN------SNSDGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNV  489
            SFQLNE+M+ETLF  N      S     +R ++P+++ ENRVLDPKKSQNIAILLRALNV
Sbjct  488  SFQLNEDMMETLFGCNPTNPVLSKEPTTRRSVLPVVDHENRVLDPKKSQNIAILLRALNV  547

Query  490  TAEEVCEALVEGTADSLG  543
            T +EV EAL++G  +SLG
Sbjct  548  TRDEVSEALLDGNPESLG  565



>emb|CBI33699.3| unnamed protein product [Vitis vinifera]
Length=852

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 84/104 (81%), Gaps = 4/104 (4%)
 Frame = +1

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSN----SDGVKRPLMP  411
            KPKLKPLHWDKVRA+SDR  VWD LKSSSFQLNE+M+ETLF  NS      +  ++ ++P
Sbjct  412  KPKLKPLHWDKVRATSDRATVWDQLKSSSFQLNEDMMETLFGCNSAVSIPKEATRKSVLP  471

Query  412  LLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
             + QENRVLDPKKSQNIAILLRALNVT +EV EAL++G  +SLG
Sbjct  472  PVEQENRVLDPKKSQNIAILLRALNVTRDEVSEALLDGNPESLG  515



>ref|XP_007155835.1| hypothetical protein PHAVU_003G235600g [Phaseolus vulgaris]
 gb|ESW27829.1| hypothetical protein PHAVU_003G235600g [Phaseolus vulgaris]
Length=902

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 94/132 (71%), Gaps = 9/132 (7%)
 Frame = +1

Query  178  SQNVAEVKHSSEAVEKRNE----ETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNE  345
            + +V+  K  SE VEKR+     + +KPKLK LHWDKV A+SDR  VWD LKSSSFQLNE
Sbjct  434  ANSVSVRKGCSEEVEKRHAGDDVDGVKPKLKALHWDKVCATSDRTTVWDQLKSSSFQLNE  493

Query  346  EMIETLFMVNSNSDGVK-----RPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCE  510
            +M+ETLF   S     K     R ++P +  ENRVLDPKKSQNIAILLRALNVT +EVCE
Sbjct  494  DMMETLFGCKSTGSAFKESVTRRSVLPPVELENRVLDPKKSQNIAILLRALNVTRDEVCE  553

Query  511  ALVEGTADSLGT  546
            AL++G  + LGT
Sbjct  554  ALLDGNPEGLGT  565



>ref|XP_010463998.1| PREDICTED: formin-like protein 6 [Camelina sativa]
Length=919

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 79/104 (76%), Gaps = 4/104 (4%)
 Frame = +1

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVKRPL----MP  411
            KPKLKPLHWDKVRASSDR  VWD LKSSSFQLNE+ +E LF  NS S   K PL    MP
Sbjct  477  KPKLKPLHWDKVRASSDRATVWDQLKSSSFQLNEDRMEHLFGCNSGSSAPKEPLRRSVMP  536

Query  412  LLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
                ENRVLDPKKSQNIAILLRALNVT EEV EAL +G  +SLG
Sbjct  537  PAENENRVLDPKKSQNIAILLRALNVTREEVSEALTDGNPESLG  580



>ref|XP_011089583.1| PREDICTED: formin-like protein 1 [Sesamum indicum]
Length=1604

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 103/166 (62%), Gaps = 35/166 (21%)
 Frame = +1

Query  142   PPMLVPPSRPVV----------------SQNV----------AEVKHSSEAVEKRNEETM  243
             PP+L+ P RP+                 SQ V           E +HSSE  +       
Sbjct  1105  PPVLIRPLRPIAVESPTLISPIELPTNDSQTVKTDGDKESPNTETEHSSEDTDS----NP  1160

Query  244   KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVKRP---LMPL  414
             KPKLKPLHWDKVRASSDR MVWD LKSSSF+LNEEMIETLF+ N++    K     ++P 
Sbjct  1161  KPKLKPLHWDKVRASSDREMVWDQLKSSSFKLNEEMIETLFVANTSKPNPKETRWQVLPS  1220

Query  415   LNQE--NRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
               Q+  NR+LDPKK+QNIAILLRAL+VT +EVCE L+EG  D LGT
Sbjct  1221  PGQDNGNRILDPKKAQNIAILLRALHVTVDEVCEGLLEGNGDVLGT  1266



>ref|XP_008660427.1| PREDICTED: formin-like protein 8 [Zea mays]
 gb|AFW89298.1| hypothetical protein ZEAMMB73_801948 [Zea mays]
Length=901

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 83/106 (78%), Gaps = 5/106 (5%)
 Frame = +1

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSN-----SDGVKRPLM  408
            +PKLKPLHWDKVRA+SDR MVWD LKSSSFQLNE+MIE LFM NS       D  ++  +
Sbjct  462  RPKLKPLHWDKVRATSDRAMVWDQLKSSSFQLNEDMIEALFMNNSTPSALPRDAGRKTTV  521

Query  409  PLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            P   QE RVLDPKK+QNIAILLRALNVT +EV +AL++G A+ LGT
Sbjct  522  PPFRQEERVLDPKKAQNIAILLRALNVTRDEVSDALLDGNAECLGT  567



>ref|XP_010444642.1| PREDICTED: formin-like protein 6 [Camelina sativa]
Length=916

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 79/104 (76%), Gaps = 4/104 (4%)
 Frame = +1

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVKRPL----MP  411
            KPKLKPLHWDKVRASSDR  VWD LKSSSFQLNE+ +E LF  NS S   K PL    MP
Sbjct  475  KPKLKPLHWDKVRASSDRATVWDQLKSSSFQLNEDRMEHLFGCNSGSSAPKEPLKRSVMP  534

Query  412  LLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
                ENRVLDPKKSQNIAILLRALNVT EEV EAL +G  +SLG
Sbjct  535  PAEGENRVLDPKKSQNIAILLRALNVTREEVSEALTDGNPESLG  578



>ref|XP_010484489.1| PREDICTED: formin-like protein 6 [Camelina sativa]
Length=928

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 79/104 (76%), Gaps = 4/104 (4%)
 Frame = +1

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVKRPL----MP  411
            KPKLKPLHWDKVRASSDR  VWD LKSSSFQLNE+ +E LF  NS S   K PL    MP
Sbjct  483  KPKLKPLHWDKVRASSDRATVWDQLKSSSFQLNEDRMEHLFGCNSGSSAPKEPLRRSVMP  542

Query  412  LLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
                ENRVLDPKKSQNIAILLRALNVT EEV EAL +G  +SLG
Sbjct  543  PAENENRVLDPKKSQNIAILLRALNVTREEVSEALTDGNPESLG  586



>ref|XP_006393951.1| hypothetical protein EUTSA_v10003621mg [Eutrema salsugineum]
 gb|ESQ31237.1| hypothetical protein EUTSA_v10003621mg [Eutrema salsugineum]
Length=918

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 91/132 (69%), Gaps = 4/132 (3%)
 Frame = +1

Query  160  PSRPVVSQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQL  339
            P    V +  +E   S E   + + +  +PKLKPLHWDKVRASSDR  VWD LKSSSFQL
Sbjct  446  PQSKAVEETNSEPTRSLEKTGEGDTDPSRPKLKPLHWDKVRASSDRATVWDQLKSSSFQL  505

Query  340  NEEMIETLFMVNSNSDG----VKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVC  507
            NE+ +E LF  NS S      VKR +MP    ENRVLDPKK+QNIAILLRALNVT EEV 
Sbjct  506  NEDRMEHLFGCNSGSAASKEPVKRSVMPPAEIENRVLDPKKAQNIAILLRALNVTREEVS  565

Query  508  EALVEGTADSLG  543
            EAL++G  +SLG
Sbjct  566  EALLDGNPESLG  577



>ref|XP_007156724.1| hypothetical protein PHAVU_002G011800g [Phaseolus vulgaris]
 gb|ESW28718.1| hypothetical protein PHAVU_002G011800g [Phaseolus vulgaris]
Length=883

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 95/127 (75%), Gaps = 4/127 (3%)
 Frame = +1

Query  178  SQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIE  357
            S+ V +   SSE +E  +++  KPKLK LHWDKVRA+SDR  VWD +KSSSFQLNE+M+E
Sbjct  421  SEEVEQSVSSSERLETNDKDGAKPKLKALHWDKVRATSDRATVWDQIKSSSFQLNEDMME  480

Query  358  TLFMVNSNSDGVKRP----LMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEG  525
            +LF   + +   K P    ++P +++ENRVLDPKKSQNIAILLRALNVT +EV EAL++G
Sbjct  481  SLFGCKATNSAPKEPSRKSVLPSVDKENRVLDPKKSQNIAILLRALNVTRDEVSEALLDG  540

Query  526  TADSLGT  546
              + LGT
Sbjct  541  NPEGLGT  547



>ref|XP_003550976.1| PREDICTED: formin-like protein 6-like [Glycine max]
Length=884

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 88/123 (72%), Gaps = 9/123 (7%)
 Frame = +1

Query  205  SSEAVEKRNE----ETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMV  372
            SSE V KR E    +  KPKLK LHWDKV A+SDR  VWD LKSSSFQLNE+M+ETLF  
Sbjct  425  SSEEVYKRREGDDVDGAKPKLKALHWDKVSATSDRATVWDQLKSSSFQLNEDMMETLFGC  484

Query  373  NSNSDGVK-----RPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADS  537
             S     K     R ++P +  ENRVLDPKKSQNIAILLRALNVT +EVCEAL++G  + 
Sbjct  485  KSTGSAFKESVTRRSVLPPVEPENRVLDPKKSQNIAILLRALNVTRDEVCEALLDGNPEG  544

Query  538  LGT  546
            LGT
Sbjct  545  LGT  547



>gb|KHG19871.1| Formin-like protein 6 [Gossypium arboreum]
Length=923

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 91/118 (77%), Gaps = 5/118 (4%)
 Frame = +1

Query  205  SSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS  384
            SSE  +  + ++ KPKLKPLHWDKVRA+S+R  VWD +KSSSFQLNE+M+ETLF  NS +
Sbjct  468  SSEKTDGDDMDSAKPKLKPLHWDKVRATSERATVWDQIKSSSFQLNEDMMETLFGCNSTT  527

Query  385  DG-----VKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
                   ++R ++P + QENRVLD KKSQNIAILLRALNVT +EV EAL++G  +SLG
Sbjct  528  AAPPKEPIRRSVLPPVKQENRVLDSKKSQNIAILLRALNVTRDEVSEALLDGNPESLG  585



>ref|XP_007207141.1| hypothetical protein PRUPE_ppa001809mg [Prunus persica]
 gb|EMJ08340.1| hypothetical protein PRUPE_ppa001809mg [Prunus persica]
Length=762

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 91/119 (76%), Gaps = 6/119 (5%)
 Frame = +1

Query  205  SSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNS-N  381
            SSE+ E  +    KPKLKPLHWDKVRA+SDR  VWD LKSSSFQLNE+M+ETLF  NS N
Sbjct  307  SSESFEADDAGGAKPKLKPLHWDKVRATSDRATVWDQLKSSSFQLNEDMMETLFGCNSAN  366

Query  382  S-----DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
            S     + ++R ++P + QENRVLDPKKSQNIAILLRALNV  +EV ++L++G  + LG
Sbjct  367  SVPKAKEPIRRSVLPPVEQENRVLDPKKSQNIAILLRALNVARDEVTDSLLDGNPEGLG  425



>tpg|DAA40547.1| TPA: hypothetical protein ZEAMMB73_701061 [Zea mays]
Length=577

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 83/104 (80%), Gaps = 4/104 (4%)
 Frame = +1

Query  247  PKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVN----SNSDGVKRPLMPL  414
            PKLKPLHWDKVRASS R  VWD LK+SSF++NEEMIETLF+ N    S+  G+K P    
Sbjct  395  PKLKPLHWDKVRASSGRPTVWDQLKASSFRVNEEMIETLFVSNSTWRSSKSGIKAPNSSS  454

Query  415  LNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
             +QEN+VLDPKKSQNIAI+LRALN T EEVC AL++G A+SLG+
Sbjct  455  CSQENKVLDPKKSQNIAIMLRALNATKEEVCRALLDGQAESLGS  498



>tpg|DAA40549.1| TPA: hypothetical protein ZEAMMB73_701061, partial [Zea mays]
Length=584

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 83/104 (80%), Gaps = 4/104 (4%)
 Frame = +1

Query  247  PKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVN----SNSDGVKRPLMPL  414
            PKLKPLHWDKVRASS R  VWD LK+SSF++NEEMIETLF+ N    S+  G+K P    
Sbjct  395  PKLKPLHWDKVRASSGRPTVWDQLKASSFRVNEEMIETLFVSNSTWRSSKSGIKAPNSSS  454

Query  415  LNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
             +QEN+VLDPKKSQNIAI+LRALN T EEVC AL++G A+SLG+
Sbjct  455  CSQENKVLDPKKSQNIAIMLRALNATKEEVCRALLDGQAESLGS  498



>gb|ACR34861.1| unknown [Zea mays]
 tpg|DAA40551.1| TPA: hypothetical protein ZEAMMB73_701061 [Zea mays]
Length=525

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 83/104 (80%), Gaps = 4/104 (4%)
 Frame = +1

Query  247  PKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVN----SNSDGVKRPLMPL  414
            PKLKPLHWDKVRASS R  VWD LK+SSF++NEEMIETLF+ N    S+  G+K P    
Sbjct  78   PKLKPLHWDKVRASSGRPTVWDQLKASSFRVNEEMIETLFVSNSTWRSSKSGIKAPNSSS  137

Query  415  LNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
             +QEN+VLDPKKSQNIAI+LRALN T EEVC AL++G A+SLG+
Sbjct  138  CSQENKVLDPKKSQNIAIMLRALNATKEEVCRALLDGQAESLGS  181



>ref|XP_008238053.1| PREDICTED: formin-like protein 6 [Prunus mume]
Length=900

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 98/133 (74%), Gaps = 10/133 (8%)
 Frame = +1

Query  163  SRPVVSQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLN  342
            ++PV  +++     SSE+ E  +    KPKLKPLHWDKVRA+SDR  VWD LKSSSFQLN
Sbjct  435  AKPVADESLV----SSESFEADDAGGAKPKLKPLHWDKVRATSDRATVWDQLKSSSFQLN  490

Query  343  EEMIETLFMVNS-NS-----DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEV  504
            E+M+ETLF  NS NS     + ++R ++P + QENRVLDPKKSQNIAILLRALNV  +EV
Sbjct  491  EDMMETLFGCNSANSVPKAKEPIRRSVLPPVEQENRVLDPKKSQNIAILLRALNVARDEV  550

Query  505  CEALVEGTADSLG  543
             ++L++G  + LG
Sbjct  551  TDSLLDGNPEGLG  563



>ref|XP_004147079.1| PREDICTED: formin-like protein 6-like [Cucumis sativus]
 ref|XP_004158398.1| PREDICTED: formin-like protein 6-like [Cucumis sativus]
Length=888

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 91/119 (76%), Gaps = 4/119 (3%)
 Frame = +1

Query  202  HSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNS-  378
            +S E +E  + +  KP+LKPLHWDKVRA+SDR  VWD LKSSSFQLNE+M+ETLF  NS 
Sbjct  435  NSMERLEAEDADGAKPRLKPLHWDKVRATSDRATVWDQLKSSSFQLNEDMMETLFGFNSA  494

Query  379  NS---DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            NS   +  ++ ++P + +ENRVLDPKKSQNIAILLRALNVT +EV EAL +G  +  GT
Sbjct  495  NSVPKEATRKSVLPPVEKENRVLDPKKSQNIAILLRALNVTRDEVIEALQDGNPEGFGT  553



>tpg|DAA62315.1| TPA: hypothetical protein ZEAMMB73_843831 [Zea mays]
Length=762

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 83/104 (80%), Gaps = 4/104 (4%)
 Frame = +1

Query  247  PKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVN----SNSDGVKRPLMPL  414
            PKLKPLHWDKVRASS R  VWD LK+SSF++NEEMIETLF+ N    S+  G K P   L
Sbjct  322  PKLKPLHWDKVRASSGRPTVWDQLKASSFRVNEEMIETLFVSNSTRRSSKSGTKGPNSSL  381

Query  415  LNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
             +QEN+VLDPKKSQNIAI+LRA N T EEVC+AL++G A+SLGT
Sbjct  382  CSQENKVLDPKKSQNIAIMLRARNATKEEVCKALLDGQAESLGT  425



>emb|CDX79799.1| BnaA05g03570D [Brassica napus]
Length=794

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 89/116 (77%), Gaps = 2/116 (2%)
 Frame = +1

Query  205  SSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS  384
            ++ +V +  +ET KPKLKPLHWDKVRASS RV VWD +KS+SFQ+NEEMIETLF  N  +
Sbjct  326  ATNSVSEEKDETFKPKLKPLHWDKVRASSSRVTVWDQIKSNSFQVNEEMIETLFRANDPT  385

Query  385  DGVKRPLMPLLNQ--ENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
               K  +   + Q   ++ LDP+KS NIAILLRALNVTA+EVCEALVEG +D+LG+
Sbjct  386  SRTKESVTTDVVQSTSHQFLDPRKSHNIAILLRALNVTADEVCEALVEGNSDALGS  441



>ref|XP_011011006.1| PREDICTED: formin-like protein 6 [Populus euphratica]
Length=904

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 96/130 (74%), Gaps = 7/130 (5%)
 Frame = +1

Query  175  VSQNVAEVKHSSEAVEKRN---EETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNE  345
            +++   EV   + + E+ N    +  KPKLKPLHWDKVRASSDR  VWD LKSSSFQLNE
Sbjct  437  ITKTTEEVNKGASSSERNNADDNDGEKPKLKPLHWDKVRASSDRATVWDQLKSSSFQLNE  496

Query  346  EMIETLFMVNS-NS---DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEA  513
            +M+E+LF  NS NS   +  ++ ++P   +ENRVLDPKKSQNIAILLRALNVT +EV EA
Sbjct  497  DMMESLFGCNSANSVPKETTRKSVLPPAERENRVLDPKKSQNIAILLRALNVTRDEVSEA  556

Query  514  LVEGTADSLG  543
            L++G  +SLG
Sbjct  557  LLDGNPESLG  566



>gb|KGN61953.1| hypothetical protein Csa_2G271460 [Cucumis sativus]
Length=912

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 91/119 (76%), Gaps = 4/119 (3%)
 Frame = +1

Query  202  HSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNS-  378
            +S E +E  + +  KP+LKPLHWDKVRA+SDR  VWD LKSSSFQLNE+M+ETLF  NS 
Sbjct  459  NSMERLEAEDADGAKPRLKPLHWDKVRATSDRATVWDQLKSSSFQLNEDMMETLFGFNSA  518

Query  379  NS---DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            NS   +  ++ ++P + +ENRVLDPKKSQNIAILLRALNVT +EV EAL +G  +  GT
Sbjct  519  NSVPKEATRKSVLPPVEKENRVLDPKKSQNIAILLRALNVTRDEVIEALQDGNPEGFGT  577



>ref|XP_010317777.1| PREDICTED: formin-like protein 6 isoform X1 [Solanum lycopersicum]
Length=870

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 87/104 (84%), Gaps = 4/104 (4%)
 Frame = +1

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNS----NSDGVKRPLMP  411
            KP+LKPLHWDKVRA+S+R  VWD LKSSSFQLNE+M+E+LF  NS     ++ +K+P+ P
Sbjct  435  KPRLKPLHWDKVRATSERATVWDQLKSSSFQLNEDMMESLFGCNSVNSVTNEVIKKPVRP  494

Query  412  LLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
             + +ENRVLDPKKSQNIAI+LRALNVT +EV EAL++G+A+ LG
Sbjct  495  TVEKENRVLDPKKSQNIAIMLRALNVTKDEVSEALLDGSAEGLG  538



>ref|XP_008457732.1| PREDICTED: formin-like protein 6 [Cucumis melo]
Length=914

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 91/119 (76%), Gaps = 4/119 (3%)
 Frame = +1

Query  202  HSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNS-  378
            +S E +E  + +  KP+LKPLHWDKVRA+SDR  VWD LKSSSFQLNE+M+ETLF  NS 
Sbjct  461  NSMERLEAEDADGAKPRLKPLHWDKVRATSDRATVWDQLKSSSFQLNEDMMETLFGFNSA  520

Query  379  NS---DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            NS   +  ++ ++P + +ENRVLDPKKSQNIAILLRALNVT +EV EAL +G  +  GT
Sbjct  521  NSVPKEATRKSVLPPVEKENRVLDPKKSQNIAILLRALNVTRDEVIEALQDGNPEGFGT  579



>ref|XP_004234650.1| PREDICTED: formin-like protein 6 isoform X2 [Solanum lycopersicum]
Length=867

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 87/104 (84%), Gaps = 4/104 (4%)
 Frame = +1

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNS----NSDGVKRPLMP  411
            KP+LKPLHWDKVRA+S+R  VWD LKSSSFQLNE+M+E+LF  NS     ++ +K+P+ P
Sbjct  432  KPRLKPLHWDKVRATSERATVWDQLKSSSFQLNEDMMESLFGCNSVNSVTNEVIKKPVRP  491

Query  412  LLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
             + +ENRVLDPKKSQNIAI+LRALNVT +EV EAL++G+A+ LG
Sbjct  492  TVEKENRVLDPKKSQNIAIMLRALNVTKDEVSEALLDGSAEGLG  535



>ref|XP_006279973.1| hypothetical protein CARUB_v10025843mg [Capsella rubella]
 gb|EOA12871.1| hypothetical protein CARUB_v10025843mg [Capsella rubella]
Length=922

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 79/104 (76%), Gaps = 4/104 (4%)
 Frame = +1

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVKRPL----MP  411
            KPKLKPLHWDKVRASSDR  VWD LKSSSFQLNE+ +E LF  NS S   K PL    MP
Sbjct  480  KPKLKPLHWDKVRASSDRATVWDQLKSSSFQLNEDRMEHLFGCNSGSSVPKEPLRRSVMP  539

Query  412  LLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
                ENRVLDPKKSQNIAILLRALNVT EEV EAL +G  +SLG
Sbjct  540  PAENENRVLDPKKSQNIAILLRALNVTREEVSEALTDGNPESLG  583



>ref|XP_010028101.1| PREDICTED: formin-like protein 6 [Eucalyptus grandis]
 gb|KCW54762.1| hypothetical protein EUGRSUZ_I00712 [Eucalyptus grandis]
Length=931

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 95/129 (74%), Gaps = 7/129 (5%)
 Frame = +1

Query  178  SQNVAEVKHSSEAVEKRNEETM---KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEE  348
            S++  E   S  + E++N + +   +PKLKPLHWDKVRA+SDR  VWD LKSSSFQLNE+
Sbjct  465  SKDAEESNRSPSSSERQNGDDVDEARPKLKPLHWDKVRATSDRATVWDQLKSSSFQLNED  524

Query  349  MIETLFMVNSNSDG----VKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEAL  516
            M+ETLF  +S +      V+R ++P   QENRVLDPKKSQNIAILLRALNVT +EV EAL
Sbjct  525  MMETLFGCHSTNSAPKEPVRRSVLPPPEQENRVLDPKKSQNIAILLRALNVTRDEVSEAL  584

Query  517  VEGTADSLG  543
            ++G  + LG
Sbjct  585  LDGNPEGLG  593



>ref|XP_010550332.1| PREDICTED: formin-like protein 6 [Tarenaya hassleriana]
Length=910

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 88/117 (75%), Gaps = 4/117 (3%)
 Frame = +1

Query  205  SSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSN-  381
            SSE       ++ +PKLKPLHWDKVRASSDR  VWD +KSSSFQLNE+ +E LF  N+  
Sbjct  455  SSEKTGDAETDSGRPKLKPLHWDKVRASSDRATVWDQIKSSSFQLNEDRMEHLFGCNTKK  514

Query  382  ---SDGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
               ++ V+R ++P +  ENRVLDPKKSQNIAILLRALNVT EEV EAL++G  DSLG
Sbjct  515  PAPNESVRRSVLPPVENENRVLDPKKSQNIAILLRALNVTREEVFEALLDGNPDSLG  571



>ref|XP_006651144.1| PREDICTED: formin-like protein 8-like, partial [Oryza brachyantha]
Length=612

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 83/107 (78%), Gaps = 6/107 (6%)
 Frame = +1

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSD------GVKRPL  405
            +PKLKPLHWDKVRA+SDR MVWD LKSSSFQL+E+MIE LFM NS         G K   
Sbjct  171  RPKLKPLHWDKVRATSDRAMVWDQLKSSSFQLDEDMIEALFMNNSTPAAPPREVGRKPGG  230

Query  406  MPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            +P   QE RVLDPKK+QNIAILLRALNVT EEV +AL++G+A+ LGT
Sbjct  231  VPSFRQEERVLDPKKAQNIAILLRALNVTREEVSDALLDGSAECLGT  277



>ref|XP_006380616.1| hypothetical protein POPTR_0007s09870g [Populus trichocarpa]
 gb|ERP58413.1| hypothetical protein POPTR_0007s09870g [Populus trichocarpa]
Length=908

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 90/117 (77%), Gaps = 4/117 (3%)
 Frame = +1

Query  205  SSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNS-N  381
            SSE  +  + +  KPKLKPLHWDKVRASSDR  VWD LKSSSFQLNE+M+E+LF  NS N
Sbjct  454  SSERNDADDNDGEKPKLKPLHWDKVRASSDRATVWDQLKSSSFQLNEDMMESLFGCNSAN  513

Query  382  S---DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
            S   +  ++ ++P    ENRVLDPKKSQNIAILLRALNVT +EV EAL++G  +SLG
Sbjct  514  SVPKEATRKSVLPPAEHENRVLDPKKSQNIAILLRALNVTRDEVSEALLDGNPESLG  570



>ref|XP_009142971.1| PREDICTED: formin-like protein 2 [Brassica rapa]
Length=857

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 88/115 (77%), Gaps = 2/115 (2%)
 Frame = +1

Query  208  SEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSD  387
            + +V +  +ET KPKLKPLHWDKVRASS RV VWD +KS+SFQ+NEEMIETLF  N  + 
Sbjct  389  TNSVSEEKDETFKPKLKPLHWDKVRASSSRVTVWDQIKSNSFQVNEEMIETLFRANDPTS  448

Query  388  GVKRPLMPLLNQ--ENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
              K  +   + Q   ++ LDP+KS NIAILLRALNVTA+EVCEALVEG +D+LG+
Sbjct  449  RTKESVTTDVVQSTSHQFLDPRKSHNIAILLRALNVTADEVCEALVEGNSDALGS  503



>gb|KJB48710.1| hypothetical protein B456_008G082700 [Gossypium raimondii]
 gb|KJB48711.1| hypothetical protein B456_008G082700 [Gossypium raimondii]
Length=896

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 99/129 (77%), Gaps = 8/129 (6%)
 Frame = +1

Query  181  QNVAEVKH-SSEAVEKRNEETM---KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEE  348
            +++ EV H +   VEK + + M   KPKLKPLHWDKVRA+S+R  VWD LKSSSFQLNE+
Sbjct  438  KSMEEVNHKAGSCVEKTDGDDMESAKPKLKPLHWDKVRATSERATVWDQLKSSSFQLNED  497

Query  349  MIETLFMVNSNS----DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEAL  516
            M+ETLF  NS +    + ++R ++P + +ENRVL+PKKSQNIAILLRAL+VT +EV EAL
Sbjct  498  MMETLFGCNSTNSVPREPIRRSVLPPVERENRVLNPKKSQNIAILLRALSVTRDEVSEAL  557

Query  517  VEGTADSLG  543
            ++G  +SLG
Sbjct  558  LDGNPESLG  566



>emb|CDY44259.1| BnaC03g24510D [Brassica napus]
Length=843

 Score =   143 bits (361),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 85/110 (77%), Gaps = 4/110 (4%)
 Frame = +1

Query  226  RNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVN---SNSDGVK  396
            + +ET+KPKLK LHWDKVRA S RVMVWD +KS+SFQ+NEEMIETLF  N   S + GV 
Sbjct  391  KKDETLKPKLKALHWDKVRAGSSRVMVWDQIKSNSFQVNEEMIETLFRANDPSSRTRGVG  450

Query  397  RP-LMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
               L+   + EN+ LDP+KS NI ILLRALNVTA+EVCEALVEG AD LG
Sbjct  451  NAGLVQSASHENQFLDPRKSHNIEILLRALNVTADEVCEALVEGNADMLG  500



>ref|XP_003608126.1| Formin-like protein [Medicago truncatula]
Length=860

 Score =   143 bits (361),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 96/163 (59%), Gaps = 40/163 (25%)
 Frame = +1

Query  109  RFWEPPVMDGGPPMLVPPSRPVVSQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRAS  288
            R WE PV              VVSQ+       +  V   NEE +KPKLK LHWDKV+AS
Sbjct  381  RLWETPV--------------VVSQD------GNGDVSVENEENLKPKLKALHWDKVKAS  420

Query  289  SDRVMVWDHLKSSSFQLNEEMIETLFMV-----------------NSNSDGVKRPLMPLL  417
            SDR MVWD L+ SSFQLNE+MIE+LFM                  N+    +    MP  
Sbjct  421  SDRAMVWDQLRPSSFQLNEDMIESLFMANNSNSSGNSALASNPKDNARHQIIHASPMP--  478

Query  418  NQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
              ENRVLDPKKSQNIAILLRALNVT +EVCEAL EG  D+LGT
Sbjct  479  -PENRVLDPKKSQNIAILLRALNVTIDEVCEALREGNCDTLGT  520



>ref|XP_003608108.1| Formin-like protein, partial [Medicago truncatula]
Length=719

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 96/163 (59%), Gaps = 40/163 (25%)
 Frame = +1

Query  109  RFWEPPVMDGGPPMLVPPSRPVVSQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRAS  288
            R WE PV              VVSQ+       +  V   NEE +KPKLK LHWDKV+AS
Sbjct  410  RLWETPV--------------VVSQD------GNGDVSVENEENLKPKLKALHWDKVKAS  449

Query  289  SDRVMVWDHLKSSSFQLNEEMIETLFMV-----------------NSNSDGVKRPLMPLL  417
            SDR MVWD L+ SSFQLNE+MIE+LFM                  N+    +    MP  
Sbjct  450  SDRAMVWDQLRPSSFQLNEDMIESLFMANNSNSSGNSALASNPKDNARHQIIHASPMP--  507

Query  418  NQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
              ENRVLDPKKSQNIAILLRALNVT +EVCEAL EG  D+LGT
Sbjct  508  -PENRVLDPKKSQNIAILLRALNVTIDEVCEALREGNCDTLGT  549



>ref|NP_001147313.1| AFH1 precursor [Zea mays]
 gb|ACG26730.1| AFH1 [Zea mays]
Length=764

 Score =   142 bits (359),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 83/104 (80%), Gaps = 4/104 (4%)
 Frame = +1

Query  247  PKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVN----SNSDGVKRPLMPL  414
            PKLKPLHWDKVRASS R  VWD LK+SSF++NEEMIETLF+ N    S+  G+K P    
Sbjct  323  PKLKPLHWDKVRASSGRPTVWDQLKASSFRVNEEMIETLFVSNSTWRSSKSGIKAPNSSS  382

Query  415  LNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
             +QEN+VLDPKKSQNIAI+LRALN T EEVC AL++G A+SLG+
Sbjct  383  CSQENKVLDPKKSQNIAIMLRALNATKEEVCRALLDGQAESLGS  426



>gb|KFK37202.1| hypothetical protein AALP_AA4G227400 [Arabis alpina]
Length=862

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 81/104 (78%), Gaps = 4/104 (4%)
 Frame = +1

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMP  411
            KPKLK LHWDKVRASS RVMVWD +KS+SFQLNEEMIETLF VN  S    D     ++ 
Sbjct  409  KPKLKALHWDKVRASSSRVMVWDQIKSNSFQLNEEMIETLFRVNDPSSRTRDAGNVGVVQ  468

Query  412  LLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
             +N ENR LDP+KS NI ILLRALNVT +EVCEALVEG +D+LG
Sbjct  469  SVNSENRFLDPRKSHNIEILLRALNVTVDEVCEALVEGNSDTLG  512



>ref|XP_002468314.1| hypothetical protein SORBIDRAFT_01g043600 [Sorghum bicolor]
 gb|EER95312.1| hypothetical protein SORBIDRAFT_01g043600 [Sorghum bicolor]
Length=889

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 83/106 (78%), Gaps = 5/106 (5%)
 Frame = +1

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSN-----SDGVKRPLM  408
            +PKLKPLHWDKVRA+SDR MVWD LKSSSFQL+E+MIE LFM NS       D  ++  +
Sbjct  450  RPKLKPLHWDKVRATSDRAMVWDQLKSSSFQLDEDMIEALFMNNSTPAAPPRDAGRKATV  509

Query  409  PLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            P   QE RVLDPKK+QNIAILLRALNVT +EV +AL++G A+ LGT
Sbjct  510  PPFKQEERVLDPKKAQNIAILLRALNVTHDEVSDALLDGNAECLGT  555



>gb|AES90323.2| formin-like 2 domain protein [Medicago truncatula]
Length=889

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 96/163 (59%), Gaps = 40/163 (25%)
 Frame = +1

Query  109  RFWEPPVMDGGPPMLVPPSRPVVSQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRAS  288
            R WE PV              VVSQ+       +  V   NEE +KPKLK LHWDKV+AS
Sbjct  410  RLWETPV--------------VVSQD------GNGDVSVENEENLKPKLKALHWDKVKAS  449

Query  289  SDRVMVWDHLKSSSFQLNEEMIETLFMV-----------------NSNSDGVKRPLMPLL  417
            SDR MVWD L+ SSFQLNE+MIE+LFM                  N+    +    MP  
Sbjct  450  SDRAMVWDQLRPSSFQLNEDMIESLFMANNSNSSGNSALASNPKDNARHQIIHASPMP--  507

Query  418  NQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
              ENRVLDPKKSQNIAILLRALNVT +EVCEAL EG  D+LGT
Sbjct  508  -PENRVLDPKKSQNIAILLRALNVTIDEVCEALREGNCDTLGT  549



>ref|XP_008667457.1| PREDICTED: uncharacterized protein LOC100272525 isoform X1 [Zea 
mays]
 tpg|DAA40548.1| TPA: AFH1 [Zea mays]
Length=842

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 83/104 (80%), Gaps = 4/104 (4%)
 Frame = +1

Query  247  PKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVN----SNSDGVKRPLMPL  414
            PKLKPLHWDKVRASS R  VWD LK+SSF++NEEMIETLF+ N    S+  G+K P    
Sbjct  395  PKLKPLHWDKVRASSGRPTVWDQLKASSFRVNEEMIETLFVSNSTWRSSKSGIKAPNSSS  454

Query  415  LNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
             +QEN+VLDPKKSQNIAI+LRALN T EEVC AL++G A+SLG+
Sbjct  455  CSQENKVLDPKKSQNIAIMLRALNATKEEVCRALLDGQAESLGS  498



>emb|CDY08720.1| BnaA06g25040D [Brassica napus]
Length=727

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 81/104 (78%), Gaps = 4/104 (4%)
 Frame = +1

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDG----VKRPLMP  411
            KPKLKPLHWDKVRASSDR  VWD LKSSSFQ+NE+ +E LF  +S S      V+R +MP
Sbjct  284  KPKLKPLHWDKVRASSDRATVWDQLKSSSFQVNEDRMEHLFGCSSASSAPKEPVRRSVMP  343

Query  412  LLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
                ENRVLDPKKSQNIAILLRALNVT EEV EAL++G  +SLG
Sbjct  344  PAENENRVLDPKKSQNIAILLRALNVTREEVSEALLDGNPESLG  387



>gb|EPS68181.1| hypothetical protein M569_06587, partial [Genlisea aurea]
Length=922

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 88/115 (77%), Gaps = 6/115 (5%)
 Frame = +1

Query  220  EKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVKR  399
            E  +E T KPKLKPLHWDKVRASS+R MVWD LKSSSF+LNEEMIETLF+ ++     K 
Sbjct  469  EADDEYTTKPKLKPLHWDKVRASSNRKMVWDQLKSSSFKLNEEMIETLFVADAPKPTPKE  528

Query  400  P----LMPLLNQE--NRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            P    ++P    E  NRVLDPKK+QNIAILL+ALNVT EEVCE L+EG ++ LGT
Sbjct  529  PTRWQVIPTPGPESGNRVLDPKKAQNIAILLKALNVTVEEVCEGLLEGNSEILGT  583



>ref|XP_003611598.1| Formin-like protein [Medicago truncatula]
 gb|AES94556.1| formin-like 2 domain protein [Medicago truncatula]
Length=908

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 102/136 (75%), Gaps = 13/136 (10%)
 Frame = +1

Query  175  VSQNVAE---VKHSSEA-VEKRNE-ETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQL  339
            VS +V E   ++ SSE  VE+ NE E  KPKLK LHWDKVRA+SDR  VWD +KSSSFQL
Sbjct  435  VSDHVDESLNLRSSSERLVEEANETEGGKPKLKALHWDKVRATSDRATVWDQIKSSSFQL  494

Query  340  NEEMIETLFMVNSNSD--------GVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTA  495
            NE+M+E+LF  N+ ++        GV++ ++P ++ EN+VLDPKKSQNIAILLRALNVT 
Sbjct  495  NEDMMESLFGCNNGTNSAPKPKEQGVRKSVLPSVDHENKVLDPKKSQNIAILLRALNVTR  554

Query  496  EEVCEALVEGTADSLG  543
            +EV EAL++G+ + LG
Sbjct  555  DEVSEALLDGSPEGLG  570



>ref|XP_010938950.1| PREDICTED: formin-like protein 8 [Elaeis guineensis]
Length=832

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 100/143 (70%), Gaps = 9/143 (6%)
 Frame = +1

Query  139  GPPMLVPPSRPVVSQNVAEVKHSSEAVEKRN---EETMKPKLKPLHWDKVRASSDRVMVW  309
            G P+ +P   P+   +  +   SS+ V++     E   KPKLKPLHWD+V ASSDR MVW
Sbjct  358  GAPINIPI--PISKFSKGDDCSSSQPVDRTGDDLEGDAKPKLKPLHWDQVMASSDRPMVW  415

Query  310  DHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMPLLNQENRVLDPKKSQNIAILLR  477
            D LKSSSFQLNE+M+E LF+ N+ +    D  +RP++P   QENRVLDPKK+QNIAILLR
Sbjct  416  DQLKSSSFQLNEDMMEALFVHNATNLVPKDSNRRPVLPPFKQENRVLDPKKAQNIAILLR  475

Query  478  ALNVTAEEVCEALVEGTADSLGT  546
            ALNVT +EV +AL++G  + LG 
Sbjct  476  ALNVTQDEVSDALLDGNPECLGA  498



>ref|XP_003538791.1| PREDICTED: formin-like protein 6-like [Glycine max]
Length=895

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 86/114 (75%), Gaps = 5/114 (4%)
 Frame = +1

Query  220  EKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVKR  399
            E  + +  KPKLK LHWDKVRA+SDR  VWD +KSSSFQLNE+M+E+LF   + +   K 
Sbjct  446  EANDTDGAKPKLKALHWDKVRATSDRATVWDQIKSSSFQLNEDMMESLFGCKATNSAPKE  505

Query  400  P-----LMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            P     ++P ++QENRVLDPKKSQNIAILLRALNVT +EV EAL++G  + LGT
Sbjct  506  PPRKKSVLPFVDQENRVLDPKKSQNIAILLRALNVTKDEVSEALLDGNPEGLGT  559



>ref|XP_009150703.1| PREDICTED: formin-like protein 6 [Brassica rapa]
Length=897

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 81/104 (78%), Gaps = 4/104 (4%)
 Frame = +1

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDG----VKRPLMP  411
            KPKLKPLHWDKVRASSDR  VWD LKSSSFQ+NE+ +E LF  +S S      V+R +MP
Sbjct  455  KPKLKPLHWDKVRASSDRATVWDQLKSSSFQVNEDRMEHLFGCSSASSAPKEPVRRSVMP  514

Query  412  LLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
                ENRVLDPKKSQNIAILLRALNVT EEV EAL++G  +SLG
Sbjct  515  PAENENRVLDPKKSQNIAILLRALNVTREEVSEALLDGNPESLG  558



>ref|XP_006380617.1| hypothetical protein POPTR_0007s09870g [Populus trichocarpa]
 gb|ERP58414.1| hypothetical protein POPTR_0007s09870g [Populus trichocarpa]
Length=578

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 86/111 (77%), Gaps = 4/111 (4%)
 Frame = +1

Query  205  SSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNS-N  381
            SSE  +  + +  KPKLKPLHWDKVRASSDR  VWD LKSSSFQLNE+M+E+LF  NS N
Sbjct  454  SSERNDADDNDGEKPKLKPLHWDKVRASSDRATVWDQLKSSSFQLNEDMMESLFGCNSAN  513

Query  382  S---DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEG  525
            S   +  ++ ++P    ENRVLDPKKSQNIAILLRALNVT +EV EAL++G
Sbjct  514  SVPKEATRKSVLPPAEHENRVLDPKKSQNIAILLRALNVTRDEVSEALLDG  564



>ref|XP_004289343.1| PREDICTED: formin-like protein 6 [Fragaria vesca subsp. vesca]
Length=876

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 87/120 (73%), Gaps = 7/120 (6%)
 Frame = +1

Query  205  SSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSN-  381
            S+E++E  +    KPKLKPLHWDKVRA+SDR  VWD LKSSSFQLNE+M+ETLF  N   
Sbjct  426  SAESLENDDSGGSKPKLKPLHWDKVRATSDRATVWDQLKSSSFQLNEDMMETLFGCNPAN  485

Query  382  ------SDGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
                  S   +R ++P + QENRVLDPKKSQNIAILLRALNV  +EV EAL +G  + LG
Sbjct  486  TTPKEPSTTTRRSVLPPVEQENRVLDPKKSQNIAILLRALNVARDEVVEALWDGNPEGLG  545



>ref|NP_001049309.1| Os03g0204100 [Oryza sativa Japonica Group]
 sp|Q10Q99.1|FH8_ORYSJ RecName: Full=Formin-like protein 8; AltName: Full=OsFH8; Flags: 
Precursor [Oryza sativa Japonica Group]
 gb|ABF94532.1| transposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11223.1| Os03g0204100 [Oryza sativa Japonica Group]
Length=892

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 82/107 (77%), Gaps = 6/107 (6%)
 Frame = +1

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSD------GVKRPL  405
            +PKLKPLHWDKVRA+SDR MVWD LKSSSFQL+E+MIE LFM NS         G K   
Sbjct  453  RPKLKPLHWDKVRATSDRAMVWDQLKSSSFQLDEDMIEALFMNNSTPAAPPREVGRKAAG  512

Query  406  MPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            +P   QE RVLDPKK+QNIAILLRALNVT EEV +AL++G A+ LG+
Sbjct  513  VPSFRQEERVLDPKKAQNIAILLRALNVTREEVSDALLDGNAECLGS  559



>emb|CDY36494.1| BnaC03g48530D [Brassica napus]
Length=902

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 81/104 (78%), Gaps = 4/104 (4%)
 Frame = +1

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDG----VKRPLMP  411
            +PKLKPLHWDKVRASSDR  VWD LKSSSFQ+NE+ +E LF  +S S      V+R +MP
Sbjct  458  RPKLKPLHWDKVRASSDRATVWDQLKSSSFQVNEDRMEHLFGCSSASSAPKEPVRRSVMP  517

Query  412  LLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
                ENRVLDPKKSQNIAILLRALNVT EEV EAL++G  +SLG
Sbjct  518  PAENENRVLDPKKSQNIAILLRALNVTREEVSEALLDGNPESLG  561



>gb|KFK28433.1| hypothetical protein AALP_AA8G514000 [Arabis alpina]
Length=919

 Score =   140 bits (354),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 92/131 (70%), Gaps = 19/131 (15%)
 Frame = +1

Query  208  SEAVEKRNEETM--------------KPKLKPLHWDKVRASSDRVMVWDHLKS-SSFQLN  342
            S+AVE+ N E++              +PKLKPLHWDKVRASSDR  VWD LKS SSFQLN
Sbjct  454  SKAVEEVNSESVGSLEKTGDGDTDPSRPKLKPLHWDKVRASSDRATVWDQLKSRSSFQLN  513

Query  343  EEMIETLFMVNSNSDG----VKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCE  510
            E+ +E LF  NS S G    V+R ++P    ENRVLDPKKSQNIAILLRALNVT EEV E
Sbjct  514  EDRMEHLFGCNSGSSGPKEPVRRSMIPPGESENRVLDPKKSQNIAILLRALNVTREEVSE  573

Query  511  ALVEGTADSLG  543
            AL++G  +SLG
Sbjct  574  ALMDGNPESLG  584



>gb|EMT17710.1| Formin-like protein 15 [Aegilops tauschii]
Length=575

 Score =   138 bits (348),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 80/104 (77%), Gaps = 4/104 (4%)
 Frame = +1

Query  247  PKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSN----SDGVKRPLMPL  414
            PKLKPLHWDK RASS R  VWD LK+SSF++NEEMIETLF+ NS      +G K      
Sbjct  130  PKLKPLHWDKFRASSGRPTVWDQLKASSFRVNEEMIETLFVSNSTRRMPKNGFKEANGAP  189

Query  415  LNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
             NQEN+VLD KKSQNIAI+LRAL+ T EEVC+AL++G ADSLGT
Sbjct  190  FNQENKVLDAKKSQNIAIMLRALDATKEEVCKALLDGQADSLGT  233



>ref|XP_003578447.1| PREDICTED: formin-like protein 15 [Brachypodium distachyon]
Length=773

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 87/118 (74%), Gaps = 4/118 (3%)
 Frame = +1

Query  202  HSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNS-  378
             SSE  +K  +   +PKLKPLHWDKVRASS R  VWD LK+SSF++NEEMIETLF+ NS 
Sbjct  317  QSSEPEDKEADAAARPKLKPLHWDKVRASSGRPTVWDQLKASSFRVNEEMIETLFVSNST  376

Query  379  ---NSDGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
               + +G K       NQEN+VLD KKSQNIAI+LRAL+ T EEVC+AL++G  +SLG
Sbjct  377  RRMSKNGFKEANGACCNQENKVLDAKKSQNIAIMLRALDATKEEVCKALLDGQTESLG  434



>ref|XP_006583848.1| PREDICTED: formin-like protein 2-like [Glycine max]
Length=886

 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 93/134 (69%), Gaps = 25/134 (19%)
 Frame = +1

Query  211  EAVEKRNE--ETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS  384
            ++V  RNE  ET KPKLK LHWDKV+ASSDRVMVWD L  SSFQLNE+MIETLFMVN+N+
Sbjct  414  KSVTFRNESEETPKPKLKALHWDKVKASSDRVMVWDRLGPSSFQLNEDMIETLFMVNNNN  473

Query  385  DGVKRPL--------------------MPLLNQENRVLDPKKSQNIAILLRALNVTAEEV  504
            +  K                       MPL   ENRVLDPKKSQNIAILLRALNVT +EV
Sbjct  474  NNSKEGFGVAIRDNHNPRRQVVHSASPMPL---ENRVLDPKKSQNIAILLRALNVTIDEV  530

Query  505  CEALVEGTADSLGT  546
            C+AL EG  D+LGT
Sbjct  531  CDALREGNCDTLGT  544



>ref|XP_006466473.1| PREDICTED: formin-like protein 6-like [Citrus sinensis]
Length=899

 Score =   140 bits (353),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 91/126 (72%), Gaps = 5/126 (4%)
 Frame = +1

Query  181  QNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIET  360
            + V++   +SE  E    +  KPKLK LHWDKVRA+SDR  VWD LKSSSFQLNE+M+E+
Sbjct  438  EEVSKSTSTSEKTEGDGTDGAKPKLKALHWDKVRATSDRATVWDQLKSSSFQLNEDMMES  497

Query  361  LFMVNSNSDGVKRP-----LMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEG  525
            LF  NS +   K P     ++P +  ENRVLDPKKSQNIAILLRALNVT +EV EAL++G
Sbjct  498  LFGCNSVNSVPKEPTTRKSVLPPVELENRVLDPKKSQNIAILLRALNVTRDEVSEALLDG  557

Query  526  TADSLG  543
              +SLG
Sbjct  558  NPESLG  563



>gb|KDO78945.1| hypothetical protein CISIN_1g038630mg [Citrus sinensis]
Length=885

 Score =   140 bits (353),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 91/126 (72%), Gaps = 5/126 (4%)
 Frame = +1

Query  181  QNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIET  360
            + V++   +SE  E    +  KPKLK LHWDKVRA+SDR  VWD LKSSSFQLNE+M+E+
Sbjct  424  EEVSKSTSTSEKTEGDGTDGAKPKLKALHWDKVRATSDRATVWDQLKSSSFQLNEDMMES  483

Query  361  LFMVNSNSDGVKRP-----LMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEG  525
            LF  NS +   K P     ++P +  ENRVLDPKKSQNIAILLRALNVT +EV EAL++G
Sbjct  484  LFGCNSVNSVPKEPTTRKSVLPPVELENRVLDPKKSQNIAILLRALNVTRDEVSEALLDG  543

Query  526  TADSLG  543
              +SLG
Sbjct  544  NPESLG  549



>ref|XP_006426080.1| hypothetical protein CICLE_v10024805mg [Citrus clementina]
 gb|ESR39320.1| hypothetical protein CICLE_v10024805mg [Citrus clementina]
Length=958

 Score =   140 bits (353),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 91/126 (72%), Gaps = 5/126 (4%)
 Frame = +1

Query  181  QNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIET  360
            + V++   +SE  E    +  KPKLK LHWDKVRA+SDR  VWD LKSSSFQLNE+M+E+
Sbjct  497  EEVSKSTSTSEKTEGDGTDGAKPKLKALHWDKVRATSDRATVWDQLKSSSFQLNEDMMES  556

Query  361  LFMVNSNSDGVKRP-----LMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEG  525
            LF  NS +   K P     ++P +  ENRVLDPKKSQNIAILLRALNVT +EV EAL++G
Sbjct  557  LFGCNSVNSVPKEPTTRKSVLPPVELENRVLDPKKSQNIAILLRALNVTRDEVSEALLDG  616

Query  526  TADSLG  543
              +SLG
Sbjct  617  NPESLG  622



>ref|XP_009619755.1| PREDICTED: formin-like protein 6 isoform X2 [Nicotiana tomentosiformis]
Length=887

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 95/131 (73%), Gaps = 11/131 (8%)
 Frame = +1

Query  166  RPVVSQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNE  345
            R +  QN  E +H S+  ++      KPKLKPLHWDKVRA+S+R  VWD LKSSSFQLNE
Sbjct  425  RTLEEQN-GEARHDSDTTDES-----KPKLKPLHWDKVRATSERATVWDQLKSSSFQLNE  478

Query  346  EMIETLFMVNSN-----SDGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCE  510
            +M+E+LF  N++     +D  ++ + P + +EN VLDPKKSQNIAI+LRALNVT +EV E
Sbjct  479  DMMESLFGCNNSANSAPTDTTRKSVRPPVEKENSVLDPKKSQNIAIMLRALNVTKDEVSE  538

Query  511  ALVEGTADSLG  543
            AL++G A+ LG
Sbjct  539  ALLDGNAEGLG  549



>ref|XP_009619754.1| PREDICTED: formin-like protein 6 isoform X1 [Nicotiana tomentosiformis]
Length=901

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 95/131 (73%), Gaps = 11/131 (8%)
 Frame = +1

Query  166  RPVVSQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNE  345
            R +  QN  E +H S+  ++      KPKLKPLHWDKVRA+S+R  VWD LKSSSFQLNE
Sbjct  439  RTLEEQN-GEARHDSDTTDES-----KPKLKPLHWDKVRATSERATVWDQLKSSSFQLNE  492

Query  346  EMIETLFMVNSN-----SDGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCE  510
            +M+E+LF  N++     +D  ++ + P + +EN VLDPKKSQNIAI+LRALNVT +EV E
Sbjct  493  DMMESLFGCNNSANSAPTDTTRKSVRPPVEKENSVLDPKKSQNIAIMLRALNVTKDEVSE  552

Query  511  ALVEGTADSLG  543
            AL++G A+ LG
Sbjct  553  ALLDGNAEGLG  563



>ref|XP_003558554.1| PREDICTED: formin-like protein 8 [Brachypodium distachyon]
Length=896

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 82/105 (78%), Gaps = 8/105 (8%)
 Frame = +1

Query  247  PKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSN-----SDGVKRPLMP  411
            PKLKPLHWDKVRA+SDR MVWD LKSSSFQL+E+MIE LFM NS       DG ++   P
Sbjct  460  PKLKPLHWDKVRATSDRAMVWDQLKSSSFQLDEDMIEALFMNNSMPAAPPRDGGRK---P  516

Query  412  LLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
               QE RVLDPKK+QNIAILLRALNVT EEV +AL++G A+ LG+
Sbjct  517  PFRQEERVLDPKKAQNIAILLRALNVTREEVSDALLDGNAECLGS  561



>ref|XP_009787754.1| PREDICTED: formin-like protein 6 [Nicotiana sylvestris]
Length=905

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 95/131 (73%), Gaps = 11/131 (8%)
 Frame = +1

Query  166  RPVVSQNVAEVKHSSEAVEKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNE  345
            RP+  QN  E +H ++  ++      KPKLKPLHWDKVRA+S+R  VWD LKSSSFQLNE
Sbjct  443  RPLEEQN-GEARHDTDTTDES-----KPKLKPLHWDKVRATSERATVWDQLKSSSFQLNE  496

Query  346  EMIETLFMVNSN-----SDGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCE  510
            +M+E+LF   ++     +D  ++ + P + +EN VLDPKKSQNIAI+LRALNVT +EV E
Sbjct  497  DMMESLFGCKNSANSAPTDTTRKSVRPPVEKENSVLDPKKSQNIAIMLRALNVTKDEVSE  556

Query  511  ALVEGTADSLG  543
            AL++G A+ LG
Sbjct  557  ALLDGNAEGLG  567



>ref|XP_009790006.1| PREDICTED: formin-like protein 6 [Nicotiana sylvestris]
Length=887

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 82/104 (79%), Gaps = 4/104 (4%)
 Frame = +1

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNS----DGVKRPLMP  411
            KPKLKPLHWDKVRA+SDR  VWD LKSSSFQLNE+M+E+LF  NS +    +  ++ ++P
Sbjct  446  KPKLKPLHWDKVRATSDRATVWDQLKSSSFQLNEDMMESLFGCNSANPVPKEATRKSVLP  505

Query  412  LLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
             + QEN+VLDPKKSQNIAI+LRALNVT  EV EAL+ G  + LG
Sbjct  506  PVEQENKVLDPKKSQNIAIMLRALNVTKNEVSEALLNGNPEGLG  549



>ref|XP_010525272.1| PREDICTED: formin-like protein 10, partial [Tarenaya hassleriana]
Length=592

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 83/104 (80%), Gaps = 4/104 (4%)
 Frame = +1

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVKRPLM----P  411
            KPKLKPLHWDKVRA+  +   WDHL SSSF+LNEEMIE+LF+ N +    K  ++    P
Sbjct  175  KPKLKPLHWDKVRANPCQRTAWDHLGSSSFKLNEEMIESLFLANPSGSNAKPRILRADDP  234

Query  412  LLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
            +LN+ENRVLDPKK+QNIAILLRALN+T ++VC+AL +G +D+LG
Sbjct  235  MLNRENRVLDPKKAQNIAILLRALNLTTKDVCQALTDGDSDALG  278



>ref|XP_003516616.1| PREDICTED: formin-like protein 6-like [Glycine max]
Length=889

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 86/114 (75%), Gaps = 5/114 (4%)
 Frame = +1

Query  220  EKRNEETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSNSDGVKR  399
            E  + +  KPKLK LHWDKVRA+SDR  VWD +KSSSFQLNE+M+E+LF   + +   K 
Sbjct  440  EANDTDGAKPKLKALHWDKVRATSDRATVWDQIKSSSFQLNEDMMESLFGCKATNFTPKE  499

Query  400  P-----LMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
            P     ++P ++QENRVLDPKKSQNIAILLRALNVT +EV EAL++G  + LGT
Sbjct  500  PPRKKSVLPSVDQENRVLDPKKSQNIAILLRALNVTRDEVSEALLDGNPEGLGT  553



>emb|CDY43578.1| BnaC02g16750D [Brassica napus]
Length=840

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 89/129 (69%), Gaps = 13/129 (10%)
 Frame = +1

Query  196  VKHSSEAVEKRNEET-------MKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMI  354
             K  ++AVE+   E+        +PKLKPLHWDKVRASSDR  VWD LKSSSF++NE+ +
Sbjct  370  FKTRTKAVEEAKSESGEGETDPSRPKLKPLHWDKVRASSDRATVWDQLKSSSFRVNEDRM  429

Query  355  ETLFMVNSNSDGV------KRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEAL  516
            E LF  NS S         +R +MP    ENRVLDPKKSQNIAILLRALNVT EEV EAL
Sbjct  430  EHLFGCNSASSSAPKEPVRRRSVMPPAENENRVLDPKKSQNIAILLRALNVTREEVSEAL  489

Query  517  VEGTADSLG  543
            ++G  +SLG
Sbjct  490  LDGNPESLG  498



>gb|KHN06016.1| Formin-like protein 6, partial [Glycine soja]
Length=517

 Score =   135 bits (339),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 85/125 (68%), Gaps = 9/125 (7%)
 Frame = +1

Query  199  KHSSEAVEKRNE----ETMKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLF  366
            K S E V +R E    +  KPKLK LHWDKV  +SDR  VWD LK SSFQLNE+M+ETLF
Sbjct  56   KGSFEEVYQRREGDDVDGAKPKLKALHWDKVSTTSDRATVWDQLKFSSFQLNEDMMETLF  115

Query  367  MVNSNSDGVK-----RPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTA  531
               S     K     R ++P    ENRVLDPKKSQNIAILLRALNVT +EVCEAL++G  
Sbjct  116  GCKSTGSASKENVTRRSVLPPAEPENRVLDPKKSQNIAILLRALNVTRDEVCEALLDGNP  175

Query  532  DSLGT  546
            + LG+
Sbjct  176  EGLGS  180



>ref|XP_009394348.1| PREDICTED: formin-like protein 8 [Musa acuminata subsp. malaccensis]
Length=811

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 90/124 (73%), Gaps = 7/124 (6%)
 Frame = +1

Query  193  EVKHSSEAVEKRNEET---MKPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETL  363
            EV  SS  +E+  E+     KPKLKPLHWDKVRASSDR MVWD LKSSSFQ+NE++I+TL
Sbjct  357  EVASSSRQIEEAREDLEGDAKPKLKPLHWDKVRASSDRAMVWDQLKSSSFQVNEDVIQTL  416

Query  364  FMVNSNS----DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTA  531
            F+ N+ +    D  +R  +     ENRVLDPKKSQNIAILL+AL VT +EV EAL++G  
Sbjct  417  FVNNTTASVPKDASRRQGILPFKWENRVLDPKKSQNIAILLKALKVTTDEVSEALLDGNP  476

Query  532  DSLG  543
            + LG
Sbjct  477  ECLG  480



>ref|XP_006343211.1| PREDICTED: formin-like protein 6-like [Solanum tuberosum]
Length=881

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 85/104 (82%), Gaps = 4/104 (4%)
 Frame = +1

Query  244  KPKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNS-NS---DGVKRPLMP  411
            KP+LKPLHWDKVRA+S+R  VWD LKSSSFQLNE M+E+LF  NS NS   +  K+ + P
Sbjct  445  KPRLKPLHWDKVRATSERATVWDQLKSSSFQLNENMMESLFGCNSVNSVPNEVAKKSVRP  504

Query  412  LLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLG  543
             + +ENRVLDPKKSQNIAI+LRALNVT +EV E+L++G+A+ LG
Sbjct  505  TVEKENRVLDPKKSQNIAIMLRALNVTKDEVSESLLDGSAEGLG  548



>gb|EAZ45377.1| hypothetical protein OsJ_30023 [Oryza sativa Japonica Group]
Length=745

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 85/111 (77%), Gaps = 5/111 (5%)
 Frame = +1

Query  220  EKRNEETMKPKLKPLHWDKVR-ASSDRVMVWDHLKSSSFQLNEEMIETLFMVNS----NS  384
            EK  +   +PKLKPLHWDKVR ASS R  VWD LK+SSF++NEEMIETLF+ NS    + 
Sbjct  339  EKAADAAARPKLKPLHWDKVRPASSGRPTVWDQLKASSFRVNEEMIETLFVSNSTRRASK  398

Query  385  DGVKRPLMPLLNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADS  537
            +GVK       NQEN+VLDPKKSQNIAI+LRAL+ T EEVC+AL++G A+S
Sbjct  399  NGVKEANAACCNQENKVLDPKKSQNIAIMLRALDATKEEVCKALLDGQAES  449



>dbj|BAK04488.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=790

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 80/104 (77%), Gaps = 4/104 (4%)
 Frame = +1

Query  247  PKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSN----SDGVKRPLMPL  414
            PKLKPLHWDK RASS R  VWD LK+SSF++NEEMIETLF+ NS      +G K      
Sbjct  342  PKLKPLHWDKFRASSGRPTVWDQLKASSFRVNEEMIETLFVSNSTRRMPKNGFKEANGAP  401

Query  415  LNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
             NQEN+VLD KKSQNIAI+LRAL+ T EEVC+AL++G A+SLGT
Sbjct  402  FNQENKVLDAKKSQNIAIMLRALDATKEEVCKALLDGQAESLGT  445



>dbj|BAJ96451.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=790

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 80/104 (77%), Gaps = 4/104 (4%)
 Frame = +1

Query  247  PKLKPLHWDKVRASSDRVMVWDHLKSSSFQLNEEMIETLFMVNSN----SDGVKRPLMPL  414
            PKLKPLHWDK RASS R  VWD LK+SSF++NEEMIETLF+ NS      +G K      
Sbjct  342  PKLKPLHWDKFRASSGRPTVWDQLKASSFRVNEEMIETLFVSNSTRRMPKNGFKEANGAP  401

Query  415  LNQENRVLDPKKSQNIAILLRALNVTAEEVCEALVEGTADSLGT  546
             NQEN+VLD KKSQNIAI+LRAL+ T EEVC+AL++G A+SLGT
Sbjct  402  FNQENKVLDAKKSQNIAIMLRALDATKEEVCKALLDGQAESLGT  445



Lambda      K        H        a         alpha
   0.312    0.129    0.368    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 592801777335