BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP009D02 400 bp,:Filtered

Length=318
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP10566.1|  unnamed protein product                                133   2e-34   Coffea canephora [robusta coffee]
gb|AGN92422.1|  putative fasciclin-like arabinogalactan protein 2       126   6e-32   Centaurium erythraea
ref|XP_004249393.1|  PREDICTED: fasciclin-like arabinogalactan pr...    124   4e-31   Solanum lycopersicum
ref|XP_009587619.1|  PREDICTED: fasciclin-like arabinogalactan pr...    124   5e-31   Nicotiana tomentosiformis
ref|XP_006339181.1|  PREDICTED: fasciclin-like arabinogalactan pr...    123   5e-31   Solanum tuberosum [potatoes]
ref|XP_009794483.1|  PREDICTED: fasciclin-like arabinogalactan pr...    122   1e-30   Nicotiana sylvestris
ref|XP_009141525.1|  PREDICTED: fasciclin-like arabinogalactan pr...    120   5e-30   Brassica rapa
gb|EYU18152.1|  hypothetical protein MIMGU_mgv1a003573mg                121   7e-30   Erythranthe guttata [common monkey flower]
gb|AAD21471.1|  unknown protein                                         120   9e-30   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850253.1|  fasciclin-like arabinogalactan protein 16             119   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002524094.1|  conserved hypothetical protein                     119   2e-29   Ricinus communis
ref|XP_002270321.1|  PREDICTED: fasciclin-like arabinogalactan pr...    118   4e-29   Vitis vinifera
gb|KFK36481.1|  hypothetical protein AALP_AA4G130300                    118   4e-29   Arabis alpina [alpine rockcress]
ref|XP_010534382.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   8e-29   Tarenaya hassleriana [spider flower]
ref|XP_010516833.1|  PREDICTED: fasciclin-like arabinogalactan pr...    116   9e-29   Camelina sativa [gold-of-pleasure]
ref|XP_006410756.1|  hypothetical protein EUTSA_v10016656mg             117   9e-29   Eutrema salsugineum
ref|XP_006294220.1|  hypothetical protein CARUB_v10023217mg             117   9e-29   Capsella rubella
ref|XP_010557991.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   1e-28   Tarenaya hassleriana [spider flower]
ref|XP_002270606.1|  PREDICTED: fasciclin-like arabinogalactan pr...    116   2e-28   Vitis vinifera
gb|EPS67882.1|  hypothetical protein M569_06891                         116   2e-28   Genlisea aurea
ref|XP_009783700.1|  PREDICTED: fasciclin-like arabinogalactan pr...    114   8e-28   Nicotiana sylvestris
ref|XP_011047143.1|  PREDICTED: fasciclin-like arabinogalactan pr...    114   8e-28   Populus euphratica
ref|XP_002309262.1|  hypothetical protein POPTR_0006s21460g             114   8e-28   Populus trichocarpa [western balsam poplar]
ref|XP_002322769.2|  hypothetical protein POPTR_0016s06680g             114   9e-28   Populus trichocarpa [western balsam poplar]
dbj|BAJ97817.1|  predicted protein                                      113   2e-27   Hordeum vulgare subsp. vulgare [barley]
dbj|BAJ98684.1|  predicted protein                                      113   2e-27   Hordeum vulgare subsp. vulgare [barley]
gb|ABI95415.1|  fasciclin-like protein FLA25                            113   2e-27   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009595093.1|  PREDICTED: fasciclin-like arabinogalactan pr...    113   3e-27   Nicotiana tomentosiformis
ref|XP_011042549.1|  PREDICTED: fasciclin-like arabinogalactan pr...    113   4e-27   Populus euphratica
ref|XP_002315410.2|  hypothetical protein POPTR_0010s25110g             112   5e-27   Populus trichocarpa [western balsam poplar]
gb|KFK34484.1|  hypothetical protein AALP_AA5G151600                    112   5e-27   Arabis alpina [alpine rockcress]
gb|ABV27485.1|  fasciclin-like arabinogalactan protein 14               112   6e-27   Gossypium hirsutum [American cotton]
ref|XP_008442961.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   8e-27   Cucumis melo [Oriental melon]
ref|XP_010938934.1|  PREDICTED: LOW QUALITY PROTEIN: fasciclin-li...    110   2e-26   Elaeis guineensis
gb|KHG00930.1|  Fasciclin-like arabinogalactan protein 17               110   3e-26   Gossypium arboreum [tree cotton]
gb|KHG10334.1|  Fasciclin-like arabinogalactan protein 17               110   3e-26   Gossypium arboreum [tree cotton]
gb|KJB73327.1|  hypothetical protein B456_011G228300                    110   3e-26   Gossypium raimondii
gb|ABV27487.1|  fasciclin-like arabinogalactan protein 16               110   3e-26   Gossypium hirsutum [American cotton]
gb|ABV27486.1|  fasciclin-like arabinogalactan protein 15               110   3e-26   Gossypium hirsutum [American cotton]
gb|KJB78512.1|  hypothetical protein B456_013G003200                    110   3e-26   Gossypium raimondii
gb|KJB73326.1|  hypothetical protein B456_011G228300                    110   4e-26   Gossypium raimondii
ref|XP_002463768.1|  hypothetical protein SORBIDRAFT_01g005770          110   5e-26   Sorghum bicolor [broomcorn]
ref|XP_004228680.1|  PREDICTED: fasciclin-like arabinogalactan pr...    109   5e-26   Solanum lycopersicum
ref|XP_007010508.1|  FASCICLIN-like arabinogalactan protein 16 pr...    109   5e-26   Theobroma cacao [chocolate]
ref|XP_006348432.1|  PREDICTED: fasciclin-like arabinogalactan pr...    109   6e-26   Solanum tuberosum [potatoes]
ref|XP_003559349.1|  PREDICTED: fasciclin-like arabinogalactan pr...    109   8e-26   Brachypodium distachyon [annual false brome]
gb|ABI95416.1|  fasciclin-like protein FLA26                            108   1e-25   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003557575.1|  PREDICTED: fasciclin-like arabinogalactan pr...    109   1e-25   Brachypodium distachyon [annual false brome]
ref|XP_004136532.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   1e-25   Cucumis sativus [cucumbers]
gb|ABI95417.1|  fasciclin-like protein FLA27                            108   1e-25   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004167872.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   1e-25   
ref|XP_006388223.1|  hypothetical protein POPTR_0276s00200g             106   2e-25   Populus trichocarpa [western balsam poplar]
gb|ABI95409.1|  fasciclin-like protein FLA19                            108   2e-25   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010045160.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   2e-25   Eucalyptus grandis [rose gum]
ref|XP_011024125.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   3e-25   Populus euphratica
ref|XP_006388929.1|  hypothetical protein POPTR_0073s00210g             107   3e-25   Populus trichocarpa [western balsam poplar]
ref|XP_004955500.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   7e-25   Setaria italica
ref|XP_002515862.1|  conserved hypothetical protein                     106   9e-25   Ricinus communis
ref|XP_011032963.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   2e-24   Populus euphratica
ref|XP_010486838.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   2e-24   Camelina sativa [gold-of-pleasure]
ref|NP_196257.2|  fasciclin-like arabinogalactan protein 17 precu...    105   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297639.1|  hypothetical protein CARUB_v10013670mg             105   2e-24   Capsella rubella
ref|XP_010464900.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010423345.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010497995.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010452564.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   2e-24   Camelina sativa [gold-of-pleasure]
gb|AEN82905.1|  AT5G06390-like protein                                  102   2e-24   Capsella rubella
dbj|BAB08961.1|  unnamed protein product                                105   2e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AEN82899.1|  AT5G06390-like protein                                  102   3e-24   Capsella grandiflora
emb|CDY55758.1|  BnaA03g55350D                                          105   3e-24   Brassica napus [oilseed rape]
ref|XP_006399110.1|  hypothetical protein EUTSA_v10013481mg             103   6e-24   Eutrema salsugineum
ref|XP_002871217.1|  beta-Ig-H3 domain-containing protein               104   6e-24   Arabidopsis lyrata subsp. lyrata
ref|XP_006399111.1|  hypothetical protein EUTSA_v10013481mg             103   8e-24   Eutrema salsugineum
ref|XP_004506247.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   8e-24   Cicer arietinum [garbanzo]
ref|XP_006379436.1|  hypothetical protein POPTR_0008s013101g            102   1e-23   Populus trichocarpa [western balsam poplar]
ref|XP_006379435.1|  hypothetical protein POPTR_0008s013101g            102   1e-23   Populus trichocarpa [western balsam poplar]
ref|XP_006287712.1|  hypothetical protein CARUB_v10000921mg             103   2e-23   Capsella rubella
ref|XP_008450315.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   2e-23   Cucumis melo [Oriental melon]
gb|EYU38707.1|  hypothetical protein MIMGU_mgv1a006053mg                102   2e-23   Erythranthe guttata [common monkey flower]
ref|XP_010491197.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   3e-23   Camelina sativa [gold-of-pleasure]
emb|CDX81004.1|  BnaC03g02580D                                          102   3e-23   Brassica napus [oilseed rape]
emb|CDY01050.1|  BnaC05g41500D                                          100   9e-23   Brassica napus [oilseed rape]
gb|AAF02137.1|AC009918_9  unknown protein                               100   1e-22   Arabidopsis thaliana [mouse-ear cress]
gb|KDP42957.1|  hypothetical protein JCGZ_23899                         100   1e-22   Jatropha curcas
ref|NP_566398.1|  FASCICLIN-like arabinogalactan protein 18 precu...    100   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004154697.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.4    2e-22   
emb|CDY32082.1|  BnaC04g44840D                                        99.8    2e-22   Brassica napus [oilseed rape]
emb|CDY40429.1|  BnaA04g20880D                                        99.8    2e-22   Brassica napus [oilseed rape]
ref|XP_004139069.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.8    3e-22   
ref|XP_011094205.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.8    3e-22   Sesamum indicum [beniseed]
ref|XP_011077777.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.4    3e-22   Sesamum indicum [beniseed]
ref|XP_009146690.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.0    5e-22   Brassica rapa
ref|XP_002882744.1|  beta-Ig-H3 domain-containing protein             99.0    5e-22   Arabidopsis lyrata subsp. lyrata
gb|KDO48671.1|  hypothetical protein CISIN_1g013434mg                 98.6    5e-22   Citrus sinensis [Valencia orange]
ref|XP_006445815.1|  hypothetical protein CICLE_v10015097mg           98.6    8e-22   Citrus clementina
ref|XP_002876139.1|  beta-Ig-H3 domain-containing protein             97.1    2e-21   Arabidopsis lyrata subsp. lyrata
ref|XP_010553413.1|  PREDICTED: fasciclin-like arabinogalactan pr...  97.1    3e-21   Tarenaya hassleriana [spider flower]
ref|XP_007132513.1|  hypothetical protein PHAVU_011G100600g           96.7    3e-21   Phaseolus vulgaris [French bean]
ref|XP_010543842.1|  PREDICTED: fasciclin-like arabinogalactan pr...  96.7    3e-21   Tarenaya hassleriana [spider flower]
ref|NP_190805.1|  fasciclin-like arabinogalactan protein 15           96.3    4e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403811.1|  hypothetical protein EUTSA_v10010381mg           96.3    4e-21   Eutrema salsugineum
ref|XP_006291159.1|  hypothetical protein CARUB_v10017276mg           95.9    5e-21   Capsella rubella
ref|XP_004296276.1|  PREDICTED: fasciclin-like arabinogalactan pr...  96.3    5e-21   Fragaria vesca subsp. vesca
ref|XP_006495395.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.7    6e-21   Citrus sinensis [Valencia orange]
ref|XP_010431275.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.0    6e-21   Camelina sativa [gold-of-pleasure]
gb|KDO70682.1|  hypothetical protein CISIN_1g019153mg                 94.4    1e-20   Citrus sinensis [Valencia orange]
ref|XP_010525828.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.5    1e-20   Tarenaya hassleriana [spider flower]
gb|KDP36078.1|  hypothetical protein JCGZ_08722                       95.5    1e-20   Jatropha curcas
ref|XP_006592365.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.1    1e-20   Glycine max [soybeans]
ref|XP_009139464.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.7    1e-20   Brassica rapa
emb|CDY23209.1|  BnaA04g05500D                                        94.7    1e-20   Brassica napus [oilseed rape]
emb|CDX95333.1|  BnaC04g28250D                                        94.7    2e-20   Brassica napus [oilseed rape]
ref|XP_010516793.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.7    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010509549.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.7    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_006407421.1|  hypothetical protein EUTSA_v10020679mg           94.7    2e-20   Eutrema salsugineum
ref|XP_006481636.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.7    2e-20   Citrus sinensis [Valencia orange]
ref|XP_006430020.1|  hypothetical protein CICLE_v10011703mg           94.7    2e-20   Citrus clementina
ref|XP_002879581.1|  predicted protein                                94.4    2e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_010505110.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.7    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010426853.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.0    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010503981.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.0    3e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010515698.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.0    3e-20   Camelina sativa [gold-of-pleasure]
ref|XP_004303393.1|  PREDICTED: fasciclin-like arabinogalactan pr...  93.6    5e-20   Fragaria vesca subsp. vesca
ref|XP_009387789.1|  PREDICTED: fasciclin-like arabinogalactan pr...  93.6    6e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388984.1|  PREDICTED: fasciclin-like arabinogalactan pr...  93.2    8e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003554480.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.8    1e-19   Glycine max [soybeans]
ref|XP_010263095.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.8    1e-19   Nelumbo nucifera [Indian lotus]
tpg|DAA51812.1|  TPA: hypothetical protein ZEAMMB73_870378            90.9    1e-19   Zea mays [maize]
ref|XP_010110455.1|  hypothetical protein L484_006448                 92.0    2e-19   Morus notabilis
emb|CDX79631.1|  BnaC03g19670D                                        91.7    2e-19   Brassica napus [oilseed rape]
ref|XP_003521503.1|  PREDICTED: fasciclin-like arabinogalactan pr...  91.3    3e-19   Glycine max [soybeans]
ref|NP_001130335.1|  uncharacterized protein LOC100191430 precursor   91.3    4e-19   Zea mays [maize]
tpg|DAA51813.1|  TPA: LOW QUALITY PROTEIN: fasciclin domain protein   91.3    4e-19   Zea mays [maize]
ref|XP_006826417.1|  hypothetical protein AMTR_s00004p00159330        91.3    4e-19   Amborella trichopoda
ref|XP_004494272.1|  PREDICTED: fasciclin-like arabinogalactan pr...  90.9    5e-19   
ref|XP_004494271.1|  PREDICTED: fasciclin-like arabinogalactan pr...  90.9    6e-19   
ref|XP_009133050.1|  PREDICTED: fasciclin-like arabinogalactan pr...  90.5    6e-19   Brassica rapa
emb|CDX84594.1|  BnaA03g16360D                                        90.5    7e-19   Brassica napus [oilseed rape]
ref|XP_007204352.1|  hypothetical protein PRUPE_ppa005721mg           89.7    1e-18   Prunus persica
ref|XP_007163001.1|  hypothetical protein PHAVU_001G197900g           89.4    2e-18   Phaseolus vulgaris [French bean]
ref|XP_008241098.1|  PREDICTED: fasciclin-like arabinogalactan pr...  89.4    2e-18   Prunus mume [ume]
gb|KEH24284.1|  fasciclin-like arabinogalactan protein 16 precursor   89.0    2e-18   Medicago truncatula
ref|XP_008803482.1|  PREDICTED: LOW QUALITY PROTEIN: fasciclin-li...  89.0    3e-18   Phoenix dactylifera
gb|KJB36231.1|  hypothetical protein B456_006G147500                  85.9    1e-17   Gossypium raimondii
ref|XP_008392004.1|  PREDICTED: fasciclin-like arabinogalactan pr...  86.7    2e-17   Malus domestica [apple tree]
emb|CDY08502.1|  BnaA05g27380D                                        85.9    3e-17   Brassica napus [oilseed rape]
ref|XP_007028043.1|  FASCICLIN-like arabinogalactan protein 17 pr...  85.5    4e-17   Theobroma cacao [chocolate]
gb|KJB36232.1|  hypothetical protein B456_006G147500                  85.5    4e-17   Gossypium raimondii
gb|KJB36230.1|  hypothetical protein B456_006G147500                  85.5    4e-17   Gossypium raimondii
ref|XP_008798695.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.5    5e-17   Phoenix dactylifera
ref|XP_009130939.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.5    5e-17   Brassica rapa
gb|KEH29726.1|  fasciclin-like arabinogalactan protein 16 precursor   85.5    5e-17   Medicago truncatula
gb|KHG03559.1|  Fasciclin-like arabinogalactan protein 17             85.5    5e-17   Gossypium arboreum [tree cotton]
dbj|BAE71191.1|  hypothetical protein                                 84.7    9e-17   Trifolium pratense [peavine clover]
ref|XP_003543398.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.7    9e-17   Glycine max [soybeans]
gb|KCW90412.1|  hypothetical protein EUGRSUZ_A02551                   84.3    1e-16   Eucalyptus grandis [rose gum]
gb|AAT75258.1|  expressed protein                                     84.3    1e-16   Oryza sativa Japonica Group [Japonica rice]
gb|KCW90413.1|  hypothetical protein EUGRSUZ_A02551                   84.3    1e-16   Eucalyptus grandis [rose gum]
ref|NP_001051505.1|  Os03g0788700                                     84.3    1e-16   
ref|XP_010058812.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.0    1e-16   Eucalyptus grandis [rose gum]
emb|CDX98919.1|  BnaC09g49160D                                        84.0    1e-16   Brassica napus [oilseed rape]
gb|AAO24903.1|  putative arabinogalactan-protein                      84.3    2e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EAY92117.1|  hypothetical protein OsI_13824                        84.3    2e-16   Oryza sativa Indica Group [Indian rice]
emb|CDY57989.1|  BnaA10g30360D                                        84.0    2e-16   Brassica napus [oilseed rape]
ref|XP_009122246.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.0    2e-16   Brassica rapa
ref|XP_007150000.1|  hypothetical protein PHAVU_005G117500g           84.0    2e-16   Phaseolus vulgaris [French bean]
ref|XP_009121226.1|  PREDICTED: fasciclin-like arabinogalactan pr...  83.6    2e-16   Brassica rapa
ref|XP_003540278.1|  PREDICTED: fasciclin-like arabinogalactan pr...  82.8    4e-16   Glycine max [soybeans]
ref|XP_009348615.1|  PREDICTED: fasciclin-like arabinogalactan pr...  81.6    1e-15   Pyrus x bretschneideri [bai li]
ref|XP_009362660.1|  PREDICTED: fasciclin-like arabinogalactan pr...  81.3    2e-15   Pyrus x bretschneideri [bai li]
ref|XP_004981498.1|  PREDICTED: fasciclin-like arabinogalactan pr...  80.5    3e-15   Setaria italica
gb|ACG39696.1|  fasciclin domain                                      80.5    3e-15   Zea mays [maize]
ref|NP_001159324.1|  uncharacterized protein LOC100304417 precursor   80.5    3e-15   Zea mays [maize]
ref|XP_003596932.1|  Fasciclin-like arabinogalactan protein           80.1    4e-15   Medicago truncatula
gb|EEC81554.1|  hypothetical protein OsI_24980                        80.1    4e-15   Oryza sativa Indica Group [Indian rice]
gb|EAZ38767.1|  hypothetical protein OsJ_23169                        80.1    4e-15   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058941.1|  Os07g0160600                                     80.1    4e-15   
ref|XP_010677585.1|  PREDICTED: fasciclin-like arabinogalactan pr...  79.7    4e-15   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|NP_001051504.1|  Os03g0788600                                     80.1    5e-15   
ref|XP_009399002.1|  PREDICTED: fasciclin-like arabinogalactan pr...  79.7    5e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004487436.1|  PREDICTED: fasciclin-like arabinogalactan pr...  79.0    9e-15   Cicer arietinum [garbanzo]
ref|XP_008387142.1|  PREDICTED: fasciclin-like arabinogalactan pr...  78.2    2e-14   Malus domestica [apple tree]
ref|XP_002444260.1|  hypothetical protein SORBIDRAFT_07g019123        75.5    2e-14   Sorghum bicolor [broomcorn]
ref|XP_006663458.1|  PREDICTED: uncharacterized protein LOC102717475  77.8    2e-14   
ref|XP_002454878.1|  hypothetical protein SORBIDRAFT_03g000685        75.1    3e-14   Sorghum bicolor [broomcorn]
ref|XP_002448333.1|  hypothetical protein SORBIDRAFT_06g025350        74.7    7e-14   Sorghum bicolor [broomcorn]
ref|XP_010248022.1|  PREDICTED: fasciclin-like arabinogalactan pr...  75.9    1e-13   Nelumbo nucifera [Indian lotus]
ref|XP_010685474.1|  PREDICTED: fasciclin-like arabinogalactan pr...  75.1    2e-13   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_011076879.1|  PREDICTED: fasciclin-like arabinogalactan pr...  74.7    4e-13   Sesamum indicum [beniseed]
ref|XP_006651891.1|  PREDICTED: LOW QUALITY PROTEIN: fasciclin-li...  73.9    6e-13   
ref|XP_006487826.1|  PREDICTED: fasciclin-like arabinogalactan pr...  72.4    2e-12   Citrus sinensis [Valencia orange]
ref|XP_010090522.1|  hypothetical protein L484_017146                 72.4    2e-12   Morus notabilis
ref|XP_002461483.1|  hypothetical protein SORBIDRAFT_02g003410        71.6    4e-12   Sorghum bicolor [broomcorn]
ref|XP_003527510.1|  PREDICTED: fasciclin-like arabinogalactan pr...  70.5    8e-12   Glycine max [soybeans]
gb|KDO48944.1|  hypothetical protein CISIN_1g043668mg                 69.3    2e-11   Citrus sinensis [Valencia orange]
ref|XP_010917919.1|  PREDICTED: fasciclin-like arabinogalactan pr...  66.2    4e-10   Elaeis guineensis
ref|XP_008790162.1|  PREDICTED: fasciclin-like arabinogalactan pr...  64.3    2e-09   Phoenix dactylifera
gb|EPS68119.1|  hypothetical protein M569_06649                       60.8    2e-08   Genlisea aurea
gb|EYU19863.1|  hypothetical protein MIMGU_mgv1a006599mg              60.1    4e-08   Erythranthe guttata [common monkey flower]
gb|ABK25415.1|  unknown                                               58.5    1e-07   Picea sitchensis
ref|XP_010685475.1|  PREDICTED: fasciclin-like arabinogalactan pr...  52.4    1e-05   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_006424052.1|  hypothetical protein CICLE_v10030024mg           49.7    1e-04   Citrus clementina



>emb|CDP10566.1| unnamed protein product [Coffea canephora]
Length=474

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = -1

Query  318  HPSLCRGAGDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNT  139
            H SLC+ A DE+  +S RNG+  +S A++ + +D+VRPDGIIHGIERVLIP+SVQ DFN+
Sbjct  150  HTSLCKDAFDESLRISHRNGDDHISVARIFKPNDIVRPDGIIHGIERVLIPKSVQQDFNS  209

Query  138  RRSLRSISAVLPTGAPEVDPRTHRLKKP-SPVPAGAPPVLPIYDAM  4
            RRSLR+ISAVLP GAPEVDPRTHRLKKP SP PAG+PP LPIYDAM
Sbjct  210  RRSLRAISAVLPEGAPEVDPRTHRLKKPASPAPAGSPPALPIYDAM  255



>gb|AGN92422.1| putative fasciclin-like arabinogalactan protein 2 [Centaurium 
erythraea]
Length=461

 Score =   126 bits (316),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = -1

Query  318  HPSLCRGAGDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNT  139
            H SLC+ +  E   +S +NGE+ VS AK+ R DDV+RPDGIIHGIER+LIP+SVQ DFN+
Sbjct  135  HSSLCKESSXEILKISNKNGEKIVSGAKITRPDDVIRPDGIIHGIERLLIPKSVQQDFNS  194

Query  138  RRSLRSISAVLPTGAPEVDPRTHRLKKP-SPVPAGAPPVLPIYD  10
            RRSLRSISAV+P GAPE+DPRTHRLKKP SPVP GAPPVLP+YD
Sbjct  195  RRSLRSISAVIPQGAPEIDPRTHRLKKPASPVPVGAPPVLPVYD  238



>ref|XP_004249393.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Solanum 
lycopersicum]
Length=449

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 86/99 (87%), Gaps = 1/99 (1%)
 Frame = -1

Query  297  AGDENP-AVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNTRRSLRS  121
            AG+EN   +S +  E+ VS+AK+++ DD+V+PDGIIHGIERVLIP+SVQ DFN RRSLRS
Sbjct  141  AGEENVLQISDKKTEKSVSSAKIIKQDDIVKPDGIIHGIERVLIPKSVQQDFNNRRSLRS  200

Query  120  ISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPVLPIYDAM  4
            ISAVLP GAPEVDPRTHRLKKP  VPAGAPPVLP+YDA+
Sbjct  201  ISAVLPEGAPEVDPRTHRLKKPVSVPAGAPPVLPVYDAL  239



>ref|XP_009587619.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Nicotiana 
tomentosiformis]
Length=449

 Score =   124 bits (310),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 91/107 (85%), Gaps = 4/107 (4%)
 Frame = -1

Query  318  HPSLCRGAGDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNT  139
            H +LC   GDE+ +V ++NG+R VS AKV+RADD+++PDGIIHGIERVLIP+SVQ DFNT
Sbjct  136  HSTLC--PGDEHISVLRKNGDRMVSMAKVIRADDIIKPDGIIHGIERVLIPKSVQQDFNT  193

Query  138  RRSLRSISAVLPTGAPEVDPRTHRLKKP--SPVPAGAPPVLPIYDAM  4
            RRSLRSISAVLP GAPEVDPRT+RLKK    PVPAG PPVLPIY AM
Sbjct  194  RRSLRSISAVLPEGAPEVDPRTNRLKKKPTIPVPAGEPPVLPIYSAM  240



>ref|XP_006339181.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like [Solanum 
tuberosum]
Length=453

 Score =   123 bits (309),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 87/99 (88%), Gaps = 1/99 (1%)
 Frame = -1

Query  297  AGDENP-AVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNTRRSLRS  121
            AG+EN   +S++  E+ VS+AK+++ DD+V+PDGIIHGIERVLIP+SVQ DFN RRSLRS
Sbjct  141  AGEENVLQISEKKTEKSVSSAKIIKQDDIVKPDGIIHGIERVLIPKSVQQDFNNRRSLRS  200

Query  120  ISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPVLPIYDAM  4
            ISAV+P GAPEVDPRTHRLKKP  VPAGAPPVLP+YDA+
Sbjct  201  ISAVIPEGAPEVDPRTHRLKKPVAVPAGAPPVLPVYDAL  239



>ref|XP_009794483.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Nicotiana 
sylvestris]
Length=449

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 91/107 (85%), Gaps = 4/107 (4%)
 Frame = -1

Query  318  HPSLCRGAGDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNT  139
            H +LC   GDE  +V +++G+R VS AKV+RADD+++PDGIIHGIERVLIP+SVQ DFNT
Sbjct  136  HSTLC--PGDERISVLRKSGDRMVSMAKVIRADDIIKPDGIIHGIERVLIPKSVQQDFNT  193

Query  138  RRSLRSISAVLPTGAPEVDPRTHRLKKP--SPVPAGAPPVLPIYDAM  4
            RRSLRSISAVLP GAPEVDPRT+RLKK    PVPAGAPPVLPIY AM
Sbjct  194  RRSLRSISAVLPEGAPEVDPRTNRLKKKPTIPVPAGAPPVLPIYSAM  240



>ref|XP_009141525.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Brassica 
rapa]
Length=443

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPVL  22
            GIIHGIER+LIP+SVQ DFN RRSLRSISAVLP GAPEVDPRTHRLKKP+ VPAGAPPVL
Sbjct  164  GIIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEVDPRTHRLKKPASVPAGAPPVL  223

Query  21   PIYDAMA  1
            P+YDAM+
Sbjct  224  PVYDAMS  230



>gb|EYU18152.1| hypothetical protein MIMGU_mgv1a003573mg [Erythranthe guttata]
 gb|EYU18153.1| hypothetical protein MIMGU_mgv1a003573mg [Erythranthe guttata]
Length=576

 Score =   121 bits (304),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 90/108 (83%), Gaps = 2/108 (2%)
 Frame = -1

Query  318  HPSLCRGA-GDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFN  142
            H SLCR A G+    + Q+NG++ VS A+V+++DD+VRPDG+IHGIER+LIP+SVQ DFN
Sbjct  257  HASLCRDANGERIQLIVQKNGDKAVSTARVIKSDDIVRPDGVIHGIERLLIPKSVQQDFN  316

Query  141  TRRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPVLPIYDAMA  1
             RRSL + SAV+P GAPEVDPRTHRLKKP+ PV AGAPP LPIYDAM+
Sbjct  317  ARRSLAATSAVIPEGAPEVDPRTHRLKKPAPPVSAGAPPALPIYDAMS  364



>gb|AAD21471.1| unknown protein [Arabidopsis thaliana]
Length=475

 Score =   120 bits (301),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSP-VPAGAPPV  25
            GIIHGIER+LIP+SVQ DFN RRSLRSISAV+P GAPEVDPRTHRLKKPSP VPAGAPPV
Sbjct  164  GIIHGIERLLIPRSVQEDFNRRRSLRSISAVIPEGAPEVDPRTHRLKKPSPAVPAGAPPV  223

Query  24   LPIYDAMA  1
            LPIYDAM+
Sbjct  224  LPIYDAMS  231



>ref|NP_850253.1| fasciclin-like arabinogalactan protein 16 [Arabidopsis thaliana]
 sp|Q8RWC5.1|FLA16_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 16; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAM13188.1| unknown protein [Arabidopsis thaliana]
 gb|AAP31934.1| At2g35860 [Arabidopsis thaliana]
 gb|AEC09172.1| fasciclin-like arabinogalactan protein 16 [Arabidopsis thaliana]
Length=445

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSP-VPAGAPPV  25
            GIIHGIER+LIP+SVQ DFN RRSLRSISAV+P GAPEVDPRTHRLKKPSP VPAGAPPV
Sbjct  164  GIIHGIERLLIPRSVQEDFNRRRSLRSISAVIPEGAPEVDPRTHRLKKPSPAVPAGAPPV  223

Query  24   LPIYDAMA  1
            LPIYDAM+
Sbjct  224  LPIYDAMS  231



>ref|XP_002524094.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38304.1| conserved hypothetical protein [Ricinus communis]
Length=462

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 62/67 (93%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKP-SPVPAGAPPV  25
            G+IHGIER+LIPQSVQ DFN RRSLRSISAVLP GAPEVDPRTHRLKKP +PVP GAPPV
Sbjct  176  GVIHGIERLLIPQSVQEDFNRRRSLRSISAVLPEGAPEVDPRTHRLKKPAAPVPVGAPPV  235

Query  24   LPIYDAM  4
            LPIYDAM
Sbjct  236  LPIYDAM  242



>ref|XP_002270321.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Vitis vinifera]
Length=466

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPVL  22
            G+IHGIER+LIP+SV+ DFN RRSLRSISAVLP GAPEVDPRTHRLKKP  VPAGAPPVL
Sbjct  181  GVIHGIERLLIPRSVEEDFNRRRSLRSISAVLPEGAPEVDPRTHRLKKPVSVPAGAPPVL  240

Query  21   PIYDAM  4
            PIYDAM
Sbjct  241  PIYDAM  246



>gb|KFK36481.1| hypothetical protein AALP_AA4G130300 [Arabis alpina]
Length=447

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 64/68 (94%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPV  25
            GIIHGIER+LIP+SVQ DFN RRSLRSISAV+P GAPEVDPRTHRLKKPS PVPAG+PPV
Sbjct  165  GIIHGIERLLIPRSVQEDFNRRRSLRSISAVIPEGAPEVDPRTHRLKKPSPPVPAGSPPV  224

Query  24   LPIYDAMA  1
            LPIYDAM+
Sbjct  225  LPIYDAMS  232



>ref|XP_010534382.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Tarenaya 
hassleriana]
Length=468

 Score =   117 bits (294),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 82/92 (89%), Gaps = 2/92 (2%)
 Frame = -1

Query  273  SQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGA  94
            +++NG+R V +A+V+R DDV RPDG+IHGIER+LIP+SVQ  FN RRSLRSISAVLPTGA
Sbjct  155  TEKNGKRMVDSAEVIRPDDVTRPDGVIHGIERLLIPRSVQESFNRRRSLRSISAVLPTGA  214

Query  93   PEVDPRTHRLKKPS--PVPAGAPPVLPIYDAM  4
            PEVDPRTHRLKKPS   VPAGAPPVLPIYDAM
Sbjct  215  PEVDPRTHRLKKPSAASVPAGAPPVLPIYDAM  246



>ref|XP_010516833.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Camelina 
sativa]
Length=325

 Score =   116 bits (290),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSP-VPAGAPPV  25
            GIIHGIER+LIP+SVQ DFN RRSLRSISAV+P GAPEVDPRTHRLKKP+P VPAG+PPV
Sbjct  164  GIIHGIERLLIPRSVQEDFNHRRSLRSISAVIPEGAPEVDPRTHRLKKPAPAVPAGSPPV  223

Query  24   LPIYDAMA  1
            LPIYDAM+
Sbjct  224  LPIYDAMS  231



>ref|XP_006410756.1| hypothetical protein EUTSA_v10016656mg [Eutrema salsugineum]
 gb|ESQ52209.1| hypothetical protein EUTSA_v10016656mg [Eutrema salsugineum]
Length=446

 Score =   117 bits (293),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPV  25
            GIIHGIER+LIP+SVQ DFN RRSLRSISAVLP GAPEVDPRTHRLKKP+ PVPAG+PPV
Sbjct  165  GIIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEVDPRTHRLKKPAPPVPAGSPPV  224

Query  24   LPIYDAMA  1
            LP+YDAM+
Sbjct  225  LPVYDAMS  232



>ref|XP_006294220.1| hypothetical protein CARUB_v10023217mg [Capsella rubella]
 gb|EOA27118.1| hypothetical protein CARUB_v10023217mg [Capsella rubella]
Length=445

 Score =   117 bits (293),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSP-VPAGAPPV  25
            GIIHGIER+LIP+SVQ DFN RRSLRSISAV+P GAPEVDPRTHRLKKP+P VPAGAPPV
Sbjct  164  GIIHGIERLLIPRSVQEDFNRRRSLRSISAVIPEGAPEVDPRTHRLKKPAPSVPAGAPPV  223

Query  24   LPIYDAMA  1
            LPI+DAM+
Sbjct  224  LPIFDAMS  231



>ref|XP_010557991.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Tarenaya 
hassleriana]
Length=469

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 62/68 (91%), Gaps = 2/68 (3%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPS--PVPAGAPP  28
            G+IHGIER+LIP+SVQ DFN RRSLR ISAVLPTGAPEVDPRTHRLKKPS   VP+GAPP
Sbjct  184  GVIHGIERLLIPRSVQADFNRRRSLREISAVLPTGAPEVDPRTHRLKKPSSAAVPSGAPP  243

Query  27   VLPIYDAM  4
            VLPIYDAM
Sbjct  244  VLPIYDAM  251



>ref|XP_002270606.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Vitis vinifera]
Length=466

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPVL  22
            G+IHGIER+LIP SV+ DFN RRSLRSISAVLP GAPEVDPRTHRLKK  PVPAGAPPVL
Sbjct  181  GVIHGIERLLIPLSVEEDFNRRRSLRSISAVLPEGAPEVDPRTHRLKKVLPVPAGAPPVL  240

Query  21   PIYDAM  4
            PIYDAM
Sbjct  241  PIYDAM  246



>gb|EPS67882.1| hypothetical protein M569_06891, partial [Genlisea aurea]
Length=475

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 85/104 (82%), Gaps = 1/104 (1%)
 Frame = -1

Query  318  HPSLCRGAGDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNT  139
            H SLCR    E   +++ NGE+ V  ++V+++DDVVRPDGIIHGIER+L+P+SV+ +FN 
Sbjct  155  HSSLCRDGNGEKIRLNENNGEKTVGISRVIKSDDVVRPDGIIHGIERILVPKSVEQEFNA  214

Query  138  RRSLRSISAVLPTGAPEVDPRTHRLKKPSP-VPAGAPPVLPIYD  10
            RRSL S +AV+P GAPE+DPRTHRLKKP+P VP GAPPVLPIYD
Sbjct  215  RRSLTSTAAVIPQGAPEIDPRTHRLKKPAPTVPVGAPPVLPIYD  258



>ref|XP_009783700.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Nicotiana 
sylvestris]
Length=454

 Score =   114 bits (286),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -1

Query  294  GDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNTRRSLRSIS  115
            GDEN  V Q+NGE+ VS+A +++ DD+++PDG+IHGIERVLIP+SVQ DFNTRRSLRSIS
Sbjct  144  GDENVNVVQKNGEKMVSSAMIIKQDDIIKPDGVIHGIERVLIPKSVQQDFNTRRSLRSIS  203

Query  114  AVLPTGAPEVDPRTHRLKKPSPVPAGAPPVLPIYDAM  4
            AVLP GAPEVDPRTHRLKKP+PVPAGAPPVLP+YDA+
Sbjct  204  AVLPEGAPEVDPRTHRLKKPAPVPAGAPPVLPVYDAL  240



>ref|XP_011047143.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Populus 
euphratica]
Length=466

 Score =   114 bits (286),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 85/106 (80%), Gaps = 4/106 (4%)
 Frame = -1

Query  318  HPSLCRGAGDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNT  139
            H +LC    D    +++ +G++ V +A++ R DDV RPDG+IHGIER+L+PQSVQ DFN 
Sbjct  143  HTTLCN---DHLHLITKNSGKKVVGSAELTRPDDVTRPDGVIHGIERLLVPQSVQEDFNR  199

Query  138  RRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPVLPIYDAM  4
            RR+LRSISAVLP GAPEVDPRTHRLKKP  PV AG+PPVLPIYDAM
Sbjct  200  RRNLRSISAVLPEGAPEVDPRTHRLKKPEPPVRAGSPPVLPIYDAM  245



>ref|XP_002309262.1| hypothetical protein POPTR_0006s21460g [Populus trichocarpa]
 gb|EEE92785.1| hypothetical protein POPTR_0006s21460g [Populus trichocarpa]
Length=466

 Score =   114 bits (286),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 84/106 (79%), Gaps = 4/106 (4%)
 Frame = -1

Query  318  HPSLCRGAGDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNT  139
            H +LC    D    +++ +G++ V +A V R DDV RPDG+IHGIER+L+PQSVQ DFN 
Sbjct  143  HTTLCN---DHLHLITKNSGKKVVGSADVTRPDDVTRPDGVIHGIERLLVPQSVQEDFNR  199

Query  138  RRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPVLPIYDAM  4
            RR+LRSISAVLP GAPEVDPRTHRLKKP  PV AG+PPVLPIYDAM
Sbjct  200  RRNLRSISAVLPEGAPEVDPRTHRLKKPEPPVRAGSPPVLPIYDAM  245



>ref|XP_002322769.2| hypothetical protein POPTR_0016s06680g [Populus trichocarpa]
 gb|EEF04530.2| hypothetical protein POPTR_0016s06680g [Populus trichocarpa]
Length=466

 Score =   114 bits (286),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 85/107 (79%), Gaps = 4/107 (4%)
 Frame = -1

Query  318  HPSLCRGAGDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNT  139
            H +LC    D    +++ +G++ V AA + R DDV RPDG+IHGIER+L+PQSVQ DFN 
Sbjct  143  HTTLC---NDHLHLITKNSGKKLVGAAVLTRPDDVTRPDGVIHGIERLLVPQSVQEDFNR  199

Query  138  RRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPVLPIYDAMA  1
            RR+LRSISAVLP GAPEVDPRTHRLKKP  PV AG+PPVLP+YDAM+
Sbjct  200  RRNLRSISAVLPEGAPEVDPRTHRLKKPEPPVRAGSPPVLPVYDAMS  246



>dbj|BAJ97817.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=464

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 63/68 (93%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSP-VPAGAPPV  25
            G+IHGIER+L+P+SVQ DFN RRSL +ISAVLPTGAPEVDPRTHRLKKP+P VP GAPPV
Sbjct  170  GVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPTVPLGAPPV  229

Query  24   LPIYDAMA  1
            LP++DAMA
Sbjct  230  LPVWDAMA  237



>dbj|BAJ98684.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=464

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 63/68 (93%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSP-VPAGAPPV  25
            G+IHGIER+L+P+SVQ DFN RRSL +ISAVLPTGAPEVDPRTHRLKKP+P VP GAPPV
Sbjct  170  GVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPTVPLGAPPV  229

Query  24   LPIYDAMA  1
            LP++DAMA
Sbjct  230  LPVWDAMA  237



>gb|ABI95415.1| fasciclin-like protein FLA25 [Triticum aestivum]
Length=459

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 63/68 (93%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPV  25
            G+IHGIER+L+P+SVQ DFN RRSL +ISAVLPTGAPEVDPRTHRLKKP+ PVP GAPPV
Sbjct  167  GVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVPLGAPPV  226

Query  24   LPIYDAMA  1
            LP++DAMA
Sbjct  227  LPVWDAMA  234



>ref|XP_009595093.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Nicotiana 
tomentosiformis]
Length=454

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -1

Query  294  GDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNTRRSLRSIS  115
            GDEN  V ++NGE+ VS+A +++ DD+++PDG+IHGIERVLIP+SVQ DFNTRRSLRSIS
Sbjct  144  GDENVNVVEKNGEKMVSSAMIIKQDDIIKPDGVIHGIERVLIPKSVQQDFNTRRSLRSIS  203

Query  114  AVLPTGAPEVDPRTHRLKKPSPVPAGAPPVLPIYDAM  4
            AVLP GAPEVDPRTHRLKKP+PVPAGAPPVLP+YDA+
Sbjct  204  AVLPEGAPEVDPRTHRLKKPAPVPAGAPPVLPVYDAL  240



>ref|XP_011042549.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Populus 
euphratica]
 ref|XP_011042550.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Populus 
euphratica]
Length=466

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 84/107 (79%), Gaps = 4/107 (4%)
 Frame = -1

Query  318  HPSLCRGAGDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNT  139
            H +LC    D    +++ +G++ V AA + R DDV RPDG+IHGIER+L+PQSVQ DFN 
Sbjct  143  HTTLC---NDHLHLITKNSGKKLVGAAVLTRPDDVTRPDGVIHGIERLLVPQSVQEDFNR  199

Query  138  RRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPVLPIYDAMA  1
            RR+LRSISAVLP GAPEVDPRTHRLKKP  PV AG+PP LP+YDAM+
Sbjct  200  RRNLRSISAVLPEGAPEVDPRTHRLKKPEPPVRAGSPPALPVYDAMS  246



>ref|XP_002315410.2| hypothetical protein POPTR_0010s25110g [Populus trichocarpa]
 gb|EEF01581.2| hypothetical protein POPTR_0010s25110g [Populus trichocarpa]
Length=439

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 84/107 (79%), Gaps = 6/107 (6%)
 Frame = -1

Query  318  HPSLCRGAGDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNT  139
            H +LCR   D     SQ +GE+ + +AK+++ + V RPDG+IHGIER+LIP+SVQ DFN 
Sbjct  136  HSTLCR---DRVKLSSQESGEKLIDSAKIIQVNAVERPDGVIHGIERLLIPRSVQQDFNN  192

Query  138  RRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPA--GAPPVLPIYDAM  4
            RRSL+SISAV P GAPEVDPRTHRLKKP+P PA  G+ PVLPIYDAM
Sbjct  193  RRSLQSISAVKPEGAPEVDPRTHRLKKPAP-PAKPGSAPVLPIYDAM  238



>gb|KFK34484.1| hypothetical protein AALP_AA5G151600 [Arabis alpina]
Length=430

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRL-KKPSPVPAGAPPV  25
            GIIHGI+R+LIP+SVQ DFN RR+LRSISAVLP GAPEVDPRTHRL KKP P+ AGAPPV
Sbjct  150  GIIHGIDRLLIPRSVQEDFNRRRNLRSISAVLPEGAPEVDPRTHRLKKKPGPIAAGAPPV  209

Query  24   LPIYDAMA  1
            LPIYDA++
Sbjct  210  LPIYDAIS  217



>gb|ABV27485.1| fasciclin-like arabinogalactan protein 14 [Gossypium hirsutum]
Length=459

 Score =   112 bits (280),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 84/105 (80%), Gaps = 3/105 (3%)
 Frame = -1

Query  318  HPSLCRGAGDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNT  139
            H +LC    D     SQ  G++ V +A++VR DDV+RPDG+IHGI+++LIP+SV  DFN 
Sbjct  141  HNTLC---NDHIRLTSQSTGKKTVDSAELVRPDDVIRPDGVIHGIQQLLIPRSVIEDFNR  197

Query  138  RRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPVLPIYDAM  4
            RR+LRSI+AVLP GAPEVDPRTHRLK P+P+P GAPPVLPIYDAM
Sbjct  198  RRNLRSITAVLPEGAPEVDPRTHRLKNPAPIPVGAPPVLPIYDAM  242



>ref|XP_008442961.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Cucumis 
melo]
Length=465

 Score =   112 bits (279),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 62/67 (93%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSP-VPAGAPPV  25
            G+IHGIER+LIP+SVQ DFN RR+L+SISAVLP GAPEVDPRTHRLKKP+P VPAGA PV
Sbjct  180  GVIHGIERLLIPRSVQEDFNRRRNLQSISAVLPEGAPEVDPRTHRLKKPAPSVPAGASPV  239

Query  24   LPIYDAM  4
            LPIYDA+
Sbjct  240  LPIYDAL  246



>ref|XP_010938934.1| PREDICTED: LOW QUALITY PROTEIN: fasciclin-like arabinogalactan 
protein 17 [Elaeis guineensis]
Length=468

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPV  25
            G+IHGIER+L+P+SVQ DFN RRSL SISA+LPTGAPEVDPRTHRLKKP+ P P G+PP 
Sbjct  181  GVIHGIERLLVPRSVQEDFNRRRSLASISAILPTGAPEVDPRTHRLKKPAPPCPRGSPPA  240

Query  24   LPIYDAMA  1
            LPIYDAMA
Sbjct  241  LPIYDAMA  248



>gb|KHG00930.1| Fasciclin-like arabinogalactan protein 17 [Gossypium arboreum]
Length=434

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 61/67 (91%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPV  25
            G+IHGIE++LIPQSVQ DFN+RR+LRSISAV P GAPEVDPRTHRLKKP+ PV  G+PPV
Sbjct  173  GVIHGIEQLLIPQSVQQDFNSRRNLRSISAVKPEGAPEVDPRTHRLKKPAPPVKPGSPPV  232

Query  24   LPIYDAM  4
            LPIYDAM
Sbjct  233  LPIYDAM  239



>gb|KHG10334.1| Fasciclin-like arabinogalactan protein 17 [Gossypium arboreum]
Length=468

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 60/67 (90%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPV  25
            G+IHGIE++LIP+SVQ DFN RRSLRSISAV P GAPEVDPRTHRLKKP+ PV  GAPPV
Sbjct  175  GVIHGIEQLLIPRSVQQDFNNRRSLRSISAVKPEGAPEVDPRTHRLKKPAPPVKPGAPPV  234

Query  24   LPIYDAM  4
            LPIYDAM
Sbjct  235  LPIYDAM  241



>gb|KJB73327.1| hypothetical protein B456_011G228300 [Gossypium raimondii]
Length=443

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 60/67 (90%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPV  25
            G+IHGIE++LIP+SVQ DFN RRSLRSISAV P GAPEVDPRTHRLKKP+ PV  GAPPV
Sbjct  176  GVIHGIEQLLIPRSVQQDFNNRRSLRSISAVKPEGAPEVDPRTHRLKKPAPPVKPGAPPV  235

Query  24   LPIYDAM  4
            LPIYDAM
Sbjct  236  LPIYDAM  242



>gb|ABV27487.1| fasciclin-like arabinogalactan protein 16 [Gossypium hirsutum]
Length=457

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 61/67 (91%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPV  25
            G+IHGIE++LIPQSVQ DFN+RR+LRSISAV P GAPEVDPRTHRLKKP+ PV  G+PPV
Sbjct  173  GVIHGIEQLLIPQSVQQDFNSRRNLRSISAVKPEGAPEVDPRTHRLKKPAPPVKPGSPPV  232

Query  24   LPIYDAM  4
            LPIYDAM
Sbjct  233  LPIYDAM  239



>gb|ABV27486.1| fasciclin-like arabinogalactan protein 15 [Gossypium hirsutum]
Length=460

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 60/67 (90%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPV  25
            G+IHGIE++LIP+SVQ DFN RRSLRSISAV P GAPEVDPRTHRLKKP+ PV  GAPPV
Sbjct  176  GVIHGIEQLLIPRSVQQDFNNRRSLRSISAVKPEGAPEVDPRTHRLKKPAPPVKPGAPPV  235

Query  24   LPIYDAM  4
            LPIYDAM
Sbjct  236  LPIYDAM  242



>gb|KJB78512.1| hypothetical protein B456_013G003200 [Gossypium raimondii]
Length=457

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 61/67 (91%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPV  25
            G+IHGIE++LIPQSVQ DFN+RR+LRSISAV P GAPEVDPRTHRLKKP+ PV  G+PPV
Sbjct  173  GVIHGIEQLLIPQSVQQDFNSRRNLRSISAVKPEGAPEVDPRTHRLKKPAPPVKPGSPPV  232

Query  24   LPIYDAM  4
            LPIYDAM
Sbjct  233  LPIYDAM  239



>gb|KJB73326.1| hypothetical protein B456_011G228300 [Gossypium raimondii]
Length=515

 Score =   110 bits (276),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 60/67 (90%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPV  25
            G+IHGIE++LIP+SVQ DFN RRSLRSISAV P GAPEVDPRTHRLKKP+ PV  GAPPV
Sbjct  231  GVIHGIEQLLIPRSVQQDFNNRRSLRSISAVKPEGAPEVDPRTHRLKKPAPPVKPGAPPV  290

Query  24   LPIYDAM  4
            LPIYDAM
Sbjct  291  LPIYDAM  297



>ref|XP_002463768.1| hypothetical protein SORBIDRAFT_01g005770 [Sorghum bicolor]
 gb|EER90766.1| hypothetical protein SORBIDRAFT_01g005770 [Sorghum bicolor]
Length=474

 Score =   110 bits (274),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPV  25
            G+IHGIER+L+P+SVQ DFN RRSL +ISAVLPTGAPEVDPRTHRLKKP+ PV  GAPPV
Sbjct  182  GVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVLPGAPPV  241

Query  24   LPIYDAMA  1
            LPI+DAMA
Sbjct  242  LPIWDAMA  249



>ref|XP_004228680.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Solanum 
lycopersicum]
Length=439

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            GIIHGI++VLIP+SVQ  FN RR+LRSISAVLP GAPE+DPRT+RLKK P PVPAGAPPV
Sbjct  159  GIIHGIQKVLIPKSVQQSFNNRRNLRSISAVLPQGAPEIDPRTNRLKKNPKPVPAGAPPV  218

Query  24   LPIYDAM  4
            LPIY AM
Sbjct  219  LPIYSAM  225



>ref|XP_007010508.1| FASCICLIN-like arabinogalactan protein 16 precursor isoform 1 
[Theobroma cacao]
 ref|XP_007010509.1| FASCICLIN-like arabinogalactan protein 16 precursor isoform 1 
[Theobroma cacao]
 gb|EOY19318.1| FASCICLIN-like arabinogalactan protein 16 precursor isoform 1 
[Theobroma cacao]
 gb|EOY19319.1| FASCICLIN-like arabinogalactan protein 16 precursor isoform 1 
[Theobroma cacao]
Length=454

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 60/67 (90%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPV  25
            G+IHGIE++LIP+SVQ DFN RRSLRSISAV P GAPEVDPRTHRLKKP+ PV  GAPPV
Sbjct  170  GVIHGIEQLLIPRSVQQDFNNRRSLRSISAVKPEGAPEVDPRTHRLKKPAPPVLPGAPPV  229

Query  24   LPIYDAM  4
            LPIYDAM
Sbjct  230  LPIYDAM  236



>ref|XP_006348432.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Solanum 
tuberosum]
Length=436

 Score =   109 bits (272),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRL-KKPSPVPAGAPPV  25
            GIIHGI++VLIP+SVQ  FN RR+LRSISAVLP GAPE+DPRT+RL KKP PVPAGAPPV
Sbjct  154  GIIHGIKKVLIPKSVQQSFNNRRNLRSISAVLPEGAPEIDPRTNRLKKKPKPVPAGAPPV  213

Query  24   LPIYDAM  4
            LPIY AM
Sbjct  214  LPIYSAM  220



>ref|XP_003559349.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Brachypodium 
distachyon]
Length=483

 Score =   109 bits (273),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 62/68 (91%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPV  25
            G+IHGIER+L+P+SVQ DFN RRSL +ISAVLPTGAPEVDPRTHRLKKP+ PV  GAPPV
Sbjct  189  GVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVLPGAPPV  248

Query  24   LPIYDAMA  1
            LP++DAMA
Sbjct  249  LPVWDAMA  256



>gb|ABI95416.1| fasciclin-like protein FLA26 [Triticum aestivum]
Length=460

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPV  25
            G+IHGIER+L+P+SVQ DFN RRSL  ISAVLPTGAPEVDPRTHRLKKP  PV  GAPPV
Sbjct  168  GVIHGIERILVPRSVQEDFNRRRSLAEISAVLPTGAPEVDPRTHRLKKPEPPVLPGAPPV  227

Query  24   LPIYDAMA  1
            LP++DAMA
Sbjct  228  LPVWDAMA  235



>ref|XP_003557575.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Brachypodium 
distachyon]
Length=489

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 62/68 (91%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPV  25
            G+IHGIE++LIP+SVQ DFN RRSL +ISAVLPTGAPEVDPRTHRLKKP+ PV  GAPPV
Sbjct  191  GVIHGIEKLLIPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVLPGAPPV  250

Query  24   LPIYDAMA  1
            LP++DAMA
Sbjct  251  LPVWDAMA  258



>ref|XP_004136532.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Cucumis 
sativus]
 gb|KGN59239.1| hypothetical protein Csa_3G783850 [Cucumis sativus]
Length=465

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 60/67 (90%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPV  25
            G+IHGIER+LIP+SVQ DFN RR+L+SISAVLP GAPEVDPRTHRLKKP+ PVP G  PV
Sbjct  180  GVIHGIERLLIPRSVQEDFNRRRNLQSISAVLPEGAPEVDPRTHRLKKPAPPVPVGTSPV  239

Query  24   LPIYDAM  4
            LPIYDA+
Sbjct  240  LPIYDAL  246



>gb|ABI95417.1| fasciclin-like protein FLA27 [Triticum aestivum]
Length=482

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 83/107 (78%), Gaps = 4/107 (4%)
 Frame = -1

Query  318  HPSLCRGAGDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNT  139
            HP+L   +G++    +  NG   V+ A V R D V+ PDG+IHGIER+L+P+SVQ DFN 
Sbjct  154  HPTL---SGEDVELAAGANGSMRVAHAAVTRPDAVLSPDGVIHGIERLLVPRSVQEDFNR  210

Query  138  RRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPVLPIYDAMA  1
            RRSL +ISAVLPTGAPEVDPRTHRLKKP+ PV  GAPPVLP++DAMA
Sbjct  211  RRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVLPGAPPVLPVWDAMA  257



>ref|XP_004167872.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Cucumis 
sativus]
Length=465

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 60/67 (90%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPV  25
            G+IHGIER+LIP+SVQ DFN RR+L+SISAVLP GAPEVDPRTHRLKKP+ PVP G  PV
Sbjct  180  GVIHGIERLLIPRSVQEDFNRRRNLQSISAVLPEGAPEVDPRTHRLKKPAPPVPVGTSPV  239

Query  24   LPIYDAM  4
            LPIYDA+
Sbjct  240  LPIYDAL  246



>ref|XP_006388223.1| hypothetical protein POPTR_0276s00200g, partial [Populus trichocarpa]
 gb|ERP47137.1| hypothetical protein POPTR_0276s00200g, partial [Populus trichocarpa]
Length=273

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 83/107 (78%), Gaps = 6/107 (6%)
 Frame = -1

Query  318  HPSLCRGAGDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNT  139
            H +LCR   D     SQ +GE+ + +AK+++ + V RPDG+IHGIER+LIP+SVQ DFN 
Sbjct  62   HRTLCR---DRVKLSSQESGEKLIDSAKIIQVNAVERPDGVIHGIERLLIPRSVQQDFNN  118

Query  138  RRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPA--GAPPVLPIYDAM  4
             RSL+SISAV P GAPEVDPRTHR+KKP+P PA  G+ PVLPIYDAM
Sbjct  119  CRSLQSISAVKPEGAPEVDPRTHRMKKPAP-PAKPGSAPVLPIYDAM  164



>gb|ABI95409.1| fasciclin-like protein FLA19 [Triticum aestivum]
Length=480

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 62/68 (91%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPV  25
            G+IHGIER+L+P+SVQ DFN RRSL +ISAVLPTGAPEVDPRTHRLKKP+ PV  GAPPV
Sbjct  188  GVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVLPGAPPV  247

Query  24   LPIYDAMA  1
            LP++DAMA
Sbjct  248  LPVWDAMA  255



>ref|XP_010045160.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Eucalyptus 
grandis]
 gb|KCW87313.1| hypothetical protein EUGRSUZ_B03801 [Eucalyptus grandis]
 gb|KCW87314.1| hypothetical protein EUGRSUZ_B03801 [Eucalyptus grandis]
Length=480

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 75/90 (83%), Gaps = 1/90 (1%)
 Frame = -1

Query  270  QRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAP  91
            + +GEREV  A+V+ AD V RPDG+IHGIER+LIPQSVQ DFN RRSLRSI+AV P GAP
Sbjct  172  RESGEREVDRARVIHADAVARPDGVIHGIERLLIPQSVQDDFNRRRSLRSITAVKPEGAP  231

Query  90   EVDPRTHRLKKPS-PVPAGAPPVLPIYDAM  4
            EVDPRTHRLKKP+ P  AG+ P LPIYDAM
Sbjct  232  EVDPRTHRLKKPAPPAKAGSAPALPIYDAM  261



>ref|XP_011024125.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Populus 
euphratica]
 ref|XP_011024126.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Populus 
euphratica]
Length=459

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 84/107 (79%), Gaps = 6/107 (6%)
 Frame = -1

Query  318  HPSLCRGAGDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNT  139
            H +L R   D     SQ +GE+ + +AK+++A+ V RPDG+IHGIER+LIP+SVQ DFN 
Sbjct  136  HSTLSR---DGVKLSSQESGEKLIDSAKIIQANAVERPDGVIHGIERLLIPRSVQQDFNN  192

Query  138  RRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPA--GAPPVLPIYDAM  4
            RRSL+SISAV P GAPEVDPRTHRLKKP+P PA  G+ PVLPIYDAM
Sbjct  193  RRSLQSISAVKPEGAPEVDPRTHRLKKPAP-PAKPGSAPVLPIYDAM  238



>ref|XP_006388929.1| hypothetical protein POPTR_0073s00210g [Populus trichocarpa]
 gb|ERP47843.1| hypothetical protein POPTR_0073s00210g [Populus trichocarpa]
Length=361

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 81/104 (78%), Gaps = 4/104 (4%)
 Frame = -1

Query  312  SLCRGAGDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNTRR  133
            +LCR   D     SQ +GE+ + +AK+++ + V RPDG+IHGI+R+LIP+SVQ DFN RR
Sbjct  152  TLCR---DRVKLSSQESGEKLIDSAKIIQVNAVERPDGVIHGIKRLLIPRSVQQDFNNRR  208

Query  132  SLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPVLPIYDAM  4
            SL+SISAV P GAPEVDPRTHRLKKP+ P   G+ PVLPIYDAM
Sbjct  209  SLQSISAVKPEGAPEVDPRTHRLKKPALPAKPGSAPVLPIYDAM  252



>ref|XP_004955500.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Setaria 
italica]
Length=489

 Score =   107 bits (266),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 61/68 (90%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPV  25
            G+IHGIER+L+P+SVQ  FN RRSL +ISAVLPTGAPEVDPRTHRLKKP+ PVP GA P+
Sbjct  192  GVIHGIERLLVPRSVQEAFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVPLGATPI  251

Query  24   LPIYDAMA  1
            LP++DAMA
Sbjct  252  LPVWDAMA  259



>ref|XP_002515862.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46531.1| conserved hypothetical protein [Ricinus communis]
Length=464

 Score =   106 bits (264),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 2/68 (3%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPA--GAPP  28
            GIIHGIERVLIPQSV+ +FN RR+LRSISAV P GAPE+DPRT+RLKKPS +PA  G+PP
Sbjct  176  GIIHGIERVLIPQSVEDEFNRRRNLRSISAVKPEGAPEIDPRTNRLKKPSSLPAKPGSPP  235

Query  27   VLPIYDAM  4
            VLPI+DAM
Sbjct  236  VLPIFDAM  243



>ref|XP_011032963.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Populus 
euphratica]
Length=463

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 60/68 (88%), Gaps = 3/68 (4%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPA--GAPP  28
            G+IHGIER+LIP+SVQ DFN RRSL+SISAV P GAPEVDPRTHRLKKP+P PA  G+ P
Sbjct  176  GVIHGIERLLIPRSVQQDFNNRRSLQSISAVKPEGAPEVDPRTHRLKKPAP-PAKPGSAP  234

Query  27   VLPIYDAM  4
            VLPIYDAM
Sbjct  235  VLPIYDAM  242



>ref|XP_010486838.1| PREDICTED: fasciclin-like arabinogalactan protein 18 [Camelina 
sativa]
Length=461

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 60/68 (88%), Gaps = 2/68 (3%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSP--VPAGAPP  28
            G+IHGIER+LIP+SVQ DFN RRSLRSISAVLP GAPE+DPRT+RLKKP+   VPAG+PP
Sbjct  177  GLIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEIDPRTNRLKKPASAAVPAGSPP  236

Query  27   VLPIYDAM  4
            VLPI  AM
Sbjct  237  VLPIQSAM  244



>ref|NP_196257.2| fasciclin-like arabinogalactan protein 17 precursor [Arabidopsis 
thaliana]
 sp|Q66GR0.1|FLA17_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 17; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAU05465.1| At5g06390 [Arabidopsis thaliana]
 gb|AAV74247.1| At5g06390 [Arabidopsis thaliana]
 gb|AED91009.1| fasciclin-like arabinogalactan protein 17 precursor [Arabidopsis 
thaliana]
Length=458

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 60/67 (90%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKP-SPVPAGAPPV  25
            G+IHGIER+LIP+SVQ DFN RRSL+SISAVLP GAPEVDPRT+RLKKP +PVPAG+PP 
Sbjct  175  GLIHGIERLLIPRSVQEDFNRRRSLQSISAVLPEGAPEVDPRTNRLKKPAAPVPAGSPPA  234

Query  24   LPIYDAM  4
            LPI  AM
Sbjct  235  LPIQSAM  241



>ref|XP_006297639.1| hypothetical protein CARUB_v10013670mg [Capsella rubella]
 gb|EOA30537.1| hypothetical protein CARUB_v10013670mg [Capsella rubella]
Length=457

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 60/68 (88%), Gaps = 2/68 (3%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSP--VPAGAPP  28
            G+IHGIER+LIP+SVQ DFN RRSLRSISAVLP GAPE+DPRT+RLKKP+   VPAG+PP
Sbjct  173  GLIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEIDPRTNRLKKPASAAVPAGSPP  232

Query  27   VLPIYDAM  4
            VLPI  AM
Sbjct  233  VLPIQSAM  240



>ref|XP_010464900.1| PREDICTED: fasciclin-like arabinogalactan protein 18 [Camelina 
sativa]
Length=462

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 60/68 (88%), Gaps = 2/68 (3%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSP--VPAGAPP  28
            G+IHGIER+LIP+SVQ DFN RRSLRSISAVLP GAPE+DPRT+RLKKP+   VPAG+PP
Sbjct  178  GLIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEIDPRTNRLKKPASAAVPAGSPP  237

Query  27   VLPIYDAM  4
            VLPI  AM
Sbjct  238  VLPIQSAM  245



>ref|XP_010423345.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Camelina 
sativa]
Length=459

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 60/67 (90%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPV  25
            G+IHGIER+LIP+SVQ DFN RRSL+SISAVLP GAPEVDPRT+RLKKP+ PVPAG+PP 
Sbjct  176  GLIHGIERLLIPRSVQEDFNRRRSLQSISAVLPEGAPEVDPRTNRLKKPTAPVPAGSPPA  235

Query  24   LPIYDAM  4
            LPI  AM
Sbjct  236  LPIQSAM  242



>ref|XP_010497995.1| PREDICTED: fasciclin-like arabinogalactan protein 18 isoform 
X1 [Camelina sativa]
 ref|XP_010498004.1| PREDICTED: fasciclin-like arabinogalactan protein 18 isoform 
X2 [Camelina sativa]
Length=469

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 60/68 (88%), Gaps = 2/68 (3%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSP--VPAGAPP  28
            G+IHGIER+LIP+SVQ DFN RRSLRSISAVLP GAPE+DPRT+RLKKP+   VPAG+PP
Sbjct  185  GLIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEIDPRTNRLKKPASAAVPAGSPP  244

Query  27   VLPIYDAM  4
            VLPI  AM
Sbjct  245  VLPIQSAM  252



>ref|XP_010452564.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Camelina 
sativa]
Length=456

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 60/67 (90%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPV  25
            G+IHGIER+LIP+SVQ DFN RRSL+SISAVLP GAPEVDPRT+RLKKP+ PVPAG+PP 
Sbjct  173  GLIHGIERLLIPRSVQEDFNRRRSLQSISAVLPEGAPEVDPRTNRLKKPTAPVPAGSPPA  232

Query  24   LPIYDAM  4
            LPI  AM
Sbjct  233  LPIQSAM  239



>gb|AEN82905.1| AT5G06390-like protein, partial [Capsella rubella]
 gb|AEN82906.1| AT5G06390-like protein, partial [Capsella rubella]
 gb|AEN82907.1| AT5G06390-like protein, partial [Capsella rubella]
 gb|AEN82908.1| AT5G06390-like protein, partial [Capsella rubella]
 gb|AEN82909.1| AT5G06390-like protein, partial [Capsella rubella]
 gb|AEN82910.1| AT5G06390-like protein, partial [Capsella rubella]
 gb|AEN82911.1| AT5G06390-like protein, partial [Capsella rubella]
 gb|AEN82912.1| AT5G06390-like protein, partial [Capsella rubella]
Length=186

 Score =   102 bits (253),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 59/67 (88%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKP-SPVPAGAPPV  25
            G+IHGIER+LIP+SVQ DFN RRSL+SISAVLP GAPEVDPRT+RLKKP +P PAG+PP 
Sbjct  24   GLIHGIERLLIPRSVQEDFNRRRSLQSISAVLPEGAPEVDPRTNRLKKPVAPKPAGSPPA  83

Query  24   LPIYDAM  4
            LPI  AM
Sbjct  84   LPIQSAM  90



>dbj|BAB08961.1| unnamed protein product [Arabidopsis thaliana]
Length=465

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 60/67 (90%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKP-SPVPAGAPPV  25
            G+IHGIER+LIP+SVQ DFN RRSL+SISAVLP GAPEVDPRT+RLKKP +PVPAG+PP 
Sbjct  175  GLIHGIERLLIPRSVQEDFNRRRSLQSISAVLPEGAPEVDPRTNRLKKPAAPVPAGSPPA  234

Query  24   LPIYDAM  4
            LPI  AM
Sbjct  235  LPIQSAM  241



>gb|AEN82899.1| AT5G06390-like protein, partial [Capsella grandiflora]
 gb|AEN82900.1| AT5G06390-like protein, partial [Capsella grandiflora]
 gb|AEN82901.1| AT5G06390-like protein, partial [Capsella grandiflora]
 gb|AEN82902.1| AT5G06390-like protein, partial [Capsella grandiflora]
 gb|AEN82903.1| AT5G06390-like protein, partial [Capsella grandiflora]
 gb|AEN82904.1| AT5G06390-like protein, partial [Capsella grandiflora]
Length=186

 Score =   102 bits (253),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 59/67 (88%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKP-SPVPAGAPPV  25
            G+IHGIER+LIP+SVQ DFN RRSL+SISAVLP GAPEVDPRT+RLKKP +P PAG+PP 
Sbjct  24   GLIHGIERLLIPRSVQEDFNRRRSLQSISAVLPEGAPEVDPRTNRLKKPVAPKPAGSPPA  83

Query  24   LPIYDAM  4
            LPI  AM
Sbjct  84   LPIQSAM  90



>emb|CDY55758.1| BnaA03g55350D [Brassica napus]
Length=458

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 59/67 (88%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRL-KKPSPVPAGAPPV  25
            G+IHGIER+LIP+SVQ DFN RRSLRSISAVLP GAPEVDPRT+RL KKP+P PAG+PP 
Sbjct  175  GLIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEVDPRTNRLKKKPAPTPAGSPPA  234

Query  24   LPIYDAM  4
            LPI  AM
Sbjct  235  LPIKSAM  241



>ref|XP_006399110.1| hypothetical protein EUTSA_v10013481mg [Eutrema salsugineum]
 gb|ESQ40563.1| hypothetical protein EUTSA_v10013481mg [Eutrema salsugineum]
Length=438

 Score =   103 bits (258),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 60/67 (90%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRL-KKPSPVPAGAPPV  25
            G+IHGIER+LIP++VQ DFN RRSL+SISAVLP GAPEVDPRT+RL KKP+PVPAG+PP 
Sbjct  176  GLIHGIERLLIPRAVQEDFNRRRSLQSISAVLPEGAPEVDPRTNRLKKKPAPVPAGSPPA  235

Query  24   LPIYDAM  4
            LPI  AM
Sbjct  236  LPIQSAM  242



>ref|XP_002871217.1| beta-Ig-H3 domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47476.1| beta-Ig-H3 domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=458

 Score =   104 bits (259),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 60/67 (90%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKP-SPVPAGAPPV  25
            G+IHGIER+LIP+SVQ DFN RRSL+SI+AVLP GAPEVDPRT+RLKKP +PVPAG+PP 
Sbjct  175  GLIHGIERLLIPRSVQEDFNRRRSLQSITAVLPEGAPEVDPRTNRLKKPAAPVPAGSPPA  234

Query  24   LPIYDAM  4
            LPI  AM
Sbjct  235  LPIQSAM  241



>ref|XP_006399111.1| hypothetical protein EUTSA_v10013481mg [Eutrema salsugineum]
 gb|ESQ40564.1| hypothetical protein EUTSA_v10013481mg [Eutrema salsugineum]
Length=460

 Score =   103 bits (258),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 60/67 (90%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRL-KKPSPVPAGAPPV  25
            G+IHGIER+LIP++VQ DFN RRSL+SISAVLP GAPEVDPRT+RL KKP+PVPAG+PP 
Sbjct  176  GLIHGIERLLIPRAVQEDFNRRRSLQSISAVLPEGAPEVDPRTNRLKKKPAPVPAGSPPA  235

Query  24   LPIYDAM  4
            LPI  AM
Sbjct  236  LPIQSAM  242



>ref|XP_004506247.1| PREDICTED: fasciclin-like arabinogalactan protein 15-like [Cicer 
arietinum]
Length=459

 Score =   103 bits (258),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPV  25
            G+IHGIER+LIP+SVQ DFN RRSL SI+A+ P GAPEVDPRTHRLKKP+ P  AG+PPV
Sbjct  168  GVIHGIERLLIPRSVQDDFNRRRSLISIAAIKPEGAPEVDPRTHRLKKPAPPQEAGSPPV  227

Query  24   LPIYDAM  4
            LPIYDA+
Sbjct  228  LPIYDAL  234



>ref|XP_006379436.1| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
 ref|XP_006379437.1| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
 ref|XP_002311924.2| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
 gb|ERP57233.1| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
 gb|ERP57234.1| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
 gb|EEE89291.2| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
Length=439

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 59/68 (87%), Gaps = 3/68 (4%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPA--GAPP  28
            G+IHGIER+LIP+SVQ DFN RRSL+SISAV P GAPEVDPRT RLKKP+P PA  G+ P
Sbjct  176  GVIHGIERLLIPRSVQQDFNNRRSLQSISAVKPEGAPEVDPRTQRLKKPAP-PAKPGSAP  234

Query  27   VLPIYDAM  4
            VLPIYDAM
Sbjct  235  VLPIYDAM  242



>ref|XP_006379435.1| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
 gb|ERP57232.1| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
Length=440

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 59/68 (87%), Gaps = 3/68 (4%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPA--GAPP  28
            G+IHGIER+LIP+SVQ DFN RRSL+SISAV P GAPEVDPRT RLKKP+P PA  G+ P
Sbjct  176  GVIHGIERLLIPRSVQQDFNNRRSLQSISAVKPEGAPEVDPRTQRLKKPAP-PAKPGSAP  234

Query  27   VLPIYDAM  4
            VLPIYDAM
Sbjct  235  VLPIYDAM  242



>ref|XP_006287712.1| hypothetical protein CARUB_v10000921mg [Capsella rubella]
 gb|EOA20610.1| hypothetical protein CARUB_v10000921mg [Capsella rubella]
Length=459

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 85/106 (80%), Gaps = 5/106 (5%)
 Frame = -1

Query  318  HPSLCRGAGDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNT  139
            HP+L    G++   +S  +G++ V +A+++R DD+ RPDG+IHGIER+LIP+SVQ DFN 
Sbjct  141  HPTL----GNDQVHLSHGDGKKMVDSAEIIRPDDLTRPDGLIHGIERLLIPRSVQEDFNR  196

Query  138  RRSLRSISAVLPTGAPEVDPRTHRLKKP-SPVPAGAPPVLPIYDAM  4
            RRSL+SISAVLP GAPEVDPRT+RLKKP +P PAG+PP LPI  AM
Sbjct  197  RRSLQSISAVLPEGAPEVDPRTNRLKKPVAPKPAGSPPALPIQSAM  242



>ref|XP_008450315.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Cucumis 
melo]
 ref|XP_008450316.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Cucumis 
melo]
Length=466

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 75/91 (82%), Gaps = 3/91 (3%)
 Frame = -1

Query  270  QRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAP  91
             R GER V  AKV++ D + RPDG+IHGIER+LIPQSVQ DFN RR+L++I+AV P GAP
Sbjct  157  HRTGERTVDLAKVIQPDAITRPDGVIHGIERLLIPQSVQDDFNRRRNLQAITAVKPEGAP  216

Query  90   EVDPRTHRLKKPSPVPA--GAPPVLPIYDAM  4
            EVDPRTHRLKKP+P PA  G+PP LPIYDA+
Sbjct  217  EVDPRTHRLKKPAP-PAEPGSPPALPIYDAL  246



>gb|EYU38707.1| hypothetical protein MIMGU_mgv1a006053mg [Erythranthe guttata]
Length=459

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 88/106 (83%), Gaps = 1/106 (1%)
 Frame = -1

Query  318  HPSLCRGAGDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNT  139
            H SLCR AGDE   + ++NGER V  A+V++ DD++RPDGIIHGIER+L+P+SVQ +FN 
Sbjct  137  HASLCRDAGDEKIRLHEKNGERIVGMARVIKPDDIIRPDGIIHGIERLLVPKSVQQEFNA  196

Query  138  RRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPVLPIYDAM  4
            RRSLR+ SAV+P GAPEVDPRT+RLKK   PV AGAPPVLPIY+A+
Sbjct  197  RRSLRATSAVIPEGAPEVDPRTNRLKKPAPPVAAGAPPVLPIYNAL  242



>ref|XP_010491197.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Camelina 
sativa]
Length=457

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 59/67 (88%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPV  25
            G+IHGIER+LIP+SVQ DFN RRSL+SISAVLP GAPEVDPRT+RLKKP+ PV AG+PP 
Sbjct  174  GLIHGIERLLIPRSVQEDFNRRRSLQSISAVLPEGAPEVDPRTNRLKKPTPPVLAGSPPA  233

Query  24   LPIYDAM  4
            LPI  AM
Sbjct  234  LPIQSAM  240



>emb|CDX81004.1| BnaC03g02580D [Brassica napus]
Length=488

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 58/67 (87%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRL-KKPSPVPAGAPPV  25
            G+IHGIER+LIP+SVQ DFN RRSLRSISAVLP GAPEVDPRT+RL KKP+P PAG+ P 
Sbjct  172  GLIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEVDPRTNRLKKKPAPAPAGSSPA  231

Query  24   LPIYDAM  4
            LPI  AM
Sbjct  232  LPIKSAM  238



>emb|CDY01050.1| BnaC05g41500D [Brassica napus]
Length=463

 Score =   100 bits (250),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 59/69 (86%), Gaps = 3/69 (4%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKP---SPVPAGAP  31
            G+IHGIER+LIP+SVQ DFN RR+LRSISAVLP GAPEVDPRT+RLKK    + VPAG+P
Sbjct  179  GLIHGIERLLIPRSVQEDFNRRRNLRSISAVLPEGAPEVDPRTNRLKKSAAAAAVPAGSP  238

Query  30   PVLPIYDAM  4
            PVLPI  AM
Sbjct  239  PVLPIQSAM  247



>gb|AAF02137.1|AC009918_9 unknown protein [Arabidopsis thaliana]
Length=447

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 59/69 (86%), Gaps = 3/69 (4%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPS---PVPAGAP  31
            G+IHGIER+LIP+SVQ DFN RR+LRSISAVLP GAPE+DPRT+RLKK +    VPAG+P
Sbjct  176  GLIHGIERLLIPRSVQEDFNRRRNLRSISAVLPEGAPEIDPRTNRLKKSATAVSVPAGSP  235

Query  30   PVLPIYDAM  4
            PVLPI  AM
Sbjct  236  PVLPIESAM  244



>gb|KDP42957.1| hypothetical protein JCGZ_23899 [Jatropha curcas]
Length=458

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 60/68 (88%), Gaps = 3/68 (4%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPA--GAPP  28
            GIIHGIER+LIPQSV+ DFN RR+LRSI+AV P GAPEVDPRT+RLKKP+P PA  G+PP
Sbjct  174  GIIHGIERLLIPQSVENDFNRRRTLRSITAVKPEGAPEVDPRTNRLKKPAP-PAKPGSPP  232

Query  27   VLPIYDAM  4
             LPI+DA+
Sbjct  233  ALPIFDAL  240



>ref|NP_566398.1| FASCICLIN-like arabinogalactan protein 18 precursor [Arabidopsis 
thaliana]
 sp|Q93W32.1|FLA18_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 18; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL07046.1| unknown protein [Arabidopsis thaliana]
 gb|AAL24265.1| AT3g11700/T19F11_10 [Arabidopsis thaliana]
 gb|AAM91728.1| unknown protein [Arabidopsis thaliana]
 gb|AEE75085.1| FASCICLIN-like arabinogalactan protein 18 precursor [Arabidopsis 
thaliana]
Length=462

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 59/69 (86%), Gaps = 3/69 (4%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSP---VPAGAP  31
            G+IHGIER+LIP+SVQ DFN RR+LRSISAVLP GAPE+DPRT+RLKK +    VPAG+P
Sbjct  176  GLIHGIERLLIPRSVQEDFNRRRNLRSISAVLPEGAPEIDPRTNRLKKSATAVSVPAGSP  235

Query  30   PVLPIYDAM  4
            PVLPI  AM
Sbjct  236  PVLPIESAM  244



>ref|XP_004154697.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like, partial 
[Cucumis sativus]
Length=399

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 59/68 (87%), Gaps = 3/68 (4%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPA--GAPP  28
            G+IHGIER+LIPQSVQ DFN RR+L++I+AV P GAPEVDPRTHRLKKP+P PA  G+ P
Sbjct  113  GVIHGIERLLIPQSVQDDFNRRRNLQAITAVKPEGAPEVDPRTHRLKKPAP-PAEPGSAP  171

Query  27   VLPIYDAM  4
             LPIYDA+
Sbjct  172  ALPIYDAL  179



>emb|CDY32082.1| BnaC04g44840D [Brassica napus]
Length=444

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPVL  22
            GIIHGIER+LIP+SVQ DFN RRSLRSISAVLP GAPEVDPRTHRLKKP+PVPAGAPPVL
Sbjct  164  GIIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEVDPRTHRLKKPAPVPAGAPPVL  223

Query  21   PIYDAMA  1
            P+YDAM+
Sbjct  224  PVYDAMS  230



>emb|CDY40429.1| BnaA04g20880D [Brassica napus]
Length=443

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPVL  22
            GIIHGIER+LIP+SVQ DFN RRSLRSISAVLP GAPEVDPRTHRLKKP+PVPAGAPPVL
Sbjct  164  GIIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEVDPRTHRLKKPAPVPAGAPPVL  223

Query  21   PIYDAMA  1
            P+YDAM+
Sbjct  224  PVYDAMS  230



>ref|XP_004139069.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Cucumis 
sativus]
 gb|KGN66568.1| hypothetical protein Csa_1G629740 [Cucumis sativus]
Length=466

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 59/68 (87%), Gaps = 3/68 (4%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPA--GAPP  28
            G+IHGIER+LIPQSVQ DFN RR+L++I+AV P GAPEVDPRTHRLKKP+P PA  G+ P
Sbjct  180  GVIHGIERLLIPQSVQDDFNRRRNLQAITAVKPEGAPEVDPRTHRLKKPAP-PAEPGSAP  238

Query  27   VLPIYDAM  4
             LPIYDA+
Sbjct  239  ALPIYDAL  246



>ref|XP_011094205.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Sesamum 
indicum]
Length=465

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = -1

Query  318  HPSLCRGAGDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNT  139
            H SLC  A DE   + ++NGE+ VS A+V+++DD++RPDGIIHGIER+LIP+SVQ DFN 
Sbjct  142  HSSLCPDASDEKILLKEKNGEKIVSMARVIKSDDIIRPDGIIHGIERLLIPKSVQQDFNA  201

Query  138  RRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPVLPIYDAM  4
            RRSLR+ SAVLP GAP VDPRTHRLKK   PVP GAPPVLPIYDAM
Sbjct  202  RRSLRATSAVLPEGAPVVDPRTHRLKKPAPPVPVGAPPVLPIYDAM  247



>ref|XP_011077777.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Sesamum 
indicum]
Length=463

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -1

Query  318  HPSLCRGAGDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNT  139
            H SLC  A DE   + ++NGE+ V  AKV+++DD++RPDGIIHGIER+L+P+SVQ DFN 
Sbjct  141  HTSLCPDANDEKIQLHEKNGEKIVGIAKVIKSDDIIRPDGIIHGIERLLVPKSVQQDFNA  200

Query  138  RRSLRSISAVLPTGAPEVDPRTHRLKK  58
            RRSLR+ SAVLP GAPEVDPRTHRLKK
Sbjct  201  RRSLRATSAVLPEGAPEVDPRTHRLKK  227



>ref|XP_009146690.1| PREDICTED: fasciclin-like arabinogalactan protein 18 [Brassica 
rapa]
Length=456

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 59/69 (86%), Gaps = 3/69 (4%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKP---SPVPAGAP  31
            G+IHGIER+LIP+SVQ DFN RR+LRSISAVLP GAPEVDPRT+RLKK    + VPAG+P
Sbjct  172  GLIHGIERLLIPRSVQEDFNRRRNLRSISAVLPEGAPEVDPRTNRLKKSAAAAAVPAGSP  231

Query  30   PVLPIYDAM  4
            PVLPI  A+
Sbjct  232  PVLPIQSAI  240



>ref|XP_002882744.1| beta-Ig-H3 domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59003.1| beta-Ig-H3 domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=460

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 58/69 (84%), Gaps = 3/69 (4%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKP---SPVPAGAP  31
            G+IHGIER+LIP+SVQ DFN RR+LRSISAVLP GAPE+DPRT+RLKK    + VPAG+P
Sbjct  174  GLIHGIERLLIPRSVQEDFNRRRNLRSISAVLPEGAPEIDPRTNRLKKSAAAASVPAGSP  233

Query  30   PVLPIYDAM  4
            P LPI  AM
Sbjct  234  PALPIESAM  242



>gb|KDO48671.1| hypothetical protein CISIN_1g013434mg [Citrus sinensis]
 gb|KDO48672.1| hypothetical protein CISIN_1g013434mg [Citrus sinensis]
Length=443

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 56/67 (84%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPA-GAPPV  25
            G+IHGIER+LIP+SVQ DFN RR+LRSISAV P GAPEVDPRT+RLKKP+P    G+ P 
Sbjct  187  GVIHGIERLLIPRSVQQDFNNRRNLRSISAVRPEGAPEVDPRTNRLKKPTPASKPGSSPA  246

Query  24   LPIYDAM  4
            LP+Y AM
Sbjct  247  LPVYYAM  253



>ref|XP_006445815.1| hypothetical protein CICLE_v10015097mg [Citrus clementina]
 ref|XP_006485518.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Citrus 
sinensis]
 gb|ESR59055.1| hypothetical protein CICLE_v10015097mg [Citrus clementina]
Length=476

 Score = 98.6 bits (244),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 56/67 (84%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPA-GAPPV  25
            G+IHGIER+LIP+SVQ DFN RR+LRSISAV P GAPEVDPRT+RLKKP+P    G+ P 
Sbjct  187  GVIHGIERLLIPRSVQQDFNNRRNLRSISAVRPEGAPEVDPRTNRLKKPTPASKPGSSPA  246

Query  24   LPIYDAM  4
            LP+Y AM
Sbjct  247  LPVYYAM  253



>ref|XP_002876139.1| beta-Ig-H3 domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52398.1| beta-Ig-H3 domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=435

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 63/68 (93%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKP-SPVPAGAPPV  25
            GIIHGIER+LIP+SVQ DFN RRSLRSI+AVLP GAPEVDPRTHRLKK  +P+PAGAPPV
Sbjct  155  GIIHGIERLLIPRSVQEDFNRRRSLRSIAAVLPEGAPEVDPRTHRLKKKPAPIPAGAPPV  214

Query  24   LPIYDAMA  1
            LP+YDAM+
Sbjct  215  LPVYDAMS  222



>ref|XP_010553413.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Tarenaya 
hassleriana]
Length=464

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 62/67 (93%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            GIIHGIE++LIP+SVQ DFN RRSLRSISAVLPTGAPEVDPRTHRLKK   PVPAGAPPV
Sbjct  178  GIIHGIEKLLIPRSVQEDFNRRRSLRSISAVLPTGAPEVDPRTHRLKKPAPPVPAGAPPV  237

Query  24   LPIYDAM  4
            LPIYDAM
Sbjct  238  LPIYDAM  244



>ref|XP_007132513.1| hypothetical protein PHAVU_011G100600g [Phaseolus vulgaris]
 gb|ESW04507.1| hypothetical protein PHAVU_011G100600g [Phaseolus vulgaris]
Length=450

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 56/67 (84%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPV  25
            G+IHGI+ +LIP+SVQ DFN RR+L SI+AV P  APEVDPRTHRLKKP+ P PAG+ P 
Sbjct  165  GVIHGIDTLLIPRSVQDDFNRRRNLISIAAVKPESAPEVDPRTHRLKKPAPPSPAGSAPA  224

Query  24   LPIYDAM  4
            LPIYDAM
Sbjct  225  LPIYDAM  231



>ref|XP_010543842.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Tarenaya 
hassleriana]
Length=468

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 62/68 (91%), Gaps = 2/68 (3%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK--PSPVPAGAPP  28
            G+IHGIER+LIP+SVQ DFN RRSLRSISAVLPTGAPEVDPRTHRLKK   + VPAGAPP
Sbjct  183  GVIHGIERLLIPRSVQEDFNRRRSLRSISAVLPTGAPEVDPRTHRLKKPSAAAVPAGAPP  242

Query  27   VLPIYDAM  4
            VLPIYDAM
Sbjct  243  VLPIYDAM  250



>ref|NP_190805.1| fasciclin-like arabinogalactan protein 15 [Arabidopsis thaliana]
 sp|Q9FT45.1|FLA15_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 15; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAC07928.1| putative protein [Arabidopsis thaliana]
 dbj|BAC42264.1| GPI-anchored protein [Arabidopsis thaliana]
 gb|ABG48483.1| At3g52370 [Arabidopsis thaliana]
 gb|AEE78939.1| fasciclin-like arabinogalactan protein 15 [Arabidopsis thaliana]
Length=436

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 63/68 (93%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKP-SPVPAGAPPV  25
            GIIHGIER+LIP+SVQ DFN RRSLRSI+AVLP GAPEVDPRTHRLKK  +P+PAGAPPV
Sbjct  156  GIIHGIERLLIPRSVQEDFNRRRSLRSIAAVLPEGAPEVDPRTHRLKKKPAPIPAGAPPV  215

Query  24   LPIYDAMA  1
            LP+YDAM+
Sbjct  216  LPVYDAMS  223



>ref|XP_006403811.1| hypothetical protein EUTSA_v10010381mg [Eutrema salsugineum]
 gb|ESQ45264.1| hypothetical protein EUTSA_v10010381mg [Eutrema salsugineum]
Length=441

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 63/68 (93%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKP-SPVPAGAPPV  25
            GIIHGIER+LIP+SVQ DFN RR+LRSISAVLP GAPEVDPRTHRLKK  +PVPAGAPP+
Sbjct  160  GIIHGIERLLIPRSVQEDFNRRRNLRSISAVLPEGAPEVDPRTHRLKKKPAPVPAGAPPI  219

Query  24   LPIYDAMA  1
            LP+YDAM+
Sbjct  220  LPVYDAMS  227



>ref|XP_006291159.1| hypothetical protein CARUB_v10017276mg [Capsella rubella]
 gb|EOA24057.1| hypothetical protein CARUB_v10017276mg [Capsella rubella]
Length=437

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 62/68 (91%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKP-SPVPAGAPPV  25
            GIIHGIER+LIP+SVQ DFN RRSLRSISAVLP GAPEVDPRTHRLKK   PVPAGAPPV
Sbjct  157  GIIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEVDPRTHRLKKKPVPVPAGAPPV  216

Query  24   LPIYDAMA  1
            LP+YDAM+
Sbjct  217  LPVYDAMS  224



>ref|XP_004296276.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Fragaria 
vesca subsp. vesca]
Length=459

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPS-PVPAGAPPV  25
            G+IH IER+LIP+SV+ DFN RRSLRSI+AV P GAPEVDPRT+RLKKP+ P   G+ PV
Sbjct  173  GVIHAIERLLIPRSVEDDFNRRRSLRSITAVKPEGAPEVDPRTNRLKKPAPPSKPGSSPV  232

Query  24   LPIYDAM  4
            LPIYDA+
Sbjct  233  LPIYDAL  239



>ref|XP_006495395.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like, partial 
[Citrus sinensis]
Length=309

 Score = 94.7 bits (234),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 62/67 (93%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            G+IHGIER+L+P+SVQ DFN RR+LRSISAVLP GAPEVDPRTHRLKK  +PVPAGAPP+
Sbjct  168  GVIHGIERLLVPRSVQEDFNRRRNLRSISAVLPQGAPEVDPRTHRLKKPAAPVPAGAPPI  227

Query  24   LPIYDAM  4
            LPIYDAM
Sbjct  228  LPIYDAM  234



>ref|XP_010431275.1| PREDICTED: fasciclin-like arabinogalactan protein 15, partial 
[Camelina sativa]
Length=246

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 62/68 (91%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKP-SPVPAGAPPV  25
            G+IHGIER+LIP+SVQ DFN RRSLRSI+AVLP GAPEVDPRTHRLKK   PVPAGAPPV
Sbjct  155  GVIHGIERLLIPRSVQEDFNRRRSLRSIAAVLPEGAPEVDPRTHRLKKKPVPVPAGAPPV  214

Query  24   LPIYDAMA  1
            LPIYDAM+
Sbjct  215  LPIYDAMS  222



>gb|KDO70682.1| hypothetical protein CISIN_1g019153mg [Citrus sinensis]
Length=345

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 62/67 (93%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            G+IHGIER+L+P+SVQ DFN RR+LRSISAVLP GAPEVDPRTHRLKK  +PVPAGAPP+
Sbjct  168  GVIHGIERLLVPRSVQEDFNRRRNLRSISAVLPQGAPEVDPRTHRLKKPAAPVPAGAPPI  227

Query  24   LPIYDAM  4
            LPIYDAM
Sbjct  228  LPIYDAM  234



>ref|XP_010525828.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Tarenaya 
hassleriana]
Length=464

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 62/67 (93%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            GIIHGI+++LIP+SVQ DFN RRSLRSISAVLPTGAPEVDPRTHRLKK   PVPAGAPPV
Sbjct  179  GIIHGIQKLLIPRSVQEDFNRRRSLRSISAVLPTGAPEVDPRTHRLKKPAPPVPAGAPPV  238

Query  24   LPIYDAM  4
            LPIYDAM
Sbjct  239  LPIYDAM  245



>gb|KDP36078.1| hypothetical protein JCGZ_08722 [Jatropha curcas]
Length=466

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 88/106 (83%), Gaps = 4/106 (4%)
 Frame = -1

Query  318  HPSLCRGAGDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNT  139
            H +LC    D    +S+ +G++ V +A+++R DDV+RPDG+IHGIER+LIPQSVQ DFN 
Sbjct  145  HSTLC---NDHLRLISKSSGKKAVDSAEIIRPDDVIRPDGVIHGIERLLIPQSVQEDFNR  201

Query  138  RRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPVLPIYDAM  4
            RR+LRSISAVLP GAPEVDPRTHRLKK  +PVPAGAPPVLPIYDA+
Sbjct  202  RRNLRSISAVLPEGAPEVDPRTHRLKKPAAPVPAGAPPVLPIYDAL  247



>ref|XP_006592365.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like [Glycine 
max]
Length=453

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPV-PAGAPPV  25
            G+IHGI+ +LIP+SVQ +FN RR+L SI+AV P  +PEVDPRTHRLKKP+P  PAG+PP 
Sbjct  168  GVIHGIDTLLIPRSVQDEFNRRRNLISIAAVKPEPSPEVDPRTHRLKKPAPASPAGSPPA  227

Query  24   LPIYDAM  4
            LPIYDAM
Sbjct  228  LPIYDAM  234



>ref|XP_009139464.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Brassica 
rapa]
Length=440

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 63/68 (93%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKP-SPVPAGAPPV  25
            GIIHGIER+LIP+SVQ DFN RR+LRSISAVLP GAPEVDPRTHRLKK  +PVPAGAPPV
Sbjct  160  GIIHGIERLLIPRSVQEDFNRRRNLRSISAVLPEGAPEVDPRTHRLKKKPAPVPAGAPPV  219

Query  24   LPIYDAMA  1
            LP+YDAM+
Sbjct  220  LPVYDAMS  227



>emb|CDY23209.1| BnaA04g05500D [Brassica napus]
Length=440

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 63/68 (93%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKP-SPVPAGAPPV  25
            GIIHGIER+LIP+SVQ DFN RR+LRSISAVLP GAPEVDPRTHRLKK  +PVPAGAPPV
Sbjct  160  GIIHGIERLLIPRSVQEDFNRRRNLRSISAVLPEGAPEVDPRTHRLKKKPAPVPAGAPPV  219

Query  24   LPIYDAMA  1
            LP+YDAM+
Sbjct  220  LPVYDAMS  227



>emb|CDX95333.1| BnaC04g28250D [Brassica napus]
Length=440

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 63/68 (93%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKP-SPVPAGAPPV  25
            GIIHGIER+LIP+SVQ DFN RR+LRSISAVLP GAPEVDPRTHRLKK  +PVPAGAPPV
Sbjct  160  GIIHGIERLLIPRSVQEDFNRRRNLRSISAVLPEGAPEVDPRTHRLKKKPAPVPAGAPPV  219

Query  24   LPIYDAMA  1
            LP+YDAM+
Sbjct  220  LPVYDAMS  227



>ref|XP_010516793.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Camelina 
sativa]
Length=445

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 61/68 (90%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            GIIHGIER+LIP+SVQ DFN RRSLRSISAV+P GAPEVDPRTHRLKK    VPAGAPPV
Sbjct  164  GIIHGIERLLIPRSVQEDFNRRRSLRSISAVIPEGAPEVDPRTHRLKKPAPAVPAGAPPV  223

Query  24   LPIYDAMA  1
            LPIYDAM+
Sbjct  224  LPIYDAMS  231



>ref|XP_010509549.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Camelina 
sativa]
Length=445

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 61/68 (90%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            GIIHGIER+LIP+SVQ DFN RRSLRSISAV+P GAPEVDPRTHRLKK    VPAGAPPV
Sbjct  164  GIIHGIERLLIPRSVQEDFNRRRSLRSISAVIPEGAPEVDPRTHRLKKPAPAVPAGAPPV  223

Query  24   LPIYDAMA  1
            LPIYDAM+
Sbjct  224  LPIYDAMS  231



>ref|XP_006407421.1| hypothetical protein EUTSA_v10020679mg [Eutrema salsugineum]
 gb|ESQ48874.1| hypothetical protein EUTSA_v10020679mg [Eutrema salsugineum]
Length=464

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 58/70 (83%), Gaps = 4/70 (6%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK----PSPVPAGA  34
            G+IHGIER+LIP+SVQ DFN RRSLRSISAVLP GAPE+DPRT+RLKK       VPAG+
Sbjct  178  GLIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEIDPRTNRLKKSAAASVAVPAGS  237

Query  33   PPVLPIYDAM  4
            PPVLPI  AM
Sbjct  238  PPVLPIQSAM  247



>ref|XP_006481636.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Citrus 
sinensis]
Length=451

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 62/67 (93%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            G+IHGIER+L+P+SVQ DFN RR+LRSISAVLP GAPEVDPRTHRLKK  +PVPAGAPP+
Sbjct  168  GVIHGIERLLVPRSVQEDFNRRRNLRSISAVLPQGAPEVDPRTHRLKKPAAPVPAGAPPI  227

Query  24   LPIYDAM  4
            LPIYDAM
Sbjct  228  LPIYDAM  234



>ref|XP_006430020.1| hypothetical protein CICLE_v10011703mg [Citrus clementina]
 ref|XP_006430021.1| hypothetical protein CICLE_v10011703mg [Citrus clementina]
 gb|ESR43260.1| hypothetical protein CICLE_v10011703mg [Citrus clementina]
 gb|ESR43261.1| hypothetical protein CICLE_v10011703mg [Citrus clementina]
Length=451

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 62/67 (93%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            G+IHGIER+L+P+SVQ DFN RR+LRSISAVLP GAPEVDPRTHRLKK  +PVPAGAPP+
Sbjct  168  GVIHGIERLLVPRSVQEDFNRRRNLRSISAVLPQGAPEVDPRTHRLKKPAAPVPAGAPPI  227

Query  24   LPIYDAM  4
            LPIYDAM
Sbjct  228  LPIYDAM  234



>ref|XP_002879581.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55840.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=445

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 61/68 (90%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            GIIHGIER+LIP+SVQ DFN RRSLRSISAV+P GAPEVDPRTHRLKK    VPAGAPPV
Sbjct  164  GIIHGIERLLIPRSVQEDFNRRRSLRSISAVIPEGAPEVDPRTHRLKKPAPAVPAGAPPV  223

Query  24   LPIYDAMA  1
            LPIYDAM+
Sbjct  224  LPIYDAMS  231



>ref|XP_010505110.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Camelina 
sativa]
Length=492

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 61/68 (90%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            GIIHGIER+LIP+SVQ DFN RRSLRSISAV+P GAPEVDPRTHRLKK    VPAGAPPV
Sbjct  211  GIIHGIERLLIPRSVQEDFNRRRSLRSISAVIPEGAPEVDPRTHRLKKPAPAVPAGAPPV  270

Query  24   LPIYDAMA  1
            LPIYDAM+
Sbjct  271  LPIYDAMS  278



>ref|XP_010426853.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Camelina 
sativa]
Length=435

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 62/68 (91%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKP-SPVPAGAPPV  25
            G+IHGIER+LIP+SVQ DFN RRSLRSI+AVLP GAPEVDPRTHRLKK   PVPAGAPPV
Sbjct  155  GVIHGIERLLIPRSVQEDFNRRRSLRSIAAVLPEGAPEVDPRTHRLKKKPVPVPAGAPPV  214

Query  24   LPIYDAMA  1
            LP+YDAM+
Sbjct  215  LPVYDAMS  222



>ref|XP_010503981.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Camelina 
sativa]
Length=435

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 62/68 (91%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKP-SPVPAGAPPV  25
            G+IHGIER+LIP+SVQ DFN RRSLRSI+AVLP GAPEVDPRTHRLKK   PVPAGAPPV
Sbjct  155  GVIHGIERLLIPRSVQEDFNRRRSLRSIAAVLPEGAPEVDPRTHRLKKKPVPVPAGAPPV  214

Query  24   LPIYDAMA  1
            LP+YDAM+
Sbjct  215  LPVYDAMS  222



>ref|XP_010515698.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Camelina 
sativa]
Length=435

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 63/68 (93%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKP-SPVPAGAPPV  25
            G+IHGIER+LIP+SVQ DFN RRSLRSI+AVLP GAPEVDPRTHRLKK  +PVPAGAPPV
Sbjct  155  GVIHGIERLLIPRSVQEDFNRRRSLRSIAAVLPEGAPEVDPRTHRLKKKPAPVPAGAPPV  214

Query  24   LPIYDAMA  1
            LP+YDAM+
Sbjct  215  LPVYDAMS  222



>ref|XP_004303393.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Fragaria 
vesca subsp. vesca]
Length=457

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 60/67 (90%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            G+IHGIERVLIP+SVQ DFN RRSLRSISAV+P GAPEVDPRTHRLKK    VPAGAPPV
Sbjct  178  GLIHGIERVLIPRSVQEDFNRRRSLRSISAVIPEGAPEVDPRTHRLKKPAPAVPAGAPPV  237

Query  24   LPIYDAM  4
            LPIYDA+
Sbjct  238  LPIYDAL  244



>ref|XP_009387789.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Musa acuminata 
subsp. malaccensis]
Length=474

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 62/68 (91%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            G+IHGIER+L+P+SVQ DFN RRSL +ISAVLPTGAPEVDPRTHRLKK   PVPAGAPPV
Sbjct  177  GVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVPAGAPPV  236

Query  24   LPIYDAMA  1
            LPIYDAMA
Sbjct  237  LPIYDAMA  244



>ref|XP_009388984.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009388985.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Musa acuminata 
subsp. malaccensis]
Length=476

 Score = 93.2 bits (230),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 62/68 (91%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            G+IHGIER+L+P+SVQ DFN RRSL +ISAVLPTGAPEVDPRTHRLKK   PVPAGAPPV
Sbjct  179  GVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVPAGAPPV  238

Query  24   LPIYDAMA  1
            LPIYDAMA
Sbjct  239  LPIYDAMA  246



>ref|XP_003554480.1| PREDICTED: fasciclin-like arabinogalactan protein 15-like [Glycine 
max]
Length=455

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPVL  22
            G+IHGIER+++P+SVQ DFN RR+L +ISAVLP GAPEVDPRTHRLKKP+PVPAGAPPVL
Sbjct  175  GVIHGIERLIVPRSVQEDFNRRRNLAAISAVLPEGAPEVDPRTHRLKKPAPVPAGAPPVL  234

Query  21   PIYDAM  4
            PIYDAM
Sbjct  235  PIYDAM  240



>ref|XP_010263095.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Nelumbo 
nucifera]
Length=470

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 59/67 (88%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            G+IHGIER+L+P+SVQ DFN RRSLRSISAVLP GAPEVDPRTHRLKK   P PAG+PP 
Sbjct  178  GVIHGIERLLVPRSVQEDFNRRRSLRSISAVLPEGAPEVDPRTHRLKKPAPPSPAGSPPA  237

Query  24   LPIYDAM  4
            LPIYDA+
Sbjct  238  LPIYDAL  244



>tpg|DAA51812.1| TPA: hypothetical protein ZEAMMB73_870378 [Zea mays]
Length=337

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            G+IHGIER+L+P+SVQ DFN RRSL +ISAVLPTGAPEVDPRTHRLKK   PV  GAPPV
Sbjct  173  GVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVAPGAPPV  232

Query  24   LPIYDAMA  1
            LP++DAMA
Sbjct  233  LPVWDAMA  240



>ref|XP_010110455.1| hypothetical protein L484_006448 [Morus notabilis]
 gb|EXC26397.1| hypothetical protein L484_006448 [Morus notabilis]
Length=460

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 62/67 (93%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            G+IHGIER+LIP+SVQ DFN RR+LRSISAVLP GAPEVDPRTHRLKK  +PVPAGAPPV
Sbjct  176  GVIHGIERLLIPRSVQEDFNRRRNLRSISAVLPEGAPEVDPRTHRLKKPAAPVPAGAPPV  235

Query  24   LPIYDAM  4
            LPIYDA+
Sbjct  236  LPIYDAL  242



>emb|CDX79631.1| BnaC03g19670D [Brassica napus]
Length=446

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 63/68 (93%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            GIIHGIER+LIP+SVQ DFN+RRSLRSISAVLP GAPEVDPRT+RLKK P PVPAGAPPV
Sbjct  165  GIIHGIERLLIPRSVQEDFNSRRSLRSISAVLPEGAPEVDPRTNRLKKPPPPVPAGAPPV  224

Query  24   LPIYDAMA  1
            LPIY AM+
Sbjct  225  LPIYSAMS  232



>ref|XP_003521503.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like isoform 
X1 [Glycine max]
Length=453

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPVL  22
            G+IHGIER+++P+SVQ DFN RR+L +ISAVLP GAPEVDPRTHRLKKP+PVPAGAPPVL
Sbjct  172  GVIHGIERLIVPRSVQEDFNRRRNLAAISAVLPEGAPEVDPRTHRLKKPAPVPAGAPPVL  231

Query  21   PIYDAM  4
            PIYDA+
Sbjct  232  PIYDAL  237



>ref|NP_001130335.1| uncharacterized protein LOC100191430 precursor [Zea mays]
 gb|ACF78522.1| unknown [Zea mays]
 gb|ACL52516.1| unknown [Zea mays]
 gb|ACL54364.1| unknown [Zea mays]
 gb|ACL54392.1| unknown [Zea mays]
 gb|ACL54585.1| unknown [Zea mays]
 gb|ACL54630.1| unknown [Zea mays]
 gb|ACL54654.1| unknown [Zea mays]
Length=465

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            G+IHGIER+L+P+SVQ DFN RRSL +ISAVLPTGAPEVDPRTHRLKK   PV  GAPPV
Sbjct  173  GVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVAPGAPPV  232

Query  24   LPIYDAMA  1
            LP++DAMA
Sbjct  233  LPVWDAMA  240



>tpg|DAA51813.1| TPA: LOW QUALITY PROTEIN: fasciclin domain protein [Zea mays]
Length=464

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            G+IHGIER+L+P+SVQ DFN RRSL +ISAVLPTGAPEVDPRTHRLKK   PV  GAPPV
Sbjct  173  GVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVAPGAPPV  232

Query  24   LPIYDAMA  1
            LP++DAMA
Sbjct  233  LPVWDAMA  240



>ref|XP_006826417.1| hypothetical protein AMTR_s00004p00159330 [Amborella trichopoda]
 gb|ERM93654.1| hypothetical protein AMTR_s00004p00159330 [Amborella trichopoda]
Length=470

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 53/69 (77%), Gaps = 2/69 (3%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPAGAP--P  28
            G+IHGIER+LIP+SVQ +FN RRSL SI AVLP GAPEVDPRT RLKKP+      P  P
Sbjct  181  GVIHGIERLLIPRSVQAEFNKRRSLTSIQAVLPEGAPEVDPRTARLKKPAHSAPAPPYTP  240

Query  27   VLPIYDAMA  1
             LPIY AMA
Sbjct  241  TLPIYAAMA  249



>ref|XP_004494272.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like isoform 
X2 [Cicer arietinum]
Length=453

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPVL  22
            G+IHGIER++IP+SVQ DFN RR+LR ISA+LP GAPEVDPRT+RLKKP+PVPAGAPPVL
Sbjct  170  GVIHGIERLIIPRSVQEDFNRRRNLRDISAILPEGAPEVDPRTNRLKKPAPVPAGAPPVL  229

Query  21   PIYDAM  4
            PIY+AM
Sbjct  230  PIYNAM  235



>ref|XP_004494271.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like isoform 
X1 [Cicer arietinum]
Length=467

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPVL  22
            G+IHGIER++IP+SVQ DFN RR+LR ISA+LP GAPEVDPRT+RLKKP+PVPAGAPPVL
Sbjct  170  GVIHGIERLIIPRSVQEDFNRRRNLRDISAILPEGAPEVDPRTNRLKKPAPVPAGAPPVL  229

Query  21   PIYDAM  4
            PIY+AM
Sbjct  230  PIYNAM  235



>ref|XP_009133050.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Brassica 
rapa]
Length=446

 Score = 90.5 bits (223),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 62/68 (91%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            GIIHGIER+LIP+SVQ DFN RRSLRSISAVLP GAPEVDPRT+RLKK P PVPAGAPPV
Sbjct  165  GIIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEVDPRTNRLKKPPPPVPAGAPPV  224

Query  24   LPIYDAMA  1
            LPIY AM+
Sbjct  225  LPIYSAMS  232



>emb|CDX84594.1| BnaA03g16360D [Brassica napus]
Length=446

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 62/68 (91%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            GIIHGIER+LIP+SVQ DFN RRSLRSISAVLP GAPEVDPRT+RLKK P PVPAGAPPV
Sbjct  165  GIIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEVDPRTNRLKKPPPPVPAGAPPV  224

Query  24   LPIYDAMA  1
            LPIY AM+
Sbjct  225  LPIYSAMS  232



>ref|XP_007204352.1| hypothetical protein PRUPE_ppa005721mg [Prunus persica]
 gb|EMJ05551.1| hypothetical protein PRUPE_ppa005721mg [Prunus persica]
Length=447

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = -1

Query  318  HPSLCRGAGDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNT  139
            H +LC      + A  + N  + V++A+++R DDV RPDG+IHGIER+LIP+SV+ DFN 
Sbjct  122  HQTLCSSHERLHLATHKNNSRKSVNSAQIIRPDDVTRPDGVIHGIERLLIPRSVEDDFNR  181

Query  138  RRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPVLPIYDAM  4
            RR+LR+ISA+LP GAPEVDPRTHRLKK  +PVPAGAPPVLP+YDA+
Sbjct  182  RRNLRTISAILPEGAPEVDPRTHRLKKPAAPVPAGAPPVLPVYDAL  227



>ref|XP_007163001.1| hypothetical protein PHAVU_001G197900g [Phaseolus vulgaris]
 gb|ESW34995.1| hypothetical protein PHAVU_001G197900g [Phaseolus vulgaris]
Length=437

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 50/66 (76%), Gaps = 13/66 (20%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPVL  22
            G+IHGIER+L+P+SVQ DFN R             APE+DPRTHRLKK +PVPAGAPPVL
Sbjct  171  GVIHGIERLLVPRSVQEDFNRR-------------APEIDPRTHRLKKSAPVPAGAPPVL  217

Query  21   PIYDAM  4
            PIYDAM
Sbjct  218  PIYDAM  223



>ref|XP_008241098.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Prunus 
mume]
Length=483

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 63/68 (93%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            G+IHGIER+LIP+SV+ DFN RR+LR+ISA+LP GAPEVDPRTHRLKK  +PVPAGAPPV
Sbjct  197  GVIHGIERLLIPRSVEDDFNRRRNLRTISAILPEGAPEVDPRTHRLKKPAAPVPAGAPPV  256

Query  24   LPIYDAMA  1
            LP+YDA+A
Sbjct  257  LPLYDALA  264



>gb|KEH24284.1| fasciclin-like arabinogalactan protein 16 precursor [Medicago 
truncatula]
Length=448

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPVL  22
            G+IHGI+R++IP+SVQ DFN RR+LR ISA+LP GAPEVDPRT+RLKKP+PVPAGAPPVL
Sbjct  163  GVIHGIQRLIIPRSVQEDFNRRRNLRDISAILPEGAPEVDPRTNRLKKPAPVPAGAPPVL  222

Query  21   PIYDAM  4
            PIYDA+
Sbjct  223  PIYDAL  228



>ref|XP_008803482.1| PREDICTED: LOW QUALITY PROTEIN: fasciclin-like arabinogalactan 
protein 17 [Phoenix dactylifera]
Length=465

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            G+IHGIER+L+P+SVQ DFN RRSL SISA+LPTGAPEVDPRTHRLKK   P PAG+PP 
Sbjct  178  GVIHGIERLLVPRSVQEDFNRRRSLASISAILPTGAPEVDPRTHRLKKPAPPAPAGSPPA  237

Query  24   LPIYDAMA  1
            LPIYDAMA
Sbjct  238  LPIYDAMA  245



>gb|KJB36231.1| hypothetical protein B456_006G147500 [Gossypium raimondii]
Length=330

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 85/105 (81%), Gaps = 3/105 (3%)
 Frame = -1

Query  318  HPSLCRGAGDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNT  139
            H +LC    D     SQ  G++ V +A++VR DDV+RPDG+IHGI+++LIP+SV  DFN 
Sbjct  141  HNTLC---NDHIRLTSQSTGKKTVDSAELVRPDDVIRPDGVIHGIQQLLIPRSVIEDFNR  197

Query  138  RRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPVLPIYDAM  4
            RR+LRSI+AVLP GAPEVDPRTHRLKKP+PVP GAPPVLPIY+AM
Sbjct  198  RRNLRSITAVLPEGAPEVDPRTHRLKKPAPVPVGAPPVLPIYEAM  242



>ref|XP_008392004.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Malus domestica]
Length=454

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPVL  22
            G+IHGIE +LIP+ V+ DFN RR+LR+ISA+ P GAPEVDPRTHRLKKP+PVPAGAPPVL
Sbjct  174  GVIHGIESLLIPRXVEDDFNRRRNLRTISAIHPEGAPEVDPRTHRLKKPAPVPAGAPPVL  233

Query  21   PIYDAM  4
            PIYDA+
Sbjct  234  PIYDAL  239



>emb|CDY08502.1| BnaA05g27380D [Brassica napus]
Length=456

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 59/69 (86%), Gaps = 3/69 (4%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK---PSPVPAGAP  31
            G+IHGIER+LIP+SVQ DFN RR+LRSISAVLP GAPEVDPRT+RLKK    + VPAG+P
Sbjct  172  GLIHGIERLLIPRSVQEDFNRRRNLRSISAVLPEGAPEVDPRTNRLKKASAAAAVPAGSP  231

Query  30   PVLPIYDAM  4
            PVLPI  AM
Sbjct  232  PVLPIQSAM  240



>ref|XP_007028043.1| FASCICLIN-like arabinogalactan protein 17 precursor [Theobroma 
cacao]
 gb|EOY08545.1| FASCICLIN-like arabinogalactan protein 17 precursor [Theobroma 
cacao]
Length=463

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPVL  22
            G+IHGI+++LIP+SV  DFN RR+LRSISAVLP GAPEVDPRTHRLKKP+PVP GAPPVL
Sbjct  181  GVIHGIQQLLIPRSVIEDFNKRRNLRSISAVLPEGAPEVDPRTHRLKKPAPVPVGAPPVL  240

Query  21   PIYDAM  4
            PIY+AM
Sbjct  241  PIYEAM  246



>gb|KJB36232.1| hypothetical protein B456_006G147500 [Gossypium raimondii]
Length=460

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 85/105 (81%), Gaps = 3/105 (3%)
 Frame = -1

Query  318  HPSLCRGAGDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNT  139
            H +LC    D     SQ  G++ V +A++VR DDV+RPDG+IHGI+++LIP+SV  DFN 
Sbjct  141  HNTLC---NDHIRLTSQSTGKKTVDSAELVRPDDVIRPDGVIHGIQQLLIPRSVIEDFNR  197

Query  138  RRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPVLPIYDAM  4
            RR+LRSI+AVLP GAPEVDPRTHRLKKP+PVP GAPPVLPIY+AM
Sbjct  198  RRNLRSITAVLPEGAPEVDPRTHRLKKPAPVPVGAPPVLPIYEAM  242



>gb|KJB36230.1| hypothetical protein B456_006G147500 [Gossypium raimondii]
Length=459

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 85/105 (81%), Gaps = 3/105 (3%)
 Frame = -1

Query  318  HPSLCRGAGDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNT  139
            H +LC    D     SQ  G++ V +A++VR DDV+RPDG+IHGI+++LIP+SV  DFN 
Sbjct  141  HNTLC---NDHIRLTSQSTGKKTVDSAELVRPDDVIRPDGVIHGIQQLLIPRSVIEDFNR  197

Query  138  RRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPVLPIYDAM  4
            RR+LRSI+AVLP GAPEVDPRTHRLKKP+PVP GAPPVLPIY+AM
Sbjct  198  RRNLRSITAVLPEGAPEVDPRTHRLKKPAPVPVGAPPVLPIYEAM  242



>ref|XP_008798695.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Phoenix 
dactylifera]
Length=464

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK  58
            G+IHGIER+L+P+SVQ DFN RRSL SISAVLP GAPEVDPRTHRLKK
Sbjct  177  GVIHGIERLLVPRSVQEDFNRRRSLASISAVLPVGAPEVDPRTHRLKK  224



>ref|XP_009130939.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Brassica 
rapa]
 ref|XP_009130940.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Brassica 
rapa]
Length=458

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK  58
            G+IHGIER+LIP+SVQ DFN RRSLRSISAVLP GAPEVDPRT+RLKK
Sbjct  174  GLIHGIERLLIPRSVQEDFNRRRSLRSISAVLPEGAPEVDPRTNRLKK  221



>gb|KEH29726.1| fasciclin-like arabinogalactan protein 16 precursor [Medicago 
truncatula]
Length=466

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 56/67 (84%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            G+IHGIER+LIP+SVQ DFN RRSL SI+A+ P GAPEVDPRTHRLKK P P   G+PP 
Sbjct  176  GVIHGIERLLIPRSVQDDFNRRRSLVSIAAIKPEGAPEVDPRTHRLKKPPPPQNPGSPPA  235

Query  24   LPIYDAM  4
            LPI+DA+
Sbjct  236  LPIFDAL  242



>gb|KHG03559.1| Fasciclin-like arabinogalactan protein 17 [Gossypium arboreum]
Length=459

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 84/105 (80%), Gaps = 3/105 (3%)
 Frame = -1

Query  318  HPSLCRGAGDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNT  139
            H +LC    D     SQ  G++ V +A++VR DDV+RPDG+IHGI+++LIP+SV  DFN 
Sbjct  141  HNTLC---NDHIRLTSQSTGKKTVDSAELVRPDDVIRPDGVIHGIQQLLIPRSVIEDFNR  197

Query  138  RRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPVLPIYDAM  4
            RR+LRSI+AVLP GAPEVDPRTHRLK P+PVP GAPPVLPIYDAM
Sbjct  198  RRNLRSITAVLPEGAPEVDPRTHRLKNPAPVPVGAPPVLPIYDAM  242



>dbj|BAE71191.1| hypothetical protein [Trifolium pratense]
Length=454

 Score = 84.7 bits (208),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 48/68 (71%), Positives = 57/68 (84%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            G+IHGI+R+LIP+SV+ DFN RRSLRSI+AV P GAP+VD R HRLKK P P   G+PPV
Sbjct  162  GVIHGIQRLLIPRSVEDDFNNRRSLRSITAVKPEGAPDVDIRNHRLKKYPPPEKPGSPPV  221

Query  24   LPIYDAMA  1
            LPIYDAM+
Sbjct  222  LPIYDAMS  229



>ref|XP_003543398.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like isoform 
X1 [Glycine max]
 ref|XP_006594907.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like isoform 
X2 [Glycine max]
Length=455

 Score = 84.7 bits (208),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRL-KKPSPVPAGAPPV  25
            G+IHGI+R+L+P+SV+ DFN RRSLRSISAV P  APEVDPRTHRL K P P   G+ P 
Sbjct  165  GVIHGIDRLLLPRSVEDDFNRRRSLRSISAVKPEPAPEVDPRTHRLKKPPPPAKPGSLPE  224

Query  24   LPIYDAM  4
            LPIYDAM
Sbjct  225  LPIYDAM  231



>gb|KCW90412.1| hypothetical protein EUGRSUZ_A02551 [Eucalyptus grandis]
Length=463

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 58/67 (87%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            G+IHGI+R+LIP++VQ DFN RRSLRSI+AV+P GAPEVDPRTHRLKK   P PAG+ P 
Sbjct  174  GVIHGIQRLLIPRAVQEDFNRRRSLRSIAAVIPEGAPEVDPRTHRLKKPAPPAPAGSAPA  233

Query  24   LPIYDAM  4
            LPIYDAM
Sbjct  234  LPIYDAM  240



>gb|AAT75258.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99261.1| beta-Ig-H3 domain-containing protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=460

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 52/65 (80%), Gaps = 2/65 (3%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPVL  22
            G+IHGI+R+L+P+SVQ +FN RRSL  ISA+ PT APEVDPRT RLKKP+  P G  PVL
Sbjct  194  GVIHGIDRLLVPRSVQDEFNRRRSLADISAMPPTAAPEVDPRTDRLKKPA--PPGDSPVL  251

Query  21   PIYDA  7
            PI DA
Sbjct  252  PISDA  256



>gb|KCW90413.1| hypothetical protein EUGRSUZ_A02551 [Eucalyptus grandis]
Length=462

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 58/67 (87%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            G+IHGI+R+LIP++VQ DFN RRSLRSI+AV+P GAPEVDPRTHRLKK   P PAG+ P 
Sbjct  174  GVIHGIQRLLIPRAVQEDFNRRRSLRSIAAVIPEGAPEVDPRTHRLKKPAPPAPAGSAPA  233

Query  24   LPIYDAM  4
            LPIYDAM
Sbjct  234  LPIYDAM  240



>ref|NP_001051505.1| Os03g0788700 [Oryza sativa Japonica Group]
 gb|AAT75257.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99260.1| beta-Ig-H3 domain-containing protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13419.1| Os03g0788700 [Oryza sativa Japonica Group]
 dbj|BAG93670.1| unnamed protein product [Oryza sativa Japonica Group]
Length=479

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 52/65 (80%), Gaps = 2/65 (3%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPVL  22
            G+IHGI+R+L+P+SVQ +FN RRSL  ISA+ PT APEVDPRT RLKKP+  P G  PVL
Sbjct  194  GVIHGIDRLLVPRSVQDEFNRRRSLADISAMPPTAAPEVDPRTDRLKKPA--PPGDSPVL  251

Query  21   PIYDA  7
            PI DA
Sbjct  252  PISDA  256



>ref|XP_010058812.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Eucalyptus 
grandis]
 gb|KCW90414.1| hypothetical protein EUGRSUZ_A02551 [Eucalyptus grandis]
 gb|KCW90415.1| hypothetical protein EUGRSUZ_A02551 [Eucalyptus grandis]
Length=439

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 58/67 (87%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            G+IHGI+R+LIP++VQ DFN RRSLRSI+AV+P GAPEVDPRTHRLKK   P PAG+ P 
Sbjct  174  GVIHGIQRLLIPRAVQEDFNRRRSLRSIAAVIPEGAPEVDPRTHRLKKPAPPAPAGSAPA  233

Query  24   LPIYDAM  4
            LPIYDAM
Sbjct  234  LPIYDAM  240



>emb|CDX98919.1| BnaC09g49160D [Brassica napus]
Length=457

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK  58
            G+IHGIER+LIP+SVQ DFN RRSL+SISAVLP GAPEVDPRT+RLKK
Sbjct  174  GLIHGIERLLIPRSVQEDFNRRRSLQSISAVLPEGAPEVDPRTNRLKK  221



>gb|AAO24903.1| putative arabinogalactan-protein [Oryza sativa Japonica Group]
 gb|EAZ28848.1| hypothetical protein OsJ_12883 [Oryza sativa Japonica Group]
Length=494

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 52/65 (80%), Gaps = 2/65 (3%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPVL  22
            G+IHGI+R+L+P+SVQ +FN RRSL  ISA+ PT APEVDPRT RLKKP+  P G  PVL
Sbjct  194  GVIHGIDRLLVPRSVQDEFNRRRSLADISAMPPTAAPEVDPRTDRLKKPA--PPGDSPVL  251

Query  21   PIYDA  7
            PI DA
Sbjct  252  PISDA  256



>gb|EAY92117.1| hypothetical protein OsI_13824 [Oryza sativa Indica Group]
Length=494

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 52/65 (80%), Gaps = 2/65 (3%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPVL  22
            G+IHGI+R+L+P+SVQ +FN RRSL  ISA+ PT APEVDPRT RLKKP+  P G  PVL
Sbjct  194  GVIHGIDRLLVPRSVQDEFNRRRSLADISAMPPTAAPEVDPRTDRLKKPA--PPGDSPVL  251

Query  21   PIYDA  7
            PI DA
Sbjct  252  PISDA  256



>emb|CDY57989.1| BnaA10g30360D [Brassica napus]
Length=457

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK  58
            G+IHGIER+LIP+SVQ DFN RRSL+SISAVLP GAPEVDPRT+RLKK
Sbjct  174  GLIHGIERLLIPRSVQEDFNRRRSLQSISAVLPEGAPEVDPRTNRLKK  221



>ref|XP_009122246.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Brassica 
rapa]
Length=457

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK  58
            G+IHGIER+LIP+SVQ DFN RRSL+SISAVLP GAPEVDPRT+RLKK
Sbjct  174  GLIHGIERLLIPRSVQEDFNRRRSLQSISAVLPEGAPEVDPRTNRLKK  221



>ref|XP_007150000.1| hypothetical protein PHAVU_005G117500g [Phaseolus vulgaris]
 gb|ESW21994.1| hypothetical protein PHAVU_005G117500g [Phaseolus vulgaris]
Length=457

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRL-KKPSPVPAGAPPV  25
            G+IH I+R+L+P+SV+ DFN RR+LRSISAV P GAPEVDPRTHRL K P P   G+ P 
Sbjct  167  GVIHAIDRLLLPRSVEHDFNRRRTLRSISAVKPEGAPEVDPRTHRLKKPPPPAKPGSSPA  226

Query  24   LPIYDAMA  1
            L IYDA++
Sbjct  227  LSIYDALS  234



>ref|XP_009121226.1| PREDICTED: fasciclin-like arabinogalactan protein 18 [Brassica 
rapa]
Length=464

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK  58
            G+IHGIER+LIP+SVQ DFN RR+LRSISAVLP GAPE+DPRT+RLKK
Sbjct  178  GLIHGIERLLIPRSVQEDFNRRRNLRSISAVLPEGAPEIDPRTNRLKK  225



>ref|XP_003540278.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like [Glycine 
max]
Length=454

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRL-KKPSPVPAGAPPV  25
            G+IHGI+R+L+P+SV+ DFN RRSLRSI+AV P  +PE+DPRTHRL K P PV  G+ P 
Sbjct  163  GVIHGIDRLLLPRSVEDDFNRRRSLRSITAVKPEPSPEIDPRTHRLKKPPPPVKPGSSPE  222

Query  24   LPIYDAM  4
            LPIYDAM
Sbjct  223  LPIYDAM  229



>ref|XP_009348615.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Pyrus x 
bretschneideri]
Length=452

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            G+IHGIER+LIP+SV+ DFN RR+LR+ISA+ P GAPEVDPRTHRLKK   PVP GAPPV
Sbjct  171  GVIHGIERLLIPRSVEDDFNRRRNLRTISAIHPEGAPEVDPRTHRLKKPAPPVPVGAPPV  230

Query  24   LPIYDAM  4
            LPIYDA+
Sbjct  231  LPIYDAL  237



>ref|XP_009362660.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Pyrus x 
bretschneideri]
Length=457

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK  58
            G+IHGIER+LIP+SV+ DFN RR+LR+ISA+ P GAPEVDPRTHRLKK
Sbjct  171  GVIHGIERLLIPRSVEDDFNRRRNLRTISAIHPEGAPEVDPRTHRLKK  218



>ref|XP_004981498.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like [Setaria 
italica]
Length=467

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHR  67
            G+IHGIER+L+P+SVQ DFN RRSL +ISAVLPTGAPEVDPRTHR
Sbjct  175  GVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHR  219



>gb|ACG39696.1| fasciclin domain [Zea mays]
Length=469

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHR  67
            G+IHGIER+L+P+SVQ DFN RRSL +ISAVLPTGAPEVDPRTHR
Sbjct  177  GVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHR  221



>ref|NP_001159324.1| uncharacterized protein LOC100304417 precursor [Zea mays]
 gb|ACN25805.1| unknown [Zea mays]
 gb|AFW67416.1| hypothetical protein ZEAMMB73_395863 [Zea mays]
Length=473

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHR  67
            G+IHGIER+L+P+SVQ DFN RRSL +ISAVLPTGAPEVDPRTHR
Sbjct  181  GVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHR  225



>ref|XP_003596932.1| Fasciclin-like arabinogalactan protein [Medicago truncatula]
 gb|AES67183.1| fasciclin-like arabinogalactan protein 16 precursor [Medicago 
truncatula]
Length=446

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 2/66 (3%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPVL  22
            G+IHGI+++LIP++V  DFN RRSL SI+AV P GAPE D R  +LKK SP   G+PP +
Sbjct  156  GVIHGIQKILIPRAVVDDFNNRRSLSSITAVKPEGAPEADTR--KLKKSSPEKPGSPPEI  213

Query  21   PIYDAM  4
            PIY+A+
Sbjct  214  PIYEAL  219



>gb|EEC81554.1| hypothetical protein OsI_24980 [Oryza sativa Indica Group]
Length=484

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHR  67
            G+IHGIER+L+P+SVQ DFN RRSL +ISAVLPTGAPEVDPRTHR
Sbjct  207  GVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHR  251



>gb|EAZ38767.1| hypothetical protein OsJ_23169 [Oryza sativa Japonica Group]
Length=460

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHR  67
            G+IHGIER+L+P+SVQ DFN RRSL +ISAVLPTGAPEVDPRTHR
Sbjct  180  GVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHR  224



>ref|NP_001058941.1| Os07g0160600 [Oryza sativa Japonica Group]
 dbj|BAC79642.1| GPI-anchored protein -like [Oryza sativa Japonica Group]
 dbj|BAF20855.1| Os07g0160600 [Oryza sativa Japonica Group]
 dbj|BAG89338.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93771.1| unnamed protein product [Oryza sativa Japonica Group]
Length=479

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHR  67
            G+IHGIER+L+P+SVQ DFN RRSL +ISAVLPTGAPEVDPRTHR
Sbjct  180  GVIHGIERLLVPRSVQEDFNRRRSLAAISAVLPTGAPEVDPRTHR  224



>ref|XP_010677585.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Beta vulgaris 
subsp. vulgaris]
Length=448

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPV-PAGAPPV  25
            G+IHGI+RVL+P SV  +FN RR LRSISAVLPT AP +D R     + + + PAGAPP 
Sbjct  166  GLIHGIDRVLVPHSVLEEFNNRRELRSISAVLPTSAPTMDSRKRTQHRGAKMGPAGAPPA  225

Query  24   LPIYDAM  4
            +PI+DA+
Sbjct  226  VPIFDAL  232



>ref|NP_001051504.1| Os03g0788600 [Oryza sativa Japonica Group]
 gb|AAT75247.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99257.1| beta-Ig-H3 domain-containing protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13418.1| Os03g0788600 [Oryza sativa Japonica Group]
 dbj|BAG91233.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97579.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76302.1| hypothetical protein OsI_13823 [Oryza sativa Indica Group]
 gb|EEE60067.1| hypothetical protein OsJ_12880 [Oryza sativa Japonica Group]
Length=474

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHR  67
            G+IHGIER+L+P+SVQ DFN RRSL  ISAVLPTGAPEVDPRTHR
Sbjct  182  GVIHGIERLLVPRSVQEDFNRRRSLADISAVLPTGAPEVDPRTHR  226



>ref|XP_009399002.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Musa acuminata 
subsp. malaccensis]
Length=486

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 58/68 (85%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHR-LKKPSPVPAGAPPV  25
            G+IHGIER+L+P+ VQ DFN RRSL +ISAVLPTGAPEVDPRTHR  K   PVP GAPPV
Sbjct  189  GVIHGIERLLVPRCVQEDFNRRRSLAAISAVLPTGAPEVDPRTHRLKKPAPPVPPGAPPV  248

Query  24   LPIYDAMA  1
            LPIYDAMA
Sbjct  249  LPIYDAMA  256



>ref|XP_004487436.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Cicer 
arietinum]
Length=454

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPA---GAP  31
            G+IHGI+ +LIP+SV  DFN RRSLRSI+AV P  +PEVD R H+LKK    P+   G+ 
Sbjct  164  GVIHGIQNLLIPRSVVDDFNRRRSLRSITAVKPEPSPEVDTRNHKLKKQKQPPSEKPGSL  223

Query  30   PVLPIYDAMA  1
            P LPIY+AM+
Sbjct  224  PKLPIYEAMS  233



>ref|XP_008387142.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Malus domestica]
Length=455

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK  58
            G+IHGIE +LIP+SV+ DFN RR+LR+ISA+ P GAPEVDPRTHRLKK
Sbjct  170  GVIHGIEGLLIPRSVEDDFNRRRNLRTISAIHPEGAPEVDPRTHRLKK  217



>ref|XP_002444260.1| hypothetical protein SORBIDRAFT_07g019123 [Sorghum bicolor]
 gb|EES13755.1| hypothetical protein SORBIDRAFT_07g019123 [Sorghum bicolor]
Length=184

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSL-RSISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPV  25
            G+IHG++R+L+P+SVQ  FN RRSL  SIS  LPTGAPEVDPRTHRL K    P GAPP 
Sbjct  27   GVIHGVDRLLVPRSVQDAFNRRRSLASSISVALPTGAPEVDPRTHRLLKKPAPPLGAPPA  86

Query  24   LPIYDAMA  1
            LP++DAMA
Sbjct  87   LPVWDAMA  94



>ref|XP_006663458.1| PREDICTED: uncharacterized protein LOC102717475 [Oryza brachyantha]
Length=468

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -1

Query  198  IIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK  58
            +IHGIER+L+P+SVQ DFN RRSL +ISAVL  GAPEVDPRTH+LKK
Sbjct  7    VIHGIERLLVPRSVQEDFNWRRSLAAISAVLLIGAPEVDPRTHQLKK  53



>ref|XP_002454878.1| hypothetical protein SORBIDRAFT_03g000685 [Sorghum bicolor]
 gb|EER99997.1| hypothetical protein SORBIDRAFT_03g000685 [Sorghum bicolor]
Length=185

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSL-RSISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPV  25
            G+IHG++R+L+P+SVQ  FN RRSL  SIS  LPTGAPEVDPRTHRL K    P GAPP 
Sbjct  27   GVIHGVDRLLVPRSVQDAFNRRRSLASSISVALPTGAPEVDPRTHRLLKKPAPPLGAPPA  86

Query  24   LPIYDAMA  1
            LP++DAMA
Sbjct  87   LPVWDAMA  94



>ref|XP_002448333.1| hypothetical protein SORBIDRAFT_06g025350 [Sorghum bicolor]
 gb|EES12661.1| hypothetical protein SORBIDRAFT_06g025350 [Sorghum bicolor]
Length=288

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSL-RSISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPV  25
            G+IHG++R+L+P+SVQ  FN RRSL  SIS  LPTGAPEVDPRTHRL K    P GAPP 
Sbjct  70   GVIHGVDRLLVPRSVQDAFNRRRSLASSISVALPTGAPEVDPRTHRLLKKPAPPLGAPPA  129

Query  24   LPIYDAMA  1
            LP++DAMA
Sbjct  130  LPVWDAMA  137



>ref|XP_010248022.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Nelumbo 
nucifera]
Length=469

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHR-LKKPSPVPAGAPPV  25
            G+IHGIER+LIP+SVQ DFN RRSL SISAV P GAPEVD RTHR  K   P P G+PP 
Sbjct  178  GVIHGIERLLIPRSVQEDFNRRRSLSSISAVRPEGAPEVDTRTHRLKKAAPPAPPGSPPS  237

Query  24   LPIYDAMA  1
            LPIY+AMA
Sbjct  238  LPIYEAMA  245



>ref|XP_010685474.1| PREDICTED: fasciclin-like arabinogalactan protein 17 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=462

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK  58
            G+IHGIER+L+P SV  DFN RRSLRSISAVLP GAP VDPRT++L K
Sbjct  173  GVIHGIERLLVPHSVLEDFNRRRSLRSISAVLPEGAPVVDPRTNKLIK  220



>ref|XP_011076879.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Sesamum 
indicum]
Length=464

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 50/66 (76%), Gaps = 2/66 (3%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRL--KKPSPVPAGAPP  28
            GIIHGIE+V+IP+SV+ +FN RR+L+SISAV P GAPE+DPR+ +L  +K + +P     
Sbjct  172  GIIHGIEKVIIPKSVEREFNNRRNLQSISAVKPEGAPEIDPRSRKLPKRKANEIPMDGAQ  231

Query  27   VLPIYD  10
             L +Y+
Sbjct  232  KLSVYE  237



>ref|XP_006651891.1| PREDICTED: LOW QUALITY PROTEIN: fasciclin-like arabinogalactan 
protein 16-like [Oryza brachyantha]
Length=464

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 49/66 (74%), Gaps = 3/66 (5%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPAGAPPVL  22
            G+IHGIER+L+P+SVQ DFN RRSL  ISA+ PT AP+VDPRT  L+KP P    A  VL
Sbjct  171  GVIHGIERLLVPRSVQEDFNRRRSLADISAMPPTAAPQVDPRTQPLEKPPP---SASAVL  227

Query  21   PIYDAM  4
            P  +A+
Sbjct  228  PTPNAI  233



>ref|XP_006487826.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Citrus 
sinensis]
Length=452

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPR--THRLKKP-SPVPAGAP  31
            G IHGI ++++P+SVQ +FN RR+L SI+AV P  APE+DPR  T +L KP   V   +P
Sbjct  162  GTIHGISQLMVPRSVQNEFNRRRNLDSIAAVKPEAAPEIDPRVITKKLNKPVFKVKPDSP  221

Query  30   PVLPIYDAMA  1
            PVLPI++A+A
Sbjct  222  PVLPIFEAIA  231



>ref|XP_010090522.1| hypothetical protein L484_017146 [Morus notabilis]
 gb|EXB39671.1| hypothetical protein L484_017146 [Morus notabilis]
Length=459

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 3/69 (4%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKKPSPVPA---GAP  31
            G+IHGIER+L+P+SV  DFN RRSL+SI+AV P GAPEVD R  + K    V     G+P
Sbjct  174  GVIHGIERMLVPRSVVDDFNKRRSLQSITAVKPEGAPEVDLRRAKKKGVDLVSKAKPGSP  233

Query  30   PVLPIYDAM  4
            P + IY+A+
Sbjct  234  PAVSIYEAL  242



>ref|XP_002461483.1| hypothetical protein SORBIDRAFT_02g003410 [Sorghum bicolor]
 gb|EER98004.1| hypothetical protein SORBIDRAFT_02g003410 [Sorghum bicolor]
Length=471

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSL-RSISAVLPTGAPEVDPRTHRLKK  58
            G+IHG++R+L+P+SVQ  FN RRSL  SISA LPTGAPEVDPRTHRL +
Sbjct  176  GVIHGVDRLLVPRSVQDAFNRRRSLASSISAALPTGAPEVDPRTHRLLR  224



>ref|XP_003527510.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like isoform 
X1 [Glycine max]
 ref|XP_006582372.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like isoform 
X2 [Glycine max]
Length=447

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK-PSPVPAGAPPV  25
            G+IHGI+ +LIP+SVQ +FN RR+L SI+AV P  +PEVDPRTHRLKK     PAGAPP 
Sbjct  161  GVIHGIDTLLIPRSVQDEFNRRRNLISIAAVKPEPSPEVDPRTHRLKKPAPASPAGAPPA  220

Query  24   LPIYDAM  4
            LPIYDAM
Sbjct  221  LPIYDAM  227



>gb|KDO48944.1| hypothetical protein CISIN_1g043668mg [Citrus sinensis]
Length=415

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 3/70 (4%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPR--THRLKKP-SPVPAGAP  31
            G IHGI ++++P+SVQ +FN RR+L SI+AV P  APE+DPR  T +L KP   V   +P
Sbjct  162  GTIHGISQLMVPRSVQNEFNRRRNLDSIAAVKPEAAPEIDPRVITKKLNKPVFNVKPYSP  221

Query  30   PVLPIYDAMA  1
            PVLPI +A+A
Sbjct  222  PVLPISEAIA  231



>ref|XP_010917919.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Elaeis 
guineensis]
Length=544

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 47/65 (72%), Gaps = 4/65 (6%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDF-NTRRSLRSISAVLPTGAPEVDPRT--HRLKKPSPV-PAGA  34
            G+IHGIER+L+P+SVQ ++ N RR L S++AVLPTGAPE DPRT  HRL    PV P+  
Sbjct  260  GVIHGIERMLVPRSVQEEYLNRRRRLSSVAAVLPTGAPEADPRTTGHRLFPSRPVSPSDG  319

Query  33   PPVLP  19
            P   P
Sbjct  320  PTTSP  324



>ref|XP_008790162.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Phoenix 
dactylifera]
Length=549

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 47/65 (72%), Gaps = 4/65 (6%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQ-VDFNTRRSLRSISAVLPTGAPEVDPRT--HRLKKPSPV-PAGA  34
            G+IHGIE++L+P+SVQ   FN RR L S++AVLPTGAP+VDPR   +RL    PV PAG 
Sbjct  265  GVIHGIEQMLVPRSVQEAYFNRRRRLSSVAAVLPTGAPKVDPRRTGNRLLPSKPVSPAGG  324

Query  33   PPVLP  19
            P   P
Sbjct  325  PTTSP  329



>gb|EPS68119.1| hypothetical protein M569_06649, partial [Genlisea aurea]
Length=370

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 74/109 (68%), Gaps = 12/109 (11%)
 Frame = -1

Query  318  HPSLCRGAGDENPAVSQRNGEREvsaakvvraddvvrpDGIIHGIERVLIPQSVQVDFNT  139
            H SL     +E P    +NGER VS A+V R DDVVRPDGI+HGIER+LIP+SV+ +F+ 
Sbjct  101  HASLADDE-EEIPLRRGKNGERIVSTARVFRPDDVVRPDGIVHGIERLLIPKSVRHEFDA  159

Query  138  RRSLRSISA-VLPTGAPEVDPRTHRLKKPSPVPAGAPP--VLPIYDAMA  1
            RRSL S S+ V+P GAPE D    +LK P+     APP  VLP+ DA+A
Sbjct  160  RRSLISASSVVIPDGAPEFDL---QLKAPA-----APPVSVLPVSDALA  200



>gb|EYU19863.1| hypothetical protein MIMGU_mgv1a006599mg [Erythranthe guttata]
Length=437

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (69%), Gaps = 3/70 (4%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTR--RSLRSI-SAVLPTGAPEVDPRTHRLKKPSPVPAGAP  31
            GIIHG+E+V++P+SV+ DFN    R+ RS+ +AV P GAPE++PRT++L K + + A   
Sbjct  186  GIIHGVEKVIVPKSVERDFNNNNGRNPRSVAAAVEPEGAPEINPRTNKLSKRNAISAPGG  245

Query  30   PVLPIYDAMA  1
                IY A A
Sbjct  246  GANTIYKATA  255



>gb|ABK25415.1| unknown [Picea sitchensis]
Length=464

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 48/70 (69%), Gaps = 5/70 (7%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPRTHRLKK---PSPVPAGAP  31
            G+IHGI+R+LIP+SVQ DF+  RS  S+ AV+P GAP +DP   +L K    S + A +P
Sbjct  171  GVIHGIDRMLIPKSVQDDFSKWRSGVSL-AVMPQGAPVLDP-IKKLSKSVAASSLSAKSP  228

Query  30   PVLPIYDAMA  1
            P+  IY A+A
Sbjct  229  PIHSIYYALA  238



>ref|XP_010685475.1| PREDICTED: fasciclin-like arabinogalactan protein 17 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=443

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAV  109
            G+IHGIER+L+P SV  DFN RRSLRSISAV
Sbjct  173  GVIHGIERLLVPHSVLEDFNRRRSLRSISAV  203



>ref|XP_006424052.1| hypothetical protein CICLE_v10030024mg [Citrus clementina]
 gb|ESR37292.1| hypothetical protein CICLE_v10030024mg [Citrus clementina]
Length=442

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 43/70 (61%), Gaps = 13/70 (19%)
 Frame = -1

Query  201  GIIHGIERVLIPQSVQVDFNTRRSLRSISAVLPTGAPEVDPR--THRLKKP-SPVPAGAP  31
            G IHGI ++++P          R+L SI+AV P  APE+DPR  T +L KP   V   +P
Sbjct  162  GTIHGISQLMVP----------RNLDSIAAVKPEAAPEIDPRVITKKLNKPVFNVKPYSP  211

Query  30   PVLPIYDAMA  1
            PVLPI +A+A
Sbjct  212  PVLPISEAIA  221



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552963472315