BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP009D03 657 bp,

Length=608
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009586688.1|  PREDICTED: growth-regulating factor 3-like i...    207   6e-63   Nicotiana tomentosiformis
ref|XP_009586687.1|  PREDICTED: growth-regulating factor 3-like i...    205   3e-62   Nicotiana tomentosiformis
ref|XP_009783589.1|  PREDICTED: growth-regulating factor 3-like         209   3e-62   Nicotiana sylvestris
ref|XP_009599016.1|  PREDICTED: growth-regulating factor 3              209   5e-62   Nicotiana tomentosiformis
ref|XP_006339314.1|  PREDICTED: growth-regulating factor 3-like         205   1e-60   Solanum tuberosum [potatoes]
ref|XP_006341255.1|  PREDICTED: growth-regulating factor 3-like         204   4e-60   
ref|XP_009771979.1|  PREDICTED: growth-regulating factor 3-like         203   7e-60   Nicotiana sylvestris
ref|XP_002277233.3|  PREDICTED: growth-regulating factor 3              203   1e-59   Vitis vinifera
emb|CBI30260.3|  unnamed protein product                                201   6e-59   Vitis vinifera
ref|XP_007027645.1|  Growth-regulating factor 3 isoform 1               200   2e-58   Theobroma cacao [chocolate]
ref|XP_009352986.1|  PREDICTED: growth-regulating factor 3-like i...    199   2e-58   Pyrus x bretschneideri [bai li]
ref|XP_004246560.1|  PREDICTED: growth-regulating factor 3-like i...    198   5e-58   Solanum lycopersicum
ref|XP_010325931.1|  PREDICTED: growth-regulating factor 3-like i...    197   8e-58   Solanum lycopersicum
ref|XP_011077893.1|  PREDICTED: growth-regulating factor 3              197   1e-57   Sesamum indicum [beniseed]
ref|XP_009365360.1|  PREDICTED: growth-regulating factor 3-like i...    196   4e-57   Pyrus x bretschneideri [bai li]
ref|XP_004249453.1|  PREDICTED: growth-regulating factor 3              196   4e-57   Solanum lycopersicum
ref|XP_011094403.1|  PREDICTED: growth-regulating factor 3-like         196   7e-57   Sesamum indicum [beniseed]
ref|XP_009365359.1|  PREDICTED: growth-regulating factor 3-like i...    195   1e-56   Pyrus x bretschneideri [bai li]
gb|ADL36702.1|  GRF domain class transcription factor                   195   1e-56   Malus domestica [apple tree]
ref|XP_007162865.1|  hypothetical protein PHAVU_001G187500g             195   1e-56   Phaseolus vulgaris [French bean]
ref|XP_007027646.1|  Growth-regulating factor 3 isoform 2               194   2e-56   Theobroma cacao [chocolate]
ref|XP_009352985.1|  PREDICTED: growth-regulating factor 3-like i...    194   4e-56   Pyrus x bretschneideri [bai li]
emb|CDP15377.1|  unnamed protein product                                194   4e-56   Coffea canephora [robusta coffee]
gb|KDP42705.1|  hypothetical protein JCGZ_23645                         194   4e-56   Jatropha curcas
ref|XP_002534110.1|  conserved hypothetical protein                     194   5e-56   Ricinus communis
ref|XP_006481829.1|  PREDICTED: growth-regulating factor 3-like         193   7e-56   Citrus sinensis [Valencia orange]
ref|XP_006430277.1|  hypothetical protein CICLE_v10011856mg             193   9e-56   Citrus clementina
ref|XP_008360545.1|  PREDICTED: growth-regulating factor 3-like         191   5e-55   Malus domestica [apple tree]
ref|XP_010243928.1|  PREDICTED: growth-regulating factor 3              189   2e-54   Nelumbo nucifera [Indian lotus]
ref|XP_006381307.1|  hypothetical protein POPTR_0006s11630g             188   5e-54   Populus trichocarpa [western balsam poplar]
ref|XP_010242635.1|  PREDICTED: growth-regulating factor 3-like         187   8e-54   Nelumbo nucifera [Indian lotus]
ref|XP_003521448.1|  PREDICTED: growth-regulating factor 3 isofor...    187   1e-53   Glycine max [soybeans]
ref|XP_003553589.1|  PREDICTED: growth-regulating factor 3-like         186   4e-53   Glycine max [soybeans]
ref|XP_011018896.1|  PREDICTED: growth-regulating factor 3 isofor...    186   6e-53   Populus euphratica
ref|XP_004494150.1|  PREDICTED: growth-regulating factor 3-like         184   1e-52   Cicer arietinum [garbanzo]
gb|KHG00974.1|  hypothetical protein F383_23443                         184   2e-52   Gossypium arboreum [tree cotton]
ref|XP_008241279.1|  PREDICTED: growth-regulating factor 3              184   2e-52   Prunus mume [ume]
ref|XP_007202117.1|  hypothetical protein PRUPE_ppa006912mg             184   3e-52   Prunus persica
ref|XP_008442809.1|  PREDICTED: growth-regulating factor 3              184   4e-52   Cucumis melo [Oriental melon]
ref|XP_010683856.1|  PREDICTED: growth-regulating factor 3 isofor...    184   5e-52   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010683855.1|  PREDICTED: growth-regulating factor 3 isofor...    183   6e-52   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_004138010.1|  PREDICTED: growth-regulating factor 4-like         182   1e-51   
ref|XP_004165500.1|  PREDICTED: growth-regulating factor 4-like         182   1e-51   
gb|KEH24126.1|  growth-regulating factor                                181   1e-51   Medicago truncatula
gb|AFK43856.1|  unknown                                                 182   1e-51   Medicago truncatula
ref|XP_003625769.1|  GRL3                                               181   2e-51   Medicago truncatula
emb|CAN66216.1|  hypothetical protein VITISV_041165                     182   3e-51   Vitis vinifera
ref|XP_010049767.1|  PREDICTED: growth-regulating factor 3              182   4e-51   Eucalyptus grandis [rose gum]
emb|CDX67545.1|  BnaA07g15850D                                          179   6e-51   Brassica napus [oilseed rape]
ref|XP_011018895.1|  PREDICTED: growth-regulating factor 3 isofor...    180   8e-51   Populus euphratica
ref|XP_010553336.1|  PREDICTED: growth-regulating factor 3              179   8e-51   Tarenaya hassleriana [spider flower]
ref|XP_003537047.1|  PREDICTED: growth-regulating factor 3-like         177   2e-50   Glycine max [soybeans]
gb|KJB62216.1|  hypothetical protein B456_009G406500                    175   2e-49   Gossypium raimondii
gb|KJB62215.1|  hypothetical protein B456_009G406500                    175   2e-49   Gossypium raimondii
ref|XP_006594200.1|  PREDICTED: growth-regulating factor 3-like i...    173   1e-48   Glycine max [soybeans]
ref|XP_004303017.1|  PREDICTED: growth-regulating factor 3              174   1e-48   Fragaria vesca subsp. vesca
emb|CDX84560.1|  BnaA03g16700D                                          173   2e-48   Brassica napus [oilseed rape]
gb|KHN18741.1|  hypothetical protein glysoja_021492                     173   2e-48   Glycine soja [wild soybean]
ref|XP_003542566.1|  PREDICTED: growth-regulating factor 3-like i...    172   3e-48   Glycine max [soybeans]
emb|CDY13333.1|  BnaC06g14240D                                          172   4e-48   Brassica napus [oilseed rape]
ref|XP_009133081.1|  PREDICTED: growth-regulating factor 3-like         171   8e-48   Brassica rapa
ref|XP_006577061.1|  PREDICTED: growth-regulating factor 3 isofor...    170   9e-48   
ref|XP_009125239.1|  PREDICTED: growth-regulating factor 4-like         171   1e-47   Brassica rapa
emb|CDX73595.1|  BnaC08g24080D                                          171   2e-47   Brassica napus [oilseed rape]
emb|CDX79674.1|  BnaC03g20100D                                          170   2e-47   Brassica napus [oilseed rape]
ref|XP_010527788.1|  PREDICTED: growth-regulating factor 3-like i...    169   2e-46   Tarenaya hassleriana [spider flower]
ref|XP_010527780.1|  PREDICTED: growth-regulating factor 3-like i...    168   2e-46   Tarenaya hassleriana [spider flower]
gb|KHN25188.1|  hypothetical protein glysoja_044785                     166   3e-46   Glycine soja [wild soybean]
gb|KJB62218.1|  hypothetical protein B456_009G406500                    166   3e-46   Gossypium raimondii
ref|XP_010089399.1|  hypothetical protein L484_013790                   168   4e-46   Morus notabilis
gb|KJB62217.1|  hypothetical protein B456_009G406500                    167   4e-46   Gossypium raimondii
ref|XP_006291235.1|  hypothetical protein CARUB_v10017366mg             168   4e-46   Capsella rubella
emb|CDX78132.1|  BnaA09g33270D                                          166   8e-46   Brassica napus [oilseed rape]
ref|XP_006410817.1|  hypothetical protein EUTSA_v10016778mg             165   3e-45   Eutrema salsugineum
gb|KJB36396.1|  hypothetical protein B456_006G157300                    163   4e-45   Gossypium raimondii
ref|XP_009115989.1|  PREDICTED: growth-regulating factor 4-like         164   5e-45   Brassica rapa
ref|XP_009148749.1|  PREDICTED: growth-regulating factor 4-like i...    164   6e-45   Brassica rapa
gb|KFK34537.1|  hypothetical protein AALP_AA5G159100                    164   7e-45   Arabis alpina [alpine rockcress]
emb|CDX76249.1|  BnaA04g05130D                                          164   7e-45   Brassica napus [oilseed rape]
ref|XP_006403753.1|  hypothetical protein EUTSA_v10010453mg             164   8e-45   Eutrema salsugineum
dbj|BAC42083.1|  unknown protein                                        164   9e-45   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181181.1|  growth-regulating factor 3                            164   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881441.1|  hypothetical protein ARALYDRAFT_482616             163   2e-44   Arabidopsis lyrata subsp. lyrata
ref|XP_010505186.1|  PREDICTED: growth-regulating factor 3-like         162   3e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010504040.1|  PREDICTED: growth-regulating factor 4-like i...    162   4e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010509475.1|  PREDICTED: growth-regulating factor 3              162   5e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010516861.1|  PREDICTED: growth-regulating factor 3-like         161   8e-44   Camelina sativa [gold-of-pleasure]
ref|NP_190859.2|  growth-regulating factor 4                            160   2e-43   Arabidopsis thaliana [mouse-ear cress]
gb|KFK36342.1|  hypothetical protein AALP_AA4G110100                    160   2e-43   Arabis alpina [alpine rockcress]
ref|XP_002877892.1|  hypothetical protein ARALYDRAFT_323835             162   4e-43   Arabidopsis lyrata subsp. lyrata
emb|CDY66284.1|  BnaCnng50230D                                          162   5e-43   Brassica napus [oilseed rape]
ref|XP_009148750.1|  PREDICTED: growth-regulating factor 4-like i...    158   5e-43   Brassica rapa
emb|CAB86895.1|  putative protein                                       162   6e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010910363.1|  PREDICTED: growth-regulating factor 3 isofor...    158   1e-42   Elaeis guineensis
ref|XP_009143588.1|  PREDICTED: growth-regulating factor 3-like         158   1e-42   Brassica rapa
emb|CDX75039.1|  BnaA05g07850D                                          157   2e-42   Brassica napus [oilseed rape]
ref|XP_006296027.1|  hypothetical protein CARUB_v10025172mg             157   3e-42   Capsella rubella
ref|XP_010426922.1|  PREDICTED: growth-regulating factor 4-like         157   5e-42   Camelina sativa [gold-of-pleasure]
emb|CDX84126.1|  BnaC04g08880D                                          155   1e-41   Brassica napus [oilseed rape]
gb|AAO24537.1|  At3g52910                                               150   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010515769.1|  PREDICTED: growth-regulating factor 4              153   8e-41   Camelina sativa [gold-of-pleasure]
ref|XP_009393370.1|  PREDICTED: growth-regulating factor 3              153   1e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007145239.1|  hypothetical protein PHAVU_007G222300g             151   2e-40   Phaseolus vulgaris [French bean]
ref|XP_008793976.1|  PREDICTED: growth-regulating factor 3              151   4e-40   Phoenix dactylifera
ref|XP_009411969.1|  PREDICTED: growth-regulating factor 3-like         147   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010910364.1|  PREDICTED: growth-regulating factor 3 isofor...    143   1e-37   Elaeis guineensis
emb|CDY43721.1|  BnaAnng07360D                                          138   2e-35   Brassica napus [oilseed rape]
gb|EYU38620.1|  hypothetical protein MIMGU_mgv1a011592mg                133   4e-34   Erythranthe guttata [common monkey flower]
gb|KGN63355.1|  hypothetical protein Csa_2G432230                       133   2e-33   Cucumis sativus [cucumbers]
ref|XP_008462790.1|  PREDICTED: growth-regulating factor 4-like         132   2e-33   Cucumis melo [Oriental melon]
ref|XP_004151910.1|  PREDICTED: growth-regulating factor 3-like         132   3e-33   
ref|XP_004148588.1|  PREDICTED: growth-regulating factor 5-like         130   1e-32   Cucumis sativus [cucumbers]
ref|XP_010255823.1|  PREDICTED: growth-regulating factor 4-like         130   2e-32   Nelumbo nucifera [Indian lotus]
gb|KEH17760.1|  growth-regulating factor                                130   2e-32   Medicago truncatula
gb|KJB80998.1|  hypothetical protein B456_013G184200                    127   2e-32   Gossypium raimondii
ref|XP_008463996.1|  PREDICTED: growth-regulating factor 5 isofor...    130   2e-32   Cucumis melo [Oriental melon]
ref|XP_008463995.1|  PREDICTED: growth-regulating factor 5 isofor...    130   2e-32   Cucumis melo [Oriental melon]
ref|XP_004165889.1|  PREDICTED: growth-regulating factor 5-like         130   2e-32   
gb|KHN46482.1|  hypothetical protein glysoja_035158                     129   3e-32   Glycine soja [wild soybean]
ref|XP_003540042.1|  PREDICTED: growth-regulating factor 4-like         129   3e-32   Glycine max [soybeans]
ref|XP_009413829.1|  PREDICTED: growth-regulating factor 1-like         124   3e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010273921.1|  PREDICTED: growth-regulating factor 1 isofor...    129   4e-32   Nelumbo nucifera [Indian lotus]
gb|EPS59351.1|  hypothetical protein M569_15457                         124   6e-32   Genlisea aurea
ref|XP_006851561.1|  hypothetical protein AMTR_s00040p00189460          130   6e-32   Amborella trichopoda
ref|XP_010933923.1|  PREDICTED: growth-regulating factor 10-like        127   7e-32   Elaeis guineensis
ref|XP_010261922.1|  PREDICTED: growth-regulating factor 1-like         129   8e-32   Nelumbo nucifera [Indian lotus]
ref|XP_004307837.1|  PREDICTED: growth-regulating factor 4-like         128   9e-32   Fragaria vesca subsp. vesca
gb|KJB81001.1|  hypothetical protein B456_013G184200                    128   1e-31   Gossypium raimondii
ref|XP_010273920.1|  PREDICTED: growth-regulating factor 1 isofor...    129   1e-31   Nelumbo nucifera [Indian lotus]
ref|XP_006437422.1|  hypothetical protein CICLE_v10032065mg             128   1e-31   Citrus clementina
ref|XP_011036429.1|  PREDICTED: growth-regulating factor 5-like         128   1e-31   Populus euphratica
ref|XP_010086824.1|  hypothetical protein L484_009597                   129   1e-31   Morus notabilis
gb|KDO48006.1|  hypothetical protein CISIN_1g020051mg                   127   1e-31   Citrus sinensis [Valencia orange]
gb|EPS64309.1|  hypothetical protein M569_10478                         123   2e-31   Genlisea aurea
ref|XP_008234521.1|  PREDICTED: growth-regulating factor 4-like         127   2e-31   Prunus mume [ume]
gb|KHG06614.1|  dna double-strand break repair rad50 atpase             127   2e-31   Gossypium arboreum [tree cotton]
ref|XP_008450915.1|  PREDICTED: growth-regulating factor 4-like         127   2e-31   Cucumis melo [Oriental melon]
ref|XP_007219489.1|  hypothetical protein PRUPE_ppa022199mg             127   2e-31   Prunus persica
gb|KJB18524.1|  hypothetical protein B456_003G057700                    127   2e-31   Gossypium raimondii
ref|XP_003627270.1|  GRL2                                               125   2e-31   
gb|KJB81000.1|  hypothetical protein B456_013G184200                    125   2e-31   Gossypium raimondii
gb|KJB18523.1|  hypothetical protein B456_003G057700                    127   2e-31   Gossypium raimondii
gb|KHG13640.1|  dna double-strand break repair rad50 atpase             127   3e-31   Gossypium arboreum [tree cotton]
gb|KDP39549.1|  hypothetical protein JCGZ_02569                         127   3e-31   Jatropha curcas
ref|XP_006375983.1|  hypothetical protein POPTR_0013s07500g             127   3e-31   Populus trichocarpa [western balsam poplar]
ref|XP_003529835.1|  PREDICTED: growth-regulating factor 5-like         127   4e-31   Glycine max [soybeans]
ref|XP_011044430.1|  PREDICTED: growth-regulating factor 4-like         126   4e-31   Populus euphratica
gb|KDO53514.1|  hypothetical protein CISIN_1g023105mg                   125   4e-31   Citrus sinensis [Valencia orange]
gb|KHN34128.1|  hypothetical protein glysoja_038617                     125   5e-31   Glycine soja [wild soybean]
ref|XP_007029701.1|  Growth-regulating factor 5                         126   5e-31   Theobroma cacao [chocolate]
ref|XP_006490823.1|  PREDICTED: growth-regulating factor 5-like i...    125   5e-31   Citrus sinensis [Valencia orange]
ref|XP_007135443.1|  hypothetical protein PHAVU_010G130000g             126   5e-31   Phaseolus vulgaris [French bean]
ref|XP_004144026.1|  PREDICTED: growth-regulating factor 5-like         126   5e-31   Cucumis sativus [cucumbers]
ref|XP_004141176.1|  PREDICTED: growth-regulating factor 5-like         126   5e-31   Cucumis sativus [cucumbers]
ref|XP_003537666.1|  PREDICTED: growth-regulating factor 4-like         125   6e-31   Glycine max [soybeans]
ref|XP_006854210.1|  hypothetical protein AMTR_s00048p00216350          126   6e-31   Amborella trichopoda
gb|KHN01405.1|  hypothetical protein glysoja_009611                     126   6e-31   Glycine soja [wild soybean]
ref|XP_002298093.2|  hypothetical protein POPTR_0001s16920g             126   6e-31   Populus trichocarpa [western balsam poplar]
ref|XP_008459738.1|  PREDICTED: growth-regulating factor 6-like         125   6e-31   Cucumis melo [Oriental melon]
ref|XP_003517558.1|  PREDICTED: growth-regulating factor 4-like         125   6e-31   Glycine max [soybeans]
gb|KHN39631.1|  hypothetical protein glysoja_020709                     126   6e-31   Glycine soja [wild soybean]
gb|AET01746.2|  growth-regulating factor-like protein                   126   7e-31   Medicago truncatula
ref|XP_006451560.1|  hypothetical protein CICLE_v10008922mg             125   8e-31   Citrus clementina
gb|EPS67843.1|  hypothetical protein M569_06931                         120   8e-31   Genlisea aurea
ref|XP_004506550.1|  PREDICTED: growth-regulating factor 4-like i...    125   8e-31   Cicer arietinum [garbanzo]
ref|XP_010940818.1|  PREDICTED: growth-regulating factor 5-like i...    125   8e-31   Elaeis guineensis
ref|XP_010940817.1|  PREDICTED: growth-regulating factor 5-like i...    125   9e-31   Elaeis guineensis
ref|XP_003547719.2|  PREDICTED: growth-regulating factor 5-like i...    125   9e-31   Glycine max [soybeans]
ref|XP_004506549.1|  PREDICTED: growth-regulating factor 4-like i...    125   1e-30   
ref|XP_007024621.1|  Growth-regulating factor 5, putative               125   1e-30   Theobroma cacao [chocolate]
ref|XP_010047492.1|  PREDICTED: growth-regulating factor 1 isofor...    126   1e-30   Eucalyptus grandis [rose gum]
ref|XP_009767378.1|  PREDICTED: growth-regulating factor 1-like         125   1e-30   Nicotiana sylvestris
ref|XP_010047491.1|  PREDICTED: growth-regulating factor 1 isofor...    126   1e-30   Eucalyptus grandis [rose gum]
ref|XP_002270427.2|  PREDICTED: growth-regulating factor 4-like i...    125   1e-30   Vitis vinifera
ref|XP_001782903.1|  predicted protein                                  119   1e-30   Physcomitrella patens
ref|XP_006598832.1|  PREDICTED: growth-regulating factor 5-like i...    125   1e-30   Glycine max [soybeans]
ref|XP_006598831.1|  PREDICTED: growth-regulating factor 5-like i...    125   1e-30   Glycine max [soybeans]
ref|XP_010662088.1|  PREDICTED: growth-regulating factor 4-like i...    125   1e-30   Vitis vinifera
ref|XP_010251960.1|  PREDICTED: growth-regulating factor 2              127   2e-30   Nelumbo nucifera [Indian lotus]
ref|XP_011035717.1|  PREDICTED: growth-regulating factor 5-like         125   2e-30   Populus euphratica
gb|KJB70121.1|  hypothetical protein B456_011G058800                    124   2e-30   Gossypium raimondii
ref|XP_009615805.1|  PREDICTED: growth-regulating factor 1-like         124   2e-30   Nicotiana tomentosiformis
ref|XP_010528592.1|  PREDICTED: growth-regulating factor 3-like i...    124   2e-30   Tarenaya hassleriana [spider flower]
ref|XP_002303244.2|  hypothetical protein POPTR_0003s06360g             125   2e-30   Populus trichocarpa [western balsam poplar]
emb|CBI26466.3|  unnamed protein product                                125   2e-30   Vitis vinifera
ref|XP_009781044.1|  PREDICTED: growth-regulating factor 1-like         124   2e-30   Nicotiana sylvestris
ref|XP_002516290.1|  conserved hypothetical protein                     123   2e-30   
ref|XP_008803298.1|  PREDICTED: growth-regulating factor 10-like ...    123   2e-30   Phoenix dactylifera
ref|XP_009385874.1|  PREDICTED: growth-regulating factor 5-like i...    124   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009385873.1|  PREDICTED: growth-regulating factor 5-like i...    124   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011012401.1|  PREDICTED: growth-regulating factor 4-like         124   2e-30   Populus euphratica
ref|XP_008812758.1|  PREDICTED: growth-regulating factor 4-like         124   3e-30   Phoenix dactylifera
ref|XP_002521329.1|  conserved hypothetical protein                     124   3e-30   Ricinus communis
ref|XP_008242216.1|  PREDICTED: growth-regulating factor 1-like i...    125   3e-30   Prunus mume [ume]
ref|XP_010919180.1|  PREDICTED: growth-regulating factor 10-like        123   3e-30   Elaeis guineensis
ref|XP_010943630.1|  PREDICTED: growth-regulating factor 4-like i...    124   3e-30   Elaeis guineensis
ref|XP_010528591.1|  PREDICTED: growth-regulating factor 3-like i...    124   3e-30   Tarenaya hassleriana [spider flower]
ref|XP_009596803.1|  PREDICTED: growth-regulating factor 1-like         124   3e-30   Nicotiana tomentosiformis
ref|XP_007157086.1|  hypothetical protein PHAVU_002G041800g             124   3e-30   Phaseolus vulgaris [French bean]
ref|XP_010943629.1|  PREDICTED: growth-regulating factor 4-like i...    124   4e-30   Elaeis guineensis
ref|XP_009415171.1|  PREDICTED: growth-regulating factor 5-like         124   4e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009420425.1|  PREDICTED: growth-regulating factor 5-like         124   4e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011460609.1|  PREDICTED: growth-regulating factor 1 isofor...    124   4e-30   Fragaria vesca subsp. vesca
ref|XP_004287622.1|  PREDICTED: growth-regulating factor 1 isofor...    124   4e-30   Fragaria vesca subsp. vesca
ref|XP_006371207.1|  hypothetical protein POPTR_0019s05910g             123   4e-30   Populus trichocarpa [western balsam poplar]
gb|KJB70120.1|  hypothetical protein B456_011G058800                    123   5e-30   Gossypium raimondii
ref|XP_003539001.1|  PREDICTED: growth-regulating factor 5-like         123   5e-30   Glycine max [soybeans]
gb|KHN39845.1|  hypothetical protein glysoja_020585                     123   5e-30   Glycine soja [wild soybean]
ref|XP_010932723.1|  PREDICTED: growth-regulating factor 1-like         119   7e-30   Elaeis guineensis
ref|XP_007131487.1|  hypothetical protein PHAVU_011G017700g             122   9e-30   Phaseolus vulgaris [French bean]
ref|XP_008813471.1|  PREDICTED: growth-regulating factor 4-like         123   1e-29   Phoenix dactylifera
gb|KDP33905.1|  hypothetical protein JCGZ_07476                         123   1e-29   Jatropha curcas
ref|XP_009386841.1|  PREDICTED: growth-regulating factor 5-like         123   1e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008803299.1|  PREDICTED: growth-regulating factor 10-like ...    120   1e-29   Phoenix dactylifera
gb|KJB29408.1|  hypothetical protein B456_005G098700                    124   1e-29   Gossypium raimondii
ref|XP_010553871.1|  PREDICTED: growth-regulating factor 4-like i...    122   2e-29   Tarenaya hassleriana [spider flower]
gb|KEH37559.1|  growth-regulating factor-like protein                   122   2e-29   Medicago truncatula
ref|XP_010553873.1|  PREDICTED: growth-regulating factor 4-like i...    121   2e-29   Tarenaya hassleriana [spider flower]
ref|XP_011045985.1|  PREDICTED: growth-regulating factor 1 isofor...    122   2e-29   Populus euphratica
ref|XP_011045982.1|  PREDICTED: growth-regulating factor 1 isofor...    122   2e-29   Populus euphratica
gb|EYU29085.1|  hypothetical protein MIMGU_mgv1a024321mg                122   2e-29   Erythranthe guttata [common monkey flower]
ref|XP_010541983.1|  PREDICTED: growth-regulating factor 6              121   2e-29   Tarenaya hassleriana [spider flower]
ref|XP_011045983.1|  PREDICTED: growth-regulating factor 1 isofor...    122   2e-29   Populus euphratica
ref|XP_011045984.1|  PREDICTED: growth-regulating factor 1 isofor...    122   2e-29   Populus euphratica
ref|XP_004513476.1|  PREDICTED: growth-regulating factor 1-like         122   2e-29   Cicer arietinum [garbanzo]
gb|KJB29407.1|  hypothetical protein B456_005G098700                    124   2e-29   Gossypium raimondii
gb|KEH37561.1|  growth-regulating factor-like protein                   122   2e-29   Medicago truncatula
emb|CDP03099.1|  unnamed protein product                                123   2e-29   Coffea canephora [robusta coffee]
gb|KFK30384.1|  hypothetical protein AALP_AA7G254100                    123   2e-29   Arabis alpina [alpine rockcress]
gb|KEH37560.1|  growth-regulating factor-like protein                   122   2e-29   Medicago truncatula
ref|XP_004964364.1|  PREDICTED: growth-regulating factor 5-like i...    122   2e-29   Setaria italica
ref|XP_010324484.1|  PREDICTED: growth-regulating factor 4-like i...    122   2e-29   Solanum lycopersicum
ref|XP_009385239.1|  PREDICTED: growth-regulating factor 10-like        120   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001778905.1|  predicted protein                                  116   3e-29   Physcomitrella patens
ref|XP_004246199.2|  PREDICTED: growth-regulating factor 4-like         122   3e-29   Solanum lycopersicum
ref|XP_006361251.1|  PREDICTED: growth-regulating factor 4-like         122   3e-29   Solanum tuberosum [potatoes]
ref|XP_004964363.1|  PREDICTED: growth-regulating factor 5-like i...    122   3e-29   
ref|XP_009605690.1|  PREDICTED: growth-regulating factor 4-like i...    122   3e-29   Nicotiana tomentosiformis
ref|XP_006381639.1|  hypothetical protein POPTR_0006s14560g             122   3e-29   Populus trichocarpa [western balsam poplar]
ref|XP_008242218.1|  PREDICTED: growth-regulating factor 1-like i...    122   3e-29   Prunus mume [ume]
ref|XP_010324483.1|  PREDICTED: growth-regulating factor 4-like i...    122   3e-29   Solanum lycopersicum
ref|XP_009797591.1|  PREDICTED: growth-regulating factor 4-like i...    122   3e-29   Nicotiana sylvestris
ref|XP_009794508.1|  PREDICTED: growth-regulating factor 4-like i...    121   3e-29   Nicotiana sylvestris
ref|XP_009605688.1|  PREDICTED: growth-regulating factor 4-like i...    121   3e-29   Nicotiana tomentosiformis
ref|XP_011093817.1|  PREDICTED: growth-regulating factor 1-like         121   4e-29   Sesamum indicum [beniseed]
ref|XP_009797585.1|  PREDICTED: growth-regulating factor 4-like i...    121   4e-29   Nicotiana sylvestris
gb|EYU25864.1|  hypothetical protein MIMGU_mgv1a010559mg                120   4e-29   Erythranthe guttata [common monkey flower]
gb|KHG19107.1|  hypothetical protein F383_07760                         121   4e-29   Gossypium arboreum [tree cotton]
ref|XP_008786732.1|  PREDICTED: growth-regulating factor 1-like         117   4e-29   
ref|XP_008780324.1|  PREDICTED: growth-regulating factor 1-like         116   4e-29   Phoenix dactylifera
ref|XP_002271355.3|  PREDICTED: growth-regulating factor 4 isofor...    123   4e-29   Vitis vinifera
ref|XP_010662924.1|  PREDICTED: growth-regulating factor 4 isofor...    123   4e-29   Vitis vinifera
ref|XP_007214861.1|  hypothetical protein PRUPE_ppa017593mg             121   4e-29   Prunus persica
gb|KHG03220.1|  ATP synthase subunit delta                              123   4e-29   Gossypium arboreum [tree cotton]
ref|XP_010661582.1|  PREDICTED: growth-regulating factor 9 isofor...    122   4e-29   Vitis vinifera
ref|XP_010661583.1|  PREDICTED: growth-regulating factor 9 isofor...    122   4e-29   Vitis vinifera
emb|CBI23073.3|  unnamed protein product                                123   5e-29   Vitis vinifera
gb|KEH32452.1|  growth-regulating factor-like protein                   122   5e-29   Medicago truncatula
ref|XP_009790956.1|  PREDICTED: growth-regulating factor 1-like         123   5e-29   Nicotiana sylvestris
ref|XP_011092609.1|  PREDICTED: growth-regulating factor 4-like i...    120   6e-29   Sesamum indicum [beniseed]
ref|XP_010533032.1|  PREDICTED: growth-regulating factor 6-like         120   6e-29   Tarenaya hassleriana [spider flower]
ref|XP_009606791.1|  PREDICTED: growth-regulating factor 4-like         120   6e-29   Nicotiana tomentosiformis
ref|XP_007138669.1|  hypothetical protein PHAVU_009G228000g             120   6e-29   Phaseolus vulgaris [French bean]
ref|XP_004510466.1|  PREDICTED: growth-regulating factor 5-like i...    120   6e-29   
gb|EYU23268.1|  hypothetical protein MIMGU_mgv1a009029mg                120   7e-29   Erythranthe guttata [common monkey flower]
ref|XP_003580449.1|  PREDICTED: growth-regulating factor 3-like         121   7e-29   Brachypodium distachyon [annual false brome]
ref|XP_008780035.1|  PREDICTED: growth-regulating factor 10-like        119   7e-29   Phoenix dactylifera
ref|XP_011074968.1|  PREDICTED: growth-regulating factor 4-like         120   7e-29   Sesamum indicum [beniseed]
ref|XP_008363050.1|  PREDICTED: growth-regulating factor 5-like         117   7e-29   Malus domestica [apple tree]
ref|XP_004510465.1|  PREDICTED: growth-regulating factor 5-like i...    120   7e-29   Cicer arietinum [garbanzo]
ref|XP_011092605.1|  PREDICTED: growth-regulating factor 4-like i...    120   7e-29   Sesamum indicum [beniseed]
gb|KJB54461.1|  hypothetical protein B456_009G035200                    121   8e-29   Gossypium raimondii
ref|XP_004303687.1|  PREDICTED: growth-regulating factor 5-like         120   8e-29   Fragaria vesca subsp. vesca
ref|XP_009414810.1|  PREDICTED: growth-regulating factor 1-like i...    120   8e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010432035.1|  PREDICTED: growth-regulating factor 2-like         122   8e-29   Camelina sativa [gold-of-pleasure]
ref|NP_195488.2|  growth-regulating factor 2                            122   8e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010666149.1|  PREDICTED: growth-regulating factor 7              122   8e-29   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009414811.1|  PREDICTED: growth-regulating factor 1-like i...    120   9e-29   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAB38922.1|  putative protein                                       121   9e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010276023.1|  PREDICTED: growth-regulating factor 10             119   1e-28   
ref|XP_006372002.1|  hypothetical protein POPTR_0018s07140g             120   1e-28   
gb|KJB59865.1|  hypothetical protein B456_009G277500                    122   1e-28   
ref|XP_006846580.1|  hypothetical protein AMTR_s00018p00250840          122   1e-28   
ref|XP_006283492.1|  hypothetical protein CARUB_v10004544mg             121   1e-28   
ref|XP_007204778.1|  hypothetical protein PRUPE_ppa015791mg             120   1e-28   
ref|XP_008646054.1|  PREDICTED: growth-regulating factor 10-like        117   1e-28   
ref|XP_007154592.1|  hypothetical protein PHAVU_003G131800g             120   1e-28   
ref|XP_002866933.1|  predicted protein                                  121   1e-28   
ref|XP_010446629.1|  PREDICTED: growth-regulating factor 2              121   1e-28   
gb|KHN06084.1|  hypothetical protein glysoja_035990                     120   1e-28   
ref|XP_008228198.1|  PREDICTED: growth-regulating factor 5 isofor...    120   1e-28   
ref|XP_008228199.1|  PREDICTED: growth-regulating factor 5 isofor...    120   1e-28   
ref|XP_003547502.2|  PREDICTED: growth-regulating factor 1-like         120   1e-28   
gb|KHF99600.1|  hypothetical protein F383_17440                         122   1e-28   
ref|XP_011009586.1|  PREDICTED: growth-regulating factor 1-like         120   1e-28   
ref|XP_010656124.1|  PREDICTED: growth-regulating factor 1 isofor...    120   2e-28   
ref|XP_009589483.1|  PREDICTED: growth-regulating factor 1-like         122   2e-28   
ref|XP_006857080.1|  hypothetical protein AMTR_s00065p00092420          122   2e-28   
ref|XP_010656126.1|  PREDICTED: growth-regulating factor 1 isofor...    120   2e-28   
emb|CBI27820.3|  unnamed protein product                                120   2e-28   
ref|XP_004243717.1|  PREDICTED: growth-regulating factor 1-like         119   2e-28   
ref|XP_009412847.1|  PREDICTED: growth-regulating factor 10-like        117   2e-28   
ref|XP_010666262.1|  PREDICTED: growth-regulating factor 1              119   2e-28   
ref|XP_002975239.1|  hypothetical protein SELMODRAFT_442763             122   2e-28   
gb|KHN12274.1|  hypothetical protein glysoja_026166                     119   2e-28   
ref|XP_003534945.2|  PREDICTED: growth-regulating factor 1-like         119   2e-28   
ref|XP_008391391.1|  PREDICTED: growth-regulating factor 5              119   2e-28   
ref|XP_006342364.1|  PREDICTED: growth-regulating factor 1-like         119   2e-28   
ref|XP_002974366.1|  hypothetical protein SELMODRAFT_442384             122   2e-28   
dbj|BAK07599.1|  predicted protein                                      119   3e-28   
gb|EPS65941.1|  hypothetical protein M569_08839                         113   3e-28   
emb|CAN65448.1|  hypothetical protein VITISV_011426                     120   3e-28   
ref|XP_009361694.1|  PREDICTED: growth-regulating factor 1-like i...    119   3e-28   
ref|XP_009372336.1|  PREDICTED: growth-regulating factor 5 isofor...    118   3e-28   
ref|XP_009361693.1|  PREDICTED: growth-regulating factor 1-like i...    119   3e-28   
gb|AAP45172.2|  hypothetical protein SBB1_14t00021                      120   3e-28   
ref|XP_006411855.1|  hypothetical protein EUTSA_v10024915mg             120   3e-28   
gb|AAP45157.2|  hypothetical protein SBB1_21t00001                      119   3e-28   
ref|XP_009372335.1|  PREDICTED: growth-regulating factor 5 isofor...    119   3e-28   
ref|NP_001056618.1|  Os06g0116200                                       119   4e-28   
ref|XP_011074333.1|  PREDICTED: growth-regulating factor 6-like         120   4e-28   
gb|KFK30383.1|  hypothetical protein AALP_AA7G254000                    119   4e-28   
ref|XP_009402977.1|  PREDICTED: growth-regulating factor 4-like         118   4e-28   
gb|EYU28340.1|  hypothetical protein MIMGU_mgv1a008605mg                119   4e-28   
ref|XP_004955149.1|  PREDICTED: growth-regulating factor 10-like        116   4e-28   
ref|XP_010906236.1|  PREDICTED: growth-regulating factor 5-like         119   4e-28   
ref|XP_007012669.1|  Growth-regulating factor 5 isoform 3               119   4e-28   
ref|XP_003551131.2|  PREDICTED: growth-regulating factor 1-like         119   4e-28   
gb|KHN17714.1|  hypothetical protein glysoja_005911                     119   4e-28   
ref|XP_007012667.1|  Growth-regulating factor 5 isoform 1               119   4e-28   
ref|XP_007012668.1|  Growth-regulating factor 5 isoform 2               118   5e-28   
emb|CDX75672.1|  BnaA01g00300D                                          119   5e-28   
ref|XP_008677414.1|  PREDICTED: growth-regulating factor isoform X1     115   6e-28   
ref|XP_010316034.1|  PREDICTED: growth-regulating factor 2-like i...    120   6e-28   
gb|AFB74090.1|  growth-regulating factor 2                              119   6e-28   
ref|XP_002301140.2|  hypothetical protein POPTR_0002s11590g             119   6e-28   
gb|KHN07909.1|  hypothetical protein glysoja_032453                     118   6e-28   
ref|XP_003541304.1|  PREDICTED: growth-regulating factor 1-like i...    118   7e-28   
ref|XP_006593944.1|  PREDICTED: growth-regulating factor 1-like i...    118   7e-28   
ref|XP_009133704.1|  PREDICTED: growth-regulating factor 2              118   7e-28   
ref|NP_001047843.1|  Os02g0701300                                       118   8e-28   
ref|XP_008647264.1|  PREDICTED: putative growth-regulating factor...    118   8e-28   
ref|NP_001152607.1|  growth-regulating factor                           115   8e-28   
ref|XP_010235821.1|  PREDICTED: growth-regulating factor 10-like        115   8e-28   
ref|XP_002320070.2|  hypothetical protein POPTR_0014s06750g             118   8e-28   
ref|XP_008647265.1|  PREDICTED: putative growth-regulating factor...    118   8e-28   
gb|ACG36157.1|  growth-regulating factor                                118   8e-28   
ref|XP_008802970.1|  PREDICTED: growth-regulating factor 5-like i...    118   8e-28   
ref|XP_009402070.1|  PREDICTED: growth-regulating factor 10-like        115   8e-28   
ref|XP_010917179.1|  PREDICTED: growth-regulating factor 1-like         117   8e-28   
gb|KGN62426.1|  hypothetical protein Csa_2G354030                       120   8e-28   
ref|XP_010685314.1|  PREDICTED: growth-regulating factor 5 isofor...    115   9e-28   
emb|CDY55116.1|  BnaA03g54950D                                          116   9e-28   
gb|AFW75298.1|  putative growth-regulating factor 14                    118   9e-28   
ref|NP_001106045.1|  putative growth-regulating factor 14               118   9e-28   
ref|XP_010090133.1|  hypothetical protein L484_027365                   118   9e-28   
gb|EEC73842.1|  hypothetical protein OsI_08594                          118   1e-27   
gb|EEE57634.1|  hypothetical protein OsJ_08054                          118   1e-27   
ref|XP_008802971.1|  PREDICTED: growth-regulating factor 5-like i...    117   1e-27   
ref|XP_008344036.1|  PREDICTED: growth-regulating factor 1-like i...    117   1e-27   
ref|XP_008344034.1|  PREDICTED: growth-regulating factor 1-like i...    117   1e-27   
ref|XP_009411325.1|  PREDICTED: growth-regulating factor 6-like         119   1e-27   
ref|XP_004953585.1|  PREDICTED: growth-regulating factor 4-like         117   1e-27   
ref|XP_002281639.1|  PREDICTED: growth-regulating factor 10-like ...    114   1e-27   
ref|XP_004231946.1|  PREDICTED: growth-regulating factor 1-like i...    119   1e-27   
ref|XP_009588672.1|  PREDICTED: growth-regulating factor 4-like i...    117   1e-27   
gb|ADO21120.1|  growth-regulating factor 1                              117   2e-27   
ref|XP_006363835.1|  PREDICTED: growth-regulating factor 1-like         119   2e-27   
emb|CDY29584.1|  BnaA03g54290D                                          117   2e-27   
gb|AFQ22739.1|  growth-regulating factor 2P                             117   2e-27   
ref|XP_011075906.1|  PREDICTED: growth-regulating factor 2-like         118   2e-27   
ref|XP_010661586.1|  PREDICTED: growth-regulating factor 10-like ...    114   2e-27   
ref|XP_008438131.1|  PREDICTED: growth-regulating factor 9 isofor...    118   2e-27   
gb|AFB74089.1|  growth-regulating factor 2                              117   2e-27   
emb|CDX69322.1|  BnaC01g01310D                                          117   2e-27   
ref|XP_009138528.1|  PREDICTED: growth-regulating factor 2-like         117   2e-27   
ref|XP_010654438.1|  PREDICTED: growth-regulating factor 1-like         117   2e-27   
gb|AFQ22738.1|  growth-regulating factor 2J                             117   2e-27   
ref|XP_007136458.1|  hypothetical protein PHAVU_009G047000g             119   2e-27   
emb|CDY66422.1|  BnaA08g30080D                                          116   2e-27   
ref|XP_011099411.1|  PREDICTED: growth-regulating factor 1-like         118   2e-27   
emb|CBI34794.3|  unnamed protein product                                114   2e-27   
emb|CDX72654.1|  BnaC07g46760D                                          117   2e-27   
ref|XP_009790531.1|  PREDICTED: growth-regulating factor 4-like i...    116   2e-27   
ref|XP_007136460.1|  hypothetical protein PHAVU_009G047000g             118   2e-27   
ref|XP_006356839.1|  PREDICTED: growth-regulating factor 6-like         118   2e-27   
ref|XP_011034630.1|  PREDICTED: growth-regulating factor 9              117   2e-27   
gb|KDO65037.1|  hypothetical protein CISIN_1g047108mg                   116   2e-27   
gb|AFB74092.1|  growth-regulating factor 2                              117   3e-27   
ref|XP_006426651.1|  hypothetical protein CICLE_v10025855mg             116   3e-27   
ref|XP_004976689.1|  PREDICTED: growth-regulating factor 3-like i...    116   3e-27   
ref|XP_006647685.1|  PREDICTED: growth-regulating factor 10-like        114   3e-27   
ref|XP_010999912.1|  PREDICTED: growth-regulating factor 1-like         118   3e-27   
ref|XP_011015778.1|  PREDICTED: growth-regulating factor 1-like         118   3e-27   
ref|XP_007047598.1|  Growth-regulating factor 1, putative isoform 2     117   3e-27   
ref|XP_009626682.1|  PREDICTED: growth-regulating factor 1-like         118   3e-27   
ref|XP_007039182.1|  Growth-regulating factor 7, putative isoform 1     118   3e-27   
emb|CAD41671.3|  OSJNBa0019K04.18                                       113   3e-27   
ref|XP_004238069.1|  PREDICTED: growth-regulating factor 1-like         118   3e-27   
gb|EMT04093.1|  hypothetical protein F775_24390                         113   3e-27   
ref|XP_008811877.1|  PREDICTED: growth-regulating factor 7-like i...    117   3e-27   
ref|XP_002320016.2|  hypothetical protein POPTR_0014s01320g             117   3e-27   
ref|XP_010685313.1|  PREDICTED: growth-regulating factor 5 isofor...    115   3e-27   
ref|XP_004976691.1|  PREDICTED: growth-regulating factor 3-like i...    116   3e-27   
ref|XP_009784651.1|  PREDICTED: growth-regulating factor 1-like         118   3e-27   
gb|ACV71017.1|  UPA17                                                   118   3e-27   
ref|XP_010534927.1|  PREDICTED: growth-regulating factor 5              115   4e-27   
ref|XP_004133902.1|  PREDICTED: growth-regulating factor 9-like         117   4e-27   
sp|Q6AWX7.1|GRF12_ORYSJ  RecName: Full=Growth-regulating factor 1...    114   4e-27   
gb|EEE57574.1|  hypothetical protein OsJ_07926                          113   4e-27   
gb|EEC77835.1|  hypothetical protein OsI_17058                          114   4e-27   
sp|Q6AWY7.1|GRF2_ORYSJ  RecName: Full=Growth-regulating factor 2;...    115   4e-27   
gb|EYU44521.1|  hypothetical protein MIMGU_mgv1a003526mg                117   4e-27   
ref|XP_002448459.1|  hypothetical protein SORBIDRAFT_06g027465          116   4e-27   
ref|XP_010501463.1|  PREDICTED: growth-regulating factor 5-like         116   4e-27   
ref|XP_008234660.1|  PREDICTED: growth-regulating factor 7 isofor...    117   4e-27   
ref|NP_001047735.1|  Os02g0678800                                       113   4e-27   
gb|ACM18110.1|  growth-regulating factor 10                             113   5e-27   
ref|XP_011017085.1|  PREDICTED: growth-regulating factor 1-like i...    117   5e-27   
ref|XP_006647996.1|  PREDICTED: growth-regulating factor 1-like         115   5e-27   
ref|XP_011017086.1|  PREDICTED: growth-regulating factor 1-like i...    117   5e-27   
sp|Q6AWY6.2|GRF3_ORYSJ  RecName: Full=Growth-regulating factor 3;...    115   5e-27   
ref|XP_010267409.1|  PREDICTED: growth-regulating factor 7-like i...    117   5e-27   
ref|XP_004171939.1|  PREDICTED: growth-regulating factor 6-like         118   5e-27   
ref|XP_010526699.1|  PREDICTED: growth-regulating factor 1-like i...    116   5e-27   
gb|EEC80200.1|  hypothetical protein OsI_22082                          115   5e-27   
ref|XP_007136459.1|  hypothetical protein PHAVU_009G047000g             117   5e-27   
ref|XP_010526698.1|  PREDICTED: growth-regulating factor 1-like i...    116   5e-27   
emb|CAH67857.1|  B0403H10-OSIGBa0105A11.9                               115   5e-27   
ref|XP_008444524.1|  PREDICTED: growth-regulating factor 6-like i...    118   5e-27   
gb|ACM18109.1|  growth-regulating factor 3                              115   5e-27   
ref|XP_009412291.1|  PREDICTED: growth-regulating factor 6-like i...    117   6e-27   
ref|XP_011017084.1|  PREDICTED: growth-regulating factor 1-like i...    117   6e-27   
ref|XP_002437722.1|  hypothetical protein SORBIDRAFT_10g001350          116   6e-27   
ref|XP_004143032.1|  PREDICTED: growth-regulating factor 6-like         118   6e-27   
ref|XP_006652759.1|  PREDICTED: LOW QUALITY PROTEIN: growth-regul...    115   6e-27   
ref|XP_010267408.1|  PREDICTED: growth-regulating factor 7-like i...    117   6e-27   
gb|KDP41582.1|  hypothetical protein JCGZ_15989                         117   6e-27   
ref|XP_009412289.1|  PREDICTED: growth-regulating factor 6-like i...    117   6e-27   
ref|XP_008811878.1|  PREDICTED: growth-regulating factor 7-like i...    116   7e-27   
emb|CDX97531.1|  BnaA05g25480D                                          115   7e-27   
emb|CAN62265.1|  hypothetical protein VITISV_018459                     116   7e-27   
ref|XP_010552235.1|  PREDICTED: growth-regulating factor 5-like         115   7e-27   
tpg|DAA05207.1|  TPA: growth-regulating factor 3                        115   8e-27   
ref|XP_010918298.1|  PREDICTED: growth-regulating factor 7-like i...    116   8e-27   
gb|ACB31255.1|  GRL3                                                    109   8e-27   
ref|XP_007047597.1|  Growth-regulating factor 1, putative isoform 1     117   8e-27   
ref|XP_010059815.1|  PREDICTED: growth-regulating factor 6-like         117   9e-27   
gb|KHG11416.1|  hypothetical protein F383_00237                         117   1e-26   
emb|CDY55209.1|  BnaCnng28460D                                          115   1e-26   
ref|XP_008440426.1|  PREDICTED: growth-regulating factor 1-like         116   1e-26   
ref|XP_007208030.1|  hypothetical protein PRUPE_ppa003017mg             117   1e-26   
emb|CBI19365.3|  unnamed protein product                                115   1e-26   
ref|XP_010110131.1|  hypothetical protein L484_003760                   116   1e-26   
gb|EMT06854.1|  hypothetical protein F775_52301                         117   1e-26   
gb|KHG28472.1|  Photosystem I P700 chlorophyll a apoprotein A1          115   1e-26   
ref|XP_010936184.1|  PREDICTED: growth-regulating factor 6-like         117   1e-26   
ref|XP_008785737.1|  PREDICTED: growth-regulating factor 6-like         117   1e-26   
ref|XP_003560956.1|  PREDICTED: growth-regulating factor 2-like         114   1e-26   
gb|ACB31258.1|  GRL3                                                    108   1e-26   
ref|XP_002436657.1|  hypothetical protein SORBIDRAFT_10g006690          114   1e-26   
ref|XP_008785738.1|  PREDICTED: growth-regulating factor 6-like         114   1e-26   
ref|XP_003570521.1|  PREDICTED: growth-regulating factor 1-like         115   1e-26   
ref|XP_010314820.1|  PREDICTED: growth-regulating factor 4-like i...    114   1e-26   
ref|XP_004289366.1|  PREDICTED: growth-regulating factor 1-like         116   1e-26   
gb|EAY87071.1|  hypothetical protein OsI_08467                          112   1e-26   
emb|CDP02630.1|  unnamed protein product                                116   1e-26   
ref|XP_007220959.1|  hypothetical protein PRUPE_ppa024293mg             116   1e-26   
ref|XP_004143409.1|  PREDICTED: growth-regulating factor 1-like         116   1e-26   
ref|XP_008234659.1|  PREDICTED: growth-regulating factor 7 isofor...    116   1e-26   
ref|XP_010314819.1|  PREDICTED: growth-regulating factor 4-like i...    113   1e-26   
ref|XP_008438134.1|  PREDICTED: growth-regulating factor 9 isofor...    115   1e-26   
ref|XP_008237479.1|  PREDICTED: growth-regulating factor 1              116   1e-26   
emb|CBI33069.3|  unnamed protein product                                116   1e-26   
ref|XP_008438133.1|  PREDICTED: growth-regulating factor 9 isofor...    115   1e-26   
ref|XP_010465271.1|  PREDICTED: growth-regulating factor 5-like         114   1e-26   
ref|XP_008342107.1|  PREDICTED: growth-regulating factor 1 isofor...    116   1e-26   
ref|XP_008342110.1|  PREDICTED: growth-regulating factor 1 isofor...    116   2e-26   
ref|XP_010531313.1|  PREDICTED: growth-regulating factor 1              115   2e-26   
gb|EAZ24805.1|  hypothetical protein OsJ_08584                          114   2e-26   
ref|XP_003635376.1|  PREDICTED: growth-regulating factor 1-like         116   2e-26   
ref|XP_008342096.1|  PREDICTED: growth-regulating factor 1 isofor...    116   2e-26   
ref|NP_001106029.1|  putative growth-regulating factor 11               113   2e-26   
gb|KDO40072.1|  hypothetical protein CISIN_1g0182081mg                  110   2e-26   
ref|XP_010664482.1|  PREDICTED: growth-regulating factor 6-like i...    115   2e-26   
ref|XP_011018425.1|  PREDICTED: growth-regulating factor 5-like         114   2e-26   
ref|XP_010273541.1|  PREDICTED: growth-regulating factor 6-like i...    116   2e-26   
gb|EPS73373.1|  hypothetical protein M569_01383                         109   2e-26   
ref|XP_010273550.1|  PREDICTED: growth-regulating factor 6-like i...    116   2e-26   
emb|CDX71979.1|  BnaC08g28950D                                          114   2e-26   
ref|XP_010487179.1|  PREDICTED: growth-regulating factor 5              114   2e-26   
gb|AFB74091.1|  growth-regulating factor 2                              114   2e-26   
gb|KJB18062.1|  hypothetical protein B456_003G032300                    115   2e-26   
emb|CDY39081.1|  BnaA01g29750D                                          114   2e-26   
ref|XP_009146430.1|  PREDICTED: growth-regulating factor 5-like         114   2e-26   
gb|KJB52379.1|  hypothetical protein B456_008G259500                    113   3e-26   
dbj|BAJ87627.1|  predicted protein                                      114   3e-26   
ref|XP_004253086.1|  PREDICTED: growth-regulating factor 4-like i...    113   3e-26   
ref|XP_010314818.1|  PREDICTED: growth-regulating factor 4-like i...    113   3e-26   
gb|KHG13446.1|  Pyridoxine 5'-phosphate synthase                        114   3e-26   



>ref|XP_009586688.1| PREDICTED: growth-regulating factor 3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=244

 Score =   207 bits (526),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 120/149 (81%), Gaps = 7/149 (5%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPV  332
            LPLFVSEP T+KLS    DST T  TKFP+MG SYFSLGQWQELELQALI+RH IAGAPV
Sbjct  46   LPLFVSEP-TTKLS----DSTTTTPTKFPKMGSSYFSLGQWQELELQALIYRHFIAGAPV  100

Query  331  PPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWR  152
            PPELLHLVKKS   S   Y+     Q   ++  +   YWGRAAMDPEPGRCRRTDGKKWR
Sbjct  101  PPELLHLVKKSIITSPSSYYFSHPFQQYPHYQQTC--YWGRAAMDPEPGRCRRTDGKKWR  158

Query  151  CSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            CSRDVVAGQKYCERH+HRGR+RSRKPVEI
Sbjct  159  CSRDVVAGQKYCERHVHRGRSRSRKPVEI  187



>ref|XP_009586687.1| PREDICTED: growth-regulating factor 3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=248

 Score =   205 bits (522),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 120/151 (79%), Gaps = 7/151 (5%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPV  332
            LPLFVSEP T+KLS    DST T  TKFP+MG SYFSLGQWQELELQALI+RH IAGAPV
Sbjct  46   LPLFVSEP-TTKLS----DSTTTTPTKFPKMGSSYFSLGQWQELELQALIYRHFIAGAPV  100

Query  331  PPELLHLVKKSPFNSApyyfphplhqyphyhPAS--APWYWGRAAMDPEPGRCRRTDGKK  158
            PPELLHLVKKS   S   Y+     Q   ++  +     YWGRAAMDPEPGRCRRTDGKK
Sbjct  101  PPELLHLVKKSIITSPSSYYFSHPFQQYPHYQQTLMQSGYWGRAAMDPEPGRCRRTDGKK  160

Query  157  WRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            WRCSRDVVAGQKYCERH+HRGR+RSRKPVEI
Sbjct  161  WRCSRDVVAGQKYCERHVHRGRSRSRKPVEI  191



>ref|XP_009783589.1| PREDICTED: growth-regulating factor 3-like [Nicotiana sylvestris]
Length=392

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 135/182 (74%), Gaps = 13/182 (7%)
 Frame = -2

Query  601  AKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTAT-TKFP  425
            AK+PRLVLDL S+ + ++            LPLF+SEP  +KLSA+S  S  T T TKF 
Sbjct  30   AKLPRLVLDLDSSFSHSASDSA--------LPLFISEP--TKLSAYSLSSDSTFTPTKFT  79

Query  424  RMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyph  245
            RMG SYFSL QWQELELQALI+RHM+AGAPVP ELLHLVKKS  NS+PY +     Q  H
Sbjct  80   RMGSSYFSLAQWQELELQALIYRHMLAGAPVPLELLHLVKKSLINSSPYNYLPQSFQQYH  139

Query  244  yhPAS--APWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPV  71
            ++  +     YWGR  MDPEPGRCRRTDGKKWRCSRDVV+G KYCERH+HRGRNRSRKPV
Sbjct  140  HYQQALVQSGYWGRTGMDPEPGRCRRTDGKKWRCSRDVVSGHKYCERHVHRGRNRSRKPV  199

Query  70   EI  65
            EI
Sbjct  200  EI  201



>ref|XP_009599016.1| PREDICTED: growth-regulating factor 3 [Nicotiana tomentosiformis]
Length=379

 Score =   209 bits (531),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 133/186 (72%), Gaps = 21/186 (11%)
 Frame = -2

Query  601  AKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAF--SSDSTPTATTKF  428
            AK+PRLVLDL S+ + ++            LPLFVSEP  +KLSA+  SSDST T T KF
Sbjct  26   AKLPRLVLDLDSSFSHSASDSA--------LPLFVSEP--TKLSAYPLSSDSTSTPT-KF  74

Query  427  PRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKS-----PFNSApyyfphp  263
             RMG SYFSL QWQELELQALI+RHM+AGAPVP ELLHLVKKS     P+N  P  F   
Sbjct  75   TRMGSSYFSLAQWQELELQALIYRHMLAGAPVPLELLHLVKKSLITSSPYNYLPQSFQQY  134

Query  262  lhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRS  83
             H       +    YWGR  MDPEPGRCRRTDGKKWRCSRDVV+G KYCERH+HRGRNRS
Sbjct  135  HHYQQALVQSG---YWGRTGMDPEPGRCRRTDGKKWRCSRDVVSGHKYCERHVHRGRNRS  191

Query  82   RKPVEI  65
            RKPVEI
Sbjct  192  RKPVEI  197



>ref|XP_006339314.1| PREDICTED: growth-regulating factor 3-like [Solanum tuberosum]
Length=391

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 130/188 (69%), Gaps = 16/188 (9%)
 Frame = -2

Query  607  SEAKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKF  428
            S  K PRL+LD HS ++ ++            LPLFVSEP T+  +   SDST T TTKF
Sbjct  24   SPTKFPRLLLDFHSVSSDSASAAA--------LPLFVSEP-TTTCAKLMSDSTTTVTTKF  74

Query  427  PRMG--GSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKS-----PFNSApyyfp  269
            PR+G  G YFSL QWQELELQ+LIFRH +AGAPVP ELLHLVKKS     P   + Y+  
Sbjct  75   PRIGSGGGYFSLAQWQELELQSLIFRHFVAGAPVPSELLHLVKKSIIASSPLPPSYYFAH  134

Query  268  hplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRN  89
                   +        YWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERH+HRGR+
Sbjct  135  PFQQYPHYQQALMQSGYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHVHRGRS  194

Query  88   RSRKPVEI  65
            RSRKPVEI
Sbjct  195  RSRKPVEI  202



>ref|XP_006341255.1| PREDICTED: growth-regulating factor 3-like [Solanum tuberosum]
Length=372

 Score =   204 bits (518),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 132/179 (74%), Gaps = 8/179 (4%)
 Frame = -2

Query  601  AKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKFPR  422
             K+PRLVLDL S ++  SH      +    LPLFVSEP  +KLSAF+ DST T T K P 
Sbjct  19   TKLPRLVLDLDSFSSCYSHSDSDSFA----LPLFVSEP-INKLSAFA-DSTLTPT-KLPS  71

Query  421  MGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphy  242
            MG  YFSL QWQELELQALI++HM+AGAPVP ELLHL+KKS  NS+PYY     + +   
Sbjct  72   MGNGYFSLAQWQELELQALIYKHMLAGAPVPHELLHLIKKSLINSSPYYNMPQQYHHYQQ  131

Query  241  hPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
                +  YWG+  MDPEPGRCRRTDGKKWRCSRDVV+G KYCERH+HRG+NRSRKPVEI
Sbjct  132  AMLHS-GYWGKTNMDPEPGRCRRTDGKKWRCSRDVVSGHKYCERHVHRGKNRSRKPVEI  189



>ref|XP_009771979.1| PREDICTED: growth-regulating factor 3-like [Nicotiana sylvestris]
Length=365

 Score =   203 bits (516),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 118/149 (79%), Gaps = 6/149 (4%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPV  332
            LPLFVS+P T+KLS    DST T  TKFPRM  SYFSLGQWQELELQALI+RH IAGAPV
Sbjct  39   LPLFVSQP-TTKLS----DSTTTTPTKFPRMESSYFSLGQWQELELQALIYRHFIAGAPV  93

Query  331  PPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWR  152
            PPELLHLVKKS   S   Y+     Q+  ++   A    GRAAMDPEPGRCRRTDGKKWR
Sbjct  94   PPELLHLVKKSIITSPSSYYFSHPFQHYPHYQQ-ALMQSGRAAMDPEPGRCRRTDGKKWR  152

Query  151  CSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            CSRDVVAGQKYCERH+HRGR+RSRKPVEI
Sbjct  153  CSRDVVAGQKYCERHVHRGRSRSRKPVEI  181



>ref|XP_002277233.3| PREDICTED: growth-regulating factor 3 [Vitis vinifera]
Length=396

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 133/182 (73%), Gaps = 19/182 (10%)
 Frame = -2

Query  601  AKVPRLVLDLhsttttashggggggssssALPLFVSEPPT--SKLSAFSSDSTPTATTKF  428
             K+PRL+LD                 S SALPLFV EP +  S LSAF  DST TAT +F
Sbjct  22   GKMPRLLLD--------------QQPSGSALPLFVPEPNSKISNLSAFP-DSTTTAT-RF  65

Query  427  PRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyp  248
             + GGSYFSL QWQELELQALIFRHM+AGA VPPELL L+KKS  N  PYY  HPL  Y 
Sbjct  66   SKTGGSYFSLAQWQELELQALIFRHMLAGAAVPPELLQLIKKSLLNHPPYYLQHPLQHYQ  125

Query  247  hyhPAS-APWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPV  71
            HY PA     YWGRAAMDPEPGRCRRTDGKKWRCSRDVV GQKYCERHMHRGRNRSRKPV
Sbjct  126  HYQPALLQSGYWGRAAMDPEPGRCRRTDGKKWRCSRDVVTGQKYCERHMHRGRNRSRKPV  185

Query  70   EI  65
            EI
Sbjct  186  EI  187



>emb|CBI30260.3| unnamed protein product [Vitis vinifera]
Length=391

 Score =   201 bits (511),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 122/152 (80%), Gaps = 5/152 (3%)
 Frame = -2

Query  511  LPLFVSEPPT--SKLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGA  338
            LPLFV EP +  S LSAF  DST TAT +F + GGSYFSL QWQELELQALIFRHM+AGA
Sbjct  15   LPLFVPEPNSKISNLSAFP-DSTTTAT-RFSKTGGSYFSLAQWQELELQALIFRHMLAGA  72

Query  337  PVPPELLHLVKKSPFNSApyyfphplhqyphyhPAS-APWYWGRAAMDPEPGRCRRTDGK  161
             VPPELL L+KKS  N  PYY  HPL  Y HY PA     YWGRAAMDPEPGRCRRTDGK
Sbjct  73   AVPPELLQLIKKSLLNHPPYYLQHPLQHYQHYQPALLQSGYWGRAAMDPEPGRCRRTDGK  132

Query  160  KWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            KWRCSRDVV GQKYCERHMHRGRNRSRKPVEI
Sbjct  133  KWRCSRDVVTGQKYCERHMHRGRNRSRKPVEI  164



>ref|XP_007027645.1| Growth-regulating factor 3 isoform 1 [Theobroma cacao]
 gb|EOY08147.1| Growth-regulating factor 3 isoform 1 [Theobroma cacao]
Length=397

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 136/179 (76%), Gaps = 9/179 (5%)
 Frame = -2

Query  601  AKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKFPR  422
            AK+P+L+LD                S SSALPLFV EP  SK+S+  S + P +TT+FPR
Sbjct  20   AKIPKLLLD---PHHQHQQQQQQHPSESSALPLFVPEP-NSKISSNLS-AVPDSTTRFPR  74

Query  421  MGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphy  242
            MG SYFSL QWQELELQALI+R+M+AGA VPPELL  +KKS  +S  Y+  HPL  Y HY
Sbjct  75   MG-SYFSLAQWQELELQALIYRYMLAGATVPPELLQPIKKSLLHSPAYFLHHPLQHYSHY  133

Query  241  hPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
             PA   WYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE+
Sbjct  134  QPA---WYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEM  189



>ref|XP_009352986.1| PREDICTED: growth-regulating factor 3-like isoform X2 [Pyrus 
x bretschneideri]
Length=390

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 138/179 (77%), Gaps = 14/179 (8%)
 Frame = -2

Query  601  AKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKFPR  422
            AK+P+L LD         H      S+  ALPLFVSEP T  LSAFS DS+P AT++FP+
Sbjct  22   AKIPKLDLD--------PHQNSEHPSAGYALPLFVSEPNTKILSAFS-DSSP-ATSRFPK  71

Query  421  MGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphy  242
            MG SYFSL QWQELELQALIFR+M AGA VP ELL  ++KS   SAPY+  HPL Q+PH+
Sbjct  72   MG-SYFSLSQWQELELQALIFRYMAAGAAVPSELLQPIRKSLLRSAPYFLHHPLQQFPHF  130

Query  241  hPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
             PA   WYWGRAAMDPEP RCRRTDGKKWRCSRDVVAGQKYCERH+HRGRNRSRKPVE+
Sbjct  131  QPA---WYWGRAAMDPEPTRCRRTDGKKWRCSRDVVAGQKYCERHVHRGRNRSRKPVEV  186



>ref|XP_004246560.1| PREDICTED: growth-regulating factor 3-like isoform X1 [Solanum 
lycopersicum]
Length=381

 Score =   198 bits (504),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 131/180 (73%), Gaps = 7/180 (4%)
 Frame = -2

Query  601  AKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDS-TPTATTKFP  425
             K+P LVLDL S + +         +SS+ LPLFVSEP  +KLSAF+  S TPT   K P
Sbjct  20   TKLPNLVLDLDSFSPSCYSHSDSDSNSSA-LPLFVSEP-INKLSAFADSSLTPT---KLP  74

Query  424  RMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyph  245
             MG  YFSL QWQELELQALI++HM+AGAPVP ELL+L+KKS  NS+PYY     + +  
Sbjct  75   SMGNGYFSLAQWQELELQALIYKHMLAGAPVPHELLYLIKKSLSNSSPYYNMSQQYHHYQ  134

Query  244  yhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
                 +  YWGR  MDPEPGRCRRTDGKKWRCSRDVV+G KYCERH+HRGRNRSRKPVEI
Sbjct  135  QAMLHS-GYWGRTNMDPEPGRCRRTDGKKWRCSRDVVSGHKYCERHVHRGRNRSRKPVEI  193



>ref|XP_010325931.1| PREDICTED: growth-regulating factor 3-like isoform X2 [Solanum 
lycopersicum]
Length=377

 Score =   197 bits (502),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 130/180 (72%), Gaps = 11/180 (6%)
 Frame = -2

Query  601  AKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDS-TPTATTKFP  425
             K+P LVLDL S + +         +SS+ LPLFVSEP  +KLSAF+  S TPT   K P
Sbjct  20   TKLPNLVLDLDSFSPSCYSHSDSDSNSSA-LPLFVSEP-INKLSAFADSSLTPT---KLP  74

Query  424  RMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyph  245
             MG  YFSL QWQELELQALI++HM+AGAPVP ELL+L+KKS  NS+PYY     + +  
Sbjct  75   SMGNGYFSLAQWQELELQALIYKHMLAGAPVPHELLYLIKKSLSNSSPYYNMSQQYHHYQ  134

Query  244  yhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
                    YWGR  MDPEPGRCRRTDGKKWRCSRDVV+G KYCERH+HRGRNRSRKPVEI
Sbjct  135  QAR-----YWGRTNMDPEPGRCRRTDGKKWRCSRDVVSGHKYCERHVHRGRNRSRKPVEI  189



>ref|XP_011077893.1| PREDICTED: growth-regulating factor 3 [Sesamum indicum]
Length=376

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 115/151 (76%), Gaps = 9/151 (6%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPV  332
            LPLFV +  T+ LSA+S D  P A  KFPRMG SYFSL QWQELELQALIFRHMIAGA V
Sbjct  34   LPLFVPDSNTN-LSAYSPD--PAA--KFPRMG-SYFSLSQWQELELQALIFRHMIAGAAV  87

Query  331  PPELLHLVKKSPFNSApyyfphplhqyphyhPASA---PWYWGRAAMDPEPGRCRRTDGK  161
            PPELLHLVKKS  N++   +      +  Y    A     YW RAAMDPEPGRCRRTDGK
Sbjct  88   PPELLHLVKKSLINTSSSQYYLSHSLHRCYPYQPALLQSGYWSRAAMDPEPGRCRRTDGK  147

Query  160  KWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            KWRCSRDVVAGQKYCERHMHRGRNRSRKPVE
Sbjct  148  KWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  178



>ref|XP_009365360.1| PREDICTED: growth-regulating factor 3-like isoform X2 [Pyrus 
x bretschneideri]
Length=395

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 137/180 (76%), Gaps = 10/180 (6%)
 Frame = -2

Query  601  AKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKFPR  422
            AK+P+L LD                ++  ALPLFV EP T  LSA  S+S+P AT++FP+
Sbjct  21   AKIPKLDLD-------PLQNAELPSAAGYALPLFVPEPNTKILSAAFSESSP-ATSRFPK  72

Query  421  MGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphy  242
            MG SYFSL QWQELELQALIFR+M+AGA VPPELL  +KKS  +SAPY+  HPL Q+PH+
Sbjct  73   MG-SYFSLSQWQELELQALIFRYMVAGAAVPPELLQPIKKSLLHSAPYFLHHPLQQFPHF  131

Query  241  hPAS-APWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
             PA     YWGRAAMDPEP RCRRTDGKKWRCSRDVVAGQKYCERH+HRGRNRSRKPVE+
Sbjct  132  QPALLQSGYWGRAAMDPEPTRCRRTDGKKWRCSRDVVAGQKYCERHVHRGRNRSRKPVEV  191



>ref|XP_004249453.1| PREDICTED: growth-regulating factor 3 [Solanum lycopersicum]
Length=389

 Score =   196 bits (498),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 128/190 (67%), Gaps = 17/190 (9%)
 Frame = -2

Query  607  SEAKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSA--FSSDSTPTATT  434
            S  K+PRL+LD HS ++ ++            LPLFVSEP TS  +     SDS  T TT
Sbjct  19   SPTKLPRLLLDFHSVSSDSASAAA--------LPLFVSEPTTSTTTCTKLMSDSATTVTT  70

Query  433  KFPRMG--GSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphp-  263
            KFPR+G  G YFSL QWQELEL +LIFRH +AGAPVP ELLHLVKKS   S P    +  
Sbjct  71   KFPRIGSGGGYFSLAQWQELELHSLIFRHFVAGAPVPSELLHLVKKSIIASPPPPPSYYF  130

Query  262  ----lhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRG  95
                     +        YWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERH+HRG
Sbjct  131  AHPYQQYPHYQQALMQSGYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHVHRG  190

Query  94   RNRSRKPVEI  65
            R+RSRKPVEI
Sbjct  191  RSRSRKPVEI  200



>ref|XP_011094403.1| PREDICTED: growth-regulating factor 3-like [Sesamum indicum]
Length=397

 Score =   196 bits (497),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 114/158 (72%), Gaps = 14/158 (9%)
 Frame = -2

Query  502  FVSEPPTSKLSAFSSD--STPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPVP  329
            FV EP T+ LSA+SSD  S+  + TK PRMG SYFSL QWQELELQALIFRHMI+GA VP
Sbjct  47   FVPEP-TTNLSAYSSDNLSSTISVTKLPRMG-SYFSLAQWQELELQALIFRHMISGAAVP  104

Query  328  PELLHLVKKSPFNSApyyfphplhqyphyhPAS----------APWYWGRAAMDPEPGRC  179
            PELLHLVKKS   S+P         Y                    YWGRAAMDPEPGRC
Sbjct  105  PELLHLVKKSLITSSPSSSSSSSPYYLCNSLHQYYPHYQSPLVQSGYWGRAAMDPEPGRC  164

Query  178  RRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            RRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI
Sbjct  165  RRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  202



>ref|XP_009365359.1| PREDICTED: growth-regulating factor 3-like isoform X1 [Pyrus 
x bretschneideri]
Length=396

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 135/180 (75%), Gaps = 9/180 (5%)
 Frame = -2

Query  601  AKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKFPR  422
            AK+P+L LD                ++  ALPLFV EP T  LSA  S+S+P AT++FP 
Sbjct  21   AKIPKLDLD-------PLQNAELPSAAGYALPLFVPEPNTKILSAAFSESSP-ATSRFPI  72

Query  421  MGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphy  242
              GSYFSL QWQELELQALIFR+M+AGA VPPELL  +KKS  +SAPY+  HPL Q+PH+
Sbjct  73   EMGSYFSLSQWQELELQALIFRYMVAGAAVPPELLQPIKKSLLHSAPYFLHHPLQQFPHF  132

Query  241  hPAS-APWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
             PA     YWGRAAMDPEP RCRRTDGKKWRCSRDVVAGQKYCERH+HRGRNRSRKPVE+
Sbjct  133  QPALLQSGYWGRAAMDPEPTRCRRTDGKKWRCSRDVVAGQKYCERHVHRGRNRSRKPVEV  192



>gb|ADL36702.1| GRF domain class transcription factor [Malus domestica]
Length=394

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 124/179 (69%), Gaps = 9/179 (5%)
 Frame = -2

Query  601  AKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKFPR  422
            AK+P+L LD         H      S+  ALPLFV EP T  LSA  S+S+P AT++FP+
Sbjct  21   AKIPKLDLD--------PHQNSELPSAGYALPLFVPEPNTKILSAAFSESSP-ATSRFPK  71

Query  421  MGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphy  242
              GSYFSL QWQELELQALIFR+M+AGA VPPELL  ++KS  ++  +            
Sbjct  72   EMGSYFSLSQWQELELQALIFRYMVAGAAVPPELLQPIRKSLHSAPYFLHHPLQQFPHLQ  131

Query  241  hPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
                   YWGRAAMDPEP RCRRTDGKKWRCSRDVVAGQKYCERH+HRGRNRSRKPVE+
Sbjct  132  PALLQSGYWGRAAMDPEPTRCRRTDGKKWRCSRDVVAGQKYCERHVHRGRNRSRKPVEV  190



>ref|XP_007162865.1| hypothetical protein PHAVU_001G187500g [Phaseolus vulgaris]
 gb|ESW34859.1| hypothetical protein PHAVU_001G187500g [Phaseolus vulgaris]
Length=386

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 116/149 (78%), Gaps = 5/149 (3%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPV  332
            LPLFV EP  SK+S  S DST  AT + PRMG SYFSL QWQELELQALIFR+M+AGA V
Sbjct  42   LPLFVPEP-NSKVSTLS-DSTLAATNRLPRMG-SYFSLSQWQELELQALIFRYMLAGAAV  98

Query  331  PPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWR  152
            PPELL  +KKS  +S  Y+  HPL  Y      S   YWGR AMDPEPGRCRRTDGKKWR
Sbjct  99   PPELLQPIKKSLLHSPHYFLHHPLQHYQPALLQSG--YWGRGAMDPEPGRCRRTDGKKWR  156

Query  151  CSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            CSRDVVAGQKYCERHMHRGRNRSRKPVE+
Sbjct  157  CSRDVVAGQKYCERHMHRGRNRSRKPVEL  185



>ref|XP_007027646.1| Growth-regulating factor 3 isoform 2 [Theobroma cacao]
 gb|EOY08148.1| Growth-regulating factor 3 isoform 2 [Theobroma cacao]
Length=401

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 129/180 (72%), Gaps = 7/180 (4%)
 Frame = -2

Query  601  AKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKFPR  422
            AK+P+L+LD                S SSALPLFV EP  SK+S+  S + P +TT+FPR
Sbjct  20   AKIPKLLLD---PHHQHQQQQQQHPSESSALPLFVPEP-NSKISSNLS-AVPDSTTRFPR  74

Query  421  MGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNS-Apyyfphplhqyph  245
            MG SYFSL QWQELELQALI+R+M+AGA VPPELL  +KKS  +S A +      H   +
Sbjct  75   MG-SYFSLAQWQELELQALIYRYMLAGATVPPELLQPIKKSLLHSPAYFLHHPLQHYSHY  133

Query  244  yhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
                    YWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE+
Sbjct  134  QPALLQSGYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEM  193



>ref|XP_009352985.1| PREDICTED: growth-regulating factor 3-like isoform X1 [Pyrus 
x bretschneideri]
Length=394

 Score =   194 bits (492),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 137/180 (76%), Gaps = 12/180 (7%)
 Frame = -2

Query  601  AKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKFPR  422
            AK+P+L LD         H      S+  ALPLFVSEP T  LSAFS DS+P AT++FP+
Sbjct  22   AKIPKLDLD--------PHQNSEHPSAGYALPLFVSEPNTKILSAFS-DSSP-ATSRFPK  71

Query  421  MGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphy  242
            MG SYFSL QWQELELQALIFR+M AGA VP ELL  ++KS   SAPY+  HPL Q+PH+
Sbjct  72   MG-SYFSLSQWQELELQALIFRYMAAGAAVPSELLQPIRKSLLRSAPYFLHHPLQQFPHF  130

Query  241  hPAS-APWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
             PA     YWGRAAMDPEP RCRRTDGKKWRCSRDVVAGQKYCERH+HRGRNRSRKPVE+
Sbjct  131  QPALLQSGYWGRAAMDPEPTRCRRTDGKKWRCSRDVVAGQKYCERHVHRGRNRSRKPVEV  190



>emb|CDP15377.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 132/199 (66%), Gaps = 26/199 (13%)
 Frame = -2

Query  601  AKVPRLVLDLhsttttashggggggssssALPLFVSEPPT-SKLSAFSS-------DSTP  446
            AK+PRL LD           G         LPLFV+EP + SKLS+  S       DSTP
Sbjct  25   AKIPRLHLDYSVYPQHQPPSGDSSA-----LPLFVTEPTSISKLSSNLSAPCPNPTDSTP  79

Query  445  TATTKFPR----MGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLH-LVKKSPFNSAp  281
            T T K+P     MG  YFSL QWQELELQALIFRHM+AGA VPPELLH LVKK+  NS+ 
Sbjct  80   TPT-KYPGEAGGMGSYYFSLAQWQELELQALIFRHMLAGAAVPPELLHHLVKKTLLNSSH  138

Query  280  yyfphplhqyphyhPASA-------PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQK  122
            ++ P+    +  +H             YWGRA+MDPEPGRCRRTDGKKWRCSRDVVAGQK
Sbjct  139  HHHPYYAPHHHRHHYPPHFQSALLQSGYWGRASMDPEPGRCRRTDGKKWRCSRDVVAGQK  198

Query  121  YCERHMHRGRNRSRKPVEI  65
            YCERHMHRGRNRSRKPVEI
Sbjct  199  YCERHMHRGRNRSRKPVEI  217



>gb|KDP42705.1| hypothetical protein JCGZ_23645 [Jatropha curcas]
Length=419

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 124/180 (69%), Gaps = 4/180 (2%)
 Frame = -2

Query  601  AKVPRLVLDLhsttttashggggggssssA-LPLFVSEPPTSKLSAFSSDSTPTATTKFP  425
             K+P+L+LD                SS +A L LFV EP  SK+S  S+ S P   T+FP
Sbjct  27   VKMPKLLLDTQKQPPPQQQQQNPSASSIAAPLSLFVPEP-NSKISNLSALSDPA--TRFP  83

Query  424  RMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyph  245
             MGGS+FSL QWQELELQALI+R+M+AGA VPPELL  +KKS  +S  +      H   +
Sbjct  84   SMGGSFFSLAQWQELELQALIYRYMLAGATVPPELLQPIKKSIIHSPYFLHHPLQHYSYY  143

Query  244  yhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
                    YWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERH+HRGRNRSRKPVEI
Sbjct  144  QPALLQTGYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHVHRGRNRSRKPVEI  203



>ref|XP_002534110.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28270.1| conserved hypothetical protein [Ricinus communis]
Length=428

 Score =   194 bits (494),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 123/156 (79%), Gaps = 7/156 (4%)
 Frame = -2

Query  511  LPLFVSEP----PTSKLSAFSSDST-PTATTKFPRMGGS-YFSLGQWQELELQALIFRHM  350
            LPLFV EP      S LSAF   ST P AT +FPRMGGS YFSL QWQELELQALI+R+M
Sbjct  55   LPLFVPEPHSNNKNSNLSAFLDSSTAPPATARFPRMGGSGYFSLAQWQELELQALIYRYM  114

Query  349  IAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPAS-APWYWGRAAMDPEPGRCRR  173
            +AGA +PPELL  +KKS  +S PY+  HPL  Y +Y PA     YWGRAAMDPEPGRCRR
Sbjct  115  LAGAAIPPELLQPIKKSLLHSPPYFLHHPLQHYSYYQPALLQTGYWGRAAMDPEPGRCRR  174

Query  172  TDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            TDGKKWRCSRDVVAGQKYCERH+HRGRNRSRKPVEI
Sbjct  175  TDGKKWRCSRDVVAGQKYCERHVHRGRNRSRKPVEI  210



>ref|XP_006481829.1| PREDICTED: growth-regulating factor 3-like [Citrus sinensis]
Length=407

 Score =   193 bits (491),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 136/182 (75%), Gaps = 6/182 (3%)
 Frame = -2

Query  607  SEAKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKF  428
            S AK+P+L L+                S SSALPLFV EP TSK+S+ S+ S   +T++F
Sbjct  20   SAAKIPKLFLE-PHEAQHLHQHQQPMSSGSSALPLFVPEP-TSKVSSLSAFSD--STSRF  75

Query  427  PRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyp  248
            PRMG SYFSL QWQELELQALI+R+M+AGA VPPELL  +KKS  NS+PY+  HPL  Y 
Sbjct  76   PRMG-SYFSLAQWQELELQALIYRYMLAGAVVPPELLQPIKKSLVNSSPYFLHHPLQHYS  134

Query  247  hyhPAS-APWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPV  71
            H+ PAS    YWGR AMDPEPGRCRRTDGKKWRCSRDVVAG KYCERHMHRGRNRSRK V
Sbjct  135  HFQPASLQSGYWGRGAMDPEPGRCRRTDGKKWRCSRDVVAGHKYCERHMHRGRNRSRKHV  194

Query  70   EI  65
            EI
Sbjct  195  EI  196



>ref|XP_006430277.1| hypothetical protein CICLE_v10011856mg [Citrus clementina]
 gb|ESR43517.1| hypothetical protein CICLE_v10011856mg [Citrus clementina]
Length=412

 Score =   193 bits (491),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 136/182 (75%), Gaps = 6/182 (3%)
 Frame = -2

Query  607  SEAKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKF  428
            S AK+P+L L+                S SSALPLFV EP TSK+S+ S+ S   +T++F
Sbjct  20   SAAKIPKLFLE-PHEAQHLHQHQQPMSSGSSALPLFVPEP-TSKVSSLSAFSD--STSRF  75

Query  427  PRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyp  248
            PRMG SYFSL QWQELELQALI+R+M+AGA VPPELL  +KKS  NS+PY+  HPL  Y 
Sbjct  76   PRMG-SYFSLAQWQELELQALIYRYMLAGAVVPPELLQPIKKSLVNSSPYFLHHPLQHYS  134

Query  247  hyhPAS-APWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPV  71
            H+ PAS    YWGR AMDPEPGRCRRTDGKKWRCSRDVVAG KYCERHMHRGRNRSRK V
Sbjct  135  HFQPASLQSGYWGRGAMDPEPGRCRRTDGKKWRCSRDVVAGHKYCERHMHRGRNRSRKHV  194

Query  70   EI  65
            EI
Sbjct  195  EI  196



>ref|XP_008360545.1| PREDICTED: growth-regulating factor 3-like [Malus domestica]
Length=397

 Score =   191 bits (485),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 135/180 (75%), Gaps = 8/180 (4%)
 Frame = -2

Query  601  AKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKFPR  422
            AK+P+L LD        S     G ++  ALPLFVSEP T  LSAFS DS+P AT++FP+
Sbjct  22   AKIPKLDLD----PHQNSEHPTAGSAAGYALPLFVSEPNTKXLSAFS-DSSP-ATSRFPK  75

Query  421  MGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphy  242
            MG SYFSL QWQELELQALIFR+M AGA VP ELL  ++KS   SAPY+  HPL Q PH+
Sbjct  76   MG-SYFSLSQWQELELQALIFRYMAAGAAVPSELLQPIRKSLLXSAPYFLHHPLQQXPHF  134

Query  241  hPAS-APWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
             PA     YWGR AMDPEP RCRRTDGKKWRCSRDVVAGQKYCERH+HRGRNRSRKP E+
Sbjct  135  QPALLQSGYWGRTAMDPEPTRCRRTDGKKWRCSRDVVAGQKYCERHVHRGRNRSRKPXEV  194



>ref|XP_010243928.1| PREDICTED: growth-regulating factor 3 [Nelumbo nucifera]
Length=384

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 122/180 (68%), Gaps = 15/180 (8%)
 Frame = -2

Query  601  AKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKFPR  422
            AK+PRL+L+                 S SALPLFV EP  S++S  S+    T TT+FPR
Sbjct  20   AKIPRLLLE------------SHQQPSGSALPLFVPEP-NSRISNLSAFPDSTTTTRFPR  66

Query  421  MGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNS-Apyyfphplhqyph  245
            MGG YFSL QWQELELQALIF++M+AGA VPPELL  +KKS  +S A Y          +
Sbjct  67   MGG-YFSLAQWQELELQALIFKYMLAGAAVPPELLQPIKKSLLSSSACYLQYPYQQYQHY  125

Query  244  yhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
                    YWGR+ +D EPGRCRRTDGKKWRCSRDVVAG KYCERHMHRGRNRSRKPVEI
Sbjct  126  QPSMLQSGYWGRSVVDSEPGRCRRTDGKKWRCSRDVVAGHKYCERHMHRGRNRSRKPVEI  185



>ref|XP_006381307.1| hypothetical protein POPTR_0006s11630g [Populus trichocarpa]
 gb|ERP59104.1| hypothetical protein POPTR_0006s11630g [Populus trichocarpa]
Length=377

 Score =   188 bits (477),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 122/180 (68%), Gaps = 9/180 (5%)
 Frame = -2

Query  601  AKVPRLVLDLhsttttashggggggssssALPLFVSEPP--TSKLSAFSSDSTPTATTKF  428
            AK+P+L++D                S S+A PLF+ EP    S LSAF  DS   A T+ 
Sbjct  21   AKMPKLLMD------PHQPQQHPHSSGSAAFPLFLPEPSCKNSNLSAFP-DSNTAANTRL  73

Query  427  PRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyp  248
            P++ G+YFSL QWQELELQALI+R M+AGA +PPELL  +KK+  +S P  +        
Sbjct  74   PKIMGNYFSLEQWQELELQALIYRFMLAGAAIPPELLQPIKKTLLHSHPPPYFLHHPLQL  133

Query  247  hyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            H       WYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAG KYCERH+HRGRNRSRKPVE
Sbjct  134  HCSYYQPSWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGHKYCERHLHRGRNRSRKPVE  193



>ref|XP_010242635.1| PREDICTED: growth-regulating factor 3-like [Nelumbo nucifera]
Length=390

 Score =   187 bits (476),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 136/201 (68%), Gaps = 15/201 (7%)
 Frame = -2

Query  601  AKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKFPR  422
            AK+PRL+L+                 S SALPLFV EP  S++S  S+    T TT+FPR
Sbjct  20   AKIPRLLLE------------PHQQPSGSALPLFVPEP-NSRISNLSAFPDSTTTTRFPR  66

Query  421  MGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphy  242
            MGG YFSL QWQELELQALIF++M+AGA VP ELL  +KKS   S+  Y  +P  QY HY
Sbjct  67   MGG-YFSLAQWQELELQALIFKYMLAGAAVPAELLQPIKKSLLGSSACYLQYPYQQYQHY  125

Query  241  hPAS-APWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
              A     YWGR+ +D EPGRCRRTDGKKWRCSRDVVAG KYCERHMHRGRNRSRKPVEI
Sbjct  126  QTAMLQSGYWGRSVVDSEPGRCRRTDGKKWRCSRDVVAGHKYCERHMHRGRNRSRKPVEI  185

Query  64   ptptpptaaggptADAQPLSA  2
            PTP   T  G    +  P++A
Sbjct  186  PTPATATGGGLNDTNTNPVAA  206



>ref|XP_003521448.1| PREDICTED: growth-regulating factor 3 isoform X1 [Glycine max]
Length=384

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 117/157 (75%), Gaps = 11/157 (7%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATTK--------FPRMGGSYFSLGQWQELELQALIFR  356
            LPLFV EP +SK+S  S DST  + T         FPRMG SYFSL QWQELELQALIFR
Sbjct  40   LPLFVPEPNSSKVSTLS-DSTLASATMTSTTTNRLFPRMG-SYFSLSQWQELELQALIFR  97

Query  355  HMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCR  176
            +M+AGA VPPELL  +KKS  +S  YY  HPL  Y       +  YWGR AMDPEPGRCR
Sbjct  98   YMLAGAAVPPELLQPIKKSLLHSPHYYLHHPLQHYQPSALLQS-GYWGRGAMDPEPGRCR  156

Query  175  RTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            RTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE+
Sbjct  157  RTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEL  193



>ref|XP_003553589.1| PREDICTED: growth-regulating factor 3-like [Glycine max]
Length=388

 Score =   186 bits (471),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 116/159 (73%), Gaps = 12/159 (8%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATTK----------FPRMGGSYFSLGQWQELELQALI  362
            LPLFV EP +S   +  SDST  A T+          FPRMG SYFSL QWQELELQALI
Sbjct  40   LPLFVPEPNSSSKVSTLSDSTLAAETETMTTTTTNRLFPRMG-SYFSLSQWQELELQALI  98

Query  361  FRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGR  182
            FR+M+AGA VPPELL  +KKS  +S  Y+  HPL  Y       +  YWGR AMDPEPGR
Sbjct  99   FRYMLAGAAVPPELLQPIKKSLLHSPHYFLHHPLQHYQPAALLQS-GYWGRGAMDPEPGR  157

Query  181  CRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            CRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE+
Sbjct  158  CRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEL  196



>ref|XP_011018896.1| PREDICTED: growth-regulating factor 3 isoform X2 [Populus euphratica]
Length=395

 Score =   186 bits (471),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 124/180 (69%), Gaps = 12/180 (7%)
 Frame = -2

Query  601  AKVPRLVLDLhsttttashggggggssssALPLFVSEPP--TSKLSAFSSDSTPTATTKF  428
            AK+P+L++D                S S A PLF+ EP   TS LSAF  DS+  A T+ 
Sbjct  21   AKMPKLLMD------PHQPQQHPHSSGSVAFPLFLPEPSCKTSNLSAFP-DSSTAAYTRL  73

Query  427  PRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyp  248
            P++ G+YFSL QWQELELQALI+R M+AGA +PPELL  +KK+   S    +        
Sbjct  74   PKIMGNYFSLEQWQELELQALIYRFMLAGAAIPPELLQPIKKTLLRSHSPPYFLRHPLQL  133

Query  247  hyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            +Y P+   WYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAG KYCERH+HRGRNRSRKPVE
Sbjct  134  YYQPS---WYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGHKYCERHLHRGRNRSRKPVE  190



>ref|XP_004494150.1| PREDICTED: growth-regulating factor 3-like [Cicer arietinum]
Length=390

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 112/149 (75%), Gaps = 3/149 (2%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPV  332
            LP F+ E   +K+S  S  + P+ T +FPRMG S+FSL QWQELELQALIFR+M+AGA V
Sbjct  44   LPFFL-ESNNTKVSNLSDSTLPSNTNRFPRMG-SHFSLSQWQELELQALIFRYMLAGASV  101

Query  331  PPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWR  152
            P ELL  +KKS  +S  ++  HPL  +          YWGR AMDPEPGRCRRTDGKKWR
Sbjct  102  PTELLQPIKKSLIHSPLHFLHHPLQHFQPTPLLQTG-YWGRGAMDPEPGRCRRTDGKKWR  160

Query  151  CSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            CSRDVVAGQKYCERHMHRGRNRSRKPVE+
Sbjct  161  CSRDVVAGQKYCERHMHRGRNRSRKPVEL  189



>gb|KHG00974.1| hypothetical protein F383_23443 [Gossypium arboreum]
Length=403

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 124/182 (68%), Gaps = 14/182 (8%)
 Frame = -2

Query  601  AKVPRLVLDLhsttttashggggggssss---ALPLFVSEPPTSKLSAFSSDSTPTATTK  431
            AK+P+L+LDL +      H       +SS   ALPLFVSE   SK+S   S   P + ++
Sbjct  20   AKIPKLLLDLDAHHHHHHHPQQQQQHASSEPSALPLFVSES-NSKISGSLSAPLPDSNSR  78

Query  430  FPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqy  251
                 GSYFSL QWQELELQALI+R+M+AGA VPPELLH +KKS   S+ Y+  H     
Sbjct  79   M----GSYFSLAQWQELELQALIYRYMLAGAAVPPELLHPIKKSLLYSSSYFLHHYQPAL  134

Query  250  phyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPV  71
                      YWGRAAMDPEPGRCRRTDGKKWRCSRDVV GQKYCERH+HRGRNRSRKPV
Sbjct  135  LQSG------YWGRAAMDPEPGRCRRTDGKKWRCSRDVVPGQKYCERHVHRGRNRSRKPV  188

Query  70   EI  65
            E+
Sbjct  189  EM  190



>ref|XP_008241279.1| PREDICTED: growth-regulating factor 3 [Prunus mume]
Length=392

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 122/152 (80%), Gaps = 5/152 (3%)
 Frame = -2

Query  511  LPLFVSEPPT---SKLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAG  341
            LPLFV EP +   S LSAFS  +  +A+T+FP+MG SYFS  Q QELELQALIFR+M+AG
Sbjct  41   LPLFVPEPNSKMISTLSAFSESTPASASTRFPKMG-SYFSFSQLQELELQALIFRYMLAG  99

Query  340  APVPPELLHLVKKSPFNSApyyfphplhqyphyhPAS-APWYWGRAAMDPEPGRCRRTDG  164
            A VPPELL  ++KS  +S PY+  HPL QYPH+ PA     YWGRAAMDPEP RCRRTDG
Sbjct  100  AAVPPELLQPIRKSLLHSPPYFLHHPLQQYPHFQPALLQSGYWGRAAMDPEPTRCRRTDG  159

Query  163  KKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            KKWRCSRDVVAGQKYCERH+HRGRNRSRKPVE
Sbjct  160  KKWRCSRDVVAGQKYCERHVHRGRNRSRKPVE  191



>ref|XP_007202117.1| hypothetical protein PRUPE_ppa006912mg [Prunus persica]
 gb|EMJ03316.1| hypothetical protein PRUPE_ppa006912mg [Prunus persica]
Length=390

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 122/152 (80%), Gaps = 5/152 (3%)
 Frame = -2

Query  511  LPLFVSEPPT---SKLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAG  341
            LPLFV EP +   S LSAFS  +  +A+T+FP+MG SYFS  Q QELELQALIFR+M+AG
Sbjct  41   LPLFVPEPNSKMISTLSAFSESTPASASTRFPKMG-SYFSFSQLQELELQALIFRYMLAG  99

Query  340  APVPPELLHLVKKSPFNSApyyfphplhqyphyhPAS-APWYWGRAAMDPEPGRCRRTDG  164
            A VPPELL  ++KS  +S PY+  HPL QYPH+ PA     YWGRAAMDPEP RCRRTDG
Sbjct  100  AAVPPELLQPIRKSLLHSPPYFLHHPLQQYPHFQPALLQSGYWGRAAMDPEPTRCRRTDG  159

Query  163  KKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            KKWRCSRDVVAGQKYCERH+HRGRNRSRKPVE
Sbjct  160  KKWRCSRDVVAGQKYCERHVHRGRNRSRKPVE  191



>ref|XP_008442809.1| PREDICTED: growth-regulating factor 3 [Cucumis melo]
Length=409

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 110/151 (73%), Gaps = 9/151 (6%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPV  332
            LPLFV    ++ LSAFS DS+ T     PRM G YFS+ Q QELELQALIFR+MIAGA V
Sbjct  47   LPLFVPSKTSNILSAFS-DSSST----LPRMLG-YFSVAQRQELELQALIFRYMIAGAAV  100

Query  331  PPELLHLVKKSPFNSApyyfphplhqyphyhPASA---PWYWGRAAMDPEPGRCRRTDGK  161
            PPELLHL+KKS  +S    F             ++     YWGRAAMDPEPGRCRRTDGK
Sbjct  101  PPELLHLIKKSLLSSNNTPFFLHHPLQHFPQYPTSLLQAGYWGRAAMDPEPGRCRRTDGK  160

Query  160  KWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            KWRCSRDVVAGQKYCERHMHRGRNRSRKPVE
Sbjct  161  KWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  191



>ref|XP_010683856.1| PREDICTED: growth-regulating factor 3 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=422

 Score =   184 bits (466),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 114/161 (71%), Gaps = 12/161 (7%)
 Frame = -2

Query  511  LPLFVS-EPPTSKLSAFSSDST-----PTATTKF-PRMGGSY-FSLGQWQELELQALIFR  356
            LPLFVS +   +K+SA+S  S+     PT+TT+F  R+GG Y FSL QWQELELQALI+R
Sbjct  52   LPLFVSTDSQPNKMSAYSDHSSTPTAIPTSTTRFQTRVGGRYTFSLAQWQELELQALIYR  111

Query  355  HMIAGAPVPPELLHLVKKSPFNSApy----yfphplhqyphyhPASAPWYWGRAAMDPEP  188
            HM AGA VPPELL LVKKS   S+      +   P  Q           YWG+ AMDPEP
Sbjct  112  HMAAGASVPPELLQLVKKSLLTSSTAPYYLHHYSPHFQPAAAAALLQAGYWGKGAMDPEP  171

Query  187  GRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            GRCRRTDGKKWRCSRDVVAG KYCERHMHRGRNRSRKPVE 
Sbjct  172  GRCRRTDGKKWRCSRDVVAGHKYCERHMHRGRNRSRKPVEF  212



>ref|XP_010683855.1| PREDICTED: growth-regulating factor 3 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=423

 Score =   183 bits (465),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 114/161 (71%), Gaps = 12/161 (7%)
 Frame = -2

Query  511  LPLFVS-EPPTSKLSAFSSDST-----PTATTKF-PRMGGSY-FSLGQWQELELQALIFR  356
            LPLFVS +   +K+SA+S  S+     PT+TT+F  R+GG Y FSL QWQELELQALI+R
Sbjct  52   LPLFVSTDSQPNKMSAYSDHSSTPTAIPTSTTRFQTRVGGRYTFSLAQWQELELQALIYR  111

Query  355  HMIAGAPVPPELLHLVKKSPFNSApy----yfphplhqyphyhPASAPWYWGRAAMDPEP  188
            HM AGA VPPELL LVKKS   S+      +   P  Q           YWG+ AMDPEP
Sbjct  112  HMAAGASVPPELLQLVKKSLLTSSTAPYYLHHYSPHFQPAAAAALLQAGYWGKGAMDPEP  171

Query  187  GRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            GRCRRTDGKKWRCSRDVVAG KYCERHMHRGRNRSRKPVE 
Sbjct  172  GRCRRTDGKKWRCSRDVVAGHKYCERHMHRGRNRSRKPVEF  212



>ref|XP_004138010.1| PREDICTED: growth-regulating factor 4-like [Cucumis sativus]
Length=414

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 109/151 (72%), Gaps = 9/151 (6%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPV  332
            LPLFV    ++ LSAFS DS+ T     PRM G YFS  Q QELELQALIFR+MIAGA V
Sbjct  47   LPLFVPSKTSNTLSAFS-DSSST----LPRMLG-YFSAAQRQELELQALIFRYMIAGAAV  100

Query  331  PPELLHLVKKSPFNSApyyfphplhqyphyhPASA---PWYWGRAAMDPEPGRCRRTDGK  161
            PPELLHL+KKS  +S               H  ++     YWG+AAMDPEPGRCRRTDGK
Sbjct  101  PPELLHLIKKSLLSSTTAPLFLHHPLQHFPHYPTSLLQAGYWGKAAMDPEPGRCRRTDGK  160

Query  160  KWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            KWRCSRDVVAGQKYCERHMHRGRNRSRKPVE
Sbjct  161  KWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  191



>ref|XP_004165500.1| PREDICTED: growth-regulating factor 4-like [Cucumis sativus]
 gb|KGN59072.1| hypothetical protein Csa_3G751470 [Cucumis sativus]
Length=416

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 109/151 (72%), Gaps = 9/151 (6%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPV  332
            LPLFV    ++ LSAFS DS+ T     PRM G YFS  Q QELELQALIFR+MIAGA V
Sbjct  49   LPLFVPSKTSNTLSAFS-DSSST----LPRMLG-YFSAAQRQELELQALIFRYMIAGAAV  102

Query  331  PPELLHLVKKSPFNSApyyfphplhqyphyhPASA---PWYWGRAAMDPEPGRCRRTDGK  161
            PPELLHL+KKS  +S               H  ++     YWG+AAMDPEPGRCRRTDGK
Sbjct  103  PPELLHLIKKSLLSSTTAPLFLHHPLQHFPHYPTSLLQAGYWGKAAMDPEPGRCRRTDGK  162

Query  160  KWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            KWRCSRDVVAGQKYCERHMHRGRNRSRKPVE
Sbjct  163  KWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  193



>gb|KEH24126.1| growth-regulating factor [Medicago truncatula]
Length=361

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 113/150 (75%), Gaps = 8/150 (5%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATTKFPRMG-GSYFSLGQWQELELQALIFRHMIAGAP  335
            LPLF+ +P T K++  S  + P +  +FPR+G GS+FSL QWQELELQALIFR+M+ GA 
Sbjct  45   LPLFLPQPNT-KVTNLSDSALP-SNNRFPRIGMGSHFSLSQWQELELQALIFRYMLVGAS  102

Query  334  VPPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKW  155
            VPPELL  +KKS  +S+PY+  H               YWGR AMDPEPGRCRRTDGKKW
Sbjct  103  VPPELLQPIKKSLLHSSPYFLHHYQPTALLQSG-----YWGRGAMDPEPGRCRRTDGKKW  157

Query  154  RCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            RC+RDVVAGQKYCERHMHRGRNRSRKPVE+
Sbjct  158  RCARDVVAGQKYCERHMHRGRNRSRKPVEL  187



>gb|AFK43856.1| unknown [Medicago truncatula]
Length=383

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 113/150 (75%), Gaps = 8/150 (5%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATTKFPRMG-GSYFSLGQWQELELQALIFRHMIAGAP  335
            LPLF+ +P T K++  S  + P +  +FPR+G GS+FSL QWQELELQALIFR+M+ GA 
Sbjct  45   LPLFLPQPNT-KVTNLSDSALP-SNNRFPRIGMGSHFSLSQWQELELQALIFRYMLVGAS  102

Query  334  VPPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKW  155
            VPPELL  +KKS  +S+PY+  H               YWGR AMDPEPGRCRRTDGKKW
Sbjct  103  VPPELLQPIKKSLLHSSPYFLHHYQPTALLQSG-----YWGRGAMDPEPGRCRRTDGKKW  157

Query  154  RCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            RC+RDVVAGQKYCERHMHRGRNRSRKPVE+
Sbjct  158  RCARDVVAGQKYCERHMHRGRNRSRKPVEL  187



>ref|XP_003625769.1| GRL3 [Medicago truncatula]
 gb|AES81987.1| growth-regulating factor [Medicago truncatula]
Length=384

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 113/150 (75%), Gaps = 8/150 (5%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATTKFPRMG-GSYFSLGQWQELELQALIFRHMIAGAP  335
            LPLF+ +P T K++  S  + P +  +FPR+G GS+FSL QWQELELQALIFR+M+ GA 
Sbjct  45   LPLFLPQPNT-KVTNLSDSALP-SNNRFPRIGMGSHFSLSQWQELELQALIFRYMLVGAS  102

Query  334  VPPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKW  155
            VPPELL  +KKS  +S+PY+  H               YWGR AMDPEPGRCRRTDGKKW
Sbjct  103  VPPELLQPIKKSLLHSSPYFLHHYQPTALLQSG-----YWGRGAMDPEPGRCRRTDGKKW  157

Query  154  RCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            RC+RDVVAGQKYCERHMHRGRNRSRKPVE+
Sbjct  158  RCARDVVAGQKYCERHMHRGRNRSRKPVEL  187



>emb|CAN66216.1| hypothetical protein VITISV_041165 [Vitis vinifera]
Length=437

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 132/222 (59%), Gaps = 58/222 (26%)
 Frame = -2

Query  601  AKVPRLVLDLhsttttashggggggssssALPLFVSEPPT--SKLSAFSSDSTPTAT---  437
             K+PRL+LD                 S SALPLFV EP +  S LSAF  DST TAT   
Sbjct  22   GKMPRLLLD--------------QQPSGSALPLFVPEPNSKISNLSAFP-DSTTTATRFS  66

Query  436  ----------------------TKFP---------------RMGGSYFSLGQWQELELQA  368
                                  +  P                 GGSYFSL QWQELELQA
Sbjct  67   KQLRKLGSRYGKVSGFLVSRFASNLPFFFSLFVWWCAFGLLETGGSYFSLAQWQELELQA  126

Query  367  LIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPAS-APWYWGRAAMDPE  191
            LIFRHM+AGA VPPELL L+KKS  N  PYY  HPL  Y HY PA     YWGRAAMDPE
Sbjct  127  LIFRHMLAGAAVPPELLQLIKKSLLNHPPYYLQHPLQHYQHYQPALLQSGYWGRAAMDPE  186

Query  190  PGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            PGRCRRTDGKKWRCSRDVV GQKYCERHMHRGRNRSRKPVEI
Sbjct  187  PGRCRRTDGKKWRCSRDVVTGQKYCERHMHRGRNRSRKPVEI  228



>ref|XP_010049767.1| PREDICTED: growth-regulating factor 3 [Eucalyptus grandis]
 gb|KCW89234.1| hypothetical protein EUGRSUZ_A01534 [Eucalyptus grandis]
Length=428

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 126/185 (68%), Gaps = 7/185 (4%)
 Frame = -2

Query  601  AKVPRLVLD--LhsttttashggggggssssALPLFVSEPPTSKLSAFS-SDSTPTATTK  431
            AK+PRLVLD   H  + + S       ++SS LPLFV +  +S +SA +  DS P A   
Sbjct  31   AKLPRLVLDEPHHPQSQSQSQPMQSLAAASSTLPLFVPDKLSSNMSAAAFPDSAPAAPRS  90

Query  430  FPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqy  251
            FPRMG SYFS  QWQELELQALI+R+M+AGA VP ELL  +KKS   +  +      H  
Sbjct  91   FPRMG-SYFSWAQWQELELQALIYRYMLAGATVPAELLQPIKKSLLQAPYFLHHPLGHLQ  149

Query  250  phyhPASA---PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSR  80
             +     A     YWGRA+MDPEPGRCRRTDGKKWRCSRDVV GQKYCERHMHRGRNRSR
Sbjct  150  HYPQYQPALLQAGYWGRASMDPEPGRCRRTDGKKWRCSRDVVPGQKYCERHMHRGRNRSR  209

Query  79   KPVEI  65
            KPVEI
Sbjct  210  KPVEI  214



>emb|CDX67545.1| BnaA07g15850D [Brassica napus]
Length=364

 Score =   179 bits (455),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 115/149 (77%), Gaps = 8/149 (5%)
 Frame = -2

Query  511  LPLFVSEPPTS-KLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAP  335
            LPLFV+EP +S  +S FS +   T++++F +MG ++FSL QWQELELQALI+R+M+AGA 
Sbjct  45   LPLFVAEPTSSTSVSCFSPN---TSSSRFLKMG-NFFSLAQWQELELQALIYRYMLAGAS  100

Query  334  VPPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKW  155
            VP ELL  +KKS F S   +  HP  Q   +H    PWYWGR AMDPEPGRC+RTDGKKW
Sbjct  101  VPQELLLPIKKSLFQSPLNFLHHPQQQNFPHHQ---PWYWGRGAMDPEPGRCKRTDGKKW  157

Query  154  RCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            RCSRDVV G KYC+RH+HRGRNRSRKPVE
Sbjct  158  RCSRDVVGGHKYCDRHIHRGRNRSRKPVE  186



>ref|XP_011018895.1| PREDICTED: growth-regulating factor 3 isoform X1 [Populus euphratica]
Length=399

 Score =   180 bits (457),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 124/181 (69%), Gaps = 10/181 (6%)
 Frame = -2

Query  601  AKVPRLVLDLhsttttashggggggssssALPLFVSEPP--TSKLSAFSSDSTPTATTKF  428
            AK+P+L++D                S S A PLF+ EP   TS LSAF  DS+  A T+ 
Sbjct  21   AKMPKLLMD------PHQPQQHPHSSGSVAFPLFLPEPSCKTSNLSAFP-DSSTAAYTRL  73

Query  427  PRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNS-Apyyfphplhqy  251
            P++ G+YFSL QWQELELQALI+R M+AGA +PPELL  +KK+   S +P YF     Q 
Sbjct  74   PKIMGNYFSLEQWQELELQALIYRFMLAGAAIPPELLQPIKKTLLRSHSPPYFLRHPLQL  133

Query  250  phyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPV  71
             +        YWGRAAMDPEPGRCRRTDGKKWRCSRDVVAG KYCERH+HRGRNRSRKPV
Sbjct  134  YYQPSLLQTGYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGHKYCERHLHRGRNRSRKPV  193

Query  70   E  68
            E
Sbjct  194  E  194



>ref|XP_010553336.1| PREDICTED: growth-regulating factor 3 [Tarenaya hassleriana]
Length=384

 Score =   179 bits (455),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 128/183 (70%), Gaps = 17/183 (9%)
 Frame = -2

Query  607  SEAKVPRLVLDLhsttttashggggggssssALPLFVSEP--PTSKLSAFSSDSTPTATT  434
            S AK+P+LV D                ++S+ALPLF  EP   +SKL++ S  +  +++ 
Sbjct  24   SAAKIPKLVFD------------QSQTATSAALPLFAHEPEATSSKLASLSGFALESSS-  70

Query  433  KFPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhq  254
            + P+MGG +FS  QWQELELQALI+R+M+AGA VP ELL  +KKS  + +P YF H   Q
Sbjct  71   RSPKMGG-FFSWSQWQELELQALIYRYMLAGAAVPHELLLPIKKSLLHHSPSYFLHHPLQ  129

Query  253  yphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKP  74
            +   H    PWYWGRA MDPEPGRCRRTDGKKWRCSRDVV G KYCERHMHRGRNRSRKP
Sbjct  130  HLSPHY-QPPWYWGRATMDPEPGRCRRTDGKKWRCSRDVVVGHKYCERHMHRGRNRSRKP  188

Query  73   VEI  65
            VEI
Sbjct  189  VEI  191



>ref|XP_003537047.1| PREDICTED: growth-regulating factor 3-like [Glycine max]
Length=336

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 109/150 (73%), Gaps = 14/150 (9%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFS--SDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGA  338
            LPLFV E P +K+S  S  SDST  ++ +FPRM  S FS  QWQELELQALIFR+M+AGA
Sbjct  42   LPLFVPEQPNTKVSTLSAFSDSTLPSSPRFPRME-SCFSFAQWQELELQALIFRYMLAGA  100

Query  337  PVPPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKK  158
            PVPPELL  +KKS            L  Y   +   + +YW R A+DPEPGRCRRTDGKK
Sbjct  101  PVPPELLLPIKKS-----------FLQLYHPPNLLESGYYWRREALDPEPGRCRRTDGKK  149

Query  157  WRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            WRCS+D VAGQKYC+RHMHRGRNRSRKPVE
Sbjct  150  WRCSKDTVAGQKYCDRHMHRGRNRSRKPVE  179



>gb|KJB62216.1| hypothetical protein B456_009G406500 [Gossypium raimondii]
Length=331

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPV  332
            LPL V      K S+ +    P +++ FP   GS+FSL QWQELELQALIFR+M+AGA V
Sbjct  41   LPLLVPHH-HCKSSSNNLPPVPHSSSTFPSRMGSFFSLSQWQELELQALIFRYMLAGAAV  99

Query  331  PPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWR  152
            PP+LL  ++ S             H   H+     PWYWGRAAMDPEPGRCRRTDGKKWR
Sbjct  100  PPQLLQSIENSTI--LHSPSYFLHHPLRHFSHYQPPWYWGRAAMDPEPGRCRRTDGKKWR  157

Query  151  CSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            CSRDVVAGQKYCERH+HRGRNRSRKPVE+
Sbjct  158  CSRDVVAGQKYCERHVHRGRNRSRKPVEM  186



>gb|KJB62215.1| hypothetical protein B456_009G406500 [Gossypium raimondii]
Length=365

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 97/129 (75%), Gaps = 2/129 (2%)
 Frame = -2

Query  451  TPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyf  272
             P +++ FP   GS+FSL QWQELELQALIFR+M+AGA VPP+LL  ++ S         
Sbjct  60   VPHSSSTFPSRMGSFFSLSQWQELELQALIFRYMLAGAAVPPQLLQSIENSTI--LHSPS  117

Query  271  phplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGR  92
                H   H+     PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERH+HRGR
Sbjct  118  YFLHHPLRHFSHYQPPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHVHRGR  177

Query  91   NRSRKPVEI  65
            NRSRKPVE+
Sbjct  178  NRSRKPVEM  186



>ref|XP_006594200.1| PREDICTED: growth-regulating factor 3-like isoform X2 [Glycine 
max]
Length=331

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 105/149 (70%), Gaps = 23/149 (15%)
 Frame = -2

Query  502  FVSEPPTSK---LSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPV  332
            FV E P +K   LSAFS  + P+A  +F RM  S FS  QWQELELQALIFR+M+AGAPV
Sbjct  42   FVPEQPNTKVCTLSAFSDSTLPSAP-RFSRME-SCFSFAQWQELELQALIFRYMLAGAPV  99

Query  331  PPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWY-WGRAAMDPEPGRCRRTDGKKW  155
            PPELL  +KKS                      + PWY WGRAA+DPEPGRCRRTDGKKW
Sbjct  100  PPELLLPIKKS-----------------FLQLYNPPWYYWGRAALDPEPGRCRRTDGKKW  142

Query  154  RCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            RCS+D VAGQKYC+RHMHRGRNRSRKPVE
Sbjct  143  RCSKDAVAGQKYCDRHMHRGRNRSRKPVE  171



>ref|XP_004303017.1| PREDICTED: growth-regulating factor 3 [Fragaria vesca subsp. 
vesca]
Length=367

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 112/157 (71%), Gaps = 13/157 (8%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATT--------KFPRMGGSYFSLGQWQELELQALIFR  356
            LPLFV EP T  +S  S+ S  T TT        +FPRMG S+FS+ QWQELELQALIFR
Sbjct  45   LPLFVPEPNTKVISTLSAFSESTTTTTAPASSATRFPRMG-SFFSMSQWQELELQALIFR  103

Query  355  HMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCR  176
            +M+AGA VPPELL  +K+S  +S  ++  H  H            YWGR +MDPEP RCR
Sbjct  104  YMLAGAAVPPELLQPIKRSLLHSQFFFQHHLQHYPALLQSG----YWGRGSMDPEPTRCR  159

Query  175  RTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            RTDGKKWRCS+DVVAGQKYCERH+HRGRNRSRKPVE+
Sbjct  160  RTDGKKWRCSKDVVAGQKYCERHVHRGRNRSRKPVEV  196



>emb|CDX84560.1| BnaA03g16700D [Brassica napus]
Length=368

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 120/181 (66%), Gaps = 21/181 (12%)
 Frame = -2

Query  607  SEAKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKF  428
            S AK+PR   D                ++S+ LPLF  EP +SKLS+   DS+    ++F
Sbjct  22   SAAKIPRHAFD----------PIQSQTATSTVLPLFAPEPASSKLSSLCPDSS----SRF  67

Query  427  PRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyp  248
             +MG S+FS  QWQELELQALI+R+M+AGA VP ELL  +KKS  + +P YF H L  Y 
Sbjct  68   SKMG-SFFSSAQWQELELQALIYRYMLAGAAVPQELLLPIKKSLLHLSPSYFLHHLPHYQ  126

Query  247  hyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
                    WY GR AMDPEPGRCRRTDGKKWRCSRDV AG KYCERHMHRGRNRSRKPVE
Sbjct  127  PA------WYLGRGAMDPEPGRCRRTDGKKWRCSRDVFAGHKYCERHMHRGRNRSRKPVE  180

Query  67   I  65
             
Sbjct  181  T  181



>gb|KHN18741.1| hypothetical protein glysoja_021492 [Glycine soja]
Length=378

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 112/157 (71%), Gaps = 17/157 (11%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATTK--------FPRMGGSYFSLGQWQELELQALIFR  356
            LPLFV EP +SK+S  S DST  + T         FPRMG SYFSL QWQELELQALIFR
Sbjct  40   LPLFVPEPNSSKVSTLS-DSTLASATMTSTTTNRLFPRMG-SYFSLSQWQELELQALIFR  97

Query  355  HMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCR  176
            +M+AGA VPPELL  +KKS  +S  YY P   +Q      +    YWGR AMDPEPGRCR
Sbjct  98   YMLAGAAVPPELLQPIKKSLLHSPHYYHPLQHYQPSALLQSG---YWGRGAMDPEPGRCR  154

Query  175  RTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            RTDGKKW    DVVAGQKYCERHMHRGRNRSRKPVE+
Sbjct  155  RTDGKKW----DVVAGQKYCERHMHRGRNRSRKPVEL  187



>ref|XP_003542566.1| PREDICTED: growth-regulating factor 3-like isoform X1 [Glycine 
max]
Length=335

 Score =   172 bits (435),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 106/148 (72%), Gaps = 17/148 (11%)
 Frame = -2

Query  502  FVSEPPTSK---LSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPV  332
            FV E P +K   LSAFS  + P+A  +F RM  S FS  QWQELELQALIFR+M+AGAPV
Sbjct  42   FVPEQPNTKVCTLSAFSDSTLPSAP-RFSRME-SCFSFAQWQELELQALIFRYMLAGAPV  99

Query  331  PPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWR  152
            PPELL  +KKS              Q  +     + +YWGRAA+DPEPGRCRRTDGKKWR
Sbjct  100  PPELLLPIKKS------------FLQLYNPPLLESGYYWGRAALDPEPGRCRRTDGKKWR  147

Query  151  CSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            CS+D VAGQKYC+RHMHRGRNRSRKPVE
Sbjct  148  CSKDAVAGQKYCDRHMHRGRNRSRKPVE  175



>emb|CDY13333.1| BnaC06g14240D [Brassica napus]
Length=366

 Score =   172 bits (436),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 112/149 (75%), Gaps = 8/149 (5%)
 Frame = -2

Query  511  LPLFVSEPPTS-KLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAP  335
            LPLFV EP  S  +S FS +   T++++F +MG + FSL QWQELELQALI+R+M+AGA 
Sbjct  44   LPLFVPEPTLSPSVSCFSPN---TSSSRFLKMG-NLFSLAQWQELELQALIYRYMLAGAS  99

Query  334  VPPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKW  155
            VP ELL  ++KS F S   +  HP  Q   +H    PW+WGR AMDPEPGRC+RTDGKKW
Sbjct  100  VPQELLLPIQKSLFQSPLNFLHHPQQQNFPHHQ---PWHWGRGAMDPEPGRCKRTDGKKW  156

Query  154  RCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            RCSRDVV G KYC+RH+HRGRNRSRKPVE
Sbjct  157  RCSRDVVGGHKYCDRHIHRGRNRSRKPVE  185



>ref|XP_009133081.1| PREDICTED: growth-regulating factor 3-like [Brassica rapa]
Length=368

 Score =   171 bits (434),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 119/181 (66%), Gaps = 21/181 (12%)
 Frame = -2

Query  607  SEAKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKF  428
            S AK+PR   D                ++S+ LPLF  EP +SKLS+   DS+    ++F
Sbjct  22   SAAKIPRHAFD----------PIQSQTATSTVLPLFAPEPASSKLSSLCPDSS----SRF  67

Query  427  PRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyp  248
             +MG S+FS  QWQELELQALI+R+M+AGA VP ELL  +KKS  + +P YF H L  Y 
Sbjct  68   SKMG-SFFSSAQWQELELQALIYRYMLAGAAVPQELLLPIKKSLLHLSPSYFLHHLPHYQ  126

Query  247  hyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
                    WY GR AMDPEPGRCRRTDGKKWRCSRDV  G KYCERHMHRGRNRSRKPVE
Sbjct  127  PA------WYLGRGAMDPEPGRCRRTDGKKWRCSRDVFVGHKYCERHMHRGRNRSRKPVE  180

Query  67   I  65
             
Sbjct  181  T  181



>ref|XP_006577061.1| PREDICTED: growth-regulating factor 3 isoform X2 [Glycine max]
Length=308

 Score =   170 bits (430),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 95/117 (81%), Gaps = 1/117 (1%)
 Frame = -2

Query  415  GSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhP  236
            GSYFSL QWQELELQALIFR+M+AGA VPPELL  +KKS  +S  YY  HPL  Y     
Sbjct  2    GSYFSLSQWQELELQALIFRYMLAGAAVPPELLQPIKKSLLHSPHYYLHHPLQHYQPSAL  61

Query  235  ASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
              +  YWGR AMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE+
Sbjct  62   LQSG-YWGRGAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEL  117



>ref|XP_009125239.1| PREDICTED: growth-regulating factor 4-like [Brassica rapa]
Length=366

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 113/151 (75%), Gaps = 10/151 (7%)
 Frame = -2

Query  511  LPLFVSEPPTS-KLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAP  335
            LPLFV EP +S  +S FS +   T++++F +MG ++FSL QWQELELQALI+R+M+AGA 
Sbjct  45   LPLFVPEPTSSTSVSCFSPN---TSSSRFLKMG-NFFSLAQWQELELQALIYRYMLAGAS  100

Query  334  VPPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKW  155
            VP ELL  +KKS F S   +  HP  Q   +H    PWYWGR AMDPEPGRC+RTDGKKW
Sbjct  101  VPQELLLPIKKSLFQSPLNFLHHPQQQNFPHH---QPWYWGRGAMDPEPGRCKRTDGKKW  157

Query  154  RCSRDVVAGQKYCERHMH--RGRNRSRKPVE  68
            RCSRDVV G KYC+RH+H  R RNRSRKPVE
Sbjct  158  RCSRDVVGGHKYCDRHIHPGRNRNRSRKPVE  188



>emb|CDX73595.1| BnaC08g24080D [Brassica napus]
Length=381

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 109/149 (73%), Gaps = 4/149 (3%)
 Frame = -2

Query  511  LPLFVSEPPTSKLS-AFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAP  335
            LPLFV EP +S     F+ DS+ ++T       G++FSL QWQELELQALI+R+M+AGA 
Sbjct  44   LPLFVPEPTSSSSFSCFTPDSSSSSTRHLKL--GNFFSLAQWQELELQALIYRYMLAGAS  101

Query  334  VPPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKW  155
            VP ELL  +KKS F+ +P  F     Q+   H   A WYWGR AMDPEPGRC+RTDGKKW
Sbjct  102  VPQELLLPIKKSLFHQSPLNFLQHPLQHNFPHHQ-ASWYWGRGAMDPEPGRCKRTDGKKW  160

Query  154  RCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            RCSRDVV G KYC+RH+HRGRNRSRKPVE
Sbjct  161  RCSRDVVGGHKYCDRHIHRGRNRSRKPVE  189



>emb|CDX79674.1| BnaC03g20100D [Brassica napus]
Length=368

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 119/180 (66%), Gaps = 21/180 (12%)
 Frame = -2

Query  607  SEAKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKF  428
            S AK+PR   D                ++S+ LPLF  EP +SKLS+   DS+    ++F
Sbjct  22   SAAKIPRHAFD----------PIQSQTATSTVLPLFAPEPASSKLSSLCPDSS----SRF  67

Query  427  PRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyp  248
             +MG S+FS  QWQELELQALI+R+M+AGA VP ELL  +KKS  + +P YF   L  Y 
Sbjct  68   SKMG-SFFSWAQWQELELQALIYRYMLAGAAVPQELLLPIKKSLLHLSPSYFLQHLPHYQ  126

Query  247  hyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
                    WY GR AMDPEPGRCRRTDGKKWRCSRDV AG KYCERH+HRGRNRSRKPVE
Sbjct  127  PA------WYLGRGAMDPEPGRCRRTDGKKWRCSRDVFAGHKYCERHVHRGRNRSRKPVE  180



>ref|XP_010527788.1| PREDICTED: growth-regulating factor 3-like isoform X2 [Tarenaya 
hassleriana]
Length=393

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 109/156 (70%), Gaps = 14/156 (9%)
 Frame = -2

Query  511  LPLFVSEPPT-------SKLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRH  353
            LPLF  EP T       S LS F+ DS+ + + KF  M  S+FS  QWQELELQALI+R+
Sbjct  43   LPLFAPEPETEPTSSKLSSLSGFAPDSS-SRSPKFVEMR-SFFSWNQWQELELQALIYRY  100

Query  352  MIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRR  173
            M+AGA VP ELL  ++KS  + +P YF H    +        PWY GRA MDPEPGRCRR
Sbjct  101  MLAGAAVPQELLLPIRKSLLHRSPSYFLHHFSAHHQ-----PPWYGGRAVMDPEPGRCRR  155

Query  172  TDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            TDGKKWRCSRDVV G KYCERHMHRGRNRSRKPVEI
Sbjct  156  TDGKKWRCSRDVVVGHKYCERHMHRGRNRSRKPVEI  191



>ref|XP_010527780.1| PREDICTED: growth-regulating factor 3-like isoform X1 [Tarenaya 
hassleriana]
Length=393

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 109/156 (70%), Gaps = 14/156 (9%)
 Frame = -2

Query  511  LPLFVSEPPT-------SKLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRH  353
            LPLF  EP T       S LS F+ DS+ + + KF  M  S+FS  QWQELELQALI+R+
Sbjct  43   LPLFAPEPETEPTSSKLSSLSGFAPDSS-SRSPKFVEMR-SFFSWNQWQELELQALIYRY  100

Query  352  MIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRR  173
            M+AGA VP ELL  ++KS  + +P YF H    +        PWY GRA MDPEPGRCRR
Sbjct  101  MLAGAAVPQELLLPIRKSLLHRSPSYFLHHFSAHHQ-----PPWYGGRAVMDPEPGRCRR  155

Query  172  TDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            TDGKKWRCSRDVV G KYCERHMHRGRNRSRKPVEI
Sbjct  156  TDGKKWRCSRDVVVGHKYCERHMHRGRNRSRKPVEI  191



>gb|KHN25188.1| hypothetical protein glysoja_044785 [Glycine soja]
Length=334

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 107/150 (71%), Gaps = 16/150 (11%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFS--SDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGA  338
            LPLFV E P +K+S  S  SDST  ++ +FPRM  S FS  QWQELELQALIFR+M+AGA
Sbjct  42   LPLFVPEQPNTKVSTLSAFSDSTLPSSPRFPRME-SCFSFAQWQELELQALIFRYMLAGA  100

Query  337  PVPPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKK  158
            PVPPELL  +KKS            L  Y   +   + +YW R A+DPEPGRCRRTDGKK
Sbjct  101  PVPPELLLPIKKS-----------FLQLYHPPNLLESGYYWRREALDPEPGRCRRTDGKK  149

Query  157  WRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            WRCS+D VAG  +C+RHMHRGRNRSRKPVE
Sbjct  150  WRCSKDTVAG--HCDRHMHRGRNRSRKPVE  177



>gb|KJB62218.1| hypothetical protein B456_009G406500 [Gossypium raimondii]
Length=335

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 106/151 (70%), Gaps = 3/151 (2%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPV  332
            LPL V      K S+ +    P +++ FP   GS+FSL QWQELELQALIFR+M+AGA V
Sbjct  41   LPLLVPHH-HCKSSSNNLPPVPHSSSTFPSRMGSFFSLSQWQELELQALIFRYMLAGAAV  99

Query  331  PPELLHLVKKSPF--NSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKK  158
            PP+LL  ++ S    + + +      H   +  P     YWGRAAMDPEPGRCRRTDGKK
Sbjct  100  PPQLLQSIENSTILHSPSYFLHHPLRHFSHYQPPLLQSGYWGRAAMDPEPGRCRRTDGKK  159

Query  157  WRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            WRCSRDVVAGQKYCERH+HRGRNRSRKPVE+
Sbjct  160  WRCSRDVVAGQKYCERHVHRGRNRSRKPVEM  190



>ref|XP_010089399.1| hypothetical protein L484_013790 [Morus notabilis]
 gb|EXB37752.1| hypothetical protein L484_013790 [Morus notabilis]
Length=430

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 117/199 (59%), Gaps = 23/199 (12%)
 Frame = -2

Query  601  AKVPRLVLDLhsttttashggggggssssALPLFVSEP---------PTSKLSAFSSDST  449
            AK+P+L+LD                  SSALPLFV +          PT    AF   ST
Sbjct  27   AKIPKLLLD--HHQQQPHQIKPEPSPVSSALPLFVPDHHHQPNNKIIPTHLSVAFPDQST  84

Query  448  PTATT----KFPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKS------  299
             T         PRMG SYFSL QWQELELQALIFR+M+AGA VPPELL  +KKS      
Sbjct  85   TTTPVSSSRHHPRMG-SYFSLAQWQELELQALIFRYMLAGAAVPPELLQPIKKSFNLLHN  143

Query  298  -PFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQK  122
             P+           H +          YWGRAAMDPEPGRCRRTDGKKWRCSRDVV GQK
Sbjct  144  PPYFLHHPTLQPYAHHFQPAAALFQTGYWGRAAMDPEPGRCRRTDGKKWRCSRDVVVGQK  203

Query  121  YCERHMHRGRNRSRKPVEI  65
            YCERHMHRGRNRSRKPVE 
Sbjct  204  YCERHMHRGRNRSRKPVET  222



>gb|KJB62217.1| hypothetical protein B456_009G406500 [Gossypium raimondii]
Length=369

 Score =   167 bits (423),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 98/131 (75%), Gaps = 2/131 (2%)
 Frame = -2

Query  451  TPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPF--NSApy  278
             P +++ FP   GS+FSL QWQELELQALIFR+M+AGA VPP+LL  ++ S    + + +
Sbjct  60   VPHSSSTFPSRMGSFFSLSQWQELELQALIFRYMLAGAAVPPQLLQSIENSTILHSPSYF  119

Query  277  yfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHR  98
                  H   +  P     YWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERH+HR
Sbjct  120  LHHPLRHFSHYQPPLLQSGYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHVHR  179

Query  97   GRNRSRKPVEI  65
            GRNRSRKPVE+
Sbjct  180  GRNRSRKPVEM  190



>ref|XP_006291235.1| hypothetical protein CARUB_v10017366mg, partial [Capsella rubella]
 gb|EOA24133.1| hypothetical protein CARUB_v10017366mg, partial [Capsella rubella]
Length=407

 Score =   168 bits (425),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 106/148 (72%), Gaps = 1/148 (1%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPV  332
            LPLFV EP +S   +  S  + +++++F ++G ++FS  QWQELELQALI+R+M+AGA V
Sbjct  68   LPLFVPEPTSSSSFSCFSPDSSSSSSRFLKVG-NFFSWAQWQELELQALIYRYMLAGASV  126

Query  331  PPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWR  152
            P ELL  +KKS  + +             +      WYWGR AMDPEPGRC+RTDGKKWR
Sbjct  127  PQELLLPIKKSLIHQSSSMHFLHHPLQHSFPHQQPSWYWGRGAMDPEPGRCKRTDGKKWR  186

Query  151  CSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            CSRDVVAG KYC+RH+HRGRNRSRKPVE
Sbjct  187  CSRDVVAGHKYCDRHIHRGRNRSRKPVE  214



>emb|CDX78132.1| BnaA09g33270D [Brassica napus]
Length=377

 Score =   166 bits (421),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 110/148 (74%), Gaps = 2/148 (1%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPV  332
            LPLFV EP +S   +  +  + +++T+  +MG ++FSL Q QELELQALI+R+M+AGA V
Sbjct  44   LPLFVPEPTSSSSFSCFTPDSSSSSTRHLKMG-NFFSLAQRQELELQALIYRYMLAGASV  102

Query  331  PPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWR  152
            P ELL  +KKS F+ +P  F     Q+   H   A WYWGR AMDPEPGRC+RTDGKKWR
Sbjct  103  PQELLLPIKKSLFHQSPLNFLQHPLQHNFPHHQ-ASWYWGRGAMDPEPGRCKRTDGKKWR  161

Query  151  CSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            CSRDVV G KYC+RH+HRGRNRSRKPVE
Sbjct  162  CSRDVVGGHKYCDRHIHRGRNRSRKPVE  189



>ref|XP_006410817.1| hypothetical protein EUTSA_v10016778mg [Eutrema salsugineum]
 gb|ESQ52270.1| hypothetical protein EUTSA_v10016778mg [Eutrema salsugineum]
Length=387

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 126/181 (70%), Gaps = 17/181 (9%)
 Frame = -2

Query  607  SEAKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKF  428
            S AK+P+ V D                ++S+ALPLF  EP +SKLS+     +P  +++F
Sbjct  25   SAAKIPKHVYD----------QIQSHTATSTALPLFAPEPTSSKLSS----LSPDPSSRF  70

Query  427  PRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyp  248
            P+MG S+FS  QWQELELQALI+R+M+AG  VP ELL  +KKS  + +P YF H   Q+ 
Sbjct  71   PKMG-SFFSWQQWQELELQALIYRYMLAGTAVPQELLLPIKKSLLHLSPSYFLHHPLQHL  129

Query  247  hyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
             ++  +  WY GRAAMDPEPGRCRRTDGKKWRCSRDV AG KYCERHMHRGRNRSRKPVE
Sbjct  130  PHYQPA--WYLGRAAMDPEPGRCRRTDGKKWRCSRDVFAGHKYCERHMHRGRNRSRKPVE  187

Query  67   I  65
             
Sbjct  188  T  188



>gb|KJB36396.1| hypothetical protein B456_006G157300 [Gossypium raimondii]
 gb|KJB36398.1| hypothetical protein B456_006G157300 [Gossypium raimondii]
Length=325

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 90/117 (77%), Gaps = 6/117 (5%)
 Frame = -2

Query  415  GSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhP  236
            GSYFSL QWQELELQALI+R+M+AGA VPPELLH +KKS   S+ Y+  H          
Sbjct  2    GSYFSLAQWQELELQALIYRYMLAGAAVPPELLHPIKKSLLYSSSYFLHHYQPALLQSG-  60

Query  235  ASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
                 YWGRAAMDPEPG CRRTDGKKWRCS+DVV GQKYCERH+H GRNRSRKPVE+
Sbjct  61   -----YWGRAAMDPEPGHCRRTDGKKWRCSKDVVPGQKYCERHVHCGRNRSRKPVEM  112



>ref|XP_009115989.1| PREDICTED: growth-regulating factor 4-like [Brassica rapa]
Length=382

 Score =   164 bits (416),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 109/148 (74%), Gaps = 2/148 (1%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPV  332
            LPLFV EP +S   +  +  + +++T+  +MG ++FSL QWQELELQALI+R+M+A A  
Sbjct  44   LPLFVPEPTSSSSFSCFTPDSSSSSTRHLKMG-NFFSLAQWQELELQALIYRYMLACASF  102

Query  331  PPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWR  152
            P ELL  +KKS F+ +P  F     Q+   H   A WYWGR AMDPEPGRC+RTDGKKWR
Sbjct  103  PQELLLPIKKSLFHQSPLNFLQHPLQHNFPHHQ-ASWYWGRGAMDPEPGRCKRTDGKKWR  161

Query  151  CSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            CSRDVVA  KYC+RH+HRGRNRSRKPVE
Sbjct  162  CSRDVVASYKYCDRHIHRGRNRSRKPVE  189



>ref|XP_009148749.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Brassica 
rapa]
Length=370

 Score =   164 bits (415),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 109/148 (74%), Gaps = 5/148 (3%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPV  332
            LPLFV EP TS   +    S  +++++  +MG + FSL QWQELELQALI+R+M+AGA V
Sbjct  44   LPLFVPEPTTSSSFS--CFSPDSSSSRLLKMG-NLFSLAQWQELELQALIYRYMLAGASV  100

Query  331  PPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWR  152
            P ELL  +KKS F+ +   F H   Q+   H    PWYWGR A+DPEPGRC+RTDGKKWR
Sbjct  101  PQELLLPIKKSLFHQSHLNFLHYPLQHNFPHHQ--PWYWGRGAVDPEPGRCKRTDGKKWR  158

Query  151  CSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            CSRDVVA  KYC+RH+HRGRNRSRKPVE
Sbjct  159  CSRDVVASYKYCDRHIHRGRNRSRKPVE  186



>gb|KFK34537.1| hypothetical protein AALP_AA5G159100 [Arabis alpina]
Length=372

 Score =   164 bits (414),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 112/148 (76%), Gaps = 2/148 (1%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPV  332
            LPLFV EP +S   +  S  + +A+++FP+MG ++FS  QWQELELQALI+R+M+AGA V
Sbjct  44   LPLFVPEPTSSSSFSCFSPDSSSASSRFPKMG-NFFSWAQWQELELQALIYRYMLAGASV  102

Query  331  PPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWR  152
            P ELL  +KKS  + +P +  H   Q+   H   + WYWG+ AMDPEPGRC+RTDGKKWR
Sbjct  103  PQELLLPIKKSLIHQSPLHLFHHPLQHNFPHYQPS-WYWGKGAMDPEPGRCKRTDGKKWR  161

Query  151  CSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            CSRDVVAG KYC+RH+HRGRNRSRK VE
Sbjct  162  CSRDVVAGHKYCDRHIHRGRNRSRKLVE  189



>emb|CDX76249.1| BnaA04g05130D [Brassica napus]
Length=409

 Score =   164 bits (416),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 109/148 (74%), Gaps = 5/148 (3%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPV  332
            LPLFV EP TS   +    S  +++++  +MG + FSL QWQELELQALI+R+M+AGA V
Sbjct  44   LPLFVPEPTTSSSFS--CFSPDSSSSRLLKMG-NLFSLAQWQELELQALIYRYMLAGASV  100

Query  331  PPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWR  152
            P ELL  +KKS F+ +   F H   Q+   H    PWYWGR A+DPEPGRC+RTDGKKWR
Sbjct  101  PQELLLPIKKSLFHQSHLNFLHYPLQHNFPHHQ--PWYWGRGAVDPEPGRCKRTDGKKWR  158

Query  151  CSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            CSRDVVA  KYC+RH+HRGRNRSRKPVE
Sbjct  159  CSRDVVASYKYCDRHIHRGRNRSRKPVE  186



>ref|XP_006403753.1| hypothetical protein EUTSA_v10010453mg [Eutrema salsugineum]
 gb|ESQ45206.1| hypothetical protein EUTSA_v10010453mg [Eutrema salsugineum]
Length=378

 Score =   164 bits (414),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 113/148 (76%), Gaps = 2/148 (1%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPV  332
            LPLFV EP TS   +  S  + +++++F +MG ++FS  QWQELELQALI+R+M+AGA V
Sbjct  44   LPLFVPEPTTSSSFSCFSPDSSSSSSRFLKMG-NFFSWTQWQELELQALIYRYMLAGASV  102

Query  331  PPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWR  152
            P ELL  +KKS F+ +P +F H   Q+   H   + WYWGR AMDPEPGRC+RTDGKKWR
Sbjct  103  PQELLLPIKKSLFHQSPLHFLHHPLQHNFPHHQPS-WYWGRGAMDPEPGRCKRTDGKKWR  161

Query  151  CSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            CSRDVV G KYC+RH+HRGRNRSRKPVE
Sbjct  162  CSRDVVGGHKYCDRHIHRGRNRSRKPVE  189



>dbj|BAC42083.1| unknown protein [Arabidopsis thaliana]
Length=398

 Score =   164 bits (415),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 128/181 (71%), Gaps = 17/181 (9%)
 Frame = -2

Query  607  SEAKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKF  428
            S AK+P+ V D                ++S+ALPLF  EP +SKLS+     +P ++++F
Sbjct  25   SAAKIPKHVFD----------QIHSHTATSTALPLFTPEPTSSKLSS----LSPDSSSRF  70

Query  427  PRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyp  248
            P+MG S+FS  QWQELELQALI+R+M+AGA VP ELL  +KKS  + +P YF H   Q+ 
Sbjct  71   PKMG-SFFSWAQWQELELQALIYRYMLAGAAVPQELLLPIKKSLLHLSPSYFLHHPLQHL  129

Query  247  hyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
             ++  +  WY GRAAMDPEPGRCRRTDGKKWRCSRDV AG KYCERHMHRGRNRSRKPVE
Sbjct  130  PHYQPA--WYLGRAAMDPEPGRCRRTDGKKWRCSRDVFAGHKYCERHMHRGRNRSRKPVE  187

Query  67   I  65
             
Sbjct  188  T  188



>ref|NP_181181.1| growth-regulating factor 3 [Arabidopsis thaliana]
 sp|Q9SJR5.1|GRF3_ARATH RecName: Full=Growth-regulating factor 3; Short=AtGRF3; AltName: 
Full=Transcription activator GRF3 [Arabidopsis thaliana]
 gb|AAD24624.1| unknown protein [Arabidopsis thaliana]
 gb|AAM52878.1| transcription activator [Arabidopsis thaliana]
 gb|ABH04579.1| At2g36400 [Arabidopsis thaliana]
 gb|AEC09248.1| growth-regulating factor 3 [Arabidopsis thaliana]
Length=398

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 128/181 (71%), Gaps = 17/181 (9%)
 Frame = -2

Query  607  SEAKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKF  428
            S AK+P+ V D                ++S+ALPLF  EP +SKLS+     +P ++++F
Sbjct  25   SAAKIPKHVFD----------QIHSHTATSTALPLFTPEPTSSKLSS----LSPDSSSRF  70

Query  427  PRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyp  248
            P+MG S+FS  QWQELELQALI+R+M+AGA VP ELL  +KKS  + +P YF H   Q+ 
Sbjct  71   PKMG-SFFSWAQWQELELQALIYRYMLAGAAVPQELLLPIKKSLLHLSPSYFLHHPLQHL  129

Query  247  hyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
             ++  +  WY GRAAMDPEPGRCRRTDGKKWRCSRDV AG KYCERHMHRGRNRSRKPVE
Sbjct  130  PHYQPA--WYLGRAAMDPEPGRCRRTDGKKWRCSRDVFAGHKYCERHMHRGRNRSRKPVE  187

Query  67   I  65
             
Sbjct  188  T  188



>ref|XP_002881441.1| hypothetical protein ARALYDRAFT_482616 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57700.1| hypothetical protein ARALYDRAFT_482616 [Arabidopsis lyrata subsp. 
lyrata]
Length=396

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 128/181 (71%), Gaps = 17/181 (9%)
 Frame = -2

Query  607  SEAKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKF  428
            S AK+P+ V D                ++S+ALPLF  EP +SKLS+     +P ++++F
Sbjct  22   SAAKIPKHVFD----------QIQSHSATSTALPLFAPEPTSSKLSS----LSPESSSRF  67

Query  427  PRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyp  248
            P+MG S+FS  QWQELELQALI+R+M+AGA VP ELL  +KKS  + +P YF H   Q+ 
Sbjct  68   PKMG-SFFSWAQWQELELQALIYRYMLAGAAVPQELLLPIKKSLLHLSPSYFLHHPLQHL  126

Query  247  hyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
             ++  +  WY GRAAMDPEPGRCRRTDGKKWRCSRDV AG KYCERHMHRGRNRSRKPVE
Sbjct  127  PHYQPA--WYLGRAAMDPEPGRCRRTDGKKWRCSRDVFAGHKYCERHMHRGRNRSRKPVE  184

Query  67   I  65
             
Sbjct  185  T  185



>ref|XP_010505186.1| PREDICTED: growth-regulating factor 3-like [Camelina sativa]
Length=390

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 124/181 (69%), Gaps = 20/181 (11%)
 Frame = -2

Query  607  SEAKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKF  428
            S AK+P+ V D                 +S+ALPLF  EP +SKLS         ++++F
Sbjct  19   SAAKIPKHVYD----------QIHSQTPASTALPLFAPEPTSSKLSP-------DSSSRF  61

Query  427  PRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyp  248
            P+MG S+FS  QWQELELQALI+R+M+AGA VP ELL  +KKS  + +P YF H   Q+ 
Sbjct  62   PKMG-SFFSWAQWQELELQALIYRYMLAGAAVPQELLLPIKKSLVHLSPSYFLHHPLQHL  120

Query  247  hyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
             ++  +  WY GRAAMDPEPGRCRRTDGKKWRCSRDV AG KYCERHMHRGRNRSRKPVE
Sbjct  121  PHYQPA--WYLGRAAMDPEPGRCRRTDGKKWRCSRDVFAGHKYCERHMHRGRNRSRKPVE  178

Query  67   I  65
             
Sbjct  179  T  179



>ref|XP_010504040.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Camelina 
sativa]
 ref|XP_010504042.1| PREDICTED: growth-regulating factor 4-like isoform X2 [Camelina 
sativa]
Length=396

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 112/148 (76%), Gaps = 2/148 (1%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPV  332
            LPLFV EP +S   +  S  + ++++KF ++G + FS  QWQELELQALI+R+M+AGA V
Sbjct  52   LPLFVPEPTSSSSFSCFSPDSSSSSSKFLKIG-NLFSWTQWQELELQALIYRYMLAGASV  110

Query  331  PPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWR  152
            P ELL  +KKS  + +P +F H   Q+   H   + WYWGR AMDPEPGRC+RTDGKKWR
Sbjct  111  PQELLLPIKKSLIHQSPMHFLHHPLQHSFPHQQPS-WYWGRGAMDPEPGRCKRTDGKKWR  169

Query  151  CSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            CSRDVVAG KYC+RH+HRGRNRSRKPVE
Sbjct  170  CSRDVVAGHKYCDRHIHRGRNRSRKPVE  197



>ref|XP_010509475.1| PREDICTED: growth-regulating factor 3 [Camelina sativa]
Length=389

 Score =   162 bits (409),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 124/181 (69%), Gaps = 20/181 (11%)
 Frame = -2

Query  607  SEAKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKF  428
            S AK+P+ V D                 +S+ALPLF  EP +SKLS         ++++F
Sbjct  19   SAAKIPKHVYD----------QIHSQTPASTALPLFAPEPTSSKLSP-------DSSSRF  61

Query  427  PRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyp  248
            P+MG S+FS  QWQELELQALI+R+M+AGA VP ELL  +KKS  + +P YF H   Q+ 
Sbjct  62   PKMG-SFFSWAQWQELELQALIYRYMLAGAAVPQELLLPIKKSLVHLSPSYFLHHPLQHL  120

Query  247  hyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
             ++  +  WY GRAAMDPEPGRCRRTDGKKWRCSRDV AG KYCERHMHRGRNRSRKPVE
Sbjct  121  PHYQPA--WYLGRAAMDPEPGRCRRTDGKKWRCSRDVFAGHKYCERHMHRGRNRSRKPVE  178

Query  67   I  65
             
Sbjct  179  T  179



>ref|XP_010516861.1| PREDICTED: growth-regulating factor 3-like [Camelina sativa]
Length=391

 Score =   161 bits (408),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 124/181 (69%), Gaps = 20/181 (11%)
 Frame = -2

Query  607  SEAKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKF  428
            S AK+P+ V D                 +S+ALPLF  EP +SKLS         ++++F
Sbjct  19   SAAKIPKHVYD----------QIHSQTPASTALPLFAPEPTSSKLSP-------DSSSRF  61

Query  427  PRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyp  248
            P+MG S+FS  QWQELELQALI+R+M+AGA VP ELL  +KKS  + +P YF H   Q+ 
Sbjct  62   PKMG-SFFSWAQWQELELQALIYRYMLAGAAVPQELLLPIKKSLVHLSPSYFLHHPLQHL  120

Query  247  hyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
             ++  +  WY GRAAMDPEPGRCRRTDGKKWRCSRDV AG KYCERHMHRGRNRSRKPVE
Sbjct  121  PHYQPA--WYLGRAAMDPEPGRCRRTDGKKWRCSRDVFAGHKYCERHMHRGRNRSRKPVE  178

Query  67   I  65
             
Sbjct  179  T  179



>ref|NP_190859.2| growth-regulating factor 4 [Arabidopsis thaliana]
 sp|Q8L8A7.1|GRF4_ARATH RecName: Full=Growth-regulating factor 4; Short=AtGRF4; AltName: 
Full=Transcription activator GRF4 [Arabidopsis thaliana]
 gb|AAM52879.1| transcription activator [Arabidopsis thaliana]
 gb|AEE79009.1| growth-regulating factor 4 [Arabidopsis thaliana]
Length=380

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 112/150 (75%), Gaps = 4/150 (3%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATT--KFPRMGGSYFSLGQWQELELQALIFRHMIAGA  338
            LPLFV EP +S   +  S  +  +++  +F +MG ++FS  QWQELELQALI+R+M+AGA
Sbjct  47   LPLFVPEPTSSSSFSCFSPDSSNSSSSSRFLKMG-NFFSWAQWQELELQALIYRYMLAGA  105

Query  337  PVPPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKK  158
             VP ELL  +KKS  + +P +F H   Q+   H   + WYWGR AMDPEPGRC+RTDGKK
Sbjct  106  SVPQELLLPIKKSLLHQSPMHFLHHPLQHSFPHHQPS-WYWGRGAMDPEPGRCKRTDGKK  164

Query  157  WRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            WRCSRDVVAG KYC+RH+HRGRNRSRKPVE
Sbjct  165  WRCSRDVVAGHKYCDRHIHRGRNRSRKPVE  194



>gb|KFK36342.1| hypothetical protein AALP_AA4G110100 [Arabis alpina]
Length=389

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 128/180 (71%), Gaps = 15/180 (8%)
 Frame = -2

Query  607  SEAKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKF  428
            S +K+P+ V D                +S++ALPLF  EP +SKLS+    S+P ++++F
Sbjct  20   SASKIPKHVFD---------QIQSQTPTSTAALPLFSHEPTSSKLSS---LSSPDSSSRF  67

Query  427  PRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyp  248
            P+MG S+FS  QWQELELQALI+R+M+AGA VP ELL  +KKS  + +P YF H   Q+ 
Sbjct  68   PKMG-SFFSWAQWQELELQALIYRYMLAGAAVPQELLLPIKKSLLHLSPSYFLHHPLQHL  126

Query  247  hyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
             ++  +  WY G+ AMDPEPGRCRRTDGKKWRCSRDV AG KYCERHMHRGRNRSRKPVE
Sbjct  127  PHYQPA--WYLGKTAMDPEPGRCRRTDGKKWRCSRDVFAGHKYCERHMHRGRNRSRKPVE  184



>ref|XP_002877892.1| hypothetical protein ARALYDRAFT_323835 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54151.1| hypothetical protein ARALYDRAFT_323835 [Arabidopsis lyrata subsp. 
lyrata]
Length=542

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 111/149 (74%), Gaps = 3/149 (2%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATT-KFPRMGGSYFSLGQWQELELQALIFRHMIAGAP  335
            LPLFV EP +S   +  S  +  +++ +F +MG ++FS  QWQELELQALI+R+M+AGA 
Sbjct  47   LPLFVPEPTSSSSFSCFSPDSSNSSSSRFLKMG-NFFSWAQWQELELQALIYRYMLAGAS  105

Query  334  VPPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKW  155
            VP ELL  +KKS  + +P +F H   Q+       + WYWGR AMDPEPGRC+RTDGKKW
Sbjct  106  VPQELLLPIKKSLIHQSPMHFLHHPLQHSFPLHQPS-WYWGRGAMDPEPGRCKRTDGKKW  164

Query  154  RCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            RCSRDVVAG KYC+RH+HRGRNRSRKPVE
Sbjct  165  RCSRDVVAGHKYCDRHIHRGRNRSRKPVE  193



>emb|CDY66284.1| BnaCnng50230D [Brassica napus]
Length=538

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 108/148 (73%), Gaps = 5/148 (3%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPV  332
            LPLFV EP TS   +    S  +++++  +MG + FSL QWQELELQALI+R+M+AGA V
Sbjct  44   LPLFVPEPTTSSSFS--CFSPDSSSSRLLKMG-NLFSLAQWQELELQALIYRYMLAGASV  100

Query  331  PPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWR  152
            P ELL  +KKS F+ +   F H   Q+   H    PWYWGR A+DPEPGRC+RTDGKKWR
Sbjct  101  PQELLLPIKKSLFHQSHLNFLHYPLQHNFPH--HQPWYWGRGAVDPEPGRCKRTDGKKWR  158

Query  151  CSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            CSR+VV   KYC+RH+HRGRNRSRKPVE
Sbjct  159  CSRNVVGSYKYCDRHIHRGRNRSRKPVE  186



>ref|XP_009148750.1| PREDICTED: growth-regulating factor 4-like isoform X2 [Brassica 
rapa]
Length=354

 Score =   158 bits (400),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 94/122 (77%), Gaps = 3/122 (2%)
 Frame = -2

Query  430  FPRMG-GSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhq  254
             PR+  G+ FSL QWQELELQALI+R+M+AGA VP ELL  +KKS F+ +   F H   Q
Sbjct  51   LPRLEMGNLFSLAQWQELELQALIYRYMLAGASVPQELLLPIKKSLFHQSHLNFLHYPLQ  110

Query  253  yphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKP  74
            +   H    PWYWGR A+DPEPGRC+RTDGKKWRCSRDVVA  KYC+RH+HRGRNRSRKP
Sbjct  111  HNFPHHQ--PWYWGRGAVDPEPGRCKRTDGKKWRCSRDVVASYKYCDRHIHRGRNRSRKP  168

Query  73   VE  68
            VE
Sbjct  169  VE  170



>emb|CAB86895.1| putative protein [Arabidopsis thaliana]
Length=548

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 112/150 (75%), Gaps = 4/150 (3%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATT--KFPRMGGSYFSLGQWQELELQALIFRHMIAGA  338
            LPLFV EP +S   +  S  +  +++  +F +MG ++FS  QWQELELQALI+R+M+AGA
Sbjct  47   LPLFVPEPTSSSSFSCFSPDSSNSSSSSRFLKMG-NFFSWAQWQELELQALIYRYMLAGA  105

Query  337  PVPPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKK  158
             VP ELL  +KKS  + +P +F H   Q+   H   + WYWGR AMDPEPGRC+RTDGKK
Sbjct  106  SVPQELLLPIKKSLLHQSPMHFLHHPLQHSFPHHQPS-WYWGRGAMDPEPGRCKRTDGKK  164

Query  157  WRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            WRCSRDVVAG KYC+RH+HRGRNRSRKPVE
Sbjct  165  WRCSRDVVAGHKYCDRHIHRGRNRSRKPVE  194



>ref|XP_010910363.1| PREDICTED: growth-regulating factor 3 isoform X1 [Elaeis guineensis]
Length=382

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 105/149 (70%), Gaps = 2/149 (1%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPV  332
            LPLF +E  T+  ++        + T  PR+GG YFSL QWQELELQALI+++MI+GA V
Sbjct  38   LPLFAAERKTTTHTSPLFSYPNLSPTGVPRVGG-YFSLAQWQELELQALIYKYMISGASV  96

Query  331  PPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWR  152
            P EL+  +K+S  N+ PYY     +Q+          YWGR  +DPEPGRCRRTDGKKWR
Sbjct  97   PVELILPIKRSLLNATPYYHHLHQYQHFQQPLLQT-GYWGRCVVDPEPGRCRRTDGKKWR  155

Query  151  CSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            CSR+VV GQKYCERH+HRGRNRSRK VEI
Sbjct  156  CSREVVTGQKYCERHVHRGRNRSRKHVEI  184



>ref|XP_009143588.1| PREDICTED: growth-regulating factor 3-like [Brassica rapa]
Length=388

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 125/181 (69%), Gaps = 17/181 (9%)
 Frame = -2

Query  607  SEAKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKF  428
            S AK+P+ V D                ++S+ALPLF  EP +SKLS+ S      ++++F
Sbjct  23   SAAKIPKHVYD----------QIQSHTATSTALPLFSPEPTSSKLSSLSQ----DSSSRF  68

Query  427  PRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyp  248
            P+MG S+FS  QWQELELQALI+R+M+AGA VP ELL  +KKS  + +P YF H   Q+ 
Sbjct  69   PKMG-SFFSWAQWQELELQALIYRYMLAGAAVPQELLLPIKKSLLHLSPSYFLHHPLQHL  127

Query  247  hyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
             ++  +  WY G+ AMDPEPGRCRRTDGKKWRCSRDV  G KYCERHMHRGRNRSRKPVE
Sbjct  128  PHYQPA--WYMGKGAMDPEPGRCRRTDGKKWRCSRDVFPGHKYCERHMHRGRNRSRKPVE  185

Query  67   I  65
             
Sbjct  186  T  186



>emb|CDX75039.1| BnaA05g07850D [Brassica napus]
Length=385

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 125/181 (69%), Gaps = 17/181 (9%)
 Frame = -2

Query  607  SEAKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKF  428
            S AK+P+ V D                ++S+ALPLF  EP +SKLS+ S      ++++F
Sbjct  23   SAAKIPKHVYD----------QIQSHTATSTALPLFSPEPTSSKLSSLSQ----DSSSRF  68

Query  427  PRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyp  248
            P+MG S+FS  QWQELELQALI+R+M+AGA VP ELL  +KKS  + +P YF +   Q+ 
Sbjct  69   PKMG-SFFSWAQWQELELQALIYRYMLAGAAVPQELLLPIKKSLLHLSPSYFLNHPLQHL  127

Query  247  hyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
             ++  +  WY G+ AMDPEPGRCRRTDGKKWRCSRDV  G KYCERHMHRGRNRSRKPVE
Sbjct  128  PHYQPA--WYMGKGAMDPEPGRCRRTDGKKWRCSRDVFPGHKYCERHMHRGRNRSRKPVE  185

Query  67   I  65
             
Sbjct  186  T  186



>ref|XP_006296027.1| hypothetical protein CARUB_v10025172mg [Capsella rubella]
 gb|EOA28925.1| hypothetical protein CARUB_v10025172mg [Capsella rubella]
Length=396

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 99/126 (79%), Gaps = 6/126 (5%)
 Frame = -2

Query  433  KFPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHL---VKKSPFNSApyyfphp  263
            +FP+MG S+FS  QWQELELQALI+R+M+AGA VP ELL L   +KKS  + +P YF H 
Sbjct  67   RFPKMG-SFFSSAQWQELELQALIYRYMLAGATVPQELLSLLLPIKKSLLHLSPSYFLHH  125

Query  262  lhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRS  83
              Q+  ++  +  WY GRAAMDPEPGRCRRTDGKKWRCSRDV AG KYCERHMHRGRNRS
Sbjct  126  PLQHLPHYQPA--WYLGRAAMDPEPGRCRRTDGKKWRCSRDVFAGHKYCERHMHRGRNRS  183

Query  82   RKPVEI  65
            RKPVE 
Sbjct  184  RKPVET  189



>ref|XP_010426922.1| PREDICTED: growth-regulating factor 4-like [Camelina sativa]
Length=396

 Score =   157 bits (396),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 109/145 (75%), Gaps = 2/145 (1%)
 Frame = -2

Query  502  FVSEPPTSKLSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPE  323
            FV EP +S   +  S  + ++++KF ++G + FS  QWQELELQALI+R+M+AGA VP E
Sbjct  52   FVPEPTSSSSFSCFSPDSSSSSSKFLKIG-NLFSWAQWQELELQALIYRYMLAGASVPQE  110

Query  322  LLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSR  143
            LL  +KKS  + +P +F H   Q+   H   + WYWGR AMDPEPGRC+RTDGKKWRCSR
Sbjct  111  LLLPIKKSLIHQSPMHFLHHPLQHSFPHQQPS-WYWGRGAMDPEPGRCKRTDGKKWRCSR  169

Query  142  DVVAGQKYCERHMHRGRNRSRKPVE  68
            DVVAG KYC+RH+HRGRNRSRKPVE
Sbjct  170  DVVAGHKYCDRHIHRGRNRSRKPVE  194



>emb|CDX84126.1| BnaC04g08880D [Brassica napus]
Length=392

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 121/181 (67%), Gaps = 17/181 (9%)
 Frame = -2

Query  607  SEAKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKF  428
            S AK+P+ V D                ++S+ALPLF  EP     ++  S  +  ++++F
Sbjct  25   SAAKIPKHVFD----------QIQSQTATSTALPLFSPEP----TASKLSSLSQDSSSRF  70

Query  427  PRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyp  248
            P++G S+FS  QWQELELQALI+R+M+AGA VP ELL  +KKS  + +P YF H   Q+ 
Sbjct  71   PKIG-SFFSWAQWQELELQALIYRYMLAGAAVPQELLLPIKKSLLHLSPSYFLHHPLQHL  129

Query  247  hyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
             ++  +  WY G+ AMDPEPGRCRRTDGKKWRCSRD   G KYCERHMHRGRNRSRKPVE
Sbjct  130  PHYQPA--WYMGKGAMDPEPGRCRRTDGKKWRCSRDAFPGHKYCERHMHRGRNRSRKPVE  187

Query  67   I  65
             
Sbjct  188  T  188



>gb|AAO24537.1| At3g52910 [Arabidopsis thaliana]
 dbj|BAE99705.1| hypothetical protein [Arabidopsis thaliana]
Length=196

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 108/147 (73%), Gaps = 4/147 (3%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTATT--KFPRMGGSYFSLGQWQELELQALIFRHMIAGA  338
            LPLFV EP +S   +  S  +  +++  +F +MG ++FS  QWQELELQALI+R+M+AGA
Sbjct  47   LPLFVPEPTSSSSFSCFSPDSSNSSSSSRFLKMG-NFFSWAQWQELELQALIYRYMLAGA  105

Query  337  PVPPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKK  158
             VP ELL  +KKS  + +P +F H   Q+   H   + WYWGR AMDPEPGRC+RTDGKK
Sbjct  106  SVPQELLLPIKKSLLHQSPMHFLHHPLQHSFPHHQPS-WYWGRGAMDPEPGRCKRTDGKK  164

Query  157  WRCSRDVVAGQKYCERHMHRGRNRSRK  77
            WRCSRDVVAG KYC+RH+HRGRNRS K
Sbjct  165  WRCSRDVVAGHKYCDRHIHRGRNRSMK  191



>ref|XP_010515769.1| PREDICTED: growth-regulating factor 4 [Camelina sativa]
Length=394

 Score =   153 bits (387),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 92/116 (79%), Gaps = 1/116 (1%)
 Frame = -2

Query  415  GSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhP  236
            G+ FS  QWQELELQALI+R+M+AGA VP ELL  +KKS  + +P +F H   Q+   H 
Sbjct  79   GNLFSWTQWQELELQALIYRYMLAGASVPQELLLPIKKSLIHQSPMHFLHHPLQHSFPHQ  138

Query  235  ASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              + WYWGR AMDPEPGRC+RTDGKKWRCSRDVVAG KYC+RH+HRGRNRSRKPVE
Sbjct  139  QPS-WYWGRGAMDPEPGRCKRTDGKKWRCSRDVVAGHKYCDRHIHRGRNRSRKPVE  193



>ref|XP_009393370.1| PREDICTED: growth-regulating factor 3 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393371.1| PREDICTED: growth-regulating factor 3 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393372.1| PREDICTED: growth-regulating factor 3 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393373.1| PREDICTED: growth-regulating factor 3 [Musa acuminata subsp. 
malaccensis]
Length=380

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 102/152 (67%), Gaps = 10/152 (7%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTPTAT---TKFPRMGGSYFSLGQWQELELQALIFRHMIAG  341
            L LF  EP     S F   +T  AT   + FPR+G  YF+L QWQELELQALI+++MIAG
Sbjct  36   LSLFAPEP----CSGFHKTTTTIATPSLSSFPRIG--YFTLAQWQELELQALIYKYMIAG  89

Query  340  APVPPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGK  161
              VP EL+  +K+S   SA  Y+ HP               WGR ++DPEPGRCRRTDGK
Sbjct  90   VSVPLELILPIKRS-LLSASPYYHHPELYQHLQPSLMQGVSWGRCSVDPEPGRCRRTDGK  148

Query  160  KWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            KWRCSR+VV GQKYCERH+HRGRNRSRK VEI
Sbjct  149  KWRCSREVVVGQKYCERHVHRGRNRSRKHVEI  180



>ref|XP_007145239.1| hypothetical protein PHAVU_007G222300g [Phaseolus vulgaris]
 gb|ESW17233.1| hypothetical protein PHAVU_007G222300g [Phaseolus vulgaris]
Length=325

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 101/150 (67%), Gaps = 8/150 (5%)
 Frame = -2

Query  511  LPLFVSEPPTSK--LSAFSSDSTPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGA  338
            LPLF+ +P T    L +FS  + P+A  +FPR   S FS  Q QELELQ+LIFR+M A A
Sbjct  38   LPLFLPQPSTKVIILPSFSDSTLPSAPPRFPR-KESCFSFAQRQELELQSLIFRYMQADA  96

Query  337  PVPPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKK  158
            PVPP+LL  +KKS  +     +P       H     + +YW R A DPEPGRCRRTDGKK
Sbjct  97   PVPPQLLQPIKKSFLH-----YPPLFLHLYHPALLESGYYWRREAEDPEPGRCRRTDGKK  151

Query  157  WRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            WRCSR+ +  QKYC+RHMHRGRNRSRKPVE
Sbjct  152  WRCSREAMDDQKYCQRHMHRGRNRSRKPVE  181



>ref|XP_008793976.1| PREDICTED: growth-regulating factor 3 [Phoenix dactylifera]
Length=385

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 106/150 (71%), Gaps = 3/150 (2%)
 Frame = -2

Query  511  LPLFVSEPPTSKLSAFSSDSTP-TATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAP  335
            L LF +E  T+        S+P +A T  P+ GG YFSL QWQELELQALI+++MI+GA 
Sbjct  38   LHLFAAERKTTTTHTCPLFSSPISAPTAVPKAGG-YFSLAQWQELELQALIYKYMISGAS  96

Query  334  VPPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKW  155
            +P EL+  +K+S  ++ PYY  H  +Q+          YWGR  +DPEPGRCRRTDGKKW
Sbjct  97   LPMELILPIKRSLLDATPYYHHHHHYQHFQQPMLQTG-YWGRYVVDPEPGRCRRTDGKKW  155

Query  154  RCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            RCSR+VV GQKYCERH+HRGRNRSRK VEI
Sbjct  156  RCSREVVTGQKYCERHVHRGRNRSRKHVEI  185



>ref|XP_009411969.1| PREDICTED: growth-regulating factor 3-like [Musa acuminata subsp. 
malaccensis]
Length=366

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 89/122 (73%), Gaps = 3/122 (2%)
 Frame = -2

Query  430  FPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqy  251
            FPR+G  YF+L QWQELELQALI+++MIAG  VP EL+  +K S   ++P+     L+  
Sbjct  54   FPRIG--YFTLAQWQELELQALIYKYMIAGVSVPLELVLPIKTSLLGASPFSHRPQLYHQ  111

Query  250  phyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPV  71
                      YWGR  +DPEPGRCRRTDGKKWRCSR+VV GQKYCERH+HRGRNRSRK V
Sbjct  112  LQPSWLQTG-YWGRWVVDPEPGRCRRTDGKKWRCSREVVVGQKYCERHVHRGRNRSRKHV  170

Query  70   EI  65
            EI
Sbjct  171  EI  172



>ref|XP_010910364.1| PREDICTED: growth-regulating factor 3 isoform X2 [Elaeis guineensis]
Length=311

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
             SL QWQELELQALI+++MI+GA VP EL+  +K+S  N+ PYY     +Q+        
Sbjct  1    MSLAQWQELELQALIYKYMISGASVPVELILPIKRSLLNATPYYHHLHQYQHFQQPLLQT  60

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
              YWGR  +DPEPGRCRRTDGKKWRCSR+VV GQKYCERH+HRGRNRSRK VEI
Sbjct  61   -GYWGRCVVDPEPGRCRRTDGKKWRCSREVVTGQKYCERHVHRGRNRSRKHVEI  113



>emb|CDY43721.1| BnaAnng07360D [Brassica napus]
Length=355

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 109/169 (64%), Gaps = 20/169 (12%)
 Frame = -2

Query  607  SEAKVPRLVLDLhsttttashggggggssssALPLFVSEPPTSKLSAFSSDSTPTATTKF  428
            S AK+P+ V D                ++S+ALPLF  +P  SKLS+     +  ++ +F
Sbjct  21   SAAKIPKHVFD----------QFQPQTAASTALPLFTPDPTPSKLSS----LSADSSARF  66

Query  427  PRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyp  248
            P+MG S+FS  QWQELELQALI+R+M+AGA VP ELL  +KKS  + +P YF H    + 
Sbjct  67   PKMG-SFFSWAQWQELELQALIYRYMLAGAAVPQELLLPIKKSLLHLSPSYFLHQHLPHY  125

Query  247  hyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMH  101
                    WY GR AMDPEPGRCRRTDGKKWRCSRDV AG KYCERHMH
Sbjct  126  QPA-----WYLGRGAMDPEPGRCRRTDGKKWRCSRDVFAGHKYCERHMH  169



>gb|EYU38620.1| hypothetical protein MIMGU_mgv1a011592mg [Erythranthe guttata]
Length=277

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 74/97 (76%), Gaps = 3/97 (3%)
 Frame = -2

Query  352  MIAGAPVPPELLHLVKKSPF-NSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCR  176
            MIAGA VPPELLHLVKKS   N  P  + H    Y      S   YWG++AMDPEPGRCR
Sbjct  1    MIAGATVPPELLHLVKKSIIVNYPPSSYHHYYPHYQPALLQSG--YWGKSAMDPEPGRCR  58

Query  175  RTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            RTDGKKWRCSRDVVAG KYCERHMHRGRNRSRKPVEI
Sbjct  59   RTDGKKWRCSRDVVAGHKYCERHMHRGRNRSRKPVEI  95



>gb|KGN63355.1| hypothetical protein Csa_2G432230 [Cucumis sativus]
Length=337

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 83/118 (70%), Gaps = 9/118 (8%)
 Frame = -2

Query  421  MGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphy  242
            M  S F++ QWQELELQALIF+ M+AG PVPPEL+ L++KS F S  + F H        
Sbjct  27   MNRSPFTVLQWQELELQALIFKFMMAGQPVPPELVLLIQKS-FESISHRFFHQPTMAYCS  85

Query  241  hPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
                   ++G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  86   -------FYGKK-VDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  135



>ref|XP_008462790.1| PREDICTED: growth-regulating factor 4-like [Cucumis melo]
Length=337

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 83/118 (70%), Gaps = 9/118 (8%)
 Frame = -2

Query  421  MGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphy  242
            M  S F++ QWQELELQALIF+ M+AG PVPPEL+ L++KS F S  + F H        
Sbjct  27   MNRSPFTVLQWQELELQALIFKFMMAGQPVPPELVLLIQKS-FESISHRFFHHPTMAYCS  85

Query  241  hPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
                   ++G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  86   -------FYGKK-VDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  135



>ref|XP_004151910.1| PREDICTED: growth-regulating factor 3-like [Cucumis sativus]
 ref|XP_004156783.1| PREDICTED: growth-regulating factor 3-like [Cucumis sativus]
Length=336

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 83/118 (70%), Gaps = 9/118 (8%)
 Frame = -2

Query  421  MGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphy  242
            M  S F++ QWQELELQALIF+ M+AG PVPPEL+ L++KS F S  + F H        
Sbjct  27   MNRSPFTVLQWQELELQALIFKFMMAGQPVPPELVLLIQKS-FESISHRFFHHPTMAYCS  85

Query  241  hPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
                   ++G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  86   -------FYGKK-VDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  135



>ref|XP_004148588.1| PREDICTED: growth-regulating factor 5-like [Cucumis sativus]
 gb|KGN58502.1| hypothetical protein Csa_3G651860 [Cucumis sativus]
Length=351

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 79/127 (62%), Gaps = 17/127 (13%)
 Frame = -2

Query  427  PRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyp  248
            P+   S F+  QWQELE QALIF+HM++G P+PP+L+  VK+S  +S             
Sbjct  5    PKTCTSPFTATQWQELEHQALIFKHMVSGVPIPPDLIFSVKRSLDSSISARLF-------  57

Query  247  hyhPASAPWYWGRAAM------DPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNR  86
                   P  WG   M      DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNR
Sbjct  58   ----PHQPIGWGCFEMGFGRKTDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNR  113

Query  85   SRKPVEI  65
            SRKPVEI
Sbjct  114  SRKPVEI  120



>ref|XP_010255823.1| PREDICTED: growth-regulating factor 4-like [Nelumbo nucifera]
Length=349

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 79/114 (69%), Gaps = 9/114 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALIF++++AG PVPPEL+H ++KS F S    F H             
Sbjct  16   FTALQWQELEHQALIFKYLMAGLPVPPELVHPIRKS-FESMSARFFHHPSMGYCS-----  69

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
              ++G+ A DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE 
Sbjct  70   --FYGKKA-DPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVET  120



>gb|KEH17760.1| growth-regulating factor [Medicago truncatula]
Length=337

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 79/113 (70%), Gaps = 6/113 (5%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F++ QWQELE QALIF++M+AG PVPP+L+H     P +S+ +        +      S 
Sbjct  26   FTVSQWQELEHQALIFKYMVAGLPVPPDLVH-----PIHSSFHSLSSNNFFHHPIPTLSY  80

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVE
Sbjct  81   CSFYGKK-VDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE  132



>gb|KJB80998.1| hypothetical protein B456_013G184200 [Gossypium raimondii]
 gb|KJB80999.1| hypothetical protein B456_013G184200 [Gossypium raimondii]
Length=201

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 81/119 (68%), Gaps = 9/119 (8%)
 Frame = -2

Query  424  RMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyph  245
            R   S F++ QWQELE QALIF++M+AG PVPP+L+  ++KS F S    F H       
Sbjct  23   RSSSSPFTVSQWQELEHQALIFKYMMAGLPVPPDLVLPIQKS-FESISQRFFHHPTMGYC  81

Query  244  yhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
                    ++G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  82   S-------FYGKK-VDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  132



>ref|XP_008463996.1| PREDICTED: growth-regulating factor 5 isoform X2 [Cucumis melo]
Length=342

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 79/127 (62%), Gaps = 17/127 (13%)
 Frame = -2

Query  427  PRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyp  248
            P+   S F+  QWQELE QALIF+HM++G P+PP+L+  VK+S  +S             
Sbjct  5    PKTCTSPFTATQWQELEHQALIFKHMVSGVPIPPDLIFSVKRSLDSSISARLF-------  57

Query  247  hyhPASAPWYWGRAAM------DPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNR  86
                   P  WG   M      DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNR
Sbjct  58   ----PHQPIGWGCFEMGFGRKTDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNR  113

Query  85   SRKPVEI  65
            SRKPVEI
Sbjct  114  SRKPVEI  120



>ref|XP_008463995.1| PREDICTED: growth-regulating factor 5 isoform X1 [Cucumis melo]
Length=350

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 79/127 (62%), Gaps = 17/127 (13%)
 Frame = -2

Query  427  PRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyp  248
            P+   S F+  QWQELE QALIF+HM++G P+PP+L+  VK+S  +S             
Sbjct  5    PKTCTSPFTATQWQELEHQALIFKHMVSGVPIPPDLIFSVKRSLDSSISARLF-------  57

Query  247  hyhPASAPWYWGRAAM------DPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNR  86
                   P  WG   M      DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNR
Sbjct  58   ----PHQPIGWGCFEMGFGRKTDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNR  113

Query  85   SRKPVEI  65
            SRKPVEI
Sbjct  114  SRKPVEI  120



>ref|XP_004165889.1| PREDICTED: growth-regulating factor 5-like [Cucumis sativus]
Length=383

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 79/127 (62%), Gaps = 17/127 (13%)
 Frame = -2

Query  427  PRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyp  248
            P+   S F+  QWQELE QALIF+HM++G P+PP+L+  VK+S  +S             
Sbjct  5    PKTCTSPFTATQWQELEHQALIFKHMVSGVPIPPDLIFSVKRSLDSSISARLF-------  57

Query  247  hyhPASAPWYWGRAAM------DPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNR  86
                   P  WG   M      DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNR
Sbjct  58   ----PHQPIGWGCFEMGFGRKTDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNR  113

Query  85   SRKPVEI  65
            SRKPVEI
Sbjct  114  SRKPVEI  120



>gb|KHN46482.1| hypothetical protein glysoja_035158 [Glycine soja]
Length=323

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 83/121 (69%), Gaps = 8/121 (7%)
 Frame = -2

Query  430  FPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqy  251
            F   G S F++ QWQELE QALIF++M+AG PVPP+L+  ++KS F+S   +        
Sbjct  3    FSSNGRSPFTVSQWQELEHQALIFKYMVAGLPVPPDLVLPIQKS-FDSTLSHAFFHHPTL  61

Query  250  phyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPV  71
                  S   ++G+  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPV
Sbjct  62   ------SYCSFYGKK-VDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPV  114

Query  70   E  68
            E
Sbjct  115  E  115



>ref|XP_003540042.1| PREDICTED: growth-regulating factor 4-like [Glycine max]
Length=327

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 83/121 (69%), Gaps = 8/121 (7%)
 Frame = -2

Query  430  FPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqy  251
            F   G S F++ QWQELE QALIF++M+AG PVPP+L+  ++KS F+S   +        
Sbjct  13   FSSNGRSPFTVSQWQELEHQALIFKYMVAGLPVPPDLVLPIQKS-FDSTLSHAFFHHPTL  71

Query  250  phyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPV  71
                  S   ++G+  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPV
Sbjct  72   ------SYCSFYGKK-VDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPV  124

Query  70   E  68
            E
Sbjct  125  E  125



>ref|XP_009413829.1| PREDICTED: growth-regulating factor 1-like, partial [Musa acuminata 
subsp. malaccensis]
Length=141

 Score =   124 bits (312),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 81/120 (68%), Gaps = 4/120 (3%)
 Frame = -2

Query  418  GGSY--FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyph  245
            GGS   F+  QWQELELQALIF++M++G PVPP+L+  +++S F         P      
Sbjct  8    GGSRYPFTASQWQELELQALIFKYMVSGIPVPPDLILCIRRSLFVEPQTLPFLPHRPTVG  67

Query  244  yhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            +         GR A+DPEPGRCRRTDGKKWRCS++     KYCERHMHRG++RSRKPVE+
Sbjct  68   WEAYQV--GDGRKAVDPEPGRCRRTDGKKWRCSKEAFPDSKYCERHMHRGKSRSRKPVEL  125



>ref|XP_010273921.1| PREDICTED: growth-regulating factor 1 isoform X2 [Nelumbo nucifera]
Length=372

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 76/124 (61%), Gaps = 17/124 (14%)
 Frame = -2

Query  418  GGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyh  239
             GS F+  QWQELE QALIF++M++G PVPPEL+  +K+S                    
Sbjct  6    NGSPFTASQWQELEHQALIFKYMVSGVPVPPELIFPIKRS-----------LDASISSRL  54

Query  238  PASAPWYWGRAAM------DPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRK  77
                P  WG   M      DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRK
Sbjct  55   FPHQPIGWGCFQMGFGRKPDPEPGRCRRTDGKKWRCSKEAFPDSKYCERHMHRGRNRSRK  114

Query  76   PVEI  65
            PVE+
Sbjct  115  PVEV  118



>gb|EPS59351.1| hypothetical protein M569_15457, partial [Genlisea aurea]
Length=138

 Score =   124 bits (310),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 81/113 (72%), Gaps = 2/113 (2%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+ GQWQELE QA+I+++++AG PVP +L+  +K+S F++    F H  H + H      
Sbjct  14   FTAGQWQELEHQAMIYKYLVAGVPVPADLVLPIKRS-FDAISARFFHHHHHHHHPSLGYV  72

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              Y+G+   DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  73   SSYYGKK-FDPEPGRCRRTDGKKWRCSKDAHPDSKYCERHMHRGRNRSRKPVE  124



>ref|XP_006851561.1| hypothetical protein AMTR_s00040p00189460 [Amborella trichopoda]
 gb|ERN13142.1| hypothetical protein AMTR_s00040p00189460 [Amborella trichopoda]
Length=414

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 97/154 (63%), Gaps = 18/154 (12%)
 Frame = -2

Query  499  VSEPPTSKLSAFSSDSTPTATT----KFPRMG------GSYFSLGQWQELELQALIFRHM  350
             SE P S L  F  DST   +     K PR+G       S F++ QW ELE QALIF++M
Sbjct  31   ASEAPPSALPLFVRDSTSVLSLSDAFKSPRLGVMGQVSRSPFNMAQWHELEQQALIFKYM  90

Query  349  IAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRT  170
            +AGAPVP +L+  ++ S      +Y P+  +Q            +GR+ +D EPGRCRRT
Sbjct  91   MAGAPVPLDLVLPIRSSVLGLPSFYHPYHHYQPSILQ-------FGRS-IDAEPGRCRRT  142

Query  169  DGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            DGKKWRCSR+VV G KYCERHMHRGRNRSRKPVE
Sbjct  143  DGKKWRCSREVVNGHKYCERHMHRGRNRSRKPVE  176



>ref|XP_010933923.1| PREDICTED: growth-regulating factor 10-like [Elaeis guineensis]
Length=260

 Score =   127 bits (318),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 92/156 (59%), Gaps = 20/156 (13%)
 Frame = -2

Query  490  PPTSKLSAFSSDSTPTATTKFP---------------RMGGSYFSLGQWQELELQALIFR  356
            PPTSK+   SSD++   T   P                     F+  Q QELE QALI++
Sbjct  22   PPTSKIPRLSSDASGVVTMAAPSPLGLGLGLRLGLGGGYSRPAFTFMQLQELEHQALIYK  81

Query  355  HMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCR  176
            +M+AG PVP   LHLV   P   +     +  H YP +    +  +  R +M+PEPGRCR
Sbjct  82   YMVAGVPVP---LHLVL--PIWKSVAASSYGPHHYPSFMGYGSLCFDYRNSMEPEPGRCR  136

Query  175  RTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            RTDGKKWRCSRDVV  QKYCERHMHRGRNRSRKPVE
Sbjct  137  RTDGKKWRCSRDVVPDQKYCERHMHRGRNRSRKPVE  172



>ref|XP_010261922.1| PREDICTED: growth-regulating factor 1-like [Nelumbo nucifera]
Length=372

 Score =   129 bits (324),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 77/124 (62%), Gaps = 17/124 (14%)
 Frame = -2

Query  418  GGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyh  239
             GS F+  QWQELE QALIF++M++G P+PP+L+  +K+S                    
Sbjct  5    SGSPFTASQWQELEHQALIFKYMVSGVPIPPDLIFPIKRS-----------MDASVSSRL  53

Query  238  PASAPWYWGRAAM------DPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRK  77
             +  P  WG   M      DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRK
Sbjct  54   FSHQPIGWGCFQMSFSRKADPEPGRCRRTDGKKWRCSKEACPDSKYCERHMHRGRNRSRK  113

Query  76   PVEI  65
            PVE+
Sbjct  114  PVEV  117



>ref|XP_004307837.1| PREDICTED: growth-regulating factor 4-like [Fragaria vesca subsp. 
vesca]
Length=334

 Score =   128 bits (321),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 82/113 (73%), Gaps = 10/113 (9%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F++ QWQELE QALIF++M+AG PVPP+L+  ++KS F+S    F HP   Y        
Sbjct  31   FTVSQWQELEHQALIFKYMMAGMPVPPDLVLPIQKS-FDSISQRFFHPSMGYCS------  83

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  84   --FYGKK-VDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  133



>gb|KJB81001.1| hypothetical protein B456_013G184200 [Gossypium raimondii]
Length=331

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 81/119 (68%), Gaps = 9/119 (8%)
 Frame = -2

Query  424  RMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyph  245
            R   S F++ QWQELE QALIF++M+AG PVPP+L+  ++KS F S    F H       
Sbjct  23   RSSSSPFTVSQWQELEHQALIFKYMMAGLPVPPDLVLPIQKS-FESISQRFFHHPTMGYC  81

Query  244  yhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
                    ++G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  82   S-------FYGKK-VDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  132



>ref|XP_010273920.1| PREDICTED: growth-regulating factor 1 isoform X1 [Nelumbo nucifera]
Length=423

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 76/124 (61%), Gaps = 17/124 (14%)
 Frame = -2

Query  418  GGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyh  239
             GS F+  QWQELE QALIF++M++G PVPPEL+  +K+S                    
Sbjct  6    NGSPFTASQWQELEHQALIFKYMVSGVPVPPELIFPIKRS-----------LDASISSRL  54

Query  238  PASAPWYWGRAAM------DPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRK  77
                P  WG   M      DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRK
Sbjct  55   FPHQPIGWGCFQMGFGRKPDPEPGRCRRTDGKKWRCSKEAFPDSKYCERHMHRGRNRSRK  114

Query  76   PVEI  65
            PVE+
Sbjct  115  PVEV  118



>ref|XP_006437422.1| hypothetical protein CICLE_v10032065mg [Citrus clementina]
 ref|XP_006484683.1| PREDICTED: growth-regulating factor 4-like [Citrus sinensis]
 ref|XP_006484684.1| PREDICTED: growth-regulating factor 4-like [Citrus sinensis]
 gb|ESR50662.1| hypothetical protein CICLE_v10032065mg [Citrus clementina]
Length=332

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 80/113 (71%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F++ QWQELE QALIF++M+AG PVPP+L+  ++KS F S  + F H             
Sbjct  26   FTVSQWQELEHQALIFKYMVAGLPVPPDLVLPIQKS-FESISHRFFHHPTMGYCS-----  79

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  80   --FYGKK-VDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  129



>ref|XP_011036429.1| PREDICTED: growth-regulating factor 5-like [Populus euphratica]
Length=339

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 77/114 (68%), Gaps = 5/114 (4%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QW ELE QALI+++M++G PVPPELL+ VK+S  +S                 A  
Sbjct  13   FTATQWHELEHQALIYKYMVSGVPVPPELLYSVKRSLESSLASRLFPHQPTGWVCFQAGV  72

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
                GR A DPEPGRCRRTDGKKWRCS++V    KYCERHMHRGRNRSRKPVE+
Sbjct  73   ----GRKA-DPEPGRCRRTDGKKWRCSKEVYPDSKYCERHMHRGRNRSRKPVEL  121



>ref|XP_010086824.1| hypothetical protein L484_009597 [Morus notabilis]
 gb|EXB23834.1| hypothetical protein L484_009597 [Morus notabilis]
Length=378

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 77/120 (64%), Gaps = 17/120 (14%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALIF++M++G P+PP+L++ VK+S               +     +  
Sbjct  14   FTATQWQELEHQALIFKYMVSGVPIPPDLIYSVKRS-----------LDSSFSSRLFSHH  62

Query  226  PWYWGRAAM------DPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            P  WG   M      DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVE+
Sbjct  63   PTGWGCFEMGFGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVEV  122



>gb|KDO48006.1| hypothetical protein CISIN_1g020051mg [Citrus sinensis]
Length=332

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 80/113 (71%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F++ QWQELE QALIF++M+AG PVPP+L+  ++KS F S  + F H             
Sbjct  26   FTVSQWQELEHQALIFKYMVAGLPVPPDLVLPIQKS-FESISHRFFHHPTMGYCS-----  79

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  80   --FYGKK-VDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  129



>gb|EPS64309.1| hypothetical protein M569_10478, partial [Genlisea aurea]
Length=158

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 79/114 (69%), Gaps = 4/114 (4%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QAL++++MI+G P+PP+LL  +++S  +S           +  +H    
Sbjct  12   FTASQWQELEHQALVYKYMISGIPIPPDLLFTIRRSLDSSTFLLPQPQQIGWSGFHMGMG  71

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
               +GR  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVEI
Sbjct  72   ---FGRK-IDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVEI  121



>ref|XP_008234521.1| PREDICTED: growth-regulating factor 4-like [Prunus mume]
Length=329

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 78/113 (69%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F++ QWQELE QALIF++M+AG PVPP+L+  ++KS F S      H             
Sbjct  26   FTVSQWQELEHQALIFKYMMAGMPVPPDLVLPIQKS-FESISQRLFHHPTMGYCS-----  79

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  80   --FYGKK-VDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  129



>gb|KHG06614.1| dna double-strand break repair rad50 atpase [Gossypium arboreum]
Length=308

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 80/113 (71%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F++ QWQELE QALIF++M+AG PVPP+L+  ++KS F S  + F H             
Sbjct  9    FTVSQWQELEHQALIFKYMMAGLPVPPDLVLPIQKS-FESISHRFFHHPTMGYCS-----  62

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  63   --FYGKK-VDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  112



>ref|XP_008450915.1| PREDICTED: growth-regulating factor 4-like [Cucumis melo]
Length=334

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 77/120 (64%), Gaps = 14/120 (12%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALIF++M++G P+PPELL  +K+S  +S       P H          
Sbjct  9    FTSAQWQELEHQALIFKYMVSGIPIPPELLFSIKRSALDSPFTSKLFPHHP--------Q  60

Query  226  PWYWGRAAM------DPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            P  W    M      DPEPGRCRRTDGKKWRCS++     KYCERHMHRG+NRSRKPV++
Sbjct  61   PVGWNYLQMSLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVDV  120



>ref|XP_007219489.1| hypothetical protein PRUPE_ppa022199mg [Prunus persica]
 gb|EMJ20688.1| hypothetical protein PRUPE_ppa022199mg [Prunus persica]
Length=332

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 79/113 (70%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F++ QWQELE QALIF++M+AG PVPP+L+  ++KS F S    F H             
Sbjct  28   FTVSQWQELEHQALIFKYMMAGMPVPPDLVLPIQKS-FESISQRFFHHPTMGYCS-----  81

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  82   --FYGKK-VDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  131



>gb|KJB18524.1| hypothetical protein B456_003G057700 [Gossypium raimondii]
Length=330

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 80/113 (71%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F++ QWQELE QALIF++M+AG PVPP+L+  ++KS F S  + F H             
Sbjct  32   FTVSQWQELEHQALIFKYMMAGLPVPPDLVLPIQKS-FESISHRFFHHPTMGYCS-----  85

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  86   --FYGKK-VDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  135



>ref|XP_003627270.1| GRL2 [Medicago truncatula]
Length=231

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 76/122 (62%), Gaps = 17/122 (14%)
 Frame = -2

Query  412  SYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPA  233
            S F+  QWQELE QAL+F++M+ G P+PP+L++ +K+S   S                  
Sbjct  10   SLFTPNQWQELEQQALVFKYMVTGTPIPPDLIYSIKRSLDTSISSRIF-----------P  58

Query  232  SAPWYWGRAAM------DPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPV  71
              P  WG   M      DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPV
Sbjct  59   HPPIGWGCFEMGFGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPV  118

Query  70   EI  65
            E+
Sbjct  119  EL  120



>gb|KJB81000.1| hypothetical protein B456_013G184200 [Gossypium raimondii]
Length=251

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 81/119 (68%), Gaps = 9/119 (8%)
 Frame = -2

Query  424  RMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyph  245
            R   S F++ QWQELE QALIF++M+AG PVPP+L+  ++KS F S    F H       
Sbjct  23   RSSSSPFTVSQWQELEHQALIFKYMMAGLPVPPDLVLPIQKS-FESISQRFFHHPTMGYC  81

Query  244  yhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
                    ++G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  82   S-------FYGKK-VDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  132



>gb|KJB18523.1| hypothetical protein B456_003G057700 [Gossypium raimondii]
Length=337

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 80/113 (71%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F++ QWQELE QALIF++M+AG PVPP+L+  ++KS F S  + F H             
Sbjct  32   FTVSQWQELEHQALIFKYMMAGLPVPPDLVLPIQKS-FESISHRFFHHPTMGYCS-----  85

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  86   --FYGKK-VDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  135



>gb|KHG13640.1| dna double-strand break repair rad50 atpase [Gossypium arboreum]
Length=334

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 80/113 (71%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F++ QWQELE QALIF++M+AG PVPP+L+  ++KS F S  + F H             
Sbjct  32   FTVSQWQELEHQALIFKYMMAGLPVPPDLVLPIQKS-FESISHRFFHHPTMGYCS-----  85

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  86   --FYGKK-VDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  135



>gb|KDP39549.1| hypothetical protein JCGZ_02569 [Jatropha curcas]
Length=340

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 80/113 (71%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F++ QWQELE QALIF++M+AG PVPP+L+  ++KS F S  + F H             
Sbjct  36   FTVSQWQELEHQALIFKYMMAGLPVPPDLVLPIQKS-FESISHRFFHHPTVGYCS-----  89

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  90   --FYGKK-VDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  139



>ref|XP_006375983.1| hypothetical protein POPTR_0013s07500g [Populus trichocarpa]
 gb|ERP53780.1| hypothetical protein POPTR_0013s07500g [Populus trichocarpa]
Length=340

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 81/113 (72%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F++ QWQELE QALI+++M+AG PVPP+L+  +++S F S  + F H           S 
Sbjct  37   FTVSQWQELEHQALIYKYMVAGLPVPPDLVLPIQRS-FESISHRFFHHPT-------MSY  88

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  89   CTFYGKK-VDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  140



>ref|XP_003529835.1| PREDICTED: growth-regulating factor 5-like [Glycine max]
Length=345

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 74/120 (62%), Gaps = 17/120 (14%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QAL+F++M+ G P+PP+L++ +K+S                        
Sbjct  12   FTQTQWQELEHQALVFKYMVTGTPIPPDLIYSIKRS-----------LDTSISSRLFPHH  60

Query  226  PWYWGRAAM------DPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            P  WG   M      DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVE+
Sbjct  61   PIGWGCFEMGFGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVEV  120



>ref|XP_011044430.1| PREDICTED: growth-regulating factor 4-like [Populus euphratica]
Length=340

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 81/113 (72%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F++ QWQELE QALI+++M+AG PVPP+L+  +++S F S  + F H           S 
Sbjct  37   FTVSQWQELEHQALIYKYMVAGLPVPPDLVLPIQRS-FESISHRFFHHPT-------MSY  88

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  89   CTFYGKK-VDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  140



>gb|KDO53514.1| hypothetical protein CISIN_1g023105mg [Citrus sinensis]
Length=287

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 82/128 (64%), Gaps = 7/128 (5%)
 Frame = -2

Query  445  TATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfph  266
            +A  +FP      F+  QWQELE QALIF++M++G PVPP+LL  +K+S +         
Sbjct  9    SAINRFP------FTASQWQELEHQALIFKYMVSGIPVPPDLLFTIKRSYYFDRSPPSAA  62

Query  265  plhqyphyhPASAPWYWGRA-AMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRN  89
                + H H     +  G    +DPEPGRCRRTDGKKWRCS++     KYCERHMHRG+N
Sbjct  63   KHFTHQHQHVEWNCFQVGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKN  122

Query  88   RSRKPVEI  65
            RSRKPVE+
Sbjct  123  RSRKPVEL  130



>gb|KHN34128.1| hypothetical protein glysoja_038617 [Glycine soja]
Length=310

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 80/113 (71%), Gaps = 7/113 (6%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F++ QWQELE QALI+++M+AG PVPP+L+  ++ S F+S    F H           S 
Sbjct  6    FTMSQWQELEHQALIYKYMVAGLPVPPDLVLPIQNS-FHSISQTFLHHPSTT-----MSY  59

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVE
Sbjct  60   CSFYGKK-VDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE  111



>ref|XP_007029701.1| Growth-regulating factor 5 [Theobroma cacao]
 gb|EOY10203.1| Growth-regulating factor 5 [Theobroma cacao]
Length=348

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 81/118 (69%), Gaps = 3/118 (3%)
 Frame = -2

Query  421  MGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphy  242
            M  S F++ QWQELE QALIF++M+AG PVP +L+  ++KS F S  + F H       +
Sbjct  33   MRSSPFTVSQWQELEHQALIFKYMMAGLPVPHDLVLPIQKS-FESISHRFFHHPTIECDF  91

Query  241  hPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
                  +Y  +  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  92   AVGYCSFYGKK--VDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  147



>ref|XP_006490823.1| PREDICTED: growth-regulating factor 5-like isoform X2 [Citrus 
sinensis]
Length=291

 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 82/128 (64%), Gaps = 7/128 (5%)
 Frame = -2

Query  445  TATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfph  266
            +A  +FP      F+  QWQELE QALIF++M++G PVPP+LL  +K+S +         
Sbjct  9    SAINRFP------FTASQWQELEHQALIFKYMVSGIPVPPDLLFTIKRSYYFDRSPPSAA  62

Query  265  plhqyphyhPASAPWYWGRA-AMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRN  89
                + H H     +  G    +DPEPGRCRRTDGKKWRCS++     KYCERHMHRG+N
Sbjct  63   KHFTHQHQHVEWNCFQVGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKN  122

Query  88   RSRKPVEI  65
            RSRKPVE+
Sbjct  123  RSRKPVEL  130



>ref|XP_007135443.1| hypothetical protein PHAVU_010G130000g [Phaseolus vulgaris]
 gb|ESW07437.1| hypothetical protein PHAVU_010G130000g [Phaseolus vulgaris]
Length=339

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 76/120 (63%), Gaps = 17/120 (14%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QAL+F++M+ G P+PP+L++ +K+S  +S                    
Sbjct  14   FTPTQWQELEQQALVFKYMVTGTPIPPDLIYSIKRSLDSSISSRLFPHH-----------  62

Query  226  PWYWGRAAM------DPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            P  WG   M      DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVE+
Sbjct  63   PIGWGCFEMGFGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVEV  122



>ref|XP_004144026.1| PREDICTED: growth-regulating factor 5-like [Cucumis sativus]
 ref|XP_004161107.1| PREDICTED: growth-regulating factor 5-like [Cucumis sativus]
 gb|KGN66287.1| hypothetical protein Csa_1G595880 [Cucumis sativus]
Length=333

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 77/120 (64%), Gaps = 14/120 (12%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALIF++M++G P+PPELL  +K+S  +S       P H          
Sbjct  9    FTSAQWQELEHQALIFKYMVSGIPIPPELLFSIKRSALDSPFTSKLFPHHP--------Q  60

Query  226  PWYWGRAAM------DPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            P  W    M      DPEPGRCRRTDGKKWRCS++     KYCERHMHRG+NRSRKPV++
Sbjct  61   PVGWNYLQMSLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVDV  120



>ref|XP_004141176.1| PREDICTED: growth-regulating factor 5-like [Cucumis sativus]
 ref|XP_004157965.1| PREDICTED: growth-regulating factor 5-like [Cucumis sativus]
 gb|KGN60508.1| hypothetical protein Csa_2G000170 [Cucumis sativus]
Length=319

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 84/131 (64%), Gaps = 15/131 (11%)
 Frame = -2

Query  445  TATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfph  266
            +A  +FP      F+  QWQELE QALIF++M++G P+PPELL+ +K +  ++       
Sbjct  2    SARNRFP------FTAAQWQELEHQALIFKYMVSGVPIPPELLYSIKATSLDTPFISRLF  55

Query  265  plhqyphyhPASAPWYW-----GRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMH  101
            P         ++  W +     GR  +DPEPGRCRRTDGKKWRCS++     KYCERHMH
Sbjct  56   PHQYPQV---SAVGWNYLQMGSGRK-IDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMH  111

Query  100  RGRNRSRKPVE  68
            RG+NRSRKPVE
Sbjct  112  RGKNRSRKPVE  122



>ref|XP_003537666.1| PREDICTED: growth-regulating factor 4-like [Glycine max]
Length=308

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 80/113 (71%), Gaps = 7/113 (6%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F++ QWQELE QALI+++M+AG PVPP+L+  ++ S F+S    F H           S 
Sbjct  6    FTISQWQELEHQALIYKYMVAGLPVPPDLVIPIQNS-FHSISQTFLHHPSTT-----MSY  59

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVE
Sbjct  60   CSFYGKK-VDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE  111



>ref|XP_006854210.1| hypothetical protein AMTR_s00048p00216350 [Amborella trichopoda]
 gb|ERN15677.1| hypothetical protein AMTR_s00048p00216350 [Amborella trichopoda]
Length=338

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 76/115 (66%), Gaps = 13/115 (11%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALIF+H++AG PVPP+LL  +++S                  +   + 
Sbjct  10   FTPSQWQELEHQALIFKHLMAGIPVPPDLLVPIRRS----------LEAMSARFFQQQTM  59

Query  226  PW--YWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
             W  ++G  + DPEPGRCRRTDGKKWRCSRD     KYCERHMHRGRNRSRKPVE
Sbjct  60   GWGSFYGNKS-DPEPGRCRRTDGKKWRCSRDAYPDSKYCERHMHRGRNRSRKPVE  113



>gb|KHN01405.1| hypothetical protein glysoja_009611 [Glycine soja]
Length=359

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 74/120 (62%), Gaps = 17/120 (14%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QAL+F++M+ G P+PP+L++ +K+S                        
Sbjct  12   FTQTQWQELEHQALVFKYMVTGTPIPPDLIYSIKRS-----------LDTSISSRLFPHH  60

Query  226  PWYWGRAAM------DPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            P  WG   M      DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVE+
Sbjct  61   PIGWGCFEMGFGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVEV  120



>ref|XP_002298093.2| hypothetical protein POPTR_0001s16920g, partial [Populus trichocarpa]
 gb|EEE82898.2| hypothetical protein POPTR_0001s16920g, partial [Populus trichocarpa]
Length=338

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 84/130 (65%), Gaps = 11/130 (8%)
 Frame = -2

Query  454  STPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyy  275
            +T  +  +FP      F+  QWQELE QALI+++M++G PVPPELL+ VK+S  +S    
Sbjct  3    NTTISRNRFP------FTATQWQELEHQALIYKYMVSGVPVPPELLYSVKRSLGSSLASR  56

Query  274  fphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRG  95
                         A     +GR A DPEPGRCRRTDGKKWRCS++     KYCERHMHRG
Sbjct  57   LFPHQPIGWGCFQAG----FGRKA-DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRG  111

Query  94   RNRSRKPVEI  65
            R+RSRKPVE+
Sbjct  112  RSRSRKPVEL  121



>ref|XP_008459738.1| PREDICTED: growth-regulating factor 6-like [Cucumis melo]
Length=316

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 80/126 (63%), Gaps = 7/126 (6%)
 Frame = -2

Query  445  TATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfph  266
            +A  +FP      F+  QWQELE QALIF++M++G P+PPELL+ +K +  ++       
Sbjct  2    SARNRFP------FTAAQWQELEHQALIFKYMVSGVPIPPELLYSIKATSLDTPFISRLF  55

Query  265  plhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNR  86
            P                GR  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRG+NR
Sbjct  56   PHQYPQAVGWNYLQMGSGRK-IDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNR  114

Query  85   SRKPVE  68
            SRKPVE
Sbjct  115  SRKPVE  120



>ref|XP_003517558.1| PREDICTED: growth-regulating factor 4-like [Glycine max]
Length=318

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 80/113 (71%), Gaps = 7/113 (6%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F++ QWQELE QALI+++M+AG PVPP+L+  ++ S F+S    F H           S 
Sbjct  14   FTMSQWQELEHQALIYKYMVAGLPVPPDLVLPIQNS-FHSISQTFLHHPSTT-----MSY  67

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVE
Sbjct  68   CSFYGKK-VDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE  119



>gb|KHN39631.1| hypothetical protein glysoja_020709 [Glycine soja]
Length=373

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 75/120 (63%), Gaps = 17/120 (14%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QAL+F++M+ G P+PP+L++ +K+S   S                    
Sbjct  14   FTQTQWQELEQQALVFKYMVTGTPIPPDLIYSIKRSLDTSISSRLFPHH-----------  62

Query  226  PWYWGRAAM------DPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            P  WG   M      DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVE+
Sbjct  63   PIGWGCFEMGFGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVEV  122



>gb|AET01746.2| growth-regulating factor-like protein [Medicago truncatula]
Length=348

 Score =   126 bits (316),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 76/122 (62%), Gaps = 17/122 (14%)
 Frame = -2

Query  412  SYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPA  233
            S F+  QWQELE QAL+F++M+ G P+PP+L++ +K+S   S                  
Sbjct  10   SLFTPNQWQELEQQALVFKYMVTGTPIPPDLIYSIKRSLDTSISSRIF-----------P  58

Query  232  SAPWYWGRAAM------DPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPV  71
              P  WG   M      DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPV
Sbjct  59   HPPIGWGCFEMGFGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPV  118

Query  70   EI  65
            E+
Sbjct  119  EL  120



>ref|XP_006451560.1| hypothetical protein CICLE_v10008922mg [Citrus clementina]
 ref|XP_006490822.1| PREDICTED: growth-regulating factor 5-like isoform X1 [Citrus 
sinensis]
 gb|ESR64800.1| hypothetical protein CICLE_v10008922mg [Citrus clementina]
Length=322

 Score =   125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 82/128 (64%), Gaps = 7/128 (5%)
 Frame = -2

Query  445  TATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfph  266
            +A  +FP      F+  QWQELE QALIF++M++G PVPP+LL  +K+S +         
Sbjct  9    SAINRFP------FTASQWQELEHQALIFKYMVSGIPVPPDLLFTIKRSYYFDRSPPSAA  62

Query  265  plhqyphyhPASAPWYWGRA-AMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRN  89
                + H H     +  G    +DPEPGRCRRTDGKKWRCS++     KYCERHMHRG+N
Sbjct  63   KHFTHQHQHVEWNCFQVGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKN  122

Query  88   RSRKPVEI  65
            RSRKPVE+
Sbjct  123  RSRKPVEL  130



>gb|EPS67843.1| hypothetical protein M569_06931, partial [Genlisea aurea]
Length=117

 Score =   120 bits (301),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 77/118 (65%), Gaps = 20/118 (17%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QW ELE QALI++++ A  P+P  LL  ++K PF SA +               S 
Sbjct  5    FTASQWMELEHQALIYKYINANVPIPSYLLDPIRK-PFQSAAFR--------------ST  49

Query  226  PWYWGRAAM-----DPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            P+ WG   +     DPEPGRCRRTDGKKWRCSRD VA QKYCERHM+RGR+RSRKPVE
Sbjct  50   PFGWGGFQLGFSNSDPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKPVE  107



>ref|XP_004506550.1| PREDICTED: growth-regulating factor 4-like isoform X2 [Cicer 
arietinum]
Length=330

 Score =   125 bits (315),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 81/113 (72%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F++ QWQELE QALIF++M+AG PVPP+L+  +++S F+S  + F H             
Sbjct  22   FTVSQWQELEHQALIFKYMVAGLPVPPDLVLPIQRS-FDSISHNFFHHPTLSYCS-----  75

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVE
Sbjct  76   --FYGKK-VDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE  125



>ref|XP_010940818.1| PREDICTED: growth-regulating factor 5-like isoform X2 [Elaeis 
guineensis]
Length=347

 Score =   125 bits (315),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 80/113 (71%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALI++++IAG PVPP+LL  +++S F +A   F H      +      
Sbjct  13   FTASQWQELEHQALIYKYLIAGVPVPPDLLIPIRRS-FEAAHARFYHHPALGYYS-----  66

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  67   --FYGKK-LDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  116



>ref|XP_010940817.1| PREDICTED: growth-regulating factor 5-like isoform X1 [Elaeis 
guineensis]
Length=348

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 80/113 (71%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALI++++IAG PVPP+LL  +++S F +A   F H      +      
Sbjct  13   FTASQWQELEHQALIYKYLIAGVPVPPDLLIPIRRS-FEAAHARFYHHPALGYYS-----  66

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  67   --FYGKK-LDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  116



>ref|XP_003547719.2| PREDICTED: growth-regulating factor 5-like isoform X1 [Glycine 
max]
Length=360

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 75/120 (63%), Gaps = 17/120 (14%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QAL+F++M+ G P+PP+L++ +K+S   S                    
Sbjct  14   FTQIQWQELEQQALVFKYMVTGTPIPPDLIYSIKRSLDTSISSRLFPHH-----------  62

Query  226  PWYWGRAAM------DPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            P  WG   M      DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVE+
Sbjct  63   PIGWGCFEMGFGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVEV  122



>ref|XP_004506549.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Cicer 
arietinum]
Length=344

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 82/113 (73%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F++ QWQELE QALIF++M+AG PVPP+L+  +++S F+S  + F H           S 
Sbjct  22   FTVSQWQELEHQALIFKYMVAGLPVPPDLVLPIQRS-FDSISHNFFHHPTL-------SY  73

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVE
Sbjct  74   CSFYGKK-VDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE  125



>ref|XP_007024621.1| Growth-regulating factor 5, putative [Theobroma cacao]
 gb|EOY27243.1| Growth-regulating factor 5, putative [Theobroma cacao]
Length=357

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 77/114 (68%), Gaps = 5/114 (4%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALIF++M++G P+PPEL++ VK+S  +S                    
Sbjct  10   FTPTQWQELEHQALIFKYMVSGVPIPPELIYSVKRSLDSSLASRLFPHQPIGWGCFQVG-  68

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
               +GR A DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVE+
Sbjct  69   ---FGRKA-DPEPGRCRRTDGKKWRCSKEAYPESKYCERHMHRGRNRSRKPVEV  118



>ref|XP_010047492.1| PREDICTED: growth-regulating factor 1 isoform X2 [Eucalyptus 
grandis]
Length=378

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 87/127 (69%), Gaps = 9/127 (7%)
 Frame = -2

Query  439  TTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSP--FNSApyyfph  266
            +++FP      F+  QWQELE QALI++++I+G P+PP+LL  +K+SP  F+S+ +    
Sbjct  9    SSRFP------FTASQWQELEHQALIYKYLISGIPIPPDLLFSLKRSPSCFDSSHFSPKF  62

Query  265  plhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNR  86
              HQ  H          G+  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRG+NR
Sbjct  63   LSHQPQHVGWNCFQMGLGKK-IDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNR  121

Query  85   SRKPVEI  65
            SRKPVE+
Sbjct  122  SRKPVEV  128



>ref|XP_009767378.1| PREDICTED: growth-regulating factor 1-like [Nicotiana sylvestris]
Length=364

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 85/126 (67%), Gaps = 9/126 (7%)
 Frame = -2

Query  442  ATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphp  263
            A ++FP      F+  QWQELE QALI+++M++G PVPP+LL+ +++S  +S        
Sbjct  6    ARSRFP------FTANQWQELEHQALIYKYMVSGMPVPPDLLYTIRRSMDSSLSSKLVLH  59

Query  262  lhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRS  83
               +  ++       +G+  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRS
Sbjct  60   QPHHIGWNCFQMG--FGK-KIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRS  116

Query  82   RKPVEI  65
            RKPVEI
Sbjct  117  RKPVEI  122



>ref|XP_010047491.1| PREDICTED: growth-regulating factor 1 isoform X1 [Eucalyptus 
grandis]
 gb|KCW79425.1| hypothetical protein EUGRSUZ_C00823 [Eucalyptus grandis]
Length=381

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 87/127 (69%), Gaps = 9/127 (7%)
 Frame = -2

Query  439  TTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSP--FNSApyyfph  266
            +++FP      F+  QWQELE QALI++++I+G P+PP+LL  +K+SP  F+S+ +    
Sbjct  9    SSRFP------FTASQWQELEHQALIYKYLISGIPIPPDLLFSLKRSPSCFDSSHFSPKF  62

Query  265  plhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNR  86
              HQ  H          G+  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRG+NR
Sbjct  63   LSHQPQHVGWNCFQMGLGKK-IDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNR  121

Query  85   SRKPVEI  65
            SRKPVE+
Sbjct  122  SRKPVEV  128



>ref|XP_002270427.2| PREDICTED: growth-regulating factor 4-like isoform X2 [Vitis 
vinifera]
Length=330

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 79/113 (70%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F++ QWQELE QALIF++++AG PVPP+L+  ++KS F S    F H             
Sbjct  24   FTVSQWQELEHQALIFKYLMAGLPVPPDLVLPIQKS-FESMSSRFFHHPTMGYCS-----  77

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  78   --FYGKK-VDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  127



>ref|XP_001782903.1| predicted protein [Physcomitrella patens]
 gb|EDQ52303.1| predicted protein, partial [Physcomitrella patens]
Length=108

 Score =   119 bits (299),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 74/113 (65%), Gaps = 11/113 (10%)
 Frame = -2

Query  403  SLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASAP  224
            +  QW ELE QALIF++M+AG  VP ELL+ ++KS                   H  + P
Sbjct  1    TTSQWAELEHQALIFKYMMAGVNVPQELLNPIRKS----------VATMNSLSSHHTTNP  50

Query  223  WYWGR-AAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            ++ G     DPEPGRCRRTDGKKWRC+RDVV  QKYCERHMHRGR+RSR+P E
Sbjct  51   FHLGVPNNTDPEPGRCRRTDGKKWRCARDVVPDQKYCERHMHRGRHRSRRPAE  103



>ref|XP_006598832.1| PREDICTED: growth-regulating factor 5-like isoform X3 [Glycine 
max]
Length=373

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 75/120 (63%), Gaps = 17/120 (14%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QAL+F++M+ G P+PP+L++ +K+S   S                    
Sbjct  14   FTQIQWQELEQQALVFKYMVTGTPIPPDLIYSIKRSLDTSISSRLFPHH-----------  62

Query  226  PWYWGRAAM------DPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            P  WG   M      DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVE+
Sbjct  63   PIGWGCFEMGFGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVEV  122



>ref|XP_006598831.1| PREDICTED: growth-regulating factor 5-like isoform X2 [Glycine 
max]
Length=374

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 75/120 (63%), Gaps = 17/120 (14%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QAL+F++M+ G P+PP+L++ +K+S   S                    
Sbjct  14   FTQIQWQELEQQALVFKYMVTGTPIPPDLIYSIKRSLDTSISSRLFPHH-----------  62

Query  226  PWYWGRAAM------DPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
            P  WG   M      DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVE+
Sbjct  63   PIGWGCFEMGFGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVEV  122



>ref|XP_010662088.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Vitis 
vinifera]
Length=332

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 79/113 (70%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F++ QWQELE QALIF++++AG PVPP+L+  ++KS F S    F H             
Sbjct  24   FTVSQWQELEHQALIFKYLMAGLPVPPDLVLPIQKS-FESMSSRFFHHPTMGYCS-----  77

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  78   --FYGKK-VDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  127



>ref|XP_010251960.1| PREDICTED: growth-regulating factor 2 [Nelumbo nucifera]
Length=581

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 79/126 (63%), Gaps = 14/126 (11%)
 Frame = -2

Query  442  ATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphp  263
            A+ +FP      F+  QWQELE QALI+++M+A  PVPP+LL  + ++P           
Sbjct  104  ASLRFP------FTSTQWQELERQALIYKYMMASVPVPPDLLMTISRNPSQPIASQSTMG  157

Query  262  lhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRS  83
                 +   +S+         DPEPGRCRRTDGKKWRCSRDV   QKYCERHMHRGR RS
Sbjct  158  RGACFNLRFSSS--------TDPEPGRCRRTDGKKWRCSRDVAPDQKYCERHMHRGRPRS  209

Query  82   RKPVEI  65
            RKPVE+
Sbjct  210  RKPVEL  215



>ref|XP_011035717.1| PREDICTED: growth-regulating factor 5-like [Populus euphratica]
Length=340

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 83/129 (64%), Gaps = 11/129 (9%)
 Frame = -2

Query  454  STPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyy  275
            +T  +  +FP      F+  QWQELE QALI+++M++G PVPPELL+ VK+S  +S    
Sbjct  3    NTTISRNRFP------FTATQWQELEHQALIYKYMVSGVPVPPELLYSVKRSLGSSLASR  56

Query  274  fphplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRG  95
                         A     +GR A DPEPGRCRRTDGKKWRCS++     KYCERHMHRG
Sbjct  57   LFPHQPIGWGCFQAG----FGRKA-DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRG  111

Query  94   RNRSRKPVE  68
            R+RSRKPVE
Sbjct  112  RSRSRKPVE  120



>gb|KJB70121.1| hypothetical protein B456_011G058800 [Gossypium raimondii]
Length=321

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 77/119 (65%), Gaps = 17/119 (14%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALIF++M++G P+PP+LL+ VK S F+S+                   
Sbjct  10   FTPNQWQELEHQALIFKYMVSGVPIPPQLLYSVKTS-FDSSLASHLF----------PHQ  58

Query  226  PWYWGRAAM------DPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            P  WG   +      DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVE
Sbjct  59   PTGWGCFQVGFGRKPDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE  117



>ref|XP_009615805.1| PREDICTED: growth-regulating factor 1-like [Nicotiana tomentosiformis]
Length=325

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 79/114 (69%), Gaps = 9/114 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALI+++M +G PVPP+LL+ +++S  +S         + +        
Sbjct  10   FTATQWQELEHQALIYKYMASGMPVPPDLLYTIRRSLDSSNHQPQHIGWNCFQLG-----  64

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
               +G+  +DPEPGRCRRTDGKKWRCS++  A  KYCERHMHRGRNRSRKPVE+
Sbjct  65   ---FGKK-IDPEPGRCRRTDGKKWRCSKEAYADSKYCERHMHRGRNRSRKPVEV  114



>ref|XP_010528592.1| PREDICTED: growth-regulating factor 3-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010528594.1| PREDICTED: growth-regulating factor 3-like isoform X2 [Tarenaya 
hassleriana]
Length=313

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 83/115 (72%), Gaps = 9/115 (8%)
 Frame = -2

Query  412  SYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPA  233
            S F++ QWQELE QALIF+++IAG PVPP+L+  ++KS  N +  +F HP          
Sbjct  5    SLFTVSQWQELEHQALIFKYIIAGLPVPPDLVLPIQKSFENISHRFFTHPSF--------  56

Query  232  SAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            S+   +G+  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVE
Sbjct  57   SSCSLYGKK-IDPEPGRCRRTDGKKWRCSKEAHPDSKYCERHMHRGRNRSRKPVE  110



>ref|XP_002303244.2| hypothetical protein POPTR_0003s06360g [Populus trichocarpa]
 gb|EEE78223.2| hypothetical protein POPTR_0003s06360g [Populus trichocarpa]
Length=340

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 5/114 (4%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QW ELE QALI+++M++G PVPPELL+ VK+S  +S                 A  
Sbjct  13   FTATQWHELEHQALIYKYMVSGVPVPPELLYSVKRSLESSLASRLFPHQPTGWGCFQAGV  72

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
                GR A DPEPGRCRRTDGKKWRCS++     KYCERHMHRG+NRSRKPVE+
Sbjct  73   ----GRKA-DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVEL  121



>emb|CBI26466.3| unnamed protein product [Vitis vinifera]
Length=373

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 79/113 (70%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F++ QWQELE QALIF++++AG PVPP+L+  ++KS F S    F H             
Sbjct  67   FTVSQWQELEHQALIFKYLMAGLPVPPDLVLPIQKS-FESMSSRFFHHPTMGYCS-----  120

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  121  --FYGKK-VDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  170



>ref|XP_009781044.1| PREDICTED: growth-regulating factor 1-like [Nicotiana sylvestris]
Length=328

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 79/114 (69%), Gaps = 6/114 (5%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALI+++M +G PVPP+LL+ +++S  +S  +        +        
Sbjct  10   FTATQWQELEHQALIYKYMASGMPVPPDLLYTIRRSLDSSNLFLHQPQHIGWNCIQLG--  67

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
               +G+  +DPEPGRCRRTDGKKWRCS++  A  KYCERHMHRGRNRSRKPVE+
Sbjct  68   ---FGKK-IDPEPGRCRRTDGKKWRCSKEAYADSKYCERHMHRGRNRSRKPVEV  117



>ref|XP_002516290.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46292.1| conserved hypothetical protein [Ricinus communis]
Length=253

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 81/127 (64%), Gaps = 8/127 (6%)
 Frame = -2

Query  445  TATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfph  266
            + T KFP      F+  QWQELE QALIF++M++G P+P +LL  +K+S  +S       
Sbjct  3    SGTNKFP------FTASQWQELEHQALIFKYMVSGIPIPSDLLFTIKRSCLDSPLSSKLF  56

Query  265  plhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNR  86
            P         +      GR  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRG+NR
Sbjct  57   PRQPPHIGW-SCFQMGLGRK-IDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNR  114

Query  85   SRKPVEI  65
            SRKPVE+
Sbjct  115  SRKPVEV  121



>ref|XP_008803298.1| PREDICTED: growth-regulating factor 10-like isoform X1 [Phoenix 
dactylifera]
Length=267

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 89/154 (58%), Gaps = 18/154 (12%)
 Frame = -2

Query  490  PPTSKLSAFSSDSTPTATTKFP-------------RMGGSYFSLGQWQELELQALIFRHM  350
            PP SK+   SSD++   T   P                   F+  Q QELE QALI+++M
Sbjct  26   PPLSKIPRLSSDASGAVTMAAPSPLGLGLRLGLGGGYSRPAFTFMQLQELEHQALIYKYM  85

Query  349  IAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCRRT  170
            +AG PVP   LHLV   P   +     +  H  P +    +     R +M+PEPGRCRRT
Sbjct  86   VAGVPVP---LHLVL--PIWKSVAASSYGPHHCPSFMGYGSLCLDYRNSMEPEPGRCRRT  140

Query  169  DGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            DGKKWRCSRDVV  QKYCERHMHRGRNRSRKPVE
Sbjct  141  DGKKWRCSRDVVPDQKYCERHMHRGRNRSRKPVE  174



>ref|XP_009385874.1| PREDICTED: growth-regulating factor 5-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=344

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 80/113 (71%), Gaps = 10/113 (9%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALI ++++AG PVPPEL+  +++S F + P  + HP   Y        
Sbjct  14   FTATQWQELEHQALILKYLMAGVPVPPELIIPIRRS-FETLPGRYYHPSLSYYS------  66

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              Y+G+   DPEPGRCRRTDGKKWRCS+D   G KYCERHMHRGRNRSRKPVE
Sbjct  67   --YYGKKP-DPEPGRCRRTDGKKWRCSKDAYPGSKYCERHMHRGRNRSRKPVE  116



>ref|XP_009385873.1| PREDICTED: growth-regulating factor 5-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=347

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 80/113 (71%), Gaps = 10/113 (9%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALI ++++AG PVPPEL+  +++S F + P  + HP   Y        
Sbjct  14   FTATQWQELEHQALILKYLMAGVPVPPELIIPIRRS-FETLPGRYYHPSLSYYS------  66

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              Y+G+   DPEPGRCRRTDGKKWRCS+D   G KYCERHMHRGRNRSRKPVE
Sbjct  67   --YYGKKP-DPEPGRCRRTDGKKWRCSKDAYPGSKYCERHMHRGRNRSRKPVE  116



>ref|XP_011012401.1| PREDICTED: growth-regulating factor 4-like [Populus euphratica]
Length=336

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 80/113 (71%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F++ QWQELE QALI+++M+AG PVPP+L+  +++S F S  + F H             
Sbjct  33   FTVSQWQELEHQALIYKYMVAGLPVPPDLVLPIQRS-FESISHRFFHHPAMGYCT-----  86

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  87   --FYGKK-VDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  136



>ref|XP_008812758.1| PREDICTED: growth-regulating factor 4-like [Phoenix dactylifera]
Length=348

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 79/113 (70%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALI++++IAG PVPP+LL  +++S F +    F H      +      
Sbjct  13   FTASQWQELEHQALIYKYLIAGVPVPPDLLIPIRRS-FEAVHARFYHHPALGYYS-----  66

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  67   --FYGKK-LDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  116



>ref|XP_002521329.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40997.1| conserved hypothetical protein [Ricinus communis]
Length=340

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 76/114 (67%), Gaps = 5/114 (4%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALI+++M++G P+PPEL+  VK+S  +S                    
Sbjct  13   FTPSQWQELEHQALIYKYMVSGIPIPPELIFTVKRSLESSLASRLFPHQPIGWGCFQVG-  71

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
               +GR A DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVE+
Sbjct  72   ---FGRKA-DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVEL  121



>ref|XP_008242216.1| PREDICTED: growth-regulating factor 1-like isoform X1 [Prunus 
mume]
Length=381

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 81/125 (65%), Gaps = 7/125 (6%)
 Frame = -2

Query  436  TKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplh  257
            T+FP      F+  QWQELE QALI+++M++G  +PP+LL  +K+S  +S          
Sbjct  5    TRFP------FTPSQWQELEHQALIYKYMVSGISIPPDLLFSIKRSCLDSPLPSKLFSHP  58

Query  256  qyphyhPASAPWYWGRA-AMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSR  80
             +       + +  G    +DPEPGRCRRTDGKKWRCS++  A  KYCERHMHRG+NRSR
Sbjct  59   PHSKPTIGWSCFQMGLGRKVDPEPGRCRRTDGKKWRCSKEAFADSKYCERHMHRGKNRSR  118

Query  79   KPVEI  65
            KPVE+
Sbjct  119  KPVEV  123



>ref|XP_010919180.1| PREDICTED: growth-regulating factor 10-like [Elaeis guineensis]
Length=275

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 91/156 (58%), Gaps = 20/156 (13%)
 Frame = -2

Query  490  PPTSKLSAFSSDSTPTATTKFP---------------RMGGSYFSLGQWQELELQALIFR  356
            PP+SK+   SSD++   T   P                     F+  Q QELE QALI++
Sbjct  25   PPSSKVPRLSSDASELVTMAAPSPLVLGLGLGLGVGGGYSRPAFTFLQLQELEHQALIYK  84

Query  355  HMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASAPWYWGRAAMDPEPGRCR  176
            +M+AG PVP   LHLV   P   +     +  H YP +    +     R +M+PEPGRCR
Sbjct  85   YMVAGVPVP---LHLVL--PIWKSVAAASYGPHHYPSFMGYGSLCLDYRNSMEPEPGRCR  139

Query  175  RTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            RTDGKKWRCSRDVV  QKYCERHMHRGRNRSRKPVE
Sbjct  140  RTDGKKWRCSRDVVPDQKYCERHMHRGRNRSRKPVE  175



>ref|XP_010943630.1| PREDICTED: growth-regulating factor 4-like isoform X2 [Elaeis 
guineensis]
Length=354

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 80/113 (71%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALIF++++AG PVPP+LL  +++S F +AP  F H             
Sbjct  14   FTASQWQELEHQALIFKYIMAGVPVPPDLLIPIRRS-FEAAPARFYHHPALGYCS-----  67

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  68   --FYGKK-LDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  117



>ref|XP_010528591.1| PREDICTED: growth-regulating factor 3-like isoform X1 [Tarenaya 
hassleriana]
Length=323

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 83/115 (72%), Gaps = 9/115 (8%)
 Frame = -2

Query  412  SYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPA  233
            S F++ QWQELE QALIF+++IAG PVPP+L+  ++KS  N +  +F HP          
Sbjct  15   SLFTVSQWQELEHQALIFKYIIAGLPVPPDLVLPIQKSFENISHRFFTHPSF--------  66

Query  232  SAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
            S+   +G+  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVE
Sbjct  67   SSCSLYGKK-IDPEPGRCRRTDGKKWRCSKEAHPDSKYCERHMHRGRNRSRKPVE  120



>ref|XP_009596803.1| PREDICTED: growth-regulating factor 1-like [Nicotiana tomentosiformis]
Length=361

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 87/129 (67%), Gaps = 9/129 (7%)
 Frame = -2

Query  451  TPTATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyf  272
            + TA ++FP      F+  QWQELE QALI+++M++G PVPP+LL+ +++S  +S     
Sbjct  3    STTARSRFP------FTANQWQELEHQALIYKYMVSGMPVPPDLLYTIRRSLDSSLSSKL  56

Query  271  phplhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGR  92
                  +  ++       +G+  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRGR
Sbjct  57   ILHQPHHIGWNCFQMG--FGK-KIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGR  113

Query  91   NRSRKPVEI  65
            NRSRKPVEI
Sbjct  114  NRSRKPVEI  122



>ref|XP_007157086.1| hypothetical protein PHAVU_002G041800g [Phaseolus vulgaris]
 gb|ESW29080.1| hypothetical protein PHAVU_002G041800g [Phaseolus vulgaris]
Length=317

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 80/113 (71%), Gaps = 7/113 (6%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F++ QWQELE QALI+++M+AG PVPP+L+  ++ S F+S    F H           S 
Sbjct  14   FTVSQWQELEHQALIYKYMVAGLPVPPDLVIPIQNS-FHSISQTFLHHPSSA-----MSY  67

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVE
Sbjct  68   CSFYGKK-VDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE  119



>ref|XP_010943629.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Elaeis 
guineensis]
Length=355

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 80/113 (71%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALIF++++AG PVPP+LL  +++S F +AP  F H             
Sbjct  14   FTASQWQELEHQALIFKYIMAGVPVPPDLLIPIRRS-FEAAPARFYHHPALGYCS-----  67

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  68   --FYGKK-LDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  117



>ref|XP_009415171.1| PREDICTED: growth-regulating factor 5-like [Musa acuminata subsp. 
malaccensis]
Length=351

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 77/113 (68%), Gaps = 10/113 (9%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALI ++++AG PVPPEL+  +++S            L    ++   S 
Sbjct  17   FTATQWQELEHQALILKYLMAGVPVPPELIIPIRRS---------FEALPGRYYHPSLSY  67

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              Y+G+   DPEPGRCRRTDGKKWRCS+D   G KYCERHMHRGRNRSRKPVE
Sbjct  68   YSYYGKKP-DPEPGRCRRTDGKKWRCSKDAYPGSKYCERHMHRGRNRSRKPVE  119



>ref|XP_009420425.1| PREDICTED: growth-regulating factor 5-like [Musa acuminata subsp. 
malaccensis]
Length=348

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 82/119 (69%), Gaps = 10/119 (8%)
 Frame = -2

Query  421  MGG-SYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyph  245
            MGG + F+  QWQELE QALI+++++AG PVPPEL+  +++S F +    + H       
Sbjct  12   MGGRAPFTAAQWQELEHQALIYKYLMAGVPVPPELVIPIQRS-FEALAGRYYHHPALAYC  70

Query  244  yhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
                    Y+G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  71   S-------YYGKK-LDPEPGRCRRTDGKKWRCSKDAHPDSKYCERHMHRGRNRSRKPVE  121



>ref|XP_011460609.1| PREDICTED: growth-regulating factor 1 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=366

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 77/114 (68%), Gaps = 4/114 (4%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALI+++M++G P+PP+LL  +K+S  +S P                  
Sbjct  15   FTPSQWQELEHQALIYKYMVSGIPIPPDLLFSIKRSCLDSPPLSSKLFSPHIGWNCFQMG  74

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
                GR  +DPEPGRCRRTDGKKWRCS++  A  KYCERHMHRG+NRSRKPVE+
Sbjct  75   ---LGRK-IDPEPGRCRRTDGKKWRCSKEAYADSKYCERHMHRGKNRSRKPVEV  124



>ref|XP_004287622.1| PREDICTED: growth-regulating factor 1 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=369

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 77/114 (68%), Gaps = 4/114 (4%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALI+++M++G P+PP+LL  +K+S  +S P                  
Sbjct  15   FTPSQWQELEHQALIYKYMVSGIPIPPDLLFSIKRSCLDSPPLSSKLFSPHIGWNCFQMG  74

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
                GR  +DPEPGRCRRTDGKKWRCS++  A  KYCERHMHRG+NRSRKPVE+
Sbjct  75   ---LGRK-IDPEPGRCRRTDGKKWRCSKEAYADSKYCERHMHRGKNRSRKPVEV  124



>ref|XP_006371207.1| hypothetical protein POPTR_0019s05910g [Populus trichocarpa]
 gb|ERP49004.1| hypothetical protein POPTR_0019s05910g [Populus trichocarpa]
Length=296

 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 80/113 (71%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F++ QWQELE QALI+++M+AG PVPP+L+  +++S F S  + F H             
Sbjct  25   FTVSQWQELEHQALIYKYMVAGLPVPPDLVLPIQRS-FESISHRFFHHPAMGYCT-----  78

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPG+CRRTDGKKWRCS+D   G KYCERHMHRGRNRSRK VE
Sbjct  79   --FYGKK-VDPEPGQCRRTDGKKWRCSKDAYPGSKYCERHMHRGRNRSRKAVE  128



>gb|KJB70120.1| hypothetical protein B456_011G058800 [Gossypium raimondii]
Length=320

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 77/113 (68%), Gaps = 6/113 (5%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALIF++M++G P+PP+LL+ VK S F+S+      P            
Sbjct  10   FTPNQWQELEHQALIFKYMVSGVPIPPQLLYSVKTS-FDSSLASHLFPHQPRWGCFQVG-  67

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
               +GR   DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVE
Sbjct  68   ---FGRKP-DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE  116



>ref|XP_003539001.1| PREDICTED: growth-regulating factor 5-like [Glycine max]
Length=341

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 81/117 (69%), Gaps = 6/117 (5%)
 Frame = -2

Query  418  GGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyh  239
            G S F++ QWQELE QALIF++M+AG PVP +L+  ++ S F+S         H     +
Sbjct  22   GRSPFTVSQWQELEHQALIFKYMLAGLPVPLDLVFPIQNS-FHSTISLSHAFFHHPTLSY  80

Query  238  PASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
             +    ++G+  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVE
Sbjct  81   CS----FYGKK-VDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE  132



>gb|KHN39845.1| hypothetical protein glysoja_020585 [Glycine soja]
Length=328

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 81/117 (69%), Gaps = 6/117 (5%)
 Frame = -2

Query  418  GGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyh  239
            G S F++ QWQELE QALIF++M+AG PVP +L+  ++ S F+S         H     +
Sbjct  9    GRSPFTVSQWQELEHQALIFKYMLAGLPVPLDLVFPIQNS-FHSTISLSHAFFHHPTLSY  67

Query  238  PASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
             +    ++G+  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVE
Sbjct  68   CS----FYGKK-VDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE  119



>ref|XP_010932723.1| PREDICTED: growth-regulating factor 1-like [Elaeis guineensis]
Length=166

 Score =   119 bits (298),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 81/130 (62%), Gaps = 15/130 (12%)
 Frame = -2

Query  439  TTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphpl  260
            T+++P      F+  QWQELE QALIF++M +G P+P +L+  +++S    +    P   
Sbjct  8    TSRYP------FTPSQWQELEHQALIFKYMASGIPIPSDLILPIRRSFLLDSTIPSPTLA  61

Query  259  hqyphyhPASAPWYW-----GRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRG  95
                     S  W W     GR A DPEPGRCRRTDGKKWRCS++     KYCERHMHRG
Sbjct  62   FPPQ----PSMSWGWNQMGFGRKAEDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRG  117

Query  94   RNRSRKPVEI  65
            +NRSRKPVE+
Sbjct  118  KNRSRKPVEM  127



>ref|XP_007131487.1| hypothetical protein PHAVU_011G017700g [Phaseolus vulgaris]
 gb|ESW03481.1| hypothetical protein PHAVU_011G017700g [Phaseolus vulgaris]
Length=322

 Score =   122 bits (307),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 78/117 (67%), Gaps = 16/117 (14%)
 Frame = -2

Query  418  GGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyh  239
            G S F++ QW+ELE QALIF++M+AG PVP  L+  ++KS F+                 
Sbjct  18   GRSPFTVSQWEELEHQALIFKYMLAGLPVPHNLVLPIQKSFFHHPT--------------  63

Query  238  PASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              S   ++G+  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVE
Sbjct  64   -LSYCSFYGKK-VDPEPGRCRRTDGKKWRCSKEAYPESKYCERHMHRGRNRSRKPVE  118



>ref|XP_008813471.1| PREDICTED: growth-regulating factor 4-like [Phoenix dactylifera]
Length=354

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 79/113 (70%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALIF++++AG PVPP+LL  +++S F + P  F H             
Sbjct  15   FTASQWQELEHQALIFKYIMAGVPVPPDLLIPIRRS-FEATPARFYHHPALGYCS-----  68

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              ++G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  69   --FYGKK-LDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  118



>gb|KDP33905.1| hypothetical protein JCGZ_07476 [Jatropha curcas]
Length=399

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 81/127 (64%), Gaps = 8/127 (6%)
 Frame = -2

Query  445  TATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfph  266
            + T KFP      F+  QWQELE QALIF++M++G P+P +LL  +K+S  +S       
Sbjct  3    SETAKFP------FTASQWQELEHQALIFKYMVSGIPIPSDLLFTIKRSCLDSPLSSKLF  56

Query  265  plhqyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNR  86
            P         +      GR  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRG+NR
Sbjct  57   PRQPSHIGW-SCFQMGLGRK-IDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNR  114

Query  85   SRKPVEI  65
            SRKPVE+
Sbjct  115  SRKPVEV  121



>ref|XP_009386841.1| PREDICTED: growth-regulating factor 5-like [Musa acuminata subsp. 
malaccensis]
Length=361

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 78/113 (69%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALI++++ AG PVPPELL  +++S F + P  + H             
Sbjct  24   FTAAQWQELEHQALIYKYLTAGVPVPPELLIPIRRS-FEALPGRYYHHPALAYCS-----  77

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              Y+G+  +DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  78   --YYGKK-LDPEPGRCRRTDGKKWRCSKDAHPDSKYCERHMHRGRNRSRKPVE  127



>ref|XP_008803299.1| PREDICTED: growth-regulating factor 10-like isoform X2 [Phoenix 
dactylifera]
Length=224

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 77/113 (68%), Gaps = 5/113 (4%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  Q QELE QALI+++M+AG PVP   LHLV   P   +     +  H  P +    +
Sbjct  24   FTFMQLQELEHQALIYKYMVAGVPVP---LHLVL--PIWKSVAASSYGPHHCPSFMGYGS  78

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
                 R +M+PEPGRCRRTDGKKWRCSRDVV  QKYCERHMHRGRNRSRKPVE
Sbjct  79   LCLDYRNSMEPEPGRCRRTDGKKWRCSRDVVPDQKYCERHMHRGRNRSRKPVE  131



>gb|KJB29408.1| hypothetical protein B456_005G098700 [Gossypium raimondii]
Length=569

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 79/120 (66%), Gaps = 2/120 (2%)
 Frame = -2

Query  424  RMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyph  245
             M G  F+  QW ELE QALI+++M A  P+P  LL  +KK+  +SA +         P+
Sbjct  140  NMNGGPFTSSQWMELEHQALIYKYMTANVPIPSTLLIPIKKA-LDSAGFSSFSGGLLRPN  198

Query  244  yhPASAPWYWGRAA-MDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
                   ++ G +   DPEPGRCRRTDGKKWRCSRD VA QKYCERHM+RGR+RSRKPVE
Sbjct  199  TSVGWGAFHLGFSNNTDPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKPVE  258



>ref|XP_010553871.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Tarenaya 
hassleriana]
Length=312

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 80/113 (71%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            FS+ QWQELE QALIF+++IAG  VPP+L+  ++KS  N +  +F HP   Y        
Sbjct  7    FSVSQWQELEHQALIFKYIIAGLHVPPDLMVPIQKSFENISHRFFNHPSLSYCS------  60

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
               +G+  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVE
Sbjct  61   --LYGKK-IDPEPGRCRRTDGKKWRCSKEAHPNSKYCERHMHRGRNRSRKPVE  110



>gb|KEH37559.1| growth-regulating factor-like protein [Medicago truncatula]
Length=357

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 81/124 (65%), Gaps = 7/124 (6%)
 Frame = -2

Query  436  TKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplh  257
             KFP      F+  QWQELE QALI+++M +G  +PP+LL  ++KS  +S       P  
Sbjct  4    NKFP------FTPSQWQELEHQALIYKYMASGISIPPDLLFTIRKSYLDSPLSSRLFPSQ  57

Query  256  qyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRK  77
            Q+ H+         GR  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRG+NRSRK
Sbjct  58   QHQHFGWNYLQMGLGRK-IDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRK  116

Query  76   PVEI  65
            PVE+
Sbjct  117  PVEV  120



>ref|XP_010553873.1| PREDICTED: growth-regulating factor 4-like isoform X2 [Tarenaya 
hassleriana]
Length=311

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 80/113 (71%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            FS+ QWQELE QALIF+++IAG  VPP+L+  ++KS  N +  +F HP   Y        
Sbjct  7    FSVSQWQELEHQALIFKYIIAGLHVPPDLMVPIQKSFENISHRFFNHPSLSYCS------  60

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
               +G+  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVE
Sbjct  61   --LYGKK-IDPEPGRCRRTDGKKWRCSKEAHPNSKYCERHMHRGRNRSRKPVE  110



>ref|XP_011045985.1| PREDICTED: growth-regulating factor 1 isoform X4 [Populus euphratica]
Length=383

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 79/114 (69%), Gaps = 1/114 (1%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALI+++M++G P+PP+LL  +K+S    +         Q PH+  +  
Sbjct  11   FTASQWQELEHQALIYKYMVSGIPIPPDLLFTIKRSGCLDSSLSSKLFPRQPPHFSWSCF  70

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
                GR  +DPEPGRCRRTDGKKWRCS++     KYCE+HMHRG+NRSRKPVE+
Sbjct  71   QMGLGRK-IDPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKPVEV  123



>ref|XP_011045982.1| PREDICTED: growth-regulating factor 1 isoform X1 [Populus euphratica]
Length=390

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 79/114 (69%), Gaps = 1/114 (1%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALI+++M++G P+PP+LL  +K+S    +         Q PH+  +  
Sbjct  11   FTASQWQELEHQALIYKYMVSGIPIPPDLLFTIKRSGCLDSSLSSKLFPRQPPHFSWSCF  70

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
                GR  +DPEPGRCRRTDGKKWRCS++     KYCE+HMHRG+NRSRKPVE+
Sbjct  71   QMGLGRK-IDPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKPVEV  123



>gb|EYU29085.1| hypothetical protein MIMGU_mgv1a024321mg, partial [Erythranthe 
guttata]
Length=362

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 78/113 (69%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QA+I+++++AG PVPP+L+  +++S              ++ ++     
Sbjct  19   FTAMQWQELEQQAMIYKYLVAGMPVPPDLVMPIRRS--------LEALSARFFNHPAMGY  70

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              Y+G+   DPEPGRCRRTDGKKWRCS+D  +  KYCERHMHRGRNRSRKPVE
Sbjct  71   CSYYGKK-FDPEPGRCRRTDGKKWRCSKDAHSDSKYCERHMHRGRNRSRKPVE  122



>ref|XP_010541983.1| PREDICTED: growth-regulating factor 6 [Tarenaya hassleriana]
Length=303

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 84/131 (64%), Gaps = 12/131 (9%)
 Frame = -2

Query  442  ATTKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphp  263
            ATT+ P      F+  QW+ELE QA+IF++++AG PVPP+LL  ++++  +S+       
Sbjct  2    ATTRVP------FTESQWEELEHQAVIFKYIVAGVPVPPDLLFPIRRTLISSSSSSLHLS  55

Query  262  lhqyphyhPASAPWY-----WGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHR  98
               + H       W      +GR  MDPEPGRCRRTDGKKWRCS++     KYCERHMHR
Sbjct  56   SKFFSHASTPHFSWNVYDMGFGRK-MDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHR  114

Query  97   GRNRSRKPVEI  65
            G+NRSRKPVE 
Sbjct  115  GKNRSRKPVEF  125



>ref|XP_011045983.1| PREDICTED: growth-regulating factor 1 isoform X2 [Populus euphratica]
Length=386

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 79/114 (69%), Gaps = 1/114 (1%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALI+++M++G P+PP+LL  +K+S    +         Q PH+  +  
Sbjct  11   FTASQWQELEHQALIYKYMVSGIPIPPDLLFTIKRSGCLDSSLSSKLFPRQPPHFSWSCF  70

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
                GR  +DPEPGRCRRTDGKKWRCS++     KYCE+HMHRG+NRSRKPVE+
Sbjct  71   QMGLGRK-IDPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKPVEV  123



>ref|XP_011045984.1| PREDICTED: growth-regulating factor 1 isoform X3 [Populus euphratica]
Length=385

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 79/114 (69%), Gaps = 1/114 (1%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALI+++M++G P+PP+LL  +K+S    +         Q PH+  +  
Sbjct  11   FTASQWQELEHQALIYKYMVSGIPIPPDLLFTIKRSGCLDSSLSSKLFPRQPPHFSWSCF  70

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
                GR  +DPEPGRCRRTDGKKWRCS++     KYCE+HMHRG+NRSRKPVE+
Sbjct  71   QMGLGRK-IDPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKPVEV  123



>ref|XP_004513476.1| PREDICTED: growth-regulating factor 1-like [Cicer arietinum]
Length=352

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 79/119 (66%), Gaps = 9/119 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QAL++++M +G  +PP+LL  +++S F+S         +Q    H    
Sbjct  8    FTPSQWQELEHQALVYKYMASGISIPPDLLFTIRRSFFDSPLISSTLLPNQTQQQHFG--  65

Query  226  PWYW-----GRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
             W +     GR  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRG+NRSRKPVE+
Sbjct  66   -WNYLQMGIGRK-IDPEPGRCRRTDGKKWRCSKEAYQDSKYCERHMHRGKNRSRKPVEV  122



>gb|KJB29407.1| hypothetical protein B456_005G098700 [Gossypium raimondii]
Length=563

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 79/120 (66%), Gaps = 2/120 (2%)
 Frame = -2

Query  424  RMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyph  245
             M G  F+  QW ELE QALI+++M A  P+P  LL  +KK+  +SA +         P+
Sbjct  134  NMNGGPFTSSQWMELEHQALIYKYMTANVPIPSTLLIPIKKA-LDSAGFSSFSGGLLRPN  192

Query  244  yhPASAPWYWGRAA-MDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
                   ++ G +   DPEPGRCRRTDGKKWRCSRD VA QKYCERHM+RGR+RSRKPVE
Sbjct  193  TSVGWGAFHLGFSNNTDPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKPVE  252



>gb|KEH37561.1| growth-regulating factor-like protein [Medicago truncatula]
Length=356

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 81/124 (65%), Gaps = 7/124 (6%)
 Frame = -2

Query  436  TKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplh  257
             KFP      F+  QWQELE QALI+++M +G  +PP+LL  ++KS  +S       P  
Sbjct  4    NKFP------FTPSQWQELEHQALIYKYMASGISIPPDLLFTIRKSYLDSPLSSRLFPSQ  57

Query  256  qyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRK  77
            Q+ H+         GR  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRG+NRSRK
Sbjct  58   QHQHFGWNYLQMGLGRK-IDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRK  116

Query  76   PVEI  65
            PVE+
Sbjct  117  PVEV  120



>emb|CDP03099.1| unnamed protein product [Coffea canephora]
Length=430

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 78/113 (69%), Gaps = 3/113 (3%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALIF++M++G PVPP+LL+ V++S    +        HQ      +  
Sbjct  16   FTASQWQELEHQALIFKYMVSGTPVPPDLLYTVRRS--LDSSLSSKLLFHQPQLGWNSCF  73

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
               +GR  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVE
Sbjct  74   QMGFGRK-IDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE  125



>gb|KFK30384.1| hypothetical protein AALP_AA7G254100 [Arabis alpina]
Length=515

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 77/123 (63%), Gaps = 25/123 (20%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKS--PFNSApyyfphplhqyphyhPA  233
            F+L QW ELELQALI++++ A  PVP  LL  +KKS  P+ S                  
Sbjct  150  FTLTQWAELELQALIYKYITANVPVPSSLLISIKKSFYPYGSL----------------P  193

Query  232  SAPWYWGR-------AAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKP  74
             + + WG          MDPEPGRCRRTDGKKWRCSRD V  QKYCERH++RGR+RSRKP
Sbjct  194  PSAFGWGAFHLGFAGGNMDPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKP  253

Query  73   VEI  65
            VE+
Sbjct  254  VEV  256



>gb|KEH37560.1| growth-regulating factor-like protein [Medicago truncatula]
Length=356

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 81/124 (65%), Gaps = 7/124 (6%)
 Frame = -2

Query  436  TKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplh  257
             KFP      F+  QWQELE QALI+++M +G  +PP+LL  ++KS  +S       P  
Sbjct  4    NKFP------FTPSQWQELEHQALIYKYMASGISIPPDLLFTIRKSYLDSPLSSRLFPSQ  57

Query  256  qyphyhPASAPWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRK  77
            Q+ H+         GR  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRG+NRSRK
Sbjct  58   QHQHFGWNYLQMGLGRK-IDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRK  116

Query  76   PVEI  65
            PVE+
Sbjct  117  PVEV  120



>ref|XP_004964364.1| PREDICTED: growth-regulating factor 5-like isoform X2 [Setaria 
italica]
Length=363

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 83/125 (66%), Gaps = 6/125 (5%)
 Frame = -2

Query  427  PRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyp  248
            P+ G + F+  QW ELE QALI+++++AG PVPP+LL  V+ SP ++A  +         
Sbjct  29   PQRGAAVFTAAQWAELEQQALIYKYLMAGVPVPPDLLLPVRPSPHSAAAAFSFAGPAATS  88

Query  247  hyhPASAP-----WYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRS  83
             ++    P      Y+G+  +DPEP RCRRTDGKKWRCS++     KYCERHMHRGRNRS
Sbjct  89   PFYHHHHPSLSYYAYYGKK-LDPEPWRCRRTDGKKWRCSKEAHPDSKYCERHMHRGRNRS  147

Query  82   RKPVE  68
            RKPVE
Sbjct  148  RKPVE  152



>ref|XP_010324484.1| PREDICTED: growth-regulating factor 4-like isoform X2 [Solanum 
lycopersicum]
Length=352

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 77/113 (68%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QA+I+++++AG PVPP+L+  +++S F++    F               
Sbjct  32   FTAVQWQELEHQAMIYKYLVAGLPVPPDLVVPIRRS-FDAISARFFSHPSLGYCS-----  85

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              Y+G+   DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  86   --YYGKK-FDPEPGRCRRTDGKKWRCSKDAHPDSKYCERHMHRGRNRSRKPVE  135



>ref|XP_009385239.1| PREDICTED: growth-regulating factor 10-like [Musa acuminata subsp. 
malaccensis]
Length=256

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 75/113 (66%), Gaps = 5/113 (4%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  Q QELE QALI+++M AG PVP  L+  + KS   S+   + +P            
Sbjct  77   FTFMQLQELEHQALIYKYMAAGLPVPVHLVLPIWKSVAASSFGAYVYPSLTGYGSLCLDY  136

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
                 R +M+PEPGRCRRTDGKKWRCSRDVV  QKYCERHMHRGRNRSRKPVE
Sbjct  137  -----RNSMEPEPGRCRRTDGKKWRCSRDVVPDQKYCERHMHRGRNRSRKPVE  184



>ref|XP_001778905.1| predicted protein [Physcomitrella patens]
 gb|EDQ56355.1| predicted protein, partial [Physcomitrella patens]
Length=112

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 73/118 (62%), Gaps = 17/118 (14%)
 Frame = -2

Query  403  SLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASAP  224
            +  QW ELE QALIF++M+AG  VP ELL+ ++KS                      +A 
Sbjct  1    TTSQWAELEHQALIFKYMMAGVNVPQELLNPIRKS-----------VATMNGLASHHTAN  49

Query  223  WYWGRAAM------DPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              WG   +      DPEPGRCRRTDGKKWRC+RDVV  QKYCERHMHRGR+RSR+P E
Sbjct  50   LGWGAFHLGVPNNTDPEPGRCRRTDGKKWRCARDVVPDQKYCERHMHRGRHRSRRPAE  107



>ref|XP_004246199.2| PREDICTED: growth-regulating factor 4-like [Solanum lycopersicum]
Length=361

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 77/113 (68%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QA+I+++++AG PVPP+L+  +++S F +    F H             
Sbjct  29   FTAVQWQELEHQAMIYKYLVAGLPVPPDLVVPIRRS-FEAISARFFHHPSLGYCS-----  82

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              Y+G+   DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  83   --YYGKK-FDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  132



>ref|XP_006361251.1| PREDICTED: growth-regulating factor 4-like [Solanum tuberosum]
Length=352

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 78/113 (69%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QA+I+++++AG PVPP+L+  +++S F++    F +             
Sbjct  32   FTAVQWQELEHQAMIYKYLVAGLPVPPDLVVPIRRS-FDAISARFFNHPSLGYCS-----  85

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              Y+G+   DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  86   --YYGKK-FDPEPGRCRRTDGKKWRCSKDAHPDSKYCERHMHRGRNRSRKPVE  135



>ref|XP_004964363.1| PREDICTED: growth-regulating factor 5-like isoform X1 [Setaria 
italica]
Length=383

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 83/125 (66%), Gaps = 6/125 (5%)
 Frame = -2

Query  427  PRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyp  248
            P+ G + F+  QW ELE QALI+++++AG PVPP+LL  V+ SP ++A  +         
Sbjct  29   PQRGAAVFTAAQWAELEQQALIYKYLMAGVPVPPDLLLPVRPSPHSAAAAFSFAGPAATS  88

Query  247  hyhPASAP-----WYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRS  83
             ++    P      Y+G+  +DPEP RCRRTDGKKWRCS++     KYCERHMHRGRNRS
Sbjct  89   PFYHHHHPSLSYYAYYGKK-LDPEPWRCRRTDGKKWRCSKEAHPDSKYCERHMHRGRNRS  147

Query  82   RKPVE  68
            RKPVE
Sbjct  148  RKPVE  152



>ref|XP_009605690.1| PREDICTED: growth-regulating factor 4-like isoform X2 [Nicotiana 
tomentosiformis]
Length=355

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 77/113 (68%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QA+I+++++AG PVPP+L+  +++S F +    F H             
Sbjct  23   FTAVQWQELEHQAMIYKYLVAGLPVPPDLVVPIRRS-FEAISARFFHHPSLGYCS-----  76

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              Y+G+   DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  77   --YYGKK-FDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  126



>ref|XP_006381639.1| hypothetical protein POPTR_0006s14560g [Populus trichocarpa]
 gb|ERP59436.1| hypothetical protein POPTR_0006s14560g [Populus trichocarpa]
Length=383

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 78/114 (68%), Gaps = 1/114 (1%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALI+++M++G P+PP+LL  +K+S    +         Q PH+     
Sbjct  9    FTASQWQELEHQALIYKYMVSGIPIPPDLLFTIKRSGCLDSSLSSKLFPRQPPHFSWGCF  68

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
                GR  +DPEPGRCRRTDGKKWRCS++     KYCE+HMHRG+NRSRKPVE+
Sbjct  69   QMGLGRK-IDPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKPVEV  121



>ref|XP_008242218.1| PREDICTED: growth-regulating factor 1-like isoform X2 [Prunus 
mume]
Length=377

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 82/132 (62%), Gaps = 25/132 (19%)
 Frame = -2

Query  436  TKFPRMGGSYFSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplh  257
            T+FP      F+  QWQELE QALI+++M++G  +PP+LL  +K+S  +S          
Sbjct  5    TRFP------FTPSQWQELEHQALIYKYMVSGISIPPDLLFSIKRSCLDSPLPSKLF---  55

Query  256  qyphyhPASAPWYWGRAA--------MDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMH  101
                    S P + G +         +DPEPGRCRRTDGKKWRCS++  A  KYCERHMH
Sbjct  56   --------SHPPHIGWSCFQMGLGRKVDPEPGRCRRTDGKKWRCSKEAFADSKYCERHMH  107

Query  100  RGRNRSRKPVEI  65
            RG+NRSRKPVE+
Sbjct  108  RGKNRSRKPVEV  119



>ref|XP_010324483.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Solanum 
lycopersicum]
Length=356

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 77/113 (68%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QA+I+++++AG PVPP+L+  +++S F++    F               
Sbjct  32   FTAVQWQELEHQAMIYKYLVAGLPVPPDLVVPIRRS-FDAISARFFSHPSLGYCS-----  85

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              Y+G+   DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  86   --YYGKK-FDPEPGRCRRTDGKKWRCSKDAHPDSKYCERHMHRGRNRSRKPVE  135



>ref|XP_009797591.1| PREDICTED: growth-regulating factor 4-like isoform X2 [Nicotiana 
sylvestris]
Length=353

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 77/113 (68%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QA+I+++++AG PVPP+L+  +++S F +    F H             
Sbjct  23   FTAVQWQELEHQAMIYKYLVAGLPVPPDLVVPIRRS-FEAISARFFHHPSLGYCS-----  76

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              Y+G+   DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  77   --YYGKK-FDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  126



>ref|XP_009794508.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009794509.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009794510.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Nicotiana 
sylvestris]
Length=329

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 78/113 (69%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QA+I+++++AG PVPP+L+  +++S F++    F +             
Sbjct  32   FTAVQWQELEHQAMIYKYLVAGLPVPPDLVVPIRRS-FDAISARFFNHPSLSYCS-----  85

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              Y+G+   DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  86   --YYGKK-FDPEPGRCRRTDGKKWRCSKDAHPDSKYCERHMHRGRNRSRKPVE  135



>ref|XP_009605688.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009605689.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Nicotiana 
tomentosiformis]
Length=356

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 77/113 (68%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QA+I+++++AG PVPP+L+  +++S F +    F H             
Sbjct  23   FTAVQWQELEHQAMIYKYLVAGLPVPPDLVVPIRRS-FEAISARFFHHPSLGYCS-----  76

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              Y+G+   DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  77   --YYGKK-FDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  126



>ref|XP_011093817.1| PREDICTED: growth-regulating factor 1-like [Sesamum indicum]
Length=357

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 80/114 (70%), Gaps = 3/114 (3%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QAL+F++M++G PVPP+LL  +++S    +       +HQ  H    S 
Sbjct  19   FTATQWQELEHQALVFKYMVSGVPVPPDLLFTIRRS--LDSSLSSKFLIHQPQHIGWNSF  76

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
               +GR  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVEI
Sbjct  77   HMGFGRK-IDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVEI  129



>ref|XP_009797585.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009797586.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009797587.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009797588.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009797590.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Nicotiana 
sylvestris]
Length=354

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 77/113 (68%), Gaps = 9/113 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QA+I+++++AG PVPP+L+  +++S F +    F H             
Sbjct  23   FTAVQWQELEHQAMIYKYLVAGLPVPPDLVVPIRRS-FEAISARFFHHPSLGYCS-----  76

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
              Y+G+   DPEPGRCRRTDGKKWRCS+D     KYCERHMHRGRNRSRKPVE
Sbjct  77   --YYGKK-FDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  126



>gb|EYU25864.1| hypothetical protein MIMGU_mgv1a010559mg [Erythranthe guttata]
Length=309

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QAL++++M+ G P+PP+LL  +++S  +         LH +      S 
Sbjct  16   FTPSQWQELEHQALVYKYMVYGIPIPPDLLFTIRRSLHHHHSSSTTFLLHHHHSGSWNSF  75

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
               +G+  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRGRNRSRKPVE
Sbjct  76   NMGFGKK-IDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE  127



>gb|KHG19107.1| hypothetical protein F383_07760 [Gossypium arboreum]
Length=375

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 76/114 (67%), Gaps = 2/114 (2%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  Q+QELE QALIF++M++G P+PP+LL  +K+S  +++                   
Sbjct  10   FTASQYQELEHQALIFKYMVSGIPIPPDLLFTIKRSCLDTSLSSRLFSYQPQHIGWNCFQ  69

Query  226  PWYWGRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
                GR  +DPEPGRCRRTDGKKWRCS++     KYCERHMHRG+NRSRKPVE+
Sbjct  70   -MGLGRK-VDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVEV  121



>ref|XP_008786732.1| PREDICTED: growth-regulating factor 1-like, partial [Phoenix 
dactylifera]
Length=150

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 76/119 (64%), Gaps = 9/119 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALIF++M +G P+P +L+  +++S    +    P            S 
Sbjct  12   FTPSQWQELEHQALIFKYMASGIPIPSDLILPLRRSYLLDSTITSPTLGFPPQ----PSM  67

Query  226  PWYW-----GRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVEI  65
             W W     GR A DPEPGRCRRTDGKKWRC+++     KYCERHMHRG+NRSRKPVE+
Sbjct  68   SWGWNQVGFGRKADDPEPGRCRRTDGKKWRCAKEAYPDSKYCERHMHRGKNRSRKPVEM  126



>ref|XP_008780324.1| PREDICTED: growth-regulating factor 1-like, partial [Phoenix 
dactylifera]
Length=125

 Score =   116 bits (290),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 75/118 (64%), Gaps = 9/118 (8%)
 Frame = -2

Query  406  FSLGQWQELELQALIFRHMIAGAPVPPELLHLVKKSPFNSApyyfphplhqyphyhPASA  227
            F+  QWQELE QALIF++M +G P+P +L+  +++S    +    P            S 
Sbjct  12   FTPSQWQELEHQALIFKYMASGIPIPSDLVLPLRRSFLLDSTIPSPTLAFHPQ----PSM  67

Query  226  PWYW-----GRAAMDPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGRNRSRKPVE  68
             W W     GR A DPEPGRCRRTDGKKWRCS++     KYCERHMHRG+NRSRKPVE
Sbjct  68   SWGWNQKGFGRKAEDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE  125



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800