BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP009C06 510 bp,:Filtered

Length=465
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAE79385.1|  unnamed protein product                                112   4e-25   Ipomoea batatas [batate]
dbj|BAE79382.1|  unnamed protein product                                110   2e-24   Ipomoea batatas [batate]
dbj|BAE79384.1|  unnamed protein product                                109   4e-24   Ipomoea batatas [batate]
ref|XP_006605148.1|  PREDICTED: putative ribonuclease H protein A...  70.9    2e-12   
gb|KHN42473.1|  Putative ribonuclease H protein                       68.9    2e-11   Glycine soja [wild soybean]
ref|XP_008221992.1|  PREDICTED: uncharacterized protein LOC103321917  71.6    2e-11   
ref|XP_007224107.1|  hypothetical protein PRUPE_ppa015647mg           66.6    6e-11   Prunus persica
ref|XP_007022832.1|  Uncharacterized protein TCM_026877               70.5    8e-11   Theobroma cacao [chocolate]
ref|XP_007008704.1|  Uncharacterized protein TCM_042330               69.7    1e-10   Theobroma cacao [chocolate]
ref|XP_007017131.1|  Uncharacterized protein TCM_033752               69.3    2e-10   Theobroma cacao [chocolate]
ref|XP_007208821.1|  hypothetical protein PRUPE_ppa025050mg           65.1    5e-10   Prunus persica
ref|XP_007042183.1|  Ribonuclease H protein                           66.6    7e-10   Theobroma cacao [chocolate]
ref|XP_007017129.1|  Uncharacterized protein TCM_042328               67.0    8e-10   Theobroma cacao [chocolate]
ref|XP_006584399.1|  PREDICTED: putative ribonuclease H protein A...  65.1    3e-09   
gb|KHN04118.1|  Putative ribonuclease H protein                       61.2    4e-09   Glycine soja [wild soybean]
ref|YP_006666138.1|  RnaseH                                           61.2    5e-09   Malus domestica [apple tree]
ref|XP_002535256.1|  conserved hypothetical protein                   60.5    8e-09   
gb|AAC26674.1|  putative non-LTR retroelement reverse transcriptase   63.9    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007019605.1|  Uncharacterized protein TCM_035716               59.7    2e-08   Theobroma cacao [chocolate]
ref|XP_006490009.1|  PREDICTED: putative ribonuclease H protein A...  59.7    2e-08   
ref|XP_007031579.1|  RNA-binding (RRM/RBD/RNP motifs) family prot...  61.6    2e-08   Theobroma cacao [chocolate]
gb|AAD22368.1|  putative non-LTR retroelement reverse transcriptase   60.8    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007019573.1|  Uncharacterized protein TCM_035679               59.3    3e-08   Theobroma cacao [chocolate]
gb|KHN06921.1|  Heat shock 70 kDa protein                             62.0    4e-08   Glycine soja [wild soybean]
ref|XP_002530597.1|  nuclease, putative                               57.8    5e-08   
ref|XP_008232034.1|  PREDICTED: uncharacterized protein LOC103331202  61.2    6e-08   
ref|XP_006477729.1|  PREDICTED: uncharacterized protein LOC102617084  61.2    6e-08   
ref|XP_009802861.1|  PREDICTED: uncharacterized protein LOC104248321  58.9    6e-08   Nicotiana sylvestris
gb|KJB64101.1|  hypothetical protein B456_010G033200                  60.5    6e-08   Gossypium raimondii
gb|KJB64102.1|  hypothetical protein B456_010G033200                  60.5    7e-08   Gossypium raimondii
ref|XP_007225020.1|  hypothetical protein PRUPE_ppa020103mg           59.7    8e-08   Prunus persica
ref|XP_008344356.1|  PREDICTED: putative ribonuclease H protein A...  60.1    8e-08   
ref|XP_004305978.1|  PREDICTED: uncharacterized protein LOC101292333  58.9    8e-08   Fragaria vesca subsp. vesca
ref|XP_007033353.1|  Non-LTR retroelement reverse transcriptase-like  60.1    9e-08   Theobroma cacao [chocolate]
ref|XP_006440743.1|  hypothetical protein CICLE_v10021474mg           59.3    9e-08   Citrus clementina
ref|XP_009101981.1|  PREDICTED: putative ribonuclease H protein A...  60.5    1e-07   Brassica rapa
gb|KDO65745.1|  hypothetical protein CISIN_1g039495mg                 59.3    1e-07   Citrus sinensis [apfelsine]
ref|XP_007225017.1|  hypothetical protein PRUPE_ppa020094mg           57.0    1e-07   Prunus persica
ref|XP_008344200.1|  PREDICTED: putative ribonuclease H protein A...  57.0    1e-07   
gb|AID60103.1|  hypothetical protein                                  59.7    2e-07   Brassica napus [oilseed rape]
ref|XP_007031938.1|  Ribonuclease H protein                           59.7    2e-07   Theobroma cacao [chocolate]
ref|XP_009147282.1|  PREDICTED: putative ribonuclease H protein A...  58.5    2e-07   Brassica rapa
gb|KHF99723.1|  HVA22-like protein a                                  58.9    2e-07   Gossypium arboreum [tree cotton]
gb|AAC63844.1|  putative non-LTR retroelement reverse transcriptase   59.3    3e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007203348.1|  hypothetical protein PRUPE_ppa020364mg           58.2    3e-07   Prunus persica
emb|CAN75081.1|  hypothetical protein VITISV_027743                   58.5    3e-07   Vitis vinifera
ref|XP_002514383.1|  nuclease, putative                               55.8    3e-07   
gb|AAF19536.1|AC007190_4  F23N19.5                                    57.0    3e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001174960.1|  Os06g0683500                                     57.0    4e-07   
gb|KHN47376.1|  Heat shock 70 kDa protein                             58.5    4e-07   Glycine soja [wild soybean]
ref|XP_008224632.1|  PREDICTED: putative ribonuclease H protein A...  56.2    4e-07   
gb|KHN08856.1|  Putative ribonuclease H protein                       55.5    4e-07   Glycine soja [wild soybean]
ref|WP_002986456.1|  ribonuclease HI                                  55.5    4e-07   Leptospira vanthielii
ref|XP_006648856.1|  PREDICTED: putative ribonuclease H protein A...  56.2    4e-07   
ref|XP_009121276.1|  PREDICTED: putative ribonuclease H protein A...  56.6    4e-07   Brassica rapa
gb|AAF79490.1|AC022492_34  F1L3.4                                     56.6    5e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008341993.1|  PREDICTED: uncharacterized protein LOC103404803  58.5    5e-07   Malus domestica [apple tree]
ref|XP_009805051.1|  PREDICTED: uncharacterized protein LOC104250178  56.2    6e-07   Nicotiana sylvestris
ref|XP_007028211.1|  Uncharacterized protein TCM_023790               55.1    6e-07   Theobroma cacao [chocolate]
dbj|BAB09815.1|  non-LTR retroelement reverse transcriptase-like      58.2    6e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AAF97302.1|AC007843_5  Hypothetical protein                        56.6    6e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002531381.1|  nuclease, putative                               54.7    7e-07   
ref|XP_004966272.1|  PREDICTED: putative ribonuclease H protein A...  55.8    7e-07   
ref|XP_007008705.1|  Uncharacterized protein TCM_042331               58.2    7e-07   Theobroma cacao [chocolate]
ref|XP_007147977.1|  hypothetical protein PHAVU_006G170300g           57.8    8e-07   Phaseolus vulgaris [French bean]
ref|XP_009120305.1|  PREDICTED: putative ribonuclease H protein A...  56.6    8e-07   Brassica rapa
gb|EEE66235.1|  hypothetical protein OsJ_22399                        55.1    9e-07   Oryza sativa Japonica Group [Japonica rice]
gb|KHN15930.1|  Putative ribonuclease H protein                       54.7    9e-07   Glycine soja [wild soybean]
gb|EEC81198.1|  hypothetical protein OsI_24213                        55.5    1e-06   Oryza sativa Indica Group [Indian rice]
gb|AFK34478.1|  unknown                                               55.1    1e-06   Lotus japonicus
ref|XP_009797103.1|  PREDICTED: uncharacterized protein LOC104243590  55.1    1e-06   Nicotiana sylvestris
ref|XP_008373258.1|  PREDICTED: putative ribonuclease H protein A...  55.1    1e-06   
ref|XP_007050978.1|  Uncharacterized protein TCM_004691               55.5    1e-06   Theobroma cacao [chocolate]
ref|XP_008245516.1|  PREDICTED: putative ribonuclease H protein A...  54.7    2e-06   
ref|XP_007020288.1|  Uncharacterized protein TCM_036737               57.0    2e-06   Theobroma cacao [chocolate]
ref|XP_009124321.1|  PREDICTED: putative ribonuclease H protein A...  55.5    2e-06   Brassica rapa
ref|XP_008244843.1|  PREDICTED: putative ribonuclease H protein A...  56.2    2e-06   
ref|XP_008383853.1|  PREDICTED: putative ribonuclease H protein A...  54.3    2e-06   
ref|XP_004309343.2|  PREDICTED: uncharacterized protein LOC101295189  54.3    2e-06   Fragaria vesca subsp. vesca
ref|XP_008441930.1|  PREDICTED: putative ribonuclease H protein A...  54.3    2e-06   
ref|XP_008371252.1|  PREDICTED: putative ribonuclease H protein A...  54.7    2e-06   
ref|XP_007226764.1|  hypothetical protein PRUPE_ppa018732mg           55.8    2e-06   Prunus persica
ref|XP_007026458.1|  Uncharacterized protein TCM_021522               56.6    2e-06   Theobroma cacao [chocolate]
ref|XP_002524970.1|  conserved hypothetical protein                   53.1    2e-06   
ref|XP_006599770.1|  PREDICTED: putative ribonuclease H protein A...  55.1    3e-06   
ref|XP_009151561.1|  PREDICTED: putative ribonuclease H protein A...  56.2    3e-06   Brassica rapa
ref|XP_004490492.1|  PREDICTED: uncharacterized protein LOC101492718  55.5    3e-06   
ref|WP_002973332.1|  ribonuclease HI                                  53.1    3e-06   Leptospira terpstrae
ref|XP_007019466.1|  Polynucleotidyl transferase, putative            55.5    3e-06   Theobroma cacao [chocolate]
ref|XP_008220870.1|  PREDICTED: putative ribonuclease H protein A...  54.7    4e-06   
dbj|BAE71259.1|  hypothetical protein                                 55.5    4e-06   Trifolium pratense [peavine clover]
ref|XP_009144970.1|  PREDICTED: putative ribonuclease H protein A...  55.1    4e-06   Brassica rapa
gb|EYU27884.1|  hypothetical protein MIMGU_mgv1a013877mg              53.5    5e-06   Erythranthe guttata [common monkey flower]
ref|XP_009123770.1|  PREDICTED: putative ribonuclease H protein A...  55.1    5e-06   Brassica rapa
gb|AFK45241.1|  unknown                                               52.8    5e-06   Lotus japonicus
ref|XP_008244240.1|  PREDICTED: putative ribonuclease H protein A...  52.8    6e-06   
gb|EEC73643.1|  hypothetical protein OsI_08164                        53.1    6e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_007010351.1|  Polynucleotidyl transferase, putative            54.7    6e-06   Theobroma cacao [chocolate]
gb|AAG12669.1|AC027033_4  hypothetical protein; 81517-79153           53.9    7e-06   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD23746.1|  hypothetical protein                                 53.1    7e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008222990.1|  PREDICTED: putative ribonuclease H protein A...  54.3    7e-06   
ref|XP_009124780.1|  PREDICTED: putative ribonuclease H protein A...  53.9    8e-06   Brassica rapa
ref|XP_002524436.1|  nucleic acid binding protein, putative           51.2    9e-06   
ref|XP_008372289.1|  PREDICTED: uncharacterized protein LOC103435668  52.8    9e-06   Malus domestica [apple tree]
ref|WP_040826687.1|  hypothetical protein                             51.6    1e-05   
ref|XP_008237302.1|  PREDICTED: putative ribonuclease H protein A...  53.9    1e-05   
ref|XP_009619020.1|  PREDICTED: uncharacterized protein LOC104111114  52.4    1e-05   Nicotiana tomentosiformis
ref|XP_010694338.1|  PREDICTED: uncharacterized protein LOC104907148  52.4    1e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006851004.1|  hypothetical protein AMTR_s00025p00218070        53.5    1e-05   Amborella trichopoda
ref|XP_004309278.1|  PREDICTED: uncharacterized protein LOC101298847  51.2    1e-05   Fragaria vesca subsp. vesca
ref|XP_011463604.1|  PREDICTED: uncharacterized protein LOC105351321  53.1    1e-05   Fragaria vesca subsp. vesca
ref|XP_007221027.1|  hypothetical protein PRUPE_ppa014857mg           52.0    1e-05   Prunus persica
ref|XP_007028292.1|  Uncharacterized protein TCM_023960               53.1    2e-05   Theobroma cacao [chocolate]
ref|XP_004309966.2|  PREDICTED: uncharacterized protein LOC101295881  53.1    2e-05   Fragaria vesca subsp. vesca
ref|XP_007018278.1|  HVA22-like protein a, putative isoform 2         53.1    2e-05   Theobroma cacao [chocolate]
ref|XP_007018277.1|  HVA22-like protein a, putative isoform 1         53.1    2e-05   Theobroma cacao [chocolate]
gb|KJB82714.1|  hypothetical protein B456_013G210500                  50.8    2e-05   Gossypium raimondii
gb|KDP31341.1|  hypothetical protein JCGZ_11717                       53.5    2e-05   Jatropha curcas
ref|XP_007039706.1|  Non-LTR retroelement reverse transcriptase       53.1    2e-05   Theobroma cacao [chocolate]
ref|XP_002524702.1|  nuclease, putative                               51.6    2e-05   
ref|XP_006475107.1|  PREDICTED: putative ribonuclease H protein A...  52.4    2e-05   
ref|XP_008220882.1|  PREDICTED: uncharacterized protein LOC103320918  53.1    2e-05   
ref|XP_008357106.1|  PREDICTED: putative ribonuclease H protein A...  52.0    2e-05   
ref|XP_009344908.1|  PREDICTED: uncharacterized protein LOC103936764  53.1    2e-05   Pyrus x bretschneideri [bai li]
ref|XP_009119466.1|  PREDICTED: uncharacterized protein LOC103844431  53.1    2e-05   Brassica rapa
ref|XP_009124282.1|  PREDICTED: putative ribonuclease H protein A...  53.1    2e-05   Brassica rapa
ref|XP_008226028.1|  PREDICTED: putative ribonuclease H protein A...  52.4    3e-05   
ref|XP_008349226.1|  PREDICTED: uncharacterized protein LOC103412449  51.2    3e-05   
ref|WP_015681904.1|  ribonuclease HI                                  50.4    3e-05   Leptospira wolbachii
ref|XP_007017128.1|  Uncharacterized protein TCM_042327               52.8    3e-05   Theobroma cacao [chocolate]
ref|XP_002521266.1|  conserved hypothetical protein                   50.4    3e-05   
ref|XP_009337067.1|  PREDICTED: uncharacterized protein LOC103929570  51.2    3e-05   Pyrus x bretschneideri [bai li]
ref|XP_008221720.1|  PREDICTED: putative ribonuclease H protein A...  51.6    3e-05   
ref|WP_004784785.1|  ribonuclease HI                                  50.1    4e-05   Leptospira meyeri
ref|XP_004287420.1|  PREDICTED: uncharacterized protein LOC101302388  52.0    4e-05   Fragaria vesca subsp. vesca
ref|XP_008221358.1|  PREDICTED: putative ribonuclease H protein A...  52.4    4e-05   
gb|KHN12872.1|  Putative ribonuclease H protein                       50.1    4e-05   Glycine soja [wild soybean]
gb|ABA96203.1|  retrotransposon protein, putative, unclassified, ...  52.8    4e-05   Oryza sativa Japonica Group [Japonica rice]
gb|ABN09101.1|  Ribonuclease H                                        50.4    4e-05   Medicago truncatula
emb|CAN67514.1|  hypothetical protein VITISV_012081                   52.4    4e-05   Vitis vinifera
ref|XP_009795398.1|  PREDICTED: uncharacterized protein LOC104242095  51.2    4e-05   Nicotiana sylvestris
ref|XP_007219947.1|  hypothetical protein PRUPE_ppb019489mg           52.0    4e-05   Prunus persica
ref|XP_009150833.1|  PREDICTED: putative ribonuclease H protein A...  50.4    4e-05   Brassica rapa
ref|XP_010484806.1|  PREDICTED: uncharacterized protein LOC104763089  52.4    4e-05   Camelina sativa [gold-of-pleasure]
ref|XP_007049665.1|  Uncharacterized protein TCM_002766               51.2    4e-05   Theobroma cacao [chocolate]
ref|XP_007040946.1|  Uncharacterized protein TCM_016753               52.4    4e-05   Theobroma cacao [chocolate]
ref|XP_008219298.1|  PREDICTED: uncharacterized protein LOC103319525  52.0    5e-05   
ref|XP_010527295.1|  PREDICTED: uncharacterized protein LOC104804652  50.8    5e-05   Tarenaya hassleriana [spider flower]
gb|KFK31801.1|  hypothetical protein AALP_AA6G160600                  51.6    5e-05   Arabis alpina [alpine rockcress]
ref|XP_007214110.1|  hypothetical protein PRUPE_ppa017108mg           50.4    5e-05   Prunus persica
ref|XP_009770934.1|  PREDICTED: uncharacterized protein LOC104221568  51.6    6e-05   Nicotiana sylvestris
ref|XP_007032969.1|  Uncharacterized protein TCM_019113               50.1    6e-05   Theobroma cacao [chocolate]
ref|XP_010522729.1|  PREDICTED: uncharacterized protein LOC104801...  51.6    6e-05   Tarenaya hassleriana [spider flower]
ref|XP_010522710.1|  PREDICTED: uncharacterized protein LOC104801...  51.6    6e-05   Tarenaya hassleriana [spider flower]
dbj|BAF36312.1|  hypothetical protein                                 48.5    6e-05   Ipomoea trifida
ref|XP_004305349.1|  PREDICTED: uncharacterized protein LOC101314779  49.7    6e-05   Fragaria vesca subsp. vesca
ref|XP_006379569.1|  hypothetical protein POPTR_0008s04925g           50.4    6e-05   Populus trichocarpa [western balsam poplar]
ref|XP_006468253.1|  PREDICTED: uncharacterized protein LOC102614777  51.2    7e-05   
ref|XP_008377870.1|  PREDICTED: putative ribonuclease H protein A...  51.6    7e-05   
ref|XP_007206968.1|  hypothetical protein PRUPE_ppb019197mg           51.2    7e-05   Prunus persica
ref|XP_008362461.1|  PREDICTED: putative ribonuclease H protein A...  49.7    7e-05   
gb|EKD46245.1|  ribonuclease HI                                       48.9    7e-05   uncultured bacterium
ref|XP_008340288.1|  PREDICTED: putative ribonuclease H protein A...  51.2    8e-05   
gb|EAY88619.1|  hypothetical protein OsI_10096                        50.1    8e-05   Oryza sativa Indica Group [Indian rice]
gb|ABE65462.1|  hypothetical protein At2g27870                        50.8    8e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAD21515.1|  putative reverse transcriptase                        50.8    8e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007022459.1|  RNase H family protein                           51.2    8e-05   Theobroma cacao [chocolate]
gb|ABK28199.1|  unknown                                               50.8    9e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008227119.1|  PREDICTED: putative ribonuclease H protein A...  48.9    9e-05   
ref|XP_011470534.1|  PREDICTED: uncharacterized protein LOC105353242  51.2    1e-04   Fragaria vesca subsp. vesca
ref|XP_008228893.1|  PREDICTED: probable CCR4-associated factor 1...  50.8    1e-04   
ref|XP_004514910.1|  PREDICTED: putative ribonuclease H protein A...  50.1    1e-04   
ref|XP_007212490.1|  hypothetical protein PRUPE_ppa019260mg           49.3    1e-04   Prunus persica
ref|XP_006492639.1|  PREDICTED: putative ribonuclease H protein A...  50.8    1e-04   
ref|XP_006480844.1|  PREDICTED: putative ribonuclease H protein A...  50.8    1e-04   
ref|XP_007010390.1|  Retrotransposon, unclassified-like protein       50.8    1e-04   Theobroma cacao [chocolate]
ref|XP_002304990.2|  hypothetical protein POPTR_0004s03265g           49.3    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_008354555.1|  PREDICTED: putative ribonuclease H protein A...  50.4    1e-04   
ref|XP_010254588.1|  PREDICTED: uncharacterized protein LOC104595...  50.4    1e-04   Nelumbo nucifera [Indian lotus]
ref|NP_001049023.1|  Os03g0158600                                     49.3    1e-04   
ref|XP_007015619.1|  Uncharacterized protein TCM_041190               48.5    2e-04   Theobroma cacao [chocolate]
gb|ABF94077.1|  expressed protein                                     49.3    2e-04   Oryza sativa Japonica Group [Japonica rice]
gb|AAG28895.1|AC008113_11  F12A21.24                                  50.4    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|WP_026476332.1|  hypothetical protein                             48.1    2e-04   Alkaliphilus transvaalensis
ref|XP_008224410.1|  PREDICTED: putative ribonuclease H protein A...  49.7    2e-04   
ref|XP_007141283.1|  hypothetical protein PHAVU_008G183100g           50.4    2e-04   Phaseolus vulgaris [French bean]
ref|XP_003626609.1|  hypothetical protein MTR_7g118250                47.8    2e-04   
ref|XP_010254587.1|  PREDICTED: uncharacterized protein LOC104595...  50.4    2e-04   Nelumbo nucifera [Indian lotus]
ref|XP_008803873.1|  PREDICTED: putative ribonuclease H protein A...  49.3    2e-04   Phoenix dactylifera
ref|XP_008391104.1|  PREDICTED: putative ribonuclease H protein A...  50.1    2e-04   
ref|WP_022914789.1|  bifunctional RNase H/acid phosphatase            50.1    2e-04   Frankia sp. Iso899
ref|XP_010678904.1|  PREDICTED: uncharacterized protein LOC104894381  50.1    2e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004292219.1|  PREDICTED: uncharacterized protein LOC101302904  48.5    2e-04   Fragaria vesca subsp. vesca
ref|XP_008227731.1|  PREDICTED: putative ribonuclease H protein A...  50.1    2e-04   
ref|XP_008232726.1|  PREDICTED: uncharacterized protein LOC103331839  49.7    2e-04   
ref|XP_007216097.1|  hypothetical protein PRUPE_ppa018451mg           50.1    2e-04   Prunus persica
ref|XP_007212728.1|  hypothetical protein PRUPE_ppa019009mg           49.7    2e-04   Prunus persica
ref|WP_029774884.1|  hypothetical protein                             48.1    2e-04   
ref|XP_006575359.1|  PREDICTED: uncharacterized protein LOC102661...  50.1    2e-04   
ref|XP_007028676.1|  Uncharacterized protein TCM_024574               47.8    2e-04   Theobroma cacao [chocolate]
ref|WP_023524696.1|  MULTISPECIES: Putative ribonuclease H            47.8    2e-04   Leptospirillum
ref|XP_009599431.1|  PREDICTED: uncharacterized protein LOC104095089  48.9    2e-04   Nicotiana tomentosiformis
ref|XP_007037316.1|  Ribonuclease H-like protein                      49.7    2e-04   Theobroma cacao [chocolate]
ref|XP_008383873.1|  PREDICTED: putative ribonuclease H protein A...  50.1    2e-04   
ref|XP_010667872.1|  PREDICTED: uncharacterized protein LOC104884867  48.5    2e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008225019.1|  PREDICTED: putative ribonuclease H protein A...  48.9    2e-04   
gb|EKP95067.1|  putative SAM-dependent methyltransferase              50.1    2e-04   Thermaerobacter subterraneus DSM 13965
ref|XP_004300849.1|  PREDICTED: uncharacterized protein LOC101302842  48.5    2e-04   Fragaria vesca subsp. vesca
ref|XP_009782743.1|  PREDICTED: uncharacterized protein LOC104231438  47.8    2e-04   Nicotiana sylvestris
ref|XP_007224782.1|  hypothetical protein PRUPE_ppa023938mg           48.5    2e-04   Prunus persica
ref|XP_007040952.1|  Uncharacterized protein TCM_005954               50.1    2e-04   Theobroma cacao [chocolate]
ref|XP_007226572.1|  hypothetical protein PRUPE_ppa024162mg           49.3    2e-04   Prunus persica
ref|XP_007036030.1|  Uncharacterized protein TCM_021518               50.1    2e-04   Theobroma cacao [chocolate]
ref|WP_006768136.1|  RNase H                                          49.7    3e-04   Corynebacterium efficiens
ref|XP_011037145.1|  PREDICTED: uncharacterized protein LOC105134437  47.8    3e-04   Populus euphratica
ref|XP_006601510.1|  PREDICTED: putative ribonuclease H protein A...  48.5    3e-04   
ref|XP_006575358.1|  PREDICTED: uncharacterized protein LOC102661...  49.7    3e-04   
gb|ABV21218.1|  At4g21420                                             48.5    3e-04   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC18943.1|  conserved hypothetical protein                       49.7    3e-04   Corynebacterium efficiens YS-314
ref|XP_007036697.1|  Uncharacterized protein TCM_012582               49.7    3e-04   Theobroma cacao [chocolate]
ref|XP_009107495.1|  PREDICTED: putative ribonuclease H protein A...  49.3    3e-04   Brassica rapa
ref|XP_009107896.1|  PREDICTED: putative ribonuclease H protein A...  49.3    3e-04   Brassica rapa
ref|XP_007221764.1|  hypothetical protein PRUPE_ppb024359mg           48.5    3e-04   Prunus persica
ref|XP_008239854.1|  PREDICTED: putative ribonuclease H protein A...  49.3    3e-04   
ref|XP_008218223.1|  PREDICTED: putative ribonuclease H protein A...  48.5    3e-04   
ref|XP_010695795.1|  PREDICTED: tetraspanin-8-like                    49.3    3e-04   Beta vulgaris subsp. vulgaris [field beet]
gb|EMS61533.1|  putative disease resistance RPP8-like protein 4       49.7    3e-04   Triticum urartu
ref|XP_007216426.1|  hypothetical protein PRUPE_ppa022108mg           47.4    3e-04   Prunus persica
ref|XP_007037560.1|  Uncharacterized protein TCM_014255               49.7    4e-04   Theobroma cacao [chocolate]
ref|XP_007217546.1|  hypothetical protein PRUPE_ppa022869mg           47.4    4e-04   Prunus persica
gb|ABN08768.1|  Polynucleotidyl transferase, Ribonuclease H fold      48.9    4e-04   Medicago truncatula
gb|KHN26153.1|  Putative ribonuclease H protein                       49.3    4e-04   Glycine soja [wild soybean]
gb|ABW81175.1|  non-LTR retrotransposon transposase                   49.3    4e-04   Arabidopsis cebennensis
ref|XP_011468499.1|  PREDICTED: uncharacterized protein LOC101309181  48.9    4e-04   Fragaria vesca subsp. vesca
ref|XP_007023230.1|  Non-LTR retroelement reverse transcriptase       49.3    5e-04   Theobroma cacao [chocolate]
ref|XP_002523031.1|  nucleic acid binding protein, putative           48.1    5e-04   
ref|XP_002530315.1|  nuclease, putative                               48.1    5e-04   
ref|XP_003604942.1|  Cyclin D3                                        48.1    5e-04   
ref|XP_009115103.1|  PREDICTED: putative ribonuclease H protein A...  48.5    5e-04   Brassica rapa
ref|XP_004513875.1|  PREDICTED: putative ribonuclease H protein A...  48.1    5e-04   
ref|XP_004146631.1|  PREDICTED: putative ribonuclease H protein A...  47.8    5e-04   
gb|ABD32321.2|  Ribonuclease H                                        48.1    5e-04   Medicago truncatula
ref|XP_007025838.1|  Polynucleotidyl transferase                      48.5    5e-04   Theobroma cacao [chocolate]
ref|WP_015676147.1|  ribonuclease HI                                  47.0    5e-04   Leptospira yanagawae
ref|WP_038591689.1|  acid phosphatase                                 48.5    5e-04   Corynebacterium imitans
ref|XP_010671945.1|  PREDICTED: uncharacterized protein LOC104888619  48.9    5e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|WP_035165042.1|  hypothetical protein                             46.6    5e-04   
ref|XP_008221996.1|  PREDICTED: putative ribonuclease H protein A...  48.9    5e-04   
emb|CAA18706.1|  hypothetical protein                                 48.1    6e-04   Arabidopsis thaliana [mouse-ear cress]
ref|WP_033430344.1|  acid phosphatase                                 48.5    6e-04   Saccharothrix syringae
ref|XP_008375089.1|  PREDICTED: uncharacterized protein LOC103438319  48.9    6e-04   Malus domestica [apple tree]
ref|XP_007207019.1|  hypothetical protein PRUPE_ppb022940mg           46.6    6e-04   Prunus persica
ref|XP_007033066.1|  Uncharacterized protein TCM_019225               48.1    7e-04   Theobroma cacao [chocolate]
ref|XP_007043335.1|  Uncharacterized protein TCM_007760               47.4    7e-04   Theobroma cacao [chocolate]
ref|XP_008385606.1|  PREDICTED: uncharacterized protein LOC103448138  47.8    7e-04   Malus domestica [apple tree]
ref|XP_002437467.1|  hypothetical protein SORBIDRAFT_10g027630        47.8    7e-04   Sorghum bicolor [broomcorn]
ref|XP_007040950.1|  Uncharacterized protein TCM_016759               48.5    8e-04   Theobroma cacao [chocolate]
ref|XP_007023195.1|  Non-LTR retroelement reverse transcriptase       48.5    8e-04   Theobroma cacao [chocolate]
ref|XP_006469101.1|  PREDICTED: putative ribonuclease H protein A...  48.1    9e-04   
ref|XP_007039529.1|  Ribonuclease H protein                           46.2    9e-04   Theobroma cacao [chocolate]
gb|KHN39772.1|  Putative ribonuclease H protein                       46.2    0.001   Glycine soja [wild soybean]
gb|ABD33309.1|  Ribonuclease H                                        48.1    0.001   Medicago truncatula
ref|WP_041311950.1|  acid phosphatase                                 47.8    0.001   Saccharothrix espanaensis
ref|XP_003625075.1|  TMV resistance protein N                         48.1    0.001   



>dbj|BAE79385.1| unnamed protein product [Ipomoea batatas]
Length=1366

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 83/126 (66%), Gaps = 0/126 (0%)
 Frame = +1

Query  37    GFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSI  216
             G+I NIG +NSF AELWGLR+GL LAK+RG  +++ E DSE+VV  +  D      +S +
Sbjct  1239  GYICNIGTANSFLAELWGLREGLLLAKNRGFTKLIAETDSEAVVQVLRKDGPVTPDASIL  1298

Query  217   FKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWGSTCldlpplslnpllTADAF  396
              KDC+ L    + +   H LREGN+C + LANLGQ+++WG+T L+ PP  L   L  DA 
Sbjct  1299  VKDCKLLLDHFQEIKVTHILREGNQCADFLANLGQSSSWGTTILERPPDDLRIFLQRDAI  1358

Query  397   GTSTAR  414
             G +++R
Sbjct  1359  GLASSR  1364



>dbj|BAE79382.1| unnamed protein product [Ipomoea batatas]
Length=1366

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 82/126 (65%), Gaps = 0/126 (0%)
 Frame = +1

Query  37    GFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSI  216
             G+  NIG +NSF AELWGLR+GL LAK+RG  +++ E DSE+VV  +  D      +S +
Sbjct  1239  GYTCNIGTANSFLAELWGLREGLLLAKNRGFTKLIAETDSEAVVQVLRKDGPVTPDASIL  1298

Query  217   FKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWGSTCldlpplslnpllTADAF  396
              KDC+ L    + +   H LREGN+C + LANLGQ+++WG+T L+ PP  L   L  DA 
Sbjct  1299  VKDCKLLLDHFQEIKVTHILREGNQCADFLANLGQSSSWGTTILERPPDDLRIFLQRDAI  1358

Query  397   GTSTAR  414
             G +++R
Sbjct  1359  GLASSR  1364



>dbj|BAE79384.1| unnamed protein product [Ipomoea batatas]
Length=1898

 Score =   109 bits (273),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 58/126 (46%), Positives = 82/126 (65%), Gaps = 0/126 (0%)
 Frame = +1

Query  37    GFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSI  216
             G+  NIG +NSF AELWGLR+GL LAK+RG  +++ E DSE+VV  +  D      +S +
Sbjct  1771  GYTCNIGTANSFLAELWGLREGLLLAKNRGFTKLIAETDSEAVVQVLRKDGPVTPDASIL  1830

Query  217   FKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWGSTCldlpplslnpllTADAF  396
              KDC+ L    + +   H LREGN+C + LANLGQ+++WG+T L+ PP  L   L  DA 
Sbjct  1831  VKDCKLLLDHFQEIKVTHILREGNQCADFLANLGQSSSWGTTILERPPDDLRIFLQRDAI  1890

Query  397   GTSTAR  414
             G +++R
Sbjct  1891  GLASSR  1896



>ref|XP_006605148.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
 gb|KHN22754.1| Putative ribonuclease H protein [Glycine soja]
Length=121

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 57/103 (55%), Gaps = 0/103 (0%)
 Frame = +1

Query  4    LTWDHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSG  183
            L WDH G  ++GF   IG S++F AELWG+ +GL+LA  +G  R++ ++DS++V+ ++  
Sbjct  8    LIWDHDGRWIYGFQKYIGRSSTFVAELWGVFQGLKLAILKGFTRILLQVDSKAVILAIRS  67

Query  184  DKIAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLAN  312
                      + +  +     +      H  +E N+CV+ LAN
Sbjct  68   GNEGSASGWRLIQAIQKFIRMVNQFQINHMYKETNRCVDKLAN  110



>gb|KHN42473.1| Putative ribonuclease H protein [Glycine soja]
Length=178

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 56/99 (57%), Gaps = 0/99 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D KG  + GF   +GI+ SFA +LWG+ +GL LA+  GL  V   +D ++VV S+ G K 
Sbjct  70   DEKGCWISGFSKKVGIAFSFAVDLWGVYEGLCLARKIGLVVVEVNIDCQAVVDSLCGSKT  129

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLA  309
                   +    R +  +   V+F+H+ +E NKCV+ LA
Sbjct  130  GCAVGCRLINSIRSMINTSWLVVFKHSYQETNKCVDALA  168



>ref|XP_008221992.1| PREDICTED: uncharacterized protein LOC103321917 [Prunus mume]
Length=658

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 40/101 (40%), Positives = 57/101 (56%), Gaps = 10/101 (10%)
 Frame = +1

Query  31   LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSS  210
            ++GF  NIGI N + AELW L +GL +A D+G+R +  E DS SVV+      IA+ C+ 
Sbjct  527  IYGFSANIGIGNIYEAELWSLFRGLHMAWDKGIRSLDIECDSLSVVS-----LIAKACNH  581

Query  211  S-----IFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLG  318
            S     + +DC+ L          H  R+ N+  +HLANLG
Sbjct  582  SHPLFCLIEDCKLLLKRNWRCNVSHIYRKQNRVADHLANLG  622



>ref|XP_007224107.1| hypothetical protein PRUPE_ppa015647mg, partial [Prunus persica]
 gb|EMJ25306.1| hypothetical protein PRUPE_ppa015647mg, partial [Prunus persica]
Length=140

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 54/100 (54%), Gaps = 0/100 (0%)
 Frame = +1

Query  37   GFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSI  216
            GF+T +G  +   AELWG+ +GL L  + G+RR+  E DS + V+ ++G+       SSI
Sbjct  11   GFVTKLGCGSILEAELWGVFRGLLLTWNEGIRRIQMECDSLTAVSLINGETGTNHPLSSI  70

Query  217  FKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWG  336
               C+ L          H  RE N   +H+A+LGQ ++ G
Sbjct  71   IHCCKDLLLRDWECTIYHIYREQNSAADHMAHLGQNSSLG  110



>ref|XP_007022832.1| Uncharacterized protein TCM_026877 [Theobroma cacao]
 gb|EOY25454.1| Uncharacterized protein TCM_026877 [Theobroma cacao]
Length=2367

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 55/105 (52%), Gaps = 5/105 (5%)
 Frame = +1

Query  13    DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
             DH G  +FGF  N+GI NS  AEL  L +GL L +D  +RR+  E+D+ SV+  + G+  
Sbjct  2234  DHAGVMIFGFSENLGIQNSLKAELLALYRGLILCRDYNIRRLWIEMDATSVIRLLQGNHR  2293

Query  193   AEECSSSIFKDCRFLATSMEHVIFR--HTLREGNKCVNHLANLGQ  321
                    +    R L   + H  FR  H  REGN+  + LAN G 
Sbjct  2294  GPHAIRYLLGSIRQL---LSHFSFRLTHIFREGNQAADFLANRGH  2335



>ref|XP_007008704.1| Uncharacterized protein TCM_042330 [Theobroma cacao]
 gb|EOY17514.1| Uncharacterized protein TCM_042330 [Theobroma cacao]
Length=2249

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 56/105 (53%), Gaps = 5/105 (5%)
 Frame = +1

Query  13    DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
             DH G  +FGF  N+GI NS  AEL  L +GL L +D  +RR+  E+D+ SV+  + G++ 
Sbjct  2116  DHAGVMVFGFSENLGIQNSLQAELLALYRGLILCRDYNIRRLWIEMDAASVIRLLQGNQR  2175

Query  193   AEECSSSIFKDCRFLATSMEHVIFR--HTLREGNKCVNHLANLGQ  321
                    +    R L   + H  FR  H  REGN+  + LAN G 
Sbjct  2176  GPHAIRYLLVSIRQL---LSHFSFRLSHIFREGNQAADFLANRGH  2217



>ref|XP_007017131.1| Uncharacterized protein TCM_033752 [Theobroma cacao]
 gb|EOY14356.1| Uncharacterized protein TCM_033752 [Theobroma cacao]
Length=2251

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 55/105 (52%), Gaps = 5/105 (5%)
 Frame = +1

Query  13    DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
             DH GE +FGF  N+G  NS  AEL  L +GL L +D  +RR+  E+D+ SV+  + G+  
Sbjct  2118  DHAGEMVFGFSENLGTQNSLQAELLALYRGLILCRDYNIRRLWIEMDAISVIRLLQGNHR  2177

Query  193   AEECSSSIFKDCRFLATSMEHVIFR--HTLREGNKCVNHLANLGQ  321
                    +    R L   + H  FR  H  REGN+  + LAN G 
Sbjct  2178  GPHAIRYLMVSLRQL---LSHFSFRFSHIFREGNQAADFLANRGH  2219



>ref|XP_007208821.1| hypothetical protein PRUPE_ppa025050mg [Prunus persica]
 gb|EMJ10020.1| hypothetical protein PRUPE_ppa025050mg [Prunus persica]
Length=241

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 53/108 (49%), Gaps = 0/108 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G  + GF  NIGI N    ELW L KGL++A +RG+R +  E D   VV+ M+    
Sbjct  106  DSHGSWICGFSVNIGIGNIAKGELWSLLKGLQMAWNRGIRSLDVECDFLYVVSLMAKVSD  165

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWG  336
                   + +DC+ L          H  RE N+  +HLANLG    +G
Sbjct  166  QSHPLLCLIEDCKSLLNRDWSCKISHVYREQNRTADHLANLGYELTFG  213



>ref|XP_007042183.1| Ribonuclease H protein [Theobroma cacao]
 gb|EOX98014.1| Ribonuclease H protein [Theobroma cacao]
Length=528

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 32/92 (35%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  37   GFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSI  216
            GF+  +G  +++ AELWG+  GLRLA D G ++V  ++D++ VV ++S DK+    ++ +
Sbjct  288  GFVAKLGKCSAYRAELWGILHGLRLAWDSGFKKVQVQVDNKMVVQAISTDKLIPGANTDL  347

Query  217  FKDCRFLATSMEHVIFRHTLREGNKCVNHLAN  312
                + +      V F HT REGN   ++LA+
Sbjct  348  ISAIKNVLQKEWEVSFMHTYREGNMVADYLAS  379



>ref|XP_007017129.1| Uncharacterized protein TCM_042328 [Theobroma cacao]
 gb|EOY34748.1| Uncharacterized protein TCM_042328 [Theobroma cacao]
Length=910

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 55/105 (52%), Gaps = 5/105 (5%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            DH G  +FGF  N+GI NS  AEL  L +GL L +D  +RR+  E+D+ SV+  + G+  
Sbjct  777  DHAGVMVFGFSENLGIQNSLQAELLALYRGLILCRDYNIRRLWIEMDAISVIRLLQGNHR  836

Query  193  AEECSSSIFKDCRFLATSMEHVIFR--HTLREGNKCVNHLANLGQ  321
                   +    R L   + H  FR  H  REGN+  + LAN G 
Sbjct  837  GPHAIRYLMVSLRQL---LSHFSFRFSHIFREGNQAADFLANRGH  878



>ref|XP_006584399.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=470

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 34/107 (32%), Positives = 58/107 (54%), Gaps = 0/107 (0%)
 Frame = +1

Query  4    LTWDHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSG  183
            L  D  G  + GF+ N+GI++++ A+ WG+ +G+ LA+ RG+  +   +DS+ VV  + G
Sbjct  330  LIRDENGRWVVGFVRNLGIASAYVAKSWGVLEGVTLARQRGIDFLEINVDSKVVVDGLKG  389

Query  184  DKIAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQT  324
            DK       +I    R + + +E V   H  RE N+C +   N  +T
Sbjct  390  DKQGCLEGWTIVGAIRKMVSGLEQVKISHIYREANQCADLHVNHART  436



>gb|KHN04118.1| Putative ribonuclease H protein [Glycine soja]
Length=128

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 53/105 (50%), Gaps = 5/105 (5%)
 Frame = +1

Query  31   LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSS  210
            +F F +NIG  N   AELWG+ KGL +A+DRG   +V E DS+  +  ++        + 
Sbjct  28   IFAFSSNIGNCNFLRAELWGILKGLTIARDRGFNYIVVESDSKIAIKLITYGCPTIHSNY  87

Query  211  SIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWGSTC  345
            ++ +  + +  S   V F H  RE N+  + LA      AW + C
Sbjct  88   NLVQQIKEIVDSRLEVTFSHIFREANQTTDALAK-----AWDAKC  127



>ref|YP_006666138.1| RnaseH (mitochondrion) [Malus domestica]
 emb|CBX33402.1| rnaseH (mitochondrion) [Malus domestica]
Length=153

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 53/104 (51%), Gaps = 0/104 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D+ G  + GF  N+G     AAELWGL  GLRLA  RG R V  E+DS +VV  ++    
Sbjct  16   DNNGNWISGFTANLGKGKIIAAELWGLFFGLRLAWMRGFRSVEVEVDSATVVTLVNQQDN  75

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQT  324
            +     ++ + C+       H    H  RE N   ++LA++G T
Sbjct  76   SLHPLHTLIRGCQAYLKMDWHCKLSHIYREKNFSADYLASIGLT  119



>ref|XP_002535256.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF27126.1| conserved hypothetical protein, partial [Ricinus communis]
Length=120

 Score = 60.5 bits (145),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 58/103 (56%), Gaps = 4/103 (4%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            DH G+ + GF+ N+G+ +   AEL G+  GL LA  +G+++VV E  + S+   M  ++ 
Sbjct  20   DHNGDWIRGFMANLGVYSVMFAELQGIYHGLCLAWSKGIKKVVLEAYNLSI--KMVLNRA  77

Query  193  AEECSSSI--FKDCRFLATSMEHVIFRHTLREGNKCVNHLANL  315
             + C  +I   K+ R + T    +   H  +EGNKC N LAN+
Sbjct  78   KDGCIQNIALVKEIRKMITREWQIQVTHINQEGNKCANLLANM  120



>gb|AAC26674.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=970

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 63/132 (48%), Gaps = 0/132 (0%)
 Frame = +1

Query  19   KGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAE  198
            +GE L GF  NIG  ++  AELWG   GL +A D+G RRV   LDSE VV  +S      
Sbjct  835  QGEWLGGFALNIGSCDAPLAELWGAYYGLLIAWDKGFRRVELNLDSELVVGFLSTGISKA  894

Query  199  ECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWGSTCldlpplslnpl  378
               S + + C+   T    V   H  RE N+  + LAN       G  C ++ P  +   
Sbjct  895  HPLSFLVRLCQGFFTRDWLVRVSHVYREANRLADGLANYAFFLPLGFHCFEICPEDVLLF  954

Query  379  lTADAFGTSTAR  414
            L  DA GTS  R
Sbjct  955  LVEDANGTSFPR  966



>ref|XP_007019605.1| Uncharacterized protein TCM_035716 [Theobroma cacao]
 gb|EOY16830.1| Uncharacterized protein TCM_035716 [Theobroma cacao]
Length=165

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 52/102 (51%), Gaps = 1/102 (1%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D+ G  +FGF  N G+ NS  AEL  L KGL L +D G+  +  E+D+  V+  ++G   
Sbjct  35   DYTGSLVFGFYENFGVKNSIQAELLALYKGLILCRDYGISHLWIEMDALVVIQMLTGRYR  94

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLG  318
                S  +  + + L     + +  H  +EGN+  + L NLG
Sbjct  95   GSHDSRYLLANIQNLHNYFSYKL-SHIFQEGNQAADLLVNLG  135



>ref|XP_006490009.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=171

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 66/135 (49%), Gaps = 0/135 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D+ G  L GF  N+G+ +  +AELWGL  GL++A D G R +   +D+++VV  +     
Sbjct  34   DYNGNWLMGFTVNLGMCSVLSAELWGLLHGLKVAWDYGFRHLQVGVDNKNVVLLLERAHP  93

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWGSTCldlpplsln  372
                ++ + K  R L      V   H  R+ N   + LA+   T   G   L  PP  + 
Sbjct  94   PANENAILVKTIRELLARDWIVHMEHVYRKANSAADFLASYSLTKPLGLHVLPSPPPDII  153

Query  373  pllTADAFGTSTARV  417
             LL  DA+G + +R+
Sbjct  154  GLLCNDAYGIAHSRL  168



>ref|XP_007031579.1| RNA-binding (RRM/RBD/RNP motifs) family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007031580.1| RNA-binding (RRM/RBD/RNP motifs) family protein isoform 1 [Theobroma 
cacao]
 gb|EOY02505.1| RNA-binding (RRM/RBD/RNP motifs) family protein isoform 1 [Theobroma 
cacao]
 gb|EOY02506.1| RNA-binding (RRM/RBD/RNP motifs) family protein isoform 1 [Theobroma 
cacao]
Length=344

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 55/104 (53%), Gaps = 0/104 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            + +GE   G+   +G + S  AE WGLR GL+LA  RGL  V+ ++D + V+  +  + +
Sbjct  94   NDQGEWNVGYSRKLGQATSTCAEHWGLRDGLQLAVKRGLFDVIIKVDLQVVLDLICKEAV  153

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQT  324
                   I K+CR L   + +  F    R+ N C +HLA +G T
Sbjct  154  DSHTLGPIIKECRSLLEQIPNHRFCQINRDSNCCADHLARMGAT  197



>gb|AAD22368.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=321

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 51/100 (51%), Gaps = 0/100 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            DH G  + GF  NIG+ ++  AELWG+  GL +A  RG RRV  E+DS+ VV  ++    
Sbjct  184  DHNGAWIGGFAVNIGVCSAPLAELWGVYYGLFIAWGRGARRVELEVDSKMVVGFLTTGIA  243

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLAN  312
                 S + + C    +    V   H  RE N+  + LAN
Sbjct  244  DSHPLSFLLRLCYDFLSKGWIVRISHVYREANRLADGLAN  283



>ref|XP_007019573.1| Uncharacterized protein TCM_035679 [Theobroma cacao]
 gb|EOY16798.1| Uncharacterized protein TCM_035679 [Theobroma cacao]
Length=203

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 46/100 (46%), Gaps = 0/100 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G  L GF   IGIS S   ELW L  GL L  D+G R+V  E DS   V  +S   +
Sbjct  77   DEVGNWLLGFNYKIGISCSLQVELWALYWGLTLCWDKGFRKVQVESDSLLAVQKISNQSL  136

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLAN  312
              + ++ + K  R L          H  RE N+C N +A 
Sbjct  137  QPKQNAGLLKCIRELFQRSWDCTLTHIHREANQCANWMAT  176



>gb|KHN06921.1| Heat shock 70 kDa protein [Glycine soja]
Length=778

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 36/107 (34%), Positives = 56/107 (52%), Gaps = 0/107 (0%)
 Frame = +1

Query  4    LTWDHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSG  183
            L  D  G  L GF  NIGI+    AELWG+  GL+LA D G ++V  ++DS   +  +  
Sbjct  637  LVRDSSGCFLGGFTVNIGITAVTLAELWGVVHGLKLAWDLGCKKVKVDIDSGHALGLIRH  696

Query  184  DKIAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQT  324
              +A++ + ++  +   L      V F H  RE N+  + LA+LG +
Sbjct  697  GPVAKDPAFALVSEINELVRKEWLVEFSHVFRESNRAADKLAHLGHS  743



>ref|XP_002530597.1| nuclease, putative [Ricinus communis]
 gb|EEF31777.1| nuclease, putative [Ricinus communis]
Length=113

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 51/90 (57%), Gaps = 0/90 (0%)
 Frame = +1

Query  22   GE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEE  201
            G+ + G++ +IG   +  AELW   +GL +A+ RG +R+V E+DS+ +VA  +   + E 
Sbjct  22   GDWIGGYVVHIGYCTAIEAELWAALQGLLIARRRGYQRLVLEVDSQLLVAWPTSLSVLEG  81

Query  202  CSSSIFKDCRFLATSMEHVIFRHTLREGNK  291
              +++ + CR L         +H  +EGN+
Sbjct  82   KCANLVQTCRGLEHEFSSFQVQHVFQEGNR  111



>ref|XP_008232034.1| PREDICTED: uncharacterized protein LOC103331202 [Prunus mume]
Length=814

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 38/103 (37%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D++G  L     NIG ++   AE   LR GL  A DRG  ++V E DS+ V+ S+ G   
Sbjct  332  DYEGHVLVAGSNNIGENSINVAECIALRDGLATALDRGWDQIVIEGDSKLVIDSILGKAN  391

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQ  321
               C   I +D   L++S+  + F+H LRE N   N +A LG 
Sbjct  392  PPWCIQQIIQDIWALSSSVACIRFQHVLREANFTANAVAKLGH  434



>ref|XP_006477729.1| PREDICTED: uncharacterized protein LOC102617084 [Citrus sinensis]
Length=842

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 39/116 (34%), Positives = 54/116 (47%), Gaps = 14/116 (12%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G+ + G+  N+G SNS A+ELW L  GL L  +RG R+V+ E +S   V  +     
Sbjct  706  DESGKWILGYSKNLGTSNSLASELWALYHGLNLVWERGFRKVLVECNSHEAVKCL-----  760

Query  193  AEECSSSIFKDCRFLATSMEHVIFRH-------TLREGNKCVNHLANLGQTAAWGS  339
              E  +S     R L  S +  + R+        LRE N C N LA   +    GS
Sbjct  761  --ELPTSFLDPNRALILSCKEYLCRNWDCKLQLILREANSCANWLAAHCENQPLGS  814



>ref|XP_009802861.1| PREDICTED: uncharacterized protein LOC104248321 [Nicotiana sylvestris]
Length=212

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 52/105 (50%), Gaps = 3/105 (3%)
 Frame = +1

Query  4    LTWDHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSG  183
            L  +HKGE + GF   I   N  +AEL  L KGL LA    L  +  E+D++ V+  +  
Sbjct  28   LIRNHKGEWMVGFAGQIPHMNCLSAELQALIKGLSLAAQLRLLPLQVEIDAKEVITLLDN  87

Query  184  DKIAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLG  318
                    S++  DCR+L  ++   +  H  RE N   ++LA LG
Sbjct  88   Q---NSRYSNLILDCRYLLGTLHDPVVNHAYREQNCVADNLAKLG  129



>gb|KJB64101.1| hypothetical protein B456_010G033200 [Gossypium raimondii]
Length=390

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 54/101 (53%), Gaps = 0/101 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D+KGE L  F+      ++F  ELW + +GL LA   G++ +  E DS+SVV +++ ++ 
Sbjct  256  DYKGEPLCAFVCKAPQGDTFLVELWAIWRGLVLASGLGIKVIWVESDSKSVVKTINREQP  315

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANL  315
                SS   +    L T  E+    H+ RE NK  +HL+ +
Sbjct  316  YGPKSSQCLRQIWKLLTKFENYRVTHSWRETNKAADHLSRM  356



>gb|KJB64102.1| hypothetical protein B456_010G033200 [Gossypium raimondii]
Length=418

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 54/101 (53%), Gaps = 0/101 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D+KGE L  F+      ++F  ELW + +GL LA   G++ +  E DS+SVV +++ ++ 
Sbjct  284  DYKGEPLCAFVCKAPQGDTFLVELWAIWRGLVLASGLGIKVIWVESDSKSVVKTINREQP  343

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANL  315
                SS   +    L T  E+    H+ RE NK  +HL+ +
Sbjct  344  YGPKSSQCLRQIWKLLTKFENYRVTHSWRETNKAADHLSRM  384



>ref|XP_007225020.1| hypothetical protein PRUPE_ppa020103mg, partial [Prunus persica]
 gb|EMJ26219.1| hypothetical protein PRUPE_ppa020103mg, partial [Prunus persica]
Length=285

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D +G  L     NIG ++   AE   LR GL  A DRG  R+V E DS+ V+ S+ G   
Sbjct  133  DSEGHVLIAGSNNIGENSINVAECVALRDGLAAALDRGWDRIVIEGDSKLVIDSIRGKAN  192

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQ  321
               C   I +D   L++S+  V F+H  RE N   + +A LG 
Sbjct  193  PPWCIQQIIQDIWALSSSVTSVRFQHVFREANFTADAVAKLGH  235



>ref|XP_008344356.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=348

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 60/132 (45%), Gaps = 0/132 (0%)
 Frame = +1

Query  19   KGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAE  198
            +G+ + GF  N+G      AELWG+  GL +A D G R V+ E DS   V S+    +  
Sbjct  213  EGDWIXGFAANLGRGTXMEAELWGVLMGLTIAWDEGCRDVILECDSWDAVISIQKPMLVS  272

Query  199  ECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWGSTCldlpplslnpl  378
                ++  DC+            H  RE N   +H+A+LG   + G    D PP +    
Sbjct  273  HPLYNLILDCKEAIERNWRCEVTHIYREKNASADHMADLGHGLSLGLHVFDSPPTTATNF  332

Query  379  lTADAFGTSTAR  414
            L +D+ G +  R
Sbjct  333  LASDSIGRALPR  344



>ref|XP_004305978.1| PREDICTED: uncharacterized protein LOC101292333 [Fragaria vesca 
subsp. vesca]
Length=258

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 51/100 (51%), Gaps = 0/100 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G  L  +   IG ++   AE+  LR GL  A++R + RV+ E DS+ V+  +     
Sbjct  137  DDSGCPLIAYTRRIGKTDVPIAEVVALRDGLLSARNRNISRVIAEGDSQLVINCIKSTTS  196

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLAN  312
                 SSI KD   +AT  EH+ F HT +E N   N +AN
Sbjct  197  IPSKLSSIVKDIIHIATRFEHISFSHTFQEANFIANVVAN  236



>ref|XP_007033353.1| Non-LTR retroelement reverse transcriptase-like [Theobroma cacao]
 gb|EOY04279.1| Non-LTR retroelement reverse transcriptase-like [Theobroma cacao]
Length=438

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 47/96 (49%), Gaps = 0/96 (0%)
 Frame = +1

Query  22   GE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEE  201
            G  L GF   IGIS S  AELW L  GL L  D+G R+V  E DS   V  +S   +  E
Sbjct  306  GNWLLGFNYKIGISCSLQAELWALYWGLTLCWDKGFRKVQVESDSLLAVQKISNQSLQPE  365

Query  202  CSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLA  309
             ++ + K  + L     +    H  RE N+C + +A
Sbjct  366  QNAGLLKCIKELFQRFWNCTLTHIHREANQCADWMA  401



>ref|XP_006440743.1| hypothetical protein CICLE_v10021474mg [Citrus clementina]
 gb|ESR53983.1| hypothetical protein CICLE_v10021474mg [Citrus clementina]
Length=290

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 53/116 (46%), Gaps = 14/116 (12%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G+ + G+  N+G SNS A+ELW L  GL L  +RG R+V+ E +S   V  +     
Sbjct  154  DESGKWILGYSKNLGTSNSLASELWALYHGLNLVWERGFRKVLVECNSHEAVKCL-----  208

Query  193  AEECSSSIFKDCRFLATSMEHVIFRH-------TLREGNKCVNHLANLGQTAAWGS  339
              E  +S     R L  S    + R+        LRE N C N LA   +    GS
Sbjct  209  --ELPASFLDPNRALILSCREYLCRNWDCKLQLILREANSCANWLAAHCENQPLGS  262



>ref|XP_009101981.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1235

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 38/100 (38%), Positives = 50/100 (50%), Gaps = 0/100 (0%)
 Frame = +1

Query  37    GFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSI  216
             GF  NIGI ++  AELWG+  GL +A DRG RRV  E+DSE VV  +          S +
Sbjct  1106  GFAINIGICSAPLAELWGVYYGLCIAWDRGFRRVEVEVDSECVVGFLQTGIQDSHPLSFL  1165

Query  217   FKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWG  336
              + C    +    V F H  RE N   + LAN   +  +G
Sbjct  1166  VRLCYGFISRDWLVKFSHVYREANHLADGLANYAFSLPFG  1205



>gb|KDO65745.1| hypothetical protein CISIN_1g039495mg, partial [Citrus sinensis]
Length=327

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 53/116 (46%), Gaps = 14/116 (12%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G+ + G+  N+G SNS A+ELW L  GL L  +RG R+V+ E +S   V  +     
Sbjct  191  DESGKWILGYSKNLGTSNSLASELWALYHGLNLVWERGFRKVLVECNSHEAVKCL-----  245

Query  193  AEECSSSIFKDCRFLATSMEHVIFRH-------TLREGNKCVNHLANLGQTAAWGS  339
              E  +S     R L  S    + R+        LRE N C N LA   +    GS
Sbjct  246  --ELPASFLDPNRALILSCREYLCRNWDCKLQLILREANSCANWLAAHCENQPLGS  299



>ref|XP_007225017.1| hypothetical protein PRUPE_ppa020094mg, partial [Prunus persica]
 gb|EMJ26216.1| hypothetical protein PRUPE_ppa020094mg, partial [Prunus persica]
Length=140

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 48/100 (48%), Gaps = 1/100 (1%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVV-ASMSGDK  189
            DH G  + GF  N+G      AELWGL  GL+LA  RG+  +V E+DS + V   +S D 
Sbjct  1    DHLGNWIGGFAVNLGKGQILEAELWGLFFGLKLATTRGIMDIVVEMDSVNAVNLILSNDL  60

Query  190  IAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLA  309
                  + +   C+ L + +      H  RE N   + LA
Sbjct  61   NFCHPMAGLVHSCKRLMSQIPKCFLHHIYREKNAVADRLA  100



>ref|XP_008344200.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=153

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 52/108 (48%), Gaps = 0/108 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D+ G  + GF  N+G     AAELWG    LRLA  RG R V  E+DS +VV  ++    
Sbjct  16   DNNGNWIXGFXANLGKGKIIAAELWGXFFXLRLAWMRGFRSVEVEVDSATVVTLVNQQDN  75

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWG  336
            +     ++ + C+       H    H  RE N   ++LA++G T   G
Sbjct  76   SLHPLHTLIRGCQAYLKMDWHCKLSHIYREKNFSADYLASIGLTYDLG  123



>gb|AID60103.1| hypothetical protein [Brassica napus]
Length=620

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 55/100 (55%), Gaps = 0/100 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D +G+ + GF  NIGI ++  AELWG+  GL +A D+G+R++  E+DS+SVV  +     
Sbjct  483  DEEGKWIGGFSLNIGICSAPLAELWGVYYGLCIAWDKGIRKLEVEVDSKSVVGFLKTGIH  542

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLAN  312
                 S + + C    +    V F H  RE N+  + LAN
Sbjct  543  DSHPLSFLVRLCYGFVSRDWIVNFSHVYRETNRLADGLAN  582



>ref|XP_007031938.1| Ribonuclease H protein [Theobroma cacao]
 gb|EOY02864.1| Ribonuclease H protein [Theobroma cacao]
Length=660

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/91 (32%), Positives = 54/91 (59%), Gaps = 0/91 (0%)
 Frame = +1

Query  40   FITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSIF  219
            F+  +G  +++ AELWG+  GLRLA D G ++V  ++D++ VV ++S +K+    ++ + 
Sbjct  531  FLAKLGKCSAYRAELWGVLHGLRLAWDSGFKKVQVQVDNKMVVPAVSTNKLIPGANTDLI  590

Query  220  KDCRFLATSMEHVIFRHTLREGNKCVNHLAN  312
            +  + +      V F HT  EGN   ++LA+
Sbjct  591  RAIKDVLQKEWEVSFMHTYCEGNMVTDYLAS  621



>ref|XP_009147282.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=308

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 53/108 (49%), Gaps = 0/108 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  GE   GF  NIGI ++  AELWG+  GL +A DRG+RR+  E+DS SVV  +     
Sbjct  171  DEYGEWKGGFAVNIGICSASLAELWGVYYGLCIAWDRGIRRLEVEVDSASVVDFLRTGIH  230

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWG  336
                 S + + C    +    V F H  RE N   + LA    +  +G
Sbjct  231  DSHPLSFLVRLCYGFISRDWLVKFSHVYREANHLADGLATYAFSLPFG  278



>gb|KHF99723.1| HVA22-like protein a [Gossypium arboreum]
Length=418

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 54/101 (53%), Gaps = 0/101 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D++GE L  F+      ++F  ELW + +GL LA   G++ +  E DS+SVV +++ ++ 
Sbjct  284  DYRGEPLCAFVCKAPQGDTFLVELWPIWRGLVLASGLGVKVIWVESDSKSVVKTINREQP  343

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANL  315
                SS   +    L T  E+    H+ RE NK  +HL+ +
Sbjct  344  YGPKSSQCLRQIWKLLTKFENYRVTHSWRETNKAADHLSRM  384



>gb|AAC63844.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1231

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 49/132 (37%), Positives = 62/132 (47%), Gaps = 0/132 (0%)
 Frame = +1

Query  19    KGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAE  198
             +GE L GF  NIG   +  AELWG   GL +A D+G RRV  +LD + VV  +S      
Sbjct  1096  QGEWLGGFALNIGSCAAPLAELWGAYYGLLIAWDKGFRRVELDLDCKLVVGFLSTGVSNA  1155

Query  199   ECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWGSTCldlpplslnpl  378
                S + + C+   T    V   H  RE N+  + LAN   T   G  C D  P  +  L
Sbjct  1156  HPLSFLVRLCQGFFTRDWLVRVSHVYREANRLADGLANYAFTLPLGLHCFDACPEGVRLL  1215

Query  379   lTADAFGTSTAR  414
             L AD  GT   R
Sbjct  1216  LLADVNGTEFPR  1227



>ref|XP_007203348.1| hypothetical protein PRUPE_ppa020364mg, partial [Prunus persica]
 gb|EMJ04547.1| hypothetical protein PRUPE_ppa020364mg, partial [Prunus persica]
Length=295

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 53/101 (52%), Gaps = 3/101 (3%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            DH G+ + GF  N+G      AELWGL  GL LA ++ L  +V E+DS++V+  +   K+
Sbjct  158  DHLGQWIAGFAVNLGQGEVLDAELWGLFFGLNLAVEKNLDDIVIEMDSDTVMLLIES-KV  216

Query  193  AEEC--SSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLA  309
              +C  ++ +   C+ L      +  +H  RE N   + LA
Sbjct  217  LNDCHPNAGLVSSCKRLMNLFRRIKLQHIYRERNDVADGLA  257



>emb|CAN75081.1| hypothetical protein VITISV_027743 [Vitis vinifera]
Length=395

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 52/106 (49%), Gaps = 1/106 (1%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDK-  189
            D +G  +  F T +  SNS  AE+  L  GLRLA    + R++ E DS+  +  +SG + 
Sbjct  258  DAQGSFIAAFATPLDTSNSLMAEIGALEGGLRLALKLNVERILIEGDSKITIEMLSGKRE  317

Query  190  IAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTA  327
               E   S+    R L    + V  RH  RE N+  +HLAN+   A
Sbjct  318  XTXEEEKSLMTHIRELLQGFQEVTARHEFREANRPADHLANIATQA  363



>ref|XP_002514383.1| nuclease, putative [Ricinus communis]
 gb|EEF47979.1| nuclease, putative [Ricinus communis]
Length=145

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/101 (29%), Positives = 51/101 (50%), Gaps = 0/101 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G  + GF+ +IG  +   AELW   +G+ LA  +G+  ++ E+DS  V   M+   +
Sbjct  27   DSNGCWVGGFVIHIGACDPVGAELWAFLQGISLAWSKGIHNLIVEVDSSLVADWMNKKSV  86

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANL  315
             +   +++   C  L  +   V  +H  RE N+  + LAN+
Sbjct  87   CKSIHANLVSACLDLLQNWWDVKIKHVFREMNQVADSLANI  127



>gb|AAF19536.1|AC007190_4 F23N19.5 [Arabidopsis thaliana]
Length=233

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 63/135 (47%), Gaps = 0/135 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            +  GE  FGF  NIG   +  AELWG+  GL +A DRG+ R+  E+DSE VV  +     
Sbjct  96   NEYGEWCFGFALNIGRCLAPLAELWGVYYGLFMAWDRGITRLELEVDSEMVVGFLRTGIG  155

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWGSTCldlpplsln  372
            +    S + + C    +    V   H  RE N+  + LAN       G      PP SL+
Sbjct  156  SSHPLSFLVRMCHGFLSRDWIVRIGHVYREANRLADGLANYAFDLPLGYHAFASPPNSLD  215

Query  373  pllTADAFGTSTARV  417
             +L  D  G S  R+
Sbjct  216  SILRDDELGISVPRL  230



>ref|NP_001174960.1| Os06g0683500 [Oryza sativa Japonica Group]
 dbj|BAD45551.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAH93688.1| Os06g0683500 [Oryza sativa Japonica Group]
Length=240

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 56/109 (51%), Gaps = 5/109 (5%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            DH G  L G+   IG + S  AEL  LR+GL LA   G RRV  E DS++VV  +  D+ 
Sbjct  110  DHDGAFLLGYAERIGTATSSVAELAALRRGLELAVRNGWRRVWAEGDSKAVVDVVC-DR-  167

Query  193  AEECSSSIFKDCRFLA---TSMEHVIFRHTLREGNKCVNHLANLGQTAA  330
            A+  S    + CR +A     ++ +   H  R GNK  +  A LG  AA
Sbjct  168  ADVQSEEDLRLCREIAALLPQLDDMAVSHVRRGGNKVAHGFAELGHRAA  216



>gb|KHN47376.1| Heat shock 70 kDa protein [Glycine soja]
Length=793

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 34/107 (32%), Positives = 56/107 (52%), Gaps = 0/107 (0%)
 Frame = +1

Query  4    LTWDHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSG  183
            L  D  G  L GF  N+G ++   AELWG+  GL+LA D G ++V  ++DS + +  +  
Sbjct  652  LVRDSSGCYLGGFTVNLGNTSVTLAELWGVVHGLKLAWDLGCKKVKVDIDSGNALGLVRH  711

Query  184  DKIAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQT  324
              +A + + ++  +   L      V F H  RE N+  + LA+LG +
Sbjct  712  GPVANDPAFALVSEINELVRKEWLVEFSHVFRESNRAADKLAHLGHS  758



>ref|XP_008224632.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=204

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 47/99 (47%), Gaps = 0/99 (0%)
 Frame = +1

Query  22   GE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEE  201
            G  + GF  N+G    F AE W L  GL LA   GLR+++   DS  VV  ++GD +   
Sbjct  70   GNWIAGFSANLGHGEVFVAEAWALYYGLNLAWQLGLRQIMVNSDSALVVDMINGDWVDSH  129

Query  202  CSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLG  318
              + +   C+ L  +  +    H  RE N   + LA LG
Sbjct  130  PMAVLLTKCKELLKNQWNCCVLHVYRETNFAADFLAKLG  168



>gb|KHN08856.1| Putative ribonuclease H protein, partial [Glycine soja]
Length=147

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +1

Query  61   SNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSIFKDCRFLA  240
            +N+F AELWG+ +GL+LA++RG + V+ ++DS+ +V  + G K       S+ +  R L 
Sbjct  25   ANAFIAELWGVYEGLKLAQNRGFKVVIVQVDSQVIVNILKGKKDGSAQGWSLVRKIRLLF  84

Query  241  TSMEHVIFRHTLREGNKCVNHLANLG  318
            ++       H  RE N   + LA + 
Sbjct  85   SADWRTKVFHVYREANIWAHMLAKMA  110



>ref|WP_002986456.1| ribonuclease HI [Leptospira vanthielii]
 gb|EMY69062.1| ribonuclease HI [Leptospira vanthielii serovar Holland str. Waz 
Holland = ATCC 700522]
Length=137

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 53/106 (50%), Gaps = 1/106 (1%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D+ G   F     IG + +  AE   L +G+  A  + L+++ F LDSE VV  M G+  
Sbjct  30   DNDGVEFFFLSEKIGNATNNVAEWQALYRGMEEAIKQNLQKIRFRLDSELVVKQMKGEYK  89

Query  193  AEECSSSIFKD-CRFLATSMEHVIFRHTLREGNKCVNHLANLGQTA  327
             +     +FK+ C FL TS  +   ++  RE N   + LANL Q A
Sbjct  90   VKNKDLLVFKNKCDFLKTSFLNFEIQYIPREQNTRADQLANLAQDA  135



>ref|XP_006648856.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Oryza 
brachyantha]
Length=206

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 53/107 (50%), Gaps = 1/107 (1%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVV-ASMSGDK  189
            DH+G  + G+   IG + S AAEL  LR+GL LA   G  RV  E DS++V+ A  +  K
Sbjct  75   DHEGAFVLGYAERIGTATSSAAELAALRRGLELAARNGWWRVWVEGDSKAVIDAVCNRAK  134

Query  190  IAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAA  330
            +        +++   L    + V   H  R GNK  +  A LG  AA
Sbjct  135  VRPSEDLRQYREIAALLPLFDGVAASHVFRGGNKVAHGFAKLGHKAA  181



>ref|XP_009121276.1| PREDICTED: putative ribonuclease H protein At1g65750, partial 
[Brassica rapa]
Length=216

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 53/100 (53%), Gaps = 0/100 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D +G  + GF  NIGI ++  AELWG+  G+ +A D+G+R++  E+DS+SVV  +     
Sbjct  79   DGQGRWIGGFALNIGICSAPLAELWGVYYGMCIAWDKGIRKLEVEVDSKSVVGFLKTGIH  138

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLAN  312
                 S + + C    +    V   H  RE N+  + LAN
Sbjct  139  DSHPLSFLVRLCYGFVSRDWIVNISHVYREANRLADGLAN  178



>gb|AAF79490.1|AC022492_34 F1L3.4 [Arabidopsis thaliana]
Length=253

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 50/100 (50%), Gaps = 0/100 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G   +GF  NIGI ++  AELWG   GL +A +RG+ ++  E+DSE VV  +     
Sbjct  116  DGDGNWCYGFSLNIGICSAPLAELWGAYYGLNIAWERGVTQLEMEIDSEMVVGFLRTGID  175

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLAN  312
                 S + + C  L +    V   H  RE N+  + LAN
Sbjct  176  DSHPLSFLVRLCHGLLSKDWSVRISHVYREANRLADGLAN  215



>ref|XP_008341993.1| PREDICTED: uncharacterized protein LOC103404803 [Malus domestica]
Length=1433

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 34/111 (31%), Positives = 51/111 (46%), Gaps = 0/111 (0%)
 Frame = +1

Query  4     LTWDHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSG  183
             L  + +G+ + GF  N+G      AELWG+  GL +A D G R V+ E DS   V S+  
Sbjct  1293  LIRNSEGDWIXGFAANLGRGTXMEAELWGVLMGLTIAWDEGXRDVILECDSWDAVISIQK  1352

Query  184   DKIAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWG  336
               +      ++  DC+            H  RE N   +H+A+LG   + G
Sbjct  1353  PMLVSHPLYNLILDCKEAIERNWRCEVTHIYREKNASADHMADLGHGLSLG  1403



>ref|XP_009805051.1| PREDICTED: uncharacterized protein LOC104250178 [Nicotiana sylvestris]
Length=222

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 52/106 (49%), Gaps = 3/106 (3%)
 Frame = +1

Query  1    DLTWDHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMS  180
            DL  +   E + GF T+I   +   AE + L +GL+LA DR L  +  E+DS   +  ++
Sbjct  73   DLIRNANAEWVIGFATSITAESPTTAETYALMQGLQLALDRNLLPLEVEVDSRDSLRLLT  132

Query  181  GDKIAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLG  318
              K   +  +++  DCR+L   +   I  H  RE N   + LA  G
Sbjct  133  STK---DIPNNLISDCRYLLDRLGKPIVMHAYREQNGVADKLAKEG  175



>ref|XP_007028211.1| Uncharacterized protein TCM_023790 [Theobroma cacao]
 gb|EOY08713.1| Uncharacterized protein TCM_023790 [Theobroma cacao]
Length=149

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 55/109 (50%), Gaps = 13/109 (12%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            DH    LFGF  N+G+ NS   EL  L +GL L ++  + R+  E+D+  V+      ++
Sbjct  43   DHASIMLFGFSENLGVKNSLQVELLALYRGLVLCREYNITRLWIEMDAMVVI------RL  96

Query  193  AEECSSSIFKDCRFLATSMEHVI------FRHTLREGNKCVNHLANLGQ  321
             +E    ++ D R+L  ++  ++        H  REGN+  + L N+G 
Sbjct  97   LQENYRGLY-DIRYLLVTIRQLLSQFFFCISHIYREGNQAADLLVNMGH  144



>dbj|BAB09815.1| non-LTR retroelement reverse transcriptase-like [Arabidopsis 
thaliana]
Length=676

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 46/134 (34%), Positives = 64/134 (48%), Gaps = 0/134 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G  L GF  NIG+ ++  AELWG+  GL +A +RG RRV  E+DS  VV  +     
Sbjct  539  DEHGSWLVGFALNIGVCSAPLAELWGVYYGLVVAWERGWRRVRLEVDSALVVGFLQSGIG  598

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWGSTCldlpplsln  372
                 + + + C    +    V   H  RE N+  + LAN   T  +G   LD  P  ++
Sbjct  599  DSHPLAFLVRLCHGFISKDWIVRITHVYREANRLADGLANYAFTLPFGFLLLDSCPEHVS  658

Query  373  pllTADAFGTSTAR  414
             +L  D  GTS  R
Sbjct  659  SILLEDVMGTSFPR  672



>gb|AAF97302.1|AC007843_5 Hypothetical protein [Arabidopsis thaliana]
 gb|AAV68820.1| hypothetical protein AT1G17390 [Arabidopsis thaliana]
Length=272

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 50/100 (50%), Gaps = 0/100 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G   +GF  NIGI ++  AELWG   GL +A +RG+ ++  E+DSE VV  +     
Sbjct  135  DGDGNWCYGFSLNIGICSAPLAELWGAYYGLNIAWERGVTQLEMEIDSEMVVGFLRTGID  194

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLAN  312
                 S + + C  L +    V   H  RE N+  + LAN
Sbjct  195  DSHPLSFLVRLCHGLLSKDWSVRISHVYREANRLADGLAN  234



>ref|XP_002531381.1| nuclease, putative [Ricinus communis]
 gb|EEF31001.1| nuclease, putative [Ricinus communis]
Length=132

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 49/93 (53%), Gaps = 9/93 (10%)
 Frame = +1

Query  52   IGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSIFKDCR  231
            IG  NS    +WG   GL+L  + G+R+VV E+D++ VV  +S D      S ++ K   
Sbjct  17   IGSCNSLLPGMWGGWYGLKLGWEAGIRKVVLEVDNQLVVQQLSSDIYHRNYSLNMIK---  73

Query  232  FLATSMEHVIFRHTLREGNKCVNHLANLGQTAA  330
                    V  +   REGN+CV+ LA++G+  A
Sbjct  74   ------WTVQVKDVYREGNQCVDALASIGRNVA  100



>ref|XP_004966272.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Setaria 
italica]
Length=207

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 54/107 (50%), Gaps = 1/107 (1%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVV-ASMSGDK  189
            DH+G  + G+   IG + S  AEL  LR+GL LA   G R V  E D+++VV A  S  +
Sbjct  77   DHQGGFVLGYAERIGTATSSVAELAALRRGLELAVANGWRSVWIEGDAKTVVDAVRSRAR  136

Query  190  IAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAA  330
            +  E    +  +   L   ++ V   H  R+GN+  +  A LG  AA
Sbjct  137  VRAEEDRRLCGEIEALLPMIDDVSVSHVRRQGNRVAHGFAKLGHGAA  183



>ref|XP_007008705.1| Uncharacterized protein TCM_042331 [Theobroma cacao]
 gb|EOY17515.1| Uncharacterized protein TCM_042331 [Theobroma cacao]
Length=1176

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 56/109 (51%), Gaps = 13/109 (12%)
 Frame = +1

Query  13    DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
             DH G+ +FGF  NIG  NS   EL  L +GL L KD  + ++  E+D+ +V+  +   + 
Sbjct  1044  DHTGKLIFGFSENIGTYNSLQGELRALHRGLLLCKDCHIEKLWIEMDALAVIQLIPHSQK  1103

Query  193   AEECSSSIFKDCRFLATS----MEHVIFR--HTLREGNKCVNHLANLGQ  321
                       D R+L  S    + ++ +R  H  REGN+ V+ L+N G 
Sbjct  1104  GSH-------DIRYLLESIRKCLNNISYRILHIFREGNQTVDFLSNRGH  1145



>ref|XP_007147977.1| hypothetical protein PHAVU_006G170300g [Phaseolus vulgaris]
 gb|ESW19971.1| hypothetical protein PHAVU_006G170300g [Phaseolus vulgaris]
Length=793

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 58/112 (52%), Gaps = 0/112 (0%)
 Frame = +1

Query  4    LTWDHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSG  183
            L  D +G  L GF  N+G ++   AELWG+  GLRLA D G ++V  ++DS   +  +  
Sbjct  652  LVRDSEGCFLGGFGVNLGSTSVTLAELWGVVHGLRLAWDLGCKKVKVDIDSGHALGLVRH  711

Query  184  DKIAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWGS  339
              +  + + ++ ++   L      V F H  RE N+  + LA+LG + +  S
Sbjct  712  CPVGSDPAFAVVREINELVRKDWLVEFSHVFRESNRAADRLAHLGHSHSLDS  763



>ref|XP_009120305.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=308

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 56/108 (52%), Gaps = 0/108 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D +GE   GF  NIG  ++  AELWG+  GL +A ++G+RR+  E+DS+ VV  ++    
Sbjct  171  DGEGEWCGGFALNIGRCSAPLAELWGVYYGLVIAWEKGIRRLEVEVDSKMVVGFLTTGIE  230

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWG  336
                 S + + C    T    V   H  RE N+  + LANL  +  +G
Sbjct  231  DTHPLSFLVRLCHGFLTRDWLVRIVHVYREANRLADGLANLAFSLPFG  278



>gb|EEE66235.1| hypothetical protein OsJ_22399 [Oryza sativa Japonica Group]
Length=192

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 55/108 (51%), Gaps = 5/108 (5%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            DH G  L G+   IG + S  AEL  LR+GL LA   G RRV  E DS++VV  +  D+ 
Sbjct  76   DHDGAFLLGYAERIGTATSSVAELAALRRGLELAVRNGWRRVWAEGDSKAVVDVVC-DR-  133

Query  193  AEECSSSIFKDCRFLA---TSMEHVIFRHTLREGNKCVNHLANLGQTA  327
            A+  S    + CR +A     ++ +   H  R GNK  +  A LG  A
Sbjct  134  ADVQSEEDLRLCREIAALLPQLDDMAVSHVRRGGNKVAHGFAELGHRA  181



>gb|KHN15930.1| Putative ribonuclease H protein [Glycine soja]
Length=159

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 66/132 (50%), Gaps = 10/132 (8%)
 Frame = +1

Query  37   GFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGD-KIAEECSSS  213
            GF+ + G + S  AEL  +  GL++A+D G+ R++ E D +  +  ++G+  +  +   +
Sbjct  32   GFMGSCGFTTSVHAELLSIYHGLKIARDIGIGRLICESDLKVALDLITGEINMFHQYFPT  91

Query  214  IFKDCRFLATSMEH----VIFRHTLREGNKCVNHLANLGQTAAWGSTCldlpplslnpll  381
            I      L  S++H    V F H  REGNKC +  A  G ++  G   LD  P  +    
Sbjct  92   I-----MLIHSLKHMDWEVTFVHVYREGNKCADWFAKTGNSSQQGMIILDHRPSPIYQAY  146

Query  382  TADAFGTSTARV  417
              DA G +T R+
Sbjct  147  LGDAMGVTTQRM  158



>gb|EEC81198.1| hypothetical protein OsI_24213 [Oryza sativa Indica Group]
Length=206

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 55/109 (50%), Gaps = 5/109 (5%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            DH G  L G+   IG + S  AEL  LR+GL LA   G RRV  E DS++VV  +  D+ 
Sbjct  76   DHDGAFLLGYAERIGTATSSVAELAALRRGLELAVRNGWRRVWAEGDSKAVVDVVC-DR-  133

Query  193  AEECSSSIFKDCRFLA---TSMEHVIFRHTLREGNKCVNHLANLGQTAA  330
            A+  S    + CR +A     ++ +   H  R GNK  +  A LG   A
Sbjct  134  ADVQSEEDLRLCREIAALLPQLDDMAVSHVRRGGNKVAHGFAELGHRTA  182



>gb|AFK34478.1| unknown [Lotus japonicus]
Length=178

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 59/110 (54%), Gaps = 4/110 (4%)
 Frame = +1

Query  13   DHKGE*LFGFITNIG---ISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASM-S  180
            DH+G+ L GF + +    +++ F AE   LR  LRLA D+G R++  E D  ++V+++  
Sbjct  43   DHRGKWLGGFYSKVPDNPLASPFMAEACALRDVLRLAWDQGHRKIRCETDCANLVSTLED  102

Query  181  GDKIAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAA  330
            GD +    + S+    + L T    V      RE NK V++LA LG  AA
Sbjct  103  GDNLHLHSAYSVLFSIKELLTRNWLVTLNVISRECNKAVDYLAKLGAAAA  152



>ref|XP_009797103.1| PREDICTED: uncharacterized protein LOC104243590 [Nicotiana sylvestris]
Length=194

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 55/108 (51%), Gaps = 2/108 (2%)
 Frame = +1

Query  22   GE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEE  201
            G+ + GF   I   NS  AEL  L+ GL LA ++ L  +  + DS  ++  +  + I+  
Sbjct  62   GDWIIGFFNRIKAHNSTHAELQALQAGLNLAYEQRLAPLEIDTDSTDIIKLLQHN-ISPV  120

Query  202  CSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWGSTC  345
             +++I  +CR+L   + + + RH+ REGNK  + L   G      ST 
Sbjct  121  YTNTIL-ECRYLLKKLGNPVIRHSFREGNKVAHLLCKWGSKHHLSSTA  167



>ref|XP_008373258.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=206

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            + KGE +  +   IG +     E   L  GL +AK +GL R+V E DS+ V+ S+SG   
Sbjct  69   NEKGECIVAWARFIGQNTISVVECLALWDGLWMAKAKGLARIVVEGDSKLVIESISGAYN  128

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLG  318
                  SI +D R+LA   E + ++H  RE N   + + ++G
Sbjct  129  PFWRLKSILEDIRWLAGFFEDICWKHVFREANFLADAITSVG  170



>ref|XP_007050978.1| Uncharacterized protein TCM_004691 [Theobroma cacao]
 gb|EOX95135.1| Uncharacterized protein TCM_004691 [Theobroma cacao]
Length=240

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 47/101 (47%), Gaps = 1/101 (1%)
 Frame = +1

Query  19   KGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAE  198
            +G   FGF    G  NS  AEL  L +GL L +D G+ RV  E+D+  V+  +       
Sbjct  107  QGHWCFGFSEKFGAKNSILAELLALHRGLILCRDYGISRVWIEMDAMVVIQMLKKGHHGS  166

Query  199  ECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQ  321
              S  +      L T   + I  H  REGN+  + LANLG 
Sbjct  167  HDSRYVLASINKLLTQFSYRI-SHIPREGNQATDLLANLGH  206



>ref|XP_008245516.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=203

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 49/101 (49%), Gaps = 1/101 (1%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G+ + GF  N+GI  +  AELWGL  GL+LA  +G+ R+  E+DS + V  +     
Sbjct  64   DSFGDWMGGFAVNLGIGQTLDAELWGLFFGLKLAVAKGVARLSIEMDSMTAVQLIKQHVP  123

Query  193  A-EECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLAN  312
            +     + +   C  L    E V   H  RE N   + LAN
Sbjct  124  SCHHPCAGVIASCVALMRKFESVELTHVYRERNVAADCLAN  164



>ref|XP_007020288.1| Uncharacterized protein TCM_036737 [Theobroma cacao]
 gb|EOY17513.1| Uncharacterized protein TCM_036737 [Theobroma cacao]
Length=2215

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 38/110 (35%), Positives = 55/110 (50%), Gaps = 13/110 (12%)
 Frame = +1

Query  13    DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
             DH G  +FGF  N G  +S  AEL  L +GL L  +  + R+  E+D++  V  +   K 
Sbjct  2082  DHTGSMIFGFSENFGPQDSLQAELMALHRGLLLCIEHNISRLWIEMDAKVAVQMI---KE  2138

Query  193   AEECSSSIFKDCRFLATSMEHVI----FR--HTLREGNKCVNHLANLGQT  324
               + SS      R+L  S+   +    FR  H  REGN+  +HL+N G T
Sbjct  2139  GHQGSSRT----RYLLASIHRCLSGISFRISHIFREGNQAADHLSNQGHT  2184



>ref|XP_009124321.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=262

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 54/106 (51%), Gaps = 0/106 (0%)
 Frame = +1

Query  19   KGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAE  198
            +GE   GF  NIG   +  AELWG+  GL +A ++G+RR+  E+DS  V+  ++      
Sbjct  125  EGEWCGGFAINIGSCTAPLAELWGVYYGLVVAWEKGVRRLEVEVDSMMVMEFLTIGIGDT  184

Query  199  ECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWG  336
               S + + C    T    V F H  RE N+  + LANL  T  +G
Sbjct  185  HPLSFLVRLCHGFLTRDWLVRFVHVYREANRLADGLANLAFTLPFG  230



>ref|XP_008244843.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=390

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 50/103 (49%), Gaps = 0/103 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D +G  L     NIG ++   AE   LR GL  A DRG  ++V E D + V+ S+ G   
Sbjct  281  DCEGHVLVAASNNIGKNSINVAECLALRDGLAAALDRGWDQIVIEWDCKLVIDSILGKAD  340

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQ  321
               C   I +D   L++    + F+H  RE N  V+ +A LG 
Sbjct  341  PPWCIKQIIQDIWALSSFATSIRFQHVFREANFTVDTVAKLGH  383



>ref|XP_008383853.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=204

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 52/105 (50%), Gaps = 2/105 (2%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            +HK E L GF  +IG +NS  AEL  L++GL L  + G R V  E D+++++  +   K 
Sbjct  67   NHKAEFLLGFAESIGEANSTIAELXALKRGLELVLENGFRDVWLEGDAKALLDIIVKRKK  126

Query  193  AEECS--SSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQ  321
              +C+       D   +   +   I  H  REGN+  +  A +G 
Sbjct  127  DFKCAEVQRQVNDVNSILPKLNGCIVSHVYREGNRAADKFAQIGH  171



>ref|XP_004309343.2| PREDICTED: uncharacterized protein LOC101295189 [Fragaria vesca 
subsp. vesca]
Length=192

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  16   HKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIA  195
              G  L    +N GI+    AE   LR  L  AK+RGL RV  E DS+ V+ +++G   +
Sbjct  56   PNGNPLVAASSNFGITTISVAEALSLRNSLICAKERGLSRVEVEGDSKLVIDAVNGIAAS  115

Query  196  EECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQ  321
                  + ++ R L  S + + F+H  RE N   N +AN+G 
Sbjct  116  PWRILKLVQEIRCLRNSFDFISFKHIFREANFVANAVANVGH  157



>ref|XP_008441930.1| PREDICTED: putative ribonuclease H protein At1g65750 [Cucumis 
melo]
Length=204

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 55/105 (52%), Gaps = 3/105 (3%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            DHK + L G+   IG +NS  AEL  L KGL L  + G + V  E D + +V  ++ +K 
Sbjct  68   DHKAQFLLGYAEAIGRANSAMAELTALTKGLELVLENGWKDVWVEGDDKGLVEILADNKE  127

Query  193  AEEC--SSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQ  321
              +C  + S F+  + L   +++    H  REGNK  +  A++G 
Sbjct  128  V-KCVETRSYFRYIKSLILDLDNCKVSHIYREGNKVADRFASIGH  171



>ref|XP_008371252.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=212

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 45/95 (47%), Gaps = 0/95 (0%)
 Frame = +1

Query  37   GFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSI  216
            GF  NIG+ +   AELWGL  GL LA   G R+V+ ELDS   V  +     +    + +
Sbjct  83   GFTINIGVGSVLNAELWGLYHGLTLAWRLGYRKVLVELDSVMAVTLIMDFNSSMHPLAHL  142

Query  217  FKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQ  321
               CR L          H  RE N+ V+ +A LG 
Sbjct  143  ITACRELLRKDWICSVSHVYREKNRVVDGMAALGH  177



>ref|XP_007226764.1| hypothetical protein PRUPE_ppa018732mg [Prunus persica]
 gb|EMJ27963.1| hypothetical protein PRUPE_ppa018732mg [Prunus persica]
Length=430

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/101 (31%), Positives = 54/101 (53%), Gaps = 0/101 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D+KG+ +  F++     + F  ELW + +GL LA   G++ +  E DSESVV +++ D+ 
Sbjct  296  DYKGDPICAFVSKALGDDIFLVELWAIWRGLVLALSLGIKVIWVESDSESVVQTINRDRP  355

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANL  315
              + +SS  K    L    +     H+ RE N+  +HL+ +
Sbjct  356  YSQKASSCLKHIWELLNKFDKHQVSHSWRETNRAADHLSKM  396



>ref|XP_007026458.1| Uncharacterized protein TCM_021522 [Theobroma cacao]
 gb|EOY06960.1| Uncharacterized protein TCM_021522 [Theobroma cacao]
Length=3503

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 38/110 (35%), Positives = 55/110 (50%), Gaps = 13/110 (12%)
 Frame = +1

Query  13    DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
             DH G  +FGF  N G  +S  AEL  L +GL L  D  + R+  E+D++  V  ++    
Sbjct  3370  DHTGSMIFGFSENFGSQDSLQAELMALHRGLLLCIDHNVTRLWIEMDAKVAVQMINE---  3426

Query  193   AEECSSSIFKDCRFLATSMEHVI----FR--HTLREGNKCVNHLANLGQT  324
               + SS      R+L  S+   +    FR  H  REGN+  +HL+N G T
Sbjct  3427  GHQGSSRT----RYLLASIHRCLSGISFRISHIFREGNQAADHLSNQGYT  3472



>ref|XP_002524970.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37467.1| conserved hypothetical protein [Ricinus communis]
Length=132

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 49/105 (47%), Gaps = 0/105 (0%)
 Frame = +1

Query  31   LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSS  210
            + GF+ NIG  +   A LWGL  GL LA   G+R+++ ++DS   V  ++G+K      +
Sbjct  7    IHGFVVNIGRCSITGAGLWGLYHGLTLAWKLGIRKLLVKVDSMCAVPLVTGEKDISSSYA  66

Query  211  SIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWGSTC  345
             +    R +      V   H  RE N   + LA+     +  S C
Sbjct  67   PLVSGIRSMLGQNWQVSVSHVYREANFAADGLASFADHPSPASGC  111



>ref|XP_006599770.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=289

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 66/132 (50%), Gaps = 10/132 (8%)
 Frame = +1

Query  37   GFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGD-KIAEECSSS  213
            GF+ + G + S  AEL  +  GL++A+D G+ R++ E D +  +  ++G+  +  +   +
Sbjct  162  GFMGSCGFTTSVHAELLAIYHGLKIARDIGIGRLICESDLKVALDLITGEINMFHQYFPT  221

Query  214  IFKDCRFLATSMEH----VIFRHTLREGNKCVNHLANLGQTAAWGSTCldlpplslnpll  381
            I      L  S++H    V F H  REGNKC +  A  G ++  G   LD  P  +    
Sbjct  222  I-----MLIHSLKHMDWEVTFVHVYREGNKCADWFAKTGNSSQQGMIILDHRPSPIYQAY  276

Query  382  TADAFGTSTARV  417
              DA G +T R+
Sbjct  277  LGDAMGVTTQRM  288



>ref|XP_009151561.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1204

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 56/108 (52%), Gaps = 0/108 (0%)
 Frame = +1

Query  13    DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
             D +GE   GF  NIG  ++  AELWG+  GL +A ++G+RR+  E+DS+ VV  ++    
Sbjct  1067  DGEGEWCGGFALNIGRCSAPLAELWGVYYGLVIAWEKGIRRLEVEVDSKMVVGFLTTGIE  1126

Query  193   AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWG  336
                  S + + C    T    V   H  RE N+  + LANL  +  +G
Sbjct  1127  DTHPLSFLVRLCHGFLTRDWLVRIVHVYREANRLADGLANLAISLPFG  1174



>ref|XP_004490492.1| PREDICTED: uncharacterized protein LOC101492718 [Cicer arietinum]
Length=375

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 51/102 (50%), Gaps = 7/102 (7%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVAS---MSG  183
            DH+GE + GF++     + F  ELW + +GL L+   G++ +  E DS SVV +   M  
Sbjct  276  DHRGEPICGFVSKAPQGDIFLVELWAIWRGLVLSFGLGIKSIWVESDSMSVVKTINKMQP  335

Query  184  DKIAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLA  309
               AE C   I+K    L +  E     H+ RE N+  +HL 
Sbjct  336  CPKAESCLEKIWK----LLSKFEKYRISHSWRETNRAADHLV  373



>ref|WP_002973332.1| ribonuclease HI [Leptospira terpstrae]
 gb|EMY61991.1| ribonuclease HI [Leptospira terpstrae serovar Hualin str. LT 
11-33 = ATCC 700639]
Length=137

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 51/106 (48%), Gaps = 1/106 (1%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D+ G   F     IG + +  AE   L +G+  A  + L+++ F LDSE VV  M G+  
Sbjct  30   DNDGIEFFFLSEKIGNATNNVAEWQALHRGMEEAIKKNLQKIKFRLDSELVVKQMKGEYK  89

Query  193  AEECSSSIFK-DCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTA  327
             +     +FK  C  L +S +    ++  RE N   + LANL Q A
Sbjct  90   VKNKDLLVFKTKCESLKSSFQQFDIQYIPREQNTRADQLANLAQDA  135



>ref|XP_007019466.1| Polynucleotidyl transferase, putative [Theobroma cacao]
 gb|EOY16691.1| Polynucleotidyl transferase, putative [Theobroma cacao]
Length=389

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 51/97 (53%), Gaps = 2/97 (2%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D KGE + GFI  IGI+ S  AELW L +GL L   RG R+V  E DS   +  +  +  
Sbjct  294  DDKGEWMLGFIHKIGITFSLNAELWALLQGLNLCWRRGFRKVQVESDSFLAIQKLLMESN  353

Query  193  AEECSSSIFKDCR-FLATSMEHVIFRHTLREGNKCVN  300
              E +  + ++ +  L    ++ IF +   E N+CV+
Sbjct  354  TLEPNVHLLRNIKELLLWDWDYRIF-YIPHEANQCVD  389



>ref|XP_008220870.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=264

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 51/94 (54%), Gaps = 1/94 (1%)
 Frame = +1

Query  37   GFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMS-GDKIAEECSSS  213
            GF+ N+G      AELWGL  GL+LA  +G+++++ E+DS + +  +   + +     + 
Sbjct  133  GFVVNLGQGQILEAELWGLFFGLKLAIGKGVKKLLVEMDSATTIRLIQCKESLEAHPLAG  192

Query  214  IFKDCRFLATSMEHVIFRHTLREGNKCVNHLANL  315
            +   CR + + ++ V   H  RE N   + LANL
Sbjct  193  LLDCCREMLSQLDCVEVHHIFREKNFAADCLANL  226



>dbj|BAE71259.1| hypothetical protein [Trifolium pratense]
Length=553

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 31/100 (31%), Positives = 49/100 (49%), Gaps = 0/100 (0%)
 Frame = +1

Query  19   KGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAE  198
            +GE L GF   +G  ++  AELWG+ +GL  A+  G   V   +DS  VV ++   + + 
Sbjct  418  QGEWLGGFARGLGNCSAIIAELWGVAEGLSYARRLGFTAVELNVDSVVVVQAIKTGRFSS  477

Query  199  ECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLG  318
                 + K  R +      +   H  RE NKC + +AN+G
Sbjct  478  SVGLPLVKHIRRMLDLDWEIKIEHAYRESNKCADAMANIG  517



>ref|XP_009144970.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=448

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 50/100 (50%), Gaps = 0/100 (0%)
 Frame = +1

Query  37   GFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSI  216
            GF  NIGI ++  AELWG+  G+ +A +RG RRV  E+DSESVV  +          S +
Sbjct  319  GFALNIGICSARMAELWGVYYGMCIAWERGFRRVELEVDSESVVGFLRTGINDSHPLSFL  378

Query  217  FKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWG  336
             + C    +    V   H  RE N   + LA    + ++G
Sbjct  379  VRLCYGFISRDWIVKISHVYREANHLADGLATYAFSLSFG  418



>gb|EYU27884.1| hypothetical protein MIMGU_mgv1a013877mg [Erythranthe guttata]
Length=208

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 53/104 (51%), Gaps = 1/104 (1%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            DH  + L G+  +IG SNS  AEL  L +GL + ++ G   V  E DS+S+V  ++G + 
Sbjct  72   DHNADFLLGYAESIGQSNSTIAELAALLRGLEIVRENGWSDVWLEGDSKSLVDIIAGKRE  131

Query  193  AEECSSSIFKD-CRFLATSMEHVIFRHTLREGNKCVNHLANLGQ  321
             +     +  D    +   +++ I  H  REGN+  +  A +G 
Sbjct  132  VKCTQVQMHVDRINLIVPEIKNCIITHIYREGNRAADKFALIGH  175



>ref|XP_009123770.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=532

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 54/106 (51%), Gaps = 0/106 (0%)
 Frame = +1

Query  19   KGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAE  198
            +GE   GF  NIG   +  AELWG+  GL +A ++G+RR+  E+DS  V+  ++      
Sbjct  395  EGEWCGGFAINIGSCTAPLAELWGVYYGLVVAWEKGVRRLEVEVDSMMVMEFLTIGIGDT  454

Query  199  ECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWG  336
               S + + C    T    V F H  RE N+  + LANL  T  +G
Sbjct  455  HPLSFLVRLCHGFLTRDWLVRFVHVYREANRLADGLANLAFTLPFG  500



>gb|AFK45241.1| unknown [Lotus japonicus]
Length=165

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 48/103 (47%), Gaps = 2/103 (2%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMS-GDK  189
            DH G  L GF   +G+ +   AELWGL  GLR    RG  +++ E DS   +  ++ G  
Sbjct  60   DHHGNFLLGFTMKVGVCSILHAELWGLVHGLRFVLGRGFSKILIEADSAGTIEFLNKGCP  119

Query  190  IAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLG  318
            +   C   + ++   L     ++ ++H  RE N   +  A  G
Sbjct  120  VVHPC-FPLVREFHHLVGQNCYIHWKHVYREVNFVADSFAKNG  161



>ref|XP_008244240.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=172

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 47/86 (55%), Gaps = 4/86 (5%)
 Frame = +1

Query  4    LTWDHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSG  183
            + WD  G+ + GF  N+G+     AELWG+  GL+LA D G   VV E DS + V  ++ 
Sbjct  54   VLWDSSGQWMRGFAVNLGVGQVLEAELWGIYLGLKLAWDIGCSAVVLESDSATAVHLLNK  113

Query  184  DKIAEECS-SSIFKDCRFLATSMEHV  258
            + +   CS   ++++C  +A  +  +
Sbjct  114  NWV---CSIHHVYRECNMVADKLAEL  136



>gb|EEC73643.1| hypothetical protein OsI_08164 [Oryza sativa Indica Group]
 gb|EEE57417.1| hypothetical protein OsJ_07612 [Oryza sativa Japonica Group]
Length=204

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 54/108 (50%), Gaps = 5/108 (5%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            DH+G  + G+   IG + S  AEL  LR+GL L    G RRV  E DS++VV  +  D+ 
Sbjct  74   DHEGAFVLGYAERIGRATSSVAELAALRRGLELVVRNGWRRVWAEGDSKTVV-DVVCDR-  131

Query  193  AEECSSSIFKDCRFLATSM---EHVIFRHTLREGNKCVNHLANLGQTA  327
            A   S    + CR +A  +   + +   H  R GNK  +  A LG  A
Sbjct  132  ANVRSEEDLRQCREIAALLPLIDDMAVSHVYRSGNKVAHGFARLGHKA  179



>ref|XP_007010351.1| Polynucleotidyl transferase, putative [Theobroma cacao]
 gb|EOY19161.1| Polynucleotidyl transferase, putative [Theobroma cacao]
Length=419

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 50/105 (48%), Gaps = 4/105 (4%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G  + GF   IGI+ S  AE WG+ +GL L  +RGLR+   E+DS   +  +     
Sbjct  284  DEYGNWIAGFCQKIGITFSLTAEPWGIYQGLTLCWNRGLRKFCVEIDSMLALQKIYSQSS  343

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVN----HLANL  315
              + ++ + +  + L      V   H  RE ++C +    H+ NL
Sbjct  344  MLDPNAQLLRRIKELLQQSWDVTISHVHREADQCTDWMTTHIENL  388



>gb|AAG12669.1|AC027033_4 hypothetical protein; 81517-79153 [Arabidopsis thaliana]
Length=256

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 65/143 (45%), Gaps = 16/143 (11%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMS---G  183
            +H+G    GF  +IGI ++  AELWG+  GL +A ++ + RV  E+DSE VV  +    G
Sbjct  38   EHQGNWCGGFSVSIGICSAPQAELWGVYYGLYIAWEKWVTRVELEVDSEIVVGFLKTGIG  97

Query  184  DK-----IAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWGSTCl  348
            D      +A  C   I KD          V   H  RE N+  + LAN   T   G    
Sbjct  98   DSHPLSFLARLCYGFISKDWI--------VRISHVYREANRLADGLANYAFTLPLGFHFF  149

Query  349  dlpplslnpllTADAFGTSTARV  417
               P  ++ +   D  GTS  R+
Sbjct  150  HSSPDVVDSVRLEDTSGTSCPRL  172



>dbj|BAD23746.1| hypothetical protein [Oryza sativa Japonica Group]
Length=212

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 54/108 (50%), Gaps = 5/108 (5%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            DH+G  + G+   IG + S  AEL  LR+GL L    G RRV  E DS++VV  +  D+ 
Sbjct  82   DHEGAFVLGYAERIGRATSSVAELAALRRGLELVVRNGWRRVWAEGDSKTVV-DVVCDR-  139

Query  193  AEECSSSIFKDCRFLATSM---EHVIFRHTLREGNKCVNHLANLGQTA  327
            A   S    + CR +A  +   + +   H  R GNK  +  A LG  A
Sbjct  140  ANVRSEEDLRQCREIAALLPLIDDMAVSHVYRSGNKVAHGFARLGHKA  187



>ref|XP_008222990.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=346

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 44/92 (48%), Gaps = 1/92 (1%)
 Frame = +1

Query  37   GFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSG-DKIAEECSSS  213
            GF  N+G      AELWGL  GLR+A  +G   ++FE+DS   +  +   D +     +S
Sbjct  215  GFAVNLGKGQILEAELWGLFFGLRMAVAKGFNNLIFEMDSVVAIQLVQQHDSLTLHPLAS  274

Query  214  IFKDCRFLATSMEHVIFRHTLREGNKCVNHLA  309
            +   C  L   +E+    H  RE N   + LA
Sbjct  275  LVSSCWQLMQQLENCSLHHIFREKNSVADRLA  306



>ref|XP_009124780.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=332

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 53/106 (50%), Gaps = 0/106 (0%)
 Frame = +1

Query  19   KGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAE  198
            +GE   GF  NIG   +  AELWG+  GL +A ++G+RR+  E+DS  V+  ++      
Sbjct  195  EGEWCGGFAINIGSCTAPLAELWGVYYGLVVAWEKGVRRLEVEVDSMMVMEFLTIGIGDT  254

Query  199  ECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWG  336
               S + + C    T    V F H  RE N+  + LAN   T  +G
Sbjct  255  HPLSFLVRLCHGFLTRDWLVRFVHVYREANRLADGLANFAFTLPFG  300



>ref|XP_002524436.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF37876.1| nucleic acid binding protein, putative [Ricinus communis]
Length=101

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 42/79 (53%), Gaps = 0/79 (0%)
 Frame = +1

Query  76   AELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSIFKDCRFLATSMEH  255
            AE W   +GL+LA + G R ++ E+DS+ V   ++ D+      S++   CR L     +
Sbjct  2    AECWAACEGLKLAWNMGYRELIVEVDSKLVAGWLNADQTCMNDCSNLIYACRELIRKDWN  61

Query  256  VIFRHTLREGNKCVNHLAN  312
            V  RH  REGN   + LAN
Sbjct  62   VDVRHVFREGNMIADSLAN  80



>ref|XP_008372289.1| PREDICTED: uncharacterized protein LOC103435668 [Malus domestica]
Length=210

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 45/83 (54%), Gaps = 0/83 (0%)
 Frame = +1

Query  70   FAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSIFKDCRFLATSM  249
            F AE  GLR+GL+ A+ +G  +V+ + DS+ ++  + G        SSI  D R L  S 
Sbjct  125  FVAEAMGLREGLQCARRKGFTKVMVDEDSKLIIEIVQGHWGXPWRVSSIINDIRILTRSF  184

Query  250  EHVIFRHTLREGNKCVNHLANLG  318
             HV ++H  +E     + LA+LG
Sbjct  185  SHVNWKHIFKEATLVADALAHLG  207



>ref|WP_040826687.1| hypothetical protein, partial [Thermaerobacter subterraneus]
Length=139

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 46/90 (51%), Gaps = 1/90 (1%)
 Frame = +1

Query  52   IGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGD-KIAEECSSSIFKDC  228
            IG + +  AE   L  GL+ A DRG RR+    DSE +V  ++G  ++  E    +F+  
Sbjct  35   IGAATNNVAEYTALITGLQRALDRGARRLDVYSDSELMVRQLNGQYRVKNEGLKPLFEQA  94

Query  229  RFLATSMEHVIFRHTLREGNKCVNHLANLG  318
              LA   E V F H  RE N+  + LAN G
Sbjct  95   ARLAAQFERVRFIHVPRERNREADRLANQG  124



>ref|XP_008237302.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=394

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 46/100 (46%), Gaps = 1/100 (1%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSG-DK  189
            D  G+   GF  N+G      AELWGL  GLR+A  +G   ++ E+DS   +  +   D 
Sbjct  255  DVSGDWCSGFAINLGKGQILEAELWGLFFGLRMAIAKGFNNLIVEMDSAVAIQLVQQHDS  314

Query  190  IAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLA  309
            +     +S+   C  L   +E    RH  RE N   + LA
Sbjct  315  LTVHPLASLVSSCWQLMQQLEKCSMRHIFREKNSVADRLA  354



>ref|XP_009619020.1| PREDICTED: uncharacterized protein LOC104111114 [Nicotiana tomentosiformis]
Length=187

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 56/102 (55%), Gaps = 3/102 (3%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            +++G+ + GF+  +  ++S  AEL  L  G ++A D+GL  +V + DSE ++  +    +
Sbjct  62   NNRGDWVLGFMGGLTNTDSLRAELQALWMGRKIALDQGLSPIVIDTDSEVMLKMLKHGNL  121

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLG  318
                 + I  +CR++   + +++  H+ RE N+  + LA  G
Sbjct  122  TH---NPIISECRYVIEQLVNLVIGHSYREQNQVADLLAKEG  160



>ref|XP_010694338.1| PREDICTED: uncharacterized protein LOC104907148 [Beta vulgaris 
subsp. vulgaris]
Length=200

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 47/102 (46%), Gaps = 0/102 (0%)
 Frame = +1

Query  16   HKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIA  195
            H G+       N+G  +   AE   L +GLRLA   GL+ ++ E D+  V+ S+      
Sbjct  65   HDGQFFRASTFNLGQYSVIIAEATALHQGLRLAVSLGLQNIIIEGDNLLVIKSIQNVWPT  124

Query  196  EECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQ  321
                ++I  DC+ L T       RH  RE N+  + + N+G 
Sbjct  125  PWKIANIIADCKILLTHFAKYEIRHVFREANRAADRITNVGH  166



>ref|XP_006851004.1| hypothetical protein AMTR_s00025p00218070 [Amborella trichopoda]
 gb|ERN12585.1| hypothetical protein AMTR_s00025p00218070 [Amborella trichopoda]
Length=313

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/105 (29%), Positives = 58/105 (55%), Gaps = 1/105 (1%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            +H+G+ L  F ++ G + + AAE   L +G++L K+ G ++++ E DS  +V  ++   +
Sbjct  168  NHQGKWLIAFASHYGTTTNVAAEFRALYEGVKLCKEEGYKKIILESDSMMLVDVITHKMV  227

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTA  327
                  + ++    L  + E  I  HTLREGN   + LA++G+ +
Sbjct  228  VPWQVWTWWESFWMLVENYEWSI-THTLREGNSAADFLASMGKNS  271



>ref|XP_004309278.1| PREDICTED: uncharacterized protein LOC101298847, partial [Fragaria 
vesca subsp. vesca]
Length=128

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 44/91 (48%), Gaps = 0/91 (0%)
 Frame = +1

Query  49   NIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSIFKDC  228
            N G +    AE   LR  L  AK RG  +V  E DS+ V+ +++G          + +D 
Sbjct  3    NAGSTTVPVAEALALRNSLIEAKRRGFTKVEIEGDSKLVLDAINGHSTPPWRIRKLCQDI  62

Query  229  RFLATSMEHVIFRHTLREGNKCVNHLANLGQ  321
            + L +S E V F+H  RE N   N  ANLG 
Sbjct  63   KALRSSFEFVSFKHVFREANFVANAFANLGH  93



>ref|XP_011463604.1| PREDICTED: uncharacterized protein LOC105351321 [Fragaria vesca 
subsp. vesca]
Length=256

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 45/91 (49%), Gaps = 0/91 (0%)
 Frame = +1

Query  49   NIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSIFKDC  228
            N G +    AE   LR GL  AK RG ++V  E DS+ V+  ++G          + +D 
Sbjct  131  NFGSTTVPVAEALSLRNGLIDAKRRGFKKVEVEGDSKLVIDVINGVSTPPRRLLKLCQDI  190

Query  229  RFLATSMEHVIFRHTLREGNKCVNHLANLGQ  321
            + L +S E + F+H  RE N   N +AN G 
Sbjct  191  KSLRSSFEFISFKHVFREANFVANAIANFGH  221



>ref|XP_007221027.1| hypothetical protein PRUPE_ppa014857mg, partial [Prunus persica]
 gb|EMJ22226.1| hypothetical protein PRUPE_ppa014857mg, partial [Prunus persica]
Length=183

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 51/101 (50%), Gaps = 1/101 (1%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSE-SVVASMSGDK  189
            D  G+ + GF  N+G      AE+WGL  GL+LA ++G+  +  E+DS  +V    +   
Sbjct  41   DSFGDWVSGFAVNLGKGQVLEAEIWGLFFGLKLAIEKGISNLTIEMDSAIAVNLCQNPSM  100

Query  190  IAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLAN  312
            +A    +++ ++C  L   +     +H  RE N   + LAN
Sbjct  101  LAMHPLAALVRNCCDLMQQVPRCALQHVFREMNIVADCLAN  141



>ref|XP_007028292.1| Uncharacterized protein TCM_023960 [Theobroma cacao]
 gb|EOY08794.1| Uncharacterized protein TCM_023960 [Theobroma cacao]
Length=303

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 55/111 (50%), Gaps = 15/111 (14%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASM-SGDK  189
            DH    +FGF  N G  +S  AEL  L +GL L  +  + RV  E+D++++V  +  G K
Sbjct  170  DHTSTMIFGFFENFGPYSSIQAELMALHRGLLLCNEYNISRVWIEMDAKAIVQMLHKGHK  229

Query  190  IAEECSSSIFKDCRFLATSMEHVI------FRHTLREGNKCVNHLANLGQT  324
             +           R+L +S+   +        H  R+GN+ V++L+N G T
Sbjct  230  GSSR--------TRYLLSSIHQCLSGISYRISHIHRQGNQAVDYLSNKGHT  272



>ref|XP_004309966.2| PREDICTED: uncharacterized protein LOC101295881 [Fragaria vesca 
subsp. vesca]
Length=325

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 56/107 (52%), Gaps = 2/107 (2%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            DH G+ L  F  N+GI+ +  AEL  +   +++A  RG R +  E DS  V+  +S  ++
Sbjct  190  DHLGQVLCCFSGNLGIATALEAELQAVIHAIQMASQRGWRSLWIESDSTLVIHFLSSFQV  249

Query  193  AEECS-SSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAA  330
                  ++ + +CR + TSM  V   H  REGN+  + LAN G   A
Sbjct  250  DVPWRFTTEWFNCRTILTSMT-VKVSHIYREGNRVADCLANFGADNA  295



>ref|XP_007018278.1| HVA22-like protein a, putative isoform 2 [Theobroma cacao]
 ref|XP_007018279.1| HVA22-like protein a, putative isoform 2 [Theobroma cacao]
 gb|EOY15503.1| HVA22-like protein a, putative isoform 2 [Theobroma cacao]
 gb|EOY15504.1| HVA22-like protein a, putative isoform 2 [Theobroma cacao]
Length=362

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/101 (31%), Positives = 52/101 (51%), Gaps = 0/101 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D+KG+ L  F++     + F  ELW + +GL LA   G++ +  E DS SVV +++ ++ 
Sbjct  228  DYKGDPLCAFVSKAPQDDIFLVELWAIWRGLVLASGLGIKVIWVESDSMSVVRTINREQF  287

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANL  315
                 S   K    L T  ++    H+ RE NK  +HL+ +
Sbjct  288  HGAKCSRCLKQIWKLLTMFDNYRVTHSWRETNKAADHLSRM  328



>ref|XP_007018277.1| HVA22-like protein a, putative isoform 1 [Theobroma cacao]
 gb|EOY15502.1| HVA22-like protein a, putative isoform 1 [Theobroma cacao]
Length=420

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/101 (31%), Positives = 52/101 (51%), Gaps = 0/101 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D+KG+ L  F++     + F  ELW + +GL LA   G++ +  E DS SVV +++ ++ 
Sbjct  286  DYKGDPLCAFVSKAPQDDIFLVELWAIWRGLVLASGLGIKVIWVESDSMSVVRTINREQF  345

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANL  315
                 S   K    L T  ++    H+ RE NK  +HL+ +
Sbjct  346  HGAKCSRCLKQIWKLLTMFDNYRVTHSWRETNKAADHLSRM  386



>gb|KJB82714.1| hypothetical protein B456_013G210500 [Gossypium raimondii]
Length=140

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 51/100 (51%), Gaps = 1/100 (1%)
 Frame = +1

Query  19   KGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAE  198
            KG  + G+   +G  + F AELWG+  GL L + +G   ++ + D+  VV ++S  K+ E
Sbjct  6    KGNWIVGYNRFLGKCSVFVAELWGILDGLLLIQKQGYNEIIIQFDNLEVVVTISDSKL-E  64

Query  199  ECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLG  318
               S++ +  + +  + E    R+  RE NK  + L  + 
Sbjct  65   RSKSTLVRQIQQILLNEEKWCLRYVPRETNKIAHALTKMA  104



>gb|KDP31341.1| hypothetical protein JCGZ_11717 [Jatropha curcas]
Length=581

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 37/120 (31%), Positives = 53/120 (44%), Gaps = 20/120 (17%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDS-------ESVVA  171
            D  G+ + G+  N+G  +   AELW +  GL LA DRG ++V+ E  S       + V  
Sbjct  443  DESGKWVIGYTLNLGSYSCLGAELWAVYHGLMLAWDRGFKKVLVESQSLESLEYLKRVPD  502

Query  172  SMSGDKIAEECSSSIFK---DCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWGST  342
             +  ++    C  ++ K   DC+FL          H  RE N C N LA   Q    G T
Sbjct  503  ELDPNRALATCCMNLIKRDWDCQFL----------HIHREANGCANWLATNFQDHPLGLT  552



>ref|XP_007039706.1| Non-LTR retroelement reverse transcriptase [Theobroma cacao]
 gb|EOY24207.1| Non-LTR retroelement reverse transcriptase [Theobroma cacao]
Length=391

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G  + G+   +  S+    ELWG  KGL+LA +RG R+V  + D++++V ++S   +
Sbjct  285  DAHGTWIVGYACKLETSSGLRVELWGFYKGLQLAWERGFRKVKLQSDNKAMVQAISFSSV  344

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLG  318
                +  + +  + +      V   H  RE N   + ++NLG
Sbjct  345  HPCSNLDLIRAIKGMLGRHWEVNISHIYREANTTADFMSNLG  386



>ref|XP_002524702.1| nuclease, putative [Ricinus communis]
 gb|EEF37721.1| nuclease, putative [Ricinus communis]
Length=201

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 51/104 (49%), Gaps = 1/104 (1%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASM-SGDK  189
            +HK E L G+  +IG S S  AEL  LR+GL L  + G   V  E D+++++  +    K
Sbjct  65   NHKAEFLLGYAESIGRSTSTIAELAALRRGLELVLENGWSNVWLEGDAKTLLEIIVKRRK  124

Query  190  IAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQ  321
            +          D   +   +++ I  H  REGN+  + LA +G 
Sbjct  125  VRCAQMQRHVSDINLIIPELDNCIVSHVYREGNRAADKLAQIGH  168



>ref|XP_006475107.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=246

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 48/99 (48%), Gaps = 0/99 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D++G    G+  N+G  +  +AELWGL  GL +A   G RRV+ E+DS+ ++  +S    
Sbjct  109  DYRGVWQIGYCANLGFCSVTSAELWGLFHGLSIAWLYGYRRVIVEVDSKCILQLVSSSNP  168

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLA  309
                  S+ K  + L      +   H  RE N   + LA
Sbjct  169  TINEHLSLIKAIQELIGRKWLIQMNHIYREANAAADFLA  207



>ref|XP_008220882.1| PREDICTED: uncharacterized protein LOC103320918 [Prunus mume]
Length=687

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 31/80 (39%), Positives = 44/80 (55%), Gaps = 10/80 (13%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G  + GF  NIGI N + AELW L +GL +  D+G+R +  E DS SVV+      I
Sbjct  609  DSNGAWICGFSANIGIGNIYEAELWSLFRGLHMVWDKGIRSLDIECDSLSVVS-----LI  663

Query  193  AEECSSS-----IFKDCRFL  237
             + C+ S     + +DC+ L
Sbjct  664  VKACNHSHPFFCLIEDCKLL  683



>ref|XP_008357106.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=246

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 58/132 (44%), Gaps = 0/132 (0%)
 Frame = +1

Query  19   KGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAE  198
            +G+ + GF  N+G      AELWG+  GL +A D G + V+ + DS   V  +    +  
Sbjct  111  EGDGIKGFAANLGRGTIMEAELWGVFMGLSIAWDEGCKDVILKCDSWDAVILIQKRILVS  170

Query  199  ECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWGSTCldlpplslnpl  378
                ++  DC+            H  RE N   +H+A+LG   + G      PP +    
Sbjct  171  HPLYNLIIDCKKAIEKNWKCEVTHIYRENNASADHMADLGYGLSLGLHVFVSPPTTSTNF  230

Query  379  lTADAFGTSTAR  414
            L +D+ G +  R
Sbjct  231  LASDSIGRALPR  242



>ref|XP_009344908.1| PREDICTED: uncharacterized protein LOC103936764 [Pyrus x bretschneideri]
Length=1365

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 40/137 (29%), Positives = 62/137 (45%), Gaps = 0/137 (0%)
 Frame = +1

Query  4     LTWDHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSG  183
             L  + +G+ + GF  N+G      AELWG+  GL +A D G R V+ E DS   V  +  
Sbjct  1225  LIRNSEGDWIKGFAANLGRGTIMEAELWGVFMGLSIAWDEGCRDVILECDSWDAVTLIQK  1284

Query  184   DKIAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWGSTCldlppl  363
               +      ++  DC+            H  RE N   +H+A+LG   + G      PP 
Sbjct  1285  PILDSHPLYNLIIDCKEAIGKNWRCEVTHIYREMNASADHMADLGHGLSLGLHVFVSPPT  1344

Query  364   slnpllTADAFGTSTAR  414
             S + +L +D+ G +  R
Sbjct  1345  SASNVLVSDSIGRALPR  1361



>ref|XP_009119466.1| PREDICTED: uncharacterized protein LOC103844431 [Brassica rapa]
Length=1834

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 35/108 (32%), Positives = 52/108 (48%), Gaps = 0/108 (0%)
 Frame = +1

Query  13    DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
             D  GE   GF  NIGI ++  AELWG+  G  +A + G+RR+  E+DS +VV  +     
Sbjct  1697  DENGEWQGGFAVNIGICSATLAELWGVYYGFVIAWENGIRRLEVEVDSATVVGFLKTGIH  1756

Query  193   AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWG  336
                  S + + C    +    V   H  RE N   + LAN   + ++G
Sbjct  1757  DAHPLSFLVRLCYGFISRDWLVKISHVYREANCLADGLANYAFSLSFG  1804



>ref|XP_009124282.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1011

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 53/106 (50%), Gaps = 0/106 (0%)
 Frame = +1

Query  19   KGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAE  198
            +GE   GF  NIG   +  AELWG+  GL  A ++G+RR+  E+DS+ VV  ++      
Sbjct  876  EGEWCGGFALNIGRCGALLAELWGVYYGLVAAWEKGIRRLELEVDSQVVVEFLTIGIGDT  935

Query  199  ECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWG  336
               S + + C  L      V   H  RE N+  + LANL  +  +G
Sbjct  936  HSLSFLVRMCHGLLKKDWLVHIVHVYREANRLADGLANLAFSLPFG  981



>ref|XP_008226028.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=294

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 46/102 (45%), Gaps = 0/102 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G+ + GF  N+G+     AELWG+  GL+LA D G   VV E DS + V  ++ +  
Sbjct  158  DSSGQWMRGFAVNLGVGQVLEAELWGIYPGLKLAWDIGCSAVVLESDSATAVHLLNKNVE  217

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLG  318
                 +++   C+            H  RE N   + L  LG
Sbjct  218  DLHPLATMLWGCKDYINKNWVCSIHHVYRECNMVADKLVELG  259



>ref|XP_008349226.1| PREDICTED: uncharacterized protein LOC103412449 [Malus domestica]
Length=202

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 51/105 (49%), Gaps = 5/105 (5%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSES---VVASMSG  183
            +HK E L G+  +IG +NS  AEL  LR+GL L  + G   V  E D+++   ++A    
Sbjct  65   NHKAEFLLGYAESIGKANSIIAELAALRRGLELVLENGWSXVWLEGDAKTLLQIIAQRRQ  124

Query  184  DKIAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLG  318
             + AE  +         +   + + +  H  REGN+  +  A LG
Sbjct  125  IRCAE--AQRQISHINLIIPEINNCVLTHIYREGNRAADKFAKLG  167



>ref|WP_015681904.1| ribonuclease HI [Leptospira wolbachii]
 gb|EOQ96566.1| ribonuclease HI [Leptospira wolbachii serovar Codice str. CDC]
Length=137

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 53/100 (53%), Gaps = 2/100 (2%)
 Frame = +1

Query  34   FGFIT-NIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSS  210
            F F++  IG + +  AE   L +G+  A  + L+++ F LDSE VV  M G+   +    
Sbjct  36   FFFLSEKIGNATNNVAEWQALHRGMEEAIKQNLQKIRFRLDSELVVKQMKGEYKVKNKDL  95

Query  211  SIFKD-CRFLATSMEHVIFRHTLREGNKCVNHLANLGQTA  327
             +FK+ C  L +S+ +   ++  RE N   + LAN+ Q A
Sbjct  96   LVFKNKCESLKSSIPNFEIQYIPREQNTRADQLANIAQDA  135



>ref|XP_007017128.1| Uncharacterized protein TCM_042327 [Theobroma cacao]
 gb|EOY34747.1| Uncharacterized protein TCM_042327 [Theobroma cacao]
Length=1014

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 56/110 (51%), Gaps = 13/110 (12%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            DH G  +FGF  NIG SNS  AEL  L +GL L KDR + ++  E+D+  V+  +   K 
Sbjct  881  DHTGTLVFGFSENIGPSNSLQAELRALLRGLLLCKDRNIEKLWIEMDALVVIQMIQQSKK  940

Query  193  AEECSSSIFKDCRFLATSMEHVI----FR--HTLREGNKCVNHLANLGQT  324
                      D R+L  S+   +    FR  H  REGN+  + L+N G T
Sbjct  941  GSH-------DIRYLLASIRKCLSFFSFRISHIFREGNQAADFLSNKGHT  983



>ref|XP_002521266.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41122.1| conserved hypothetical protein [Ricinus communis]
Length=149

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 45/90 (50%), Gaps = 0/90 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D++G  + GF+ NIG  ++  AELW    GL +A ++GLR++V  +DS   +  +S   I
Sbjct  52   DYRGRCVVGFMCNIGYCSAIGAELWAAFHGLTIAWNKGLRKLVLAMDSTLALYWLSKRSI  111

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLRE  282
                 S++   C  + +        H  RE
Sbjct  112  CNSHLSNLVHSCSAILSYELDAKLVHVHRE  141



>ref|XP_009337067.1| PREDICTED: uncharacterized protein LOC103929570 [Pyrus x bretschneideri]
Length=208

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +1

Query  70   FAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSIFKDCRFLATSM  249
              AE  GLR+GL+ A+ +G  +V  E DS+ ++ ++ G        SSI  D R LA S 
Sbjct  90   LVAEATGLREGLQCARRKGFTKVKVEGDSKLIIDAVKGHWGIPWRVSSIINDIRILARSF  149

Query  250  EHVIFRHTLREGNKCVNHLANL  315
             HV ++H  RE N   + LA+L
Sbjct  150  SHVDWKHIFREINFVADALAHL  171



>ref|XP_008221720.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=228

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 45/99 (45%), Gaps = 0/99 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G  + GF  N+G  +   AELWG+  GL +A D G R V  E D+ S VA +    +
Sbjct  91   DSCGSWIKGFSVNLGYGSIIEAELWGIFWGLNMAWDAGFRTVEIECDANSAVALLKSPIV  150

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLA  309
            +     SI   C+           +H  RE N  V+ LA
Sbjct  151  STHPLFSIINCCKMKIHEDWSCSVKHIFREQNCAVDALA  189



>ref|WP_004784785.1| ribonuclease HI [Leptospira meyeri]
 gb|EKJ86544.1| ribonuclease HI [Leptospira meyeri serovar Hardjo str. Went 5]
 gb|EMJ89186.1| ribonuclease HI [Leptospira meyeri serovar Semaranga str. Veldrot 
Semarang 173]
Length=137

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 48/91 (53%), Gaps = 1/91 (1%)
 Frame = +1

Query  52   IGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSIFK-DC  228
            IG + +  AE   L +G+  A ++ L+++ F LDSE VV  M G+   +     +FK  C
Sbjct  43   IGNATNNVAEWQALYRGMEEAINQNLQKIRFRLDSELVVKQMKGEYKVKNKDLLVFKTKC  102

Query  229  RFLATSMEHVIFRHTLREGNKCVNHLANLGQ  321
              L +S ++   ++  RE N   + LANL Q
Sbjct  103  DTLKSSFQNFEIQYIPREQNSRADQLANLAQ  133



>ref|XP_004287420.1| PREDICTED: uncharacterized protein LOC101302388 [Fragaria vesca 
subsp. vesca]
Length=425

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/101 (31%), Positives = 53/101 (52%), Gaps = 0/101 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            ++KGE +  F++     ++F  ELW + +GL LA   G++ +  E DS SVV +++ D+ 
Sbjct  291  NYKGEPICAFVSKALGDDTFLVELWAIWRGLILASSLGIKVLWVESDSLSVVKTINRDQP  350

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANL  315
                +SS  K    L    +     H+ RE N+  +HLA +
Sbjct  351  YSLKASSCLKHIWELLKKFDEHRVSHSWRETNRAADHLAKM  391



>ref|XP_008221358.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=877

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 41/135 (30%), Positives = 58/135 (43%), Gaps = 0/135 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D+ G  + GF  N+G+ +   A+LWG+  GL LA +   R V  E DS   VA +S   I
Sbjct  740  DNYGAWIKGFSVNLGVGSVLEAKLWGIFLGLHLAWESSFRFVEAESDSSVAVALLSSSTI  799

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWGSTCldlpplsln  372
            +     S+   C+    +      +H  RE N   + LA+       G       P  L 
Sbjct  800  STHPLFSLMSCCKLKVQAGWRFSIKHIFREQNVAADVLASKSSEFGPGVRYFTEVPAFLV  859

Query  373  pllTADAFGTSTARV  417
              L  DA G S +RV
Sbjct  860  NCLAVDAIGVSRSRV  874



>gb|KHN12872.1| Putative ribonuclease H protein, partial [Glycine soja]
Length=151

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 47/96 (49%), Gaps = 0/96 (0%)
 Frame = +1

Query  37   GFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSI  216
            GF  + G + S  AEL  +  GL L+ D+G R +  E DS+  +  +S  + +    +SI
Sbjct  32   GFYGSCGTATSLQAELLAILHGLNLSWDKGFRNIQCESDSKLALQLISEGRNSLHPYASI  91

Query  217  FKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQT  324
             +  +        + F HT REGN C + LA  G +
Sbjct  92   IQKIQDFKLLHWDLHFNHTFREGNMCADELAKTGSS  127



>gb|ABA96203.1| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
Length=1378

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = +1

Query  58   ISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSIFKDCRFL  237
            + ++  AE + L++GL LA+  G  R++ + D   VV  M+        +++I++DC  L
Sbjct  714  LVDAPMAEAFALKEGLMLAQQIGCNRLIIQSDCMEVVQIMTDGGFTANSAAAIYEDCNIL  773

Query  238  ATSMEHVIFRHTLREGNKCVNHLANLGQT  324
             +    +   H  RE N+C +H+    QT
Sbjct  774  WSGFADITIEHCSREANQCTDHILVSSQT  802



>gb|ABN09101.1| Ribonuclease H [Medicago truncatula]
Length=170

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 47/93 (51%), Gaps = 0/93 (0%)
 Frame = +1

Query  31   LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSS  210
            + GF  + G  ++   EL+ +  GL+LA D G R +  E D +S +  +  +       +
Sbjct  41   IHGFSESCGRVSNLLVELYAILNGLQLAWDLGFRIITLEPDYKSALDLILDNDTTYHPHA  100

Query  211  SIFKDCRFLATSMEHVIFRHTLREGNKCVNHLA  309
             +    R L +    ++F HTLREGN+C + LA
Sbjct  101  IVLGRIRTLMSRDWSLLFNHTLREGNECADWLA  133



>emb|CAN67514.1| hypothetical protein VITISV_012081 [Vitis vinifera]
Length=697

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/104 (29%), Positives = 50/104 (48%), Gaps = 1/104 (1%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVA-SMSGDK  189
            DH    L G+  +IG + S  AE+  LR+GL L  + G  +V  E D +S+V   M G +
Sbjct  504  DHNAAFLLGYAESIGHAXSTIAEMAALRRGLELVVENGWSQVWLEGDLQSLVEIIMQGRR  563

Query  190  IAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQ  321
            +    +       + L   +++ +  H  REGN+  +  A +G 
Sbjct  564  VRSAEAQKQVSHIKLLIPELDNFLITHIYREGNRVAHTFAQMGH  607



>ref|XP_009795398.1| PREDICTED: uncharacterized protein LOC104242095 [Nicotiana sylvestris]
Length=229

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 57/121 (47%), Gaps = 19/121 (16%)
 Frame = +1

Query  13   DHKGE*LFGFITNIG--ISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMS--  180
            D KG  + GF   +    ++S   ELW +  GL LAK+  L++V+ E DS   +  +S  
Sbjct  73   DDKGRWIGGFYDRLSKKATSSLTLELWAIHGGLTLAKNYNLKKVIIETDSYDALMLLSVR  132

Query  181  --------------GDKIAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLG  318
                           + +       + ++ R L + ++ +   HTLR+GN CV +L+ LG
Sbjct  133  NDIKSHLDHMLLSVRNDVKSHLDHYVIEEYRRLMSELQ-ICLIHTLRQGNNCVYYLSKLG  191

Query  319  Q  321
            +
Sbjct  192  R  192



>ref|XP_007219947.1| hypothetical protein PRUPE_ppb019489mg [Prunus persica]
 gb|EMJ21146.1| hypothetical protein PRUPE_ppb019489mg [Prunus persica]
Length=516

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 40/135 (30%), Positives = 57/135 (42%), Gaps = 0/135 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D+ G  + GF  N+G+ +   AELW +  GL LA +   R V  E D    VA +S   I
Sbjct  379  DNYGAWIKGFFVNLGVGSVLEAELWSIFGGLHLAWESSFRVVEVESDFSVAVALLSSSTI  438

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWGSTCldlpplsln  372
            +     S+ + C+    +      +H  RE N   + LA+       G       P  L 
Sbjct  439  STHPLFSLIRCCKLKVQAGWRCSVKHIFREQNVAADVLASKSSEFGIGVQYFTEVPTFLA  498

Query  373  pllTADAFGTSTARV  417
              L  DA G S +RV
Sbjct  499  TCLAEDAIGVSRSRV  513



>ref|XP_009150833.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=188

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 49/108 (45%), Gaps = 0/108 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G  L GF  NIG  ++  AELWG+  GL +A  +G+R V  E+DS  VV        
Sbjct  51   DENGSWLCGFGLNIGRCSAPLAELWGVYYGLLIAWQKGVRCVEVEVDSAVVVGFFQTGIA  110

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWG  336
                 S + + C    +    V F+H  RE N   + LA    + A G
Sbjct  111  ETHPLSFLVRLCYGFISRDWIVRFKHVYREANGLADGLATYAFSLALG  158



>ref|XP_010484806.1| PREDICTED: uncharacterized protein LOC104763089 [Camelina sativa]
Length=1130

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 49/100 (49%), Gaps = 0/100 (0%)
 Frame = +1

Query  13    DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
             D  G  + GF  NIGI  +  AELWG+  GL  A ++G+ RV  E+DSE VV  ++    
Sbjct  993   DSDGAWIGGFAFNIGICTAPLAELWGVYYGLYTAWEKGITRVELEVDSELVVGFLTTVIE  1052

Query  193   AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLAN  312
                  S + + C    +    V   H  RE N+  + LAN
Sbjct  1053  DSHPLSFLVRLCYDFISRDWIVRIGHMYREANRLADGLAN  1092



>ref|XP_007049665.1| Uncharacterized protein TCM_002766 [Theobroma cacao]
 gb|EOX93822.1| Uncharacterized protein TCM_002766 [Theobroma cacao]
Length=241

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 51/104 (49%), Gaps = 1/104 (1%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            DH G  +FGF  N  +  S  AEL  L +GL L  +  + R+  E++++ VV  +     
Sbjct  131  DHTGIVIFGFSKNFRLYISLQAELMALHRGLLLCIEYNVSRIWIEMNAKVVVQMIHEGNK  190

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQT  324
                +  +    R    ++ + I  H  REGN+ V+HL+N G +
Sbjct  191  GSSQTRYLLASIRKCLNAISYCI-SHIHREGNQVVDHLSNQGHS  233



>ref|XP_007040946.1| Uncharacterized protein TCM_016753 [Theobroma cacao]
 gb|EOY25447.1| Uncharacterized protein TCM_016753 [Theobroma cacao]
Length=1275

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 33/109 (30%), Positives = 53/109 (49%), Gaps = 13/109 (12%)
 Frame = +1

Query  13    DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
             DH  + +F F  NIG  NS  AEL  L +GL L K+R + ++  E+D+ +V+  +   + 
Sbjct  998   DHTSKLIFCFSENIGTYNSLQAELRALHRGLLLCKERHIEKLWIEMDALAVIQLIPHSQK  1057

Query  193   AEECSSSIFKDCRFLATSMEHVI------FRHTLREGNKCVNHLANLGQ  321
                       D R+L  S++  +        H  REGN+  + L+N G 
Sbjct  1058  GSH-------DIRYLLESIKKCLNSISYRISHIFREGNQAADFLSNEGH  1099



>ref|XP_008219298.1| PREDICTED: uncharacterized protein LOC103319525 [Prunus mume]
Length=393

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/101 (31%), Positives = 53/101 (52%), Gaps = 0/101 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D+KGE +  F++     + F  ELW + +GL LA   G++ +  E DSESVV +++ D+ 
Sbjct  259  DYKGEPICAFVSKALGDDIFLVELWAIWRGLVLALSLGIKVIWVESDSESVVQTINRDRP  318

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANL  315
              + +SS  K    L    +     H+ RE N+  + L+ +
Sbjct  319  YGQKASSCLKHIWELLKKFDKHQVSHSWRETNRAADLLSKM  359



>ref|XP_010527295.1| PREDICTED: uncharacterized protein LOC104804652 [Tarenaya hassleriana]
Length=225

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 43/77 (56%), Gaps = 0/77 (0%)
 Frame = +1

Query  4    LTWDHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSG  183
            L  D  G  L GF  N+G  + F AE WG+  GLRLA +RG R+V  E+D++++V+++  
Sbjct  149  LIRDQMGNWLVGFKANLGTCSIFRAEAWGVLLGLRLAWNRGWRKVRVEVDNQALVSTIQR  208

Query  184  DKIAEECSSSIFKDCRF  234
                     +I ++ + 
Sbjct  209  SDYEYTVDGTILREIKI  225



>gb|KFK31801.1| hypothetical protein AALP_AA6G160600 [Arabis alpina]
Length=373

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 59/126 (47%), Gaps = 0/126 (0%)
 Frame = +1

Query  37   GFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSI  216
            GF+ NIGI  +  AELWG+  GL +A +R + R+  E+DS  VV  +          S +
Sbjct  244  GFVLNIGICFAPLAELWGVYYGLYIAWERRITRLEIEVDSAIVVEFLKTGISEYHPLSFL  303

Query  217  FKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWGSTCldlpplslnpllTADAF  396
             + C    +    V   H  RE N+  + LAN   +   G   L+  P S+  +   DA 
Sbjct  304  VRLCHGFISRDWIVRIVHVYREANRLADGLANYAFSLPLGFLFLESIPDSVRLIFAEDAS  363

Query  397  GTSTAR  414
            GT+  R
Sbjct  364  GTAIPR  369



>ref|XP_007214110.1| hypothetical protein PRUPE_ppa017108mg, partial [Prunus persica]
 gb|EMJ15309.1| hypothetical protein PRUPE_ppa017108mg, partial [Prunus persica]
Length=197

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 46/106 (43%), Gaps = 2/106 (2%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            + +GE L GF  N+G      AELW L +GL LA   GL  +  E DS +V+  M     
Sbjct  47   NQEGEWLSGFAANLGTGKVIEAELWALYRGLELAWKSGLAPIEVETDSTTVLKLMHNPVE  106

Query  193  A--EECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQT  324
               +    ++ K C+ L          H   + N   + LAN G T
Sbjct  107  VNWKHPQFNLIKSCQNLLNQSWSCSLNHAYWQQNSVADCLANFGLT  152



>ref|XP_009770934.1| PREDICTED: uncharacterized protein LOC104221568 [Nicotiana sylvestris]
Length=344

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 52/106 (49%), Gaps = 3/106 (3%)
 Frame = +1

Query  4    LTWDHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSG  183
            L  + K E + GF  +    +S  AEL+ L +GL+LA +  +R +  E+D + V   +  
Sbjct  203  LIRNSKAEWILGFSGSAPHDSSTTAELYALTQGLKLAYENNIRPLEMEVDVKEVTMLLHT  262

Query  184  DKIAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQ  321
            + IA  C   +  DCR+    + + + ++  +E N   + LA  G 
Sbjct  263  NNIAFSC---MIIDCRYYLGQLGNPVVQYAYKEQNMVADQLAKAGH  305



>ref|XP_007032969.1| Uncharacterized protein TCM_019113 [Theobroma cacao]
 gb|EOY03895.1| Uncharacterized protein TCM_019113 [Theobroma cacao]
Length=184

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/101 (28%), Positives = 50/101 (50%), Gaps = 1/101 (1%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWG-LRKGLRLAKDRGLRRVVFELDSESVVASMSGDK  189
            D  G  L GF   +   +++ A+LW  + + L+LA + GLRR+  ++D+  VV +++   
Sbjct  84   DSDGHWLRGFTVKLDSYSAYQAKLWQYIYQSLKLAWELGLRRIWLQVDNRMVVNAVTTPS  143

Query  190  IAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLAN  312
                 +S + +  R        V   H  +EGN   +H+AN
Sbjct  144  SRPYANSDLLQVIRTFLQRQWEVKILHIYQEGNMIADHMAN  184



>ref|XP_010522729.1| PREDICTED: uncharacterized protein LOC104801226 isoform X2 [Tarenaya 
hassleriana]
Length=609

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 28/108 (26%), Positives = 53/108 (49%), Gaps = 0/108 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G  + G++ N+   +  +A+LW + +GL+L  DRG R+V+ E  S + + +++ + +
Sbjct  476  DESGRWVCGYVVNLKNLSELSADLWAVYQGLKLLWDRGFRKVIVETTSLNALEALNANSL  535

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWG  336
              + S+SI + C+ +              E N C   LAN  +    G
Sbjct  536  PFQQSNSILQRCKDMLLKNWECRICAISEEQNSCAVWLANKAEEQPTG  583



>ref|XP_010522710.1| PREDICTED: uncharacterized protein LOC104801226 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522718.1| PREDICTED: uncharacterized protein LOC104801226 isoform X1 [Tarenaya 
hassleriana]
Length=614

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 28/108 (26%), Positives = 53/108 (49%), Gaps = 0/108 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G  + G++ N+   +  +A+LW + +GL+L  DRG R+V+ E  S + + +++ + +
Sbjct  481  DESGRWVCGYVVNLKNLSELSADLWAVYQGLKLLWDRGFRKVIVETTSLNALEALNANSL  540

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWG  336
              + S+SI + C+ +              E N C   LAN  +    G
Sbjct  541  PFQQSNSILQRCKDMLLKNWECRICAISEEQNSCAVWLANKAEEQPTG  588



>dbj|BAF36312.1| hypothetical protein [Ipomoea trifida]
Length=76

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = +1

Query  205  SSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWGSTCldlpplslnpllT  384
            ++++  DCR L      +   H LREGN+  + LANLGQ + WG+T LD PP  L  LL 
Sbjct  5    TNTLISDCRALMRDFRSIKITHILREGNQSADFLANLGQNSDWGTTILDDPPEGLRELLV  64

Query  385  ADAFGTSTAR  414
             D+ G + +R
Sbjct  65   RDSHGVAASR  74



>ref|XP_004305349.1| PREDICTED: uncharacterized protein LOC101314779 [Fragaria vesca 
subsp. vesca]
Length=167

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 45/91 (49%), Gaps = 0/91 (0%)
 Frame = +1

Query  49   NIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSIFKDC  228
            N G +    AE   L   L  AK++G  ++  E +S+ V+ +++G          +  D 
Sbjct  42   NSGTTTVPVAEALALLNSLVYAKEQGFSKIEVEGNSKLVIDAVNGVLTPPWKLLKLIHDI  101

Query  229  RFLATSMEHVIFRHTLREGNKCVNHLANLGQ  321
            +FL+ S E V F+H  RE N   N LANLG 
Sbjct  102  KFLSNSSEFVCFQHVFRETNFVANVLANLGH  132



>ref|XP_006379569.1| hypothetical protein POPTR_0008s04925g [Populus trichocarpa]
 gb|ERP57366.1| hypothetical protein POPTR_0008s04925g [Populus trichocarpa]
Length=208

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 45/90 (50%), Gaps = 0/90 (0%)
 Frame = +1

Query  49   NIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSIFKDC  228
            N GI  S  AELW +  GL LA   GL +V+ + DS  VV  ++      + ++++    
Sbjct  89   NTGICTSVRAELWAVVTGLDLAWTLGLCQVILDTDSILVVGLITKSTTKSDSNNALITQV  148

Query  229  RFLATSMEHVIFRHTLREGNKCVNHLANLG  318
            +        +  +HTL+EGN   + LAN G
Sbjct  149  KEALAREWEIRVQHTLQEGNTAADWLANYG  178



>ref|XP_006468253.1| PREDICTED: uncharacterized protein LOC102614777 [Citrus sinensis]
Length=320

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 62/135 (46%), Gaps = 0/135 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D +G    G+  N+G+ +  + ELWGL  GL +A   G RRV  E+DS  V+  +S    
Sbjct  183  DFRGVWQVGYSANLGVCSVTSTELWGLFHGLSIAWQYGFRRVYVEVDSMCVMRLISNPNP  242

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWGSTCldlpplsln  372
                  ++ ++ + L          H  RE N+  + LA+   + + G  C    P ++ 
Sbjct  243  PINEHFTLIQEIQALLRRDWLTKVEHIYREANEVADFLASYNFSFSLGLHCFQFNPPNML  302

Query  373  pllTADAFGTSTARV  417
             +LT D  G +  R+
Sbjct  303  SILTNDVHGVAHFRL  317



>ref|XP_008377870.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=591

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 38/116 (33%), Positives = 58/116 (50%), Gaps = 9/116 (8%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G  L GF  ++G   SF AEL  +   + LA  RG + +  E DS SV++  +    
Sbjct  454  DSAGYFLGGFSLSLGHRTSFYAELHAVILAVELAHARGWQNLWLESDSSSVISCFASGSF  513

Query  193  AEECS-SSIFKDCRFLATSMEHVIFR--HTLREGNKCVNHLANLG---QTAAWGST  342
            +   S  + + +C  L   +++++FR  H  REGN   + LANLG    +  W ST
Sbjct  514  SPPWSLQTRWNNCTLL---LQNMVFRCSHIFREGNAVADKLANLGLLSSSLVWHST  566



>ref|XP_007206968.1| hypothetical protein PRUPE_ppb019197mg [Prunus persica]
 gb|EMJ08167.1| hypothetical protein PRUPE_ppb019197mg [Prunus persica]
Length=363

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 48/102 (47%), Gaps = 3/102 (3%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSG--D  186
            D  G+ + GF  N+GI  +   ELWGL  GL+L   +G+ R+  E+DS + V  +     
Sbjct  246  DSFGDWMGGFAVNLGIGQTLDDELWGLFFGLKLVAAKGVARLSIEMDSMTDVQLIKQHVP  305

Query  187  KIAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLAN  312
                 C+  I   C  L +  E V   H  RE N   + LAN
Sbjct  306  SCLHPCTGVI-ASCVALISKFEFVELTHVYRERNAAADCLAN  346



>ref|XP_008362461.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=164

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 42/95 (44%), Gaps = 0/95 (0%)
 Frame = +1

Query  37   GFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSI  216
            GF  NIG+ +    ELWGL  GL LA   G R+V  E+DS   V  +     + +  + +
Sbjct  24   GFTINIGVGSVLNVELWGLLHGLSLALRLGYRKVFVEMDSVIAVTLVMDFNSSMDPLAHL  83

Query  217  FKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQ  321
               CR L          H  RE N+    + NLG 
Sbjct  84   ITACRELLRRDWICSVSHVYRENNRVTAGMTNLGH  118



>gb|EKD46245.1| ribonuclease HI [uncultured bacterium]
Length=136

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/101 (29%), Positives = 50/101 (50%), Gaps = 1/101 (1%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSG-DK  189
            D  G+ L+     +GI+ +  AE   L +GL+    +G++ V   LDSE VV  ++G  +
Sbjct  25   DQTGKTLYRLSKYLGIATNNQAEYAALIQGLKFLTQKGIKIVACYLDSELVVRQLNGLYR  84

Query  190  IAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLAN  312
            I ++     ++    L +  + V F+H  RE N   + L N
Sbjct  85   IKDQKIKEKYQQLSLLISKFKKVTFKHIYRENNVEADKLVN  125



>ref|XP_008340288.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=364

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 58/116 (50%), Gaps = 9/116 (8%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G  L GF  ++G   SF AEL  +   + LA  RG + +  E DS SV++  +    
Sbjct  227  DSTGYFLGGFSLSLGHRTSFYAELHAVILAVELAHARGWQNLWLESDSSSVISCFASGSF  286

Query  193  AEECS-SSIFKDCRFLATSMEHVIFR--HTLREGNKCVNHLANLG---QTAAWGST  342
            +   S  + + +C  L   +++++FR  H  REGN   + LANLG    +  W ST
Sbjct  287  SPPWSLQTRWNNCTLL---LQNMVFRCSHIFREGNVVADKLANLGLLSSSLVWHST  339



>gb|EAY88619.1| hypothetical protein OsI_10096 [Oryza sativa Indica Group]
Length=207

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 54/107 (50%), Gaps = 4/107 (4%)
 Frame = +1

Query  13   DHKGE*LFGFITN--IGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGD  186
            DH+G  + G+     +G ++SF AEL  LR+GL LA   G RRV  E DS +VV  + G 
Sbjct  78   DHEGAFVAGYAERMIVGGASSFTAELAALRRGLELAARYGWRRVWAEGDSRAVVDVVHGV  137

Query  187  KIAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTA  327
            +  E+       +   L  +++ V   H  R+ NK  +  A LG  A
Sbjct  138  RSEEDRRQC--GEIAALLPALDGVAVSHLCRDENKVAHGFAKLGHKA  182



>gb|ABE65462.1| hypothetical protein At2g27870 [Arabidopsis thaliana]
Length=314

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 49/100 (49%), Gaps = 0/100 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D +G    GF  NIG+ ++  AELWG+  GL +A +R + R+  E+DSE VV  +     
Sbjct  177  DEEGAWRGGFALNIGVCSAPLAELWGVYYGLYIAWERRVTRLEIEVDSEIVVGFLKIXIN  236

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLAN  312
                 S + + C    +    V   H  RE N+  + LAN
Sbjct  237  EVHPLSFLVRLCHDFISRDWRVRISHVYREANRLADGLAN  276



>gb|AAD21515.1| putative reverse transcriptase [Arabidopsis thaliana]
 gb|AAM15081.1| putative reverse transcriptase [Arabidopsis thaliana]
Length=314

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 49/100 (49%), Gaps = 0/100 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D +G    GF  NIG+ ++  AELWG+  GL +A +R + R+  E+DSE VV  +     
Sbjct  177  DEEGAWRGGFALNIGVCSAPLAELWGVYYGLYIAWERRVTRLEIEVDSEIVVGFLKIGIN  236

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLAN  312
                 S + + C    +    V   H  RE N+  + LAN
Sbjct  237  EVHPLSFLVRLCHDFISRDWRVRISHVYREANRLADGLAN  276



>ref|XP_007022459.1| RNase H family protein [Theobroma cacao]
 gb|EOY13984.1| RNase H family protein [Theobroma cacao]
Length=429

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 55/108 (51%), Gaps = 13/108 (12%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            DH G  +F F+ N G  NS  AEL  L +GL L  +  +RR+  E+D++ V+  +     
Sbjct  289  DHTGTLIFSFVENFGPYNSLQAELMALYRGLLLCIEHNVRRLWIEMDAKVVIQMIHR---  345

Query  193  AEECSSSIFKDCRFLATSMEH----VIFR--HTLREGNKCVNHLANLG  318
              + S+ I    R+L  S+      + FR  H  REGN+  + L+N G
Sbjct  346  GHKGSAQI----RYLLASIRKCLSVISFRISHIHREGNQAADLLSNQG  389



>gb|ABK28199.1| unknown [Arabidopsis thaliana]
Length=315

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 49/100 (49%), Gaps = 0/100 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D +G    GF  NIG+ ++  AELWG+  GL +A +R + R+  E+DSE VV  +     
Sbjct  177  DEEGAWRGGFALNIGVCSAPLAELWGVYYGLYIAWERRVTRLEIEVDSEIVVGFLKIGIN  236

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLAN  312
                 S + + C    +    V   H  RE N+  + LAN
Sbjct  237  EVHPLSFLVRLCHDFISRDWRVRISHVYREANRLADGLAN  276



>ref|XP_008227119.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=147

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 40/92 (43%), Gaps = 0/92 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  GE + GF  N+G  +   AELWG   GL LA D G R V  E DS  VV+ ++   I
Sbjct  32   DATGEWIKGFSVNLGNGSVLEAELWGFLWGLTLAWDSGYRNVEVESDSGDVVSLLNSPTI  91

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGN  288
                  SI   C+            H  RE N
Sbjct  92   PTHPLLSIICCCKSKINKDWRCSISHIYREQN  123



>ref|XP_011470534.1| PREDICTED: uncharacterized protein LOC105353242 [Fragaria vesca 
subsp. vesca]
Length=1179

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 54/100 (54%), Gaps = 1/100 (1%)
 Frame = +1

Query  13    DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
             D+ G+ +  F +N+ I +S AAE+  + K + LA  R  + +  E+DSE V++ +    +
Sbjct  1046  DYSGKVMGAFCSNLDIPSSVAAEVMAVIKAIELAWVREWKHIWLEVDSELVLSFLRSPTL  1105

Query  193   AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLAN  312
                  S  + +C +L + M +    H  REGN+ V+ LAN
Sbjct  1106  VPWQLSVEWSNCLYLISQM-NFHSSHIFREGNRVVDALAN  1144



>ref|XP_008228893.1| PREDICTED: probable CCR4-associated factor 1 homolog 9 [Prunus 
mume]
Length=405

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 48/110 (44%), Gaps = 2/110 (2%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D +G+   GF  N+G      AEL GL  GL+L   +G+  V+ E DSE  V  +     
Sbjct  266  DSEGKWFAGFAVNLGKGGVLEAELQGLYHGLKLVVQKGISHVLVESDSEIAVKFLQNPHR  325

Query  193  AEECS-SSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWGS  339
               C    +  DC  L   +   +  H  RE N   ++LANL      GS
Sbjct  326  LASCPYRDLMSDCLELMQEI-GCVPTHVYREKNSVADYLANLSYDLDAGS  374



>ref|XP_004514910.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Cicer 
arietinum]
Length=215

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 48/108 (44%), Gaps = 0/108 (0%)
 Frame = +1

Query  4    LTWDHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSG  183
            L  DHKG  + GF  +I  +++   EL  +  GL LA D G + V    D    ++ +  
Sbjct  35   LIRDHKGSWVLGFSGHISFADNLEVELLAVLNGLMLAWDIGCKDVSCRSDCVEALSLIQN  94

Query  184  DKIAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTA  327
                      I    + L +    V F HT REGN+C + +A LG  A
Sbjct  95   PTSQPHKYDEIILSIKELVSRDWVVSFAHTYREGNQCADFMAKLGANA  142



>ref|XP_007212490.1| hypothetical protein PRUPE_ppa019260mg, partial [Prunus persica]
 gb|EMJ13689.1| hypothetical protein PRUPE_ppa019260mg, partial [Prunus persica]
Length=169

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 50/106 (47%), Gaps = 5/106 (5%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSES---VVASMSG  183
            +HK + L G+   IG +NS  AEL  LR+GL L  + G   V  E D+++   ++A    
Sbjct  33   NHKADFLLGYAEPIGRANSIIAELAALRRGLELVLENGWSDVWLEGDAKTLLQIIAQRRQ  92

Query  184  DKIAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQ  321
             + AE  +         +   + + I  H  REGN+  +  A +G 
Sbjct  93   IRCAE--AQRHISHINLIIPEINNCILTHIYREGNRAADKFAQMGH  136



>ref|XP_006492639.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=569

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 33/105 (31%), Positives = 52/105 (50%), Gaps = 0/105 (0%)
 Frame = +1

Query  4    LTWDHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSG  183
            L  DH G  L GF   IG  +   AELWGL +GL+LA + G+R++  E+DS  V+  ++ 
Sbjct  364  LIRDHMGRWLSGFGMMIGSCSITVAELWGLYQGLQLAWNSGIRKLQVEIDSLCVLQLVTK  423

Query  184  DKIAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLG  318
              +     + + +  +        V   H  RE N   +++ANL 
Sbjct  424  PSLEINHYAPLIQAIKDYLKMDWQVSISHIYREANFAADYMANLA  468



>ref|XP_006480844.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=768

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 38/112 (34%), Positives = 54/112 (48%), Gaps = 18/112 (16%)
 Frame = +1

Query  1    DLTWDHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESV--VAS  174
            +L  D+KG    G+  N+G  +  +AELWGL  GL +A   G RRV+ E+DS  +  + S
Sbjct  627  ELIRDYKGVWQIGYCANLGFCSVTSAELWGLFHGLSIAWLHGYRRVIVEVDSRCILQLVS  686

Query  175  MSGDKIAEECSSSIFKDCRFLATSMEHVIFR-------HTLREGNKCVNHLA  309
             S   I E  S         L T+++ +I R       H  RE N   + LA
Sbjct  687  NSNPTINEHLS---------LITAIQELIGRDWLIQMNHIYREANAASDFLA  729



>ref|XP_007010390.1| Retrotransposon, unclassified-like protein [Theobroma cacao]
 gb|EOY19200.1| Retrotransposon, unclassified-like protein [Theobroma cacao]
Length=1368

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 34/108 (31%), Positives = 52/108 (48%), Gaps = 9/108 (8%)
 Frame = +1

Query  13    DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMS----  180
             DH G  +FGF  N G  NS  AEL  L +GL L  +  + RV  E+D++ V+  +     
Sbjct  1203  DHTGNLIFGFSENFGYQNSLQAELLALHRGLCLCMEYNVSRVWIEVDAQVVIQMIQNHHK  1262

Query  181   GDKIAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQT  324
             G    +    SI K  + ++  + H+      REGN+  + L+  G T
Sbjct  1263  GSYKIQYLLESIRKCLQVISVRISHI-----HREGNQAADFLSKHGHT  1305



>ref|XP_002304990.2| hypothetical protein POPTR_0004s03265g [Populus trichocarpa]
 gb|EEE85501.2| hypothetical protein POPTR_0004s03265g [Populus trichocarpa]
Length=202

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 51/104 (49%), Gaps = 3/104 (3%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            +H+ E L G+   IG + S  AEL  LR+GL L  + G   V  E DS+S+V  +   K 
Sbjct  66   NHEAEFLLGYAEPIGGTTSTIAELAALRRGLELVLENGWSNVWLEGDSKSLVDIIVKRKQ  125

Query  193  A--EECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLG  318
               +E    +      +   +++ +  H  REGN+  + LA +G
Sbjct  126  VRCKEAQRQV-SHINLIMPELQNCVVTHVFREGNRAADKLARIG  168



>ref|XP_008354555.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=426

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 42/95 (44%), Gaps = 0/95 (0%)
 Frame = +1

Query  37   GFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSI  216
            GF  NIG+ +    ELWGL  GL LA   G R+V  E+DS   V  +     + +  + +
Sbjct  294  GFTINIGVGSVLNXELWGLLHGLSLALRLGYRKVFVEMDSVXAVTLVMDFNSSMDPLAHL  353

Query  217  FKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQ  321
               CR L          H  RE N+    + NLG 
Sbjct  354  ITACRELLXRDWICSVSHVYRENNRVTXGMXNLGH  388



>ref|XP_010254588.1| PREDICTED: uncharacterized protein LOC104595530 isoform X2 [Nelumbo 
nucifera]
Length=414

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/101 (29%), Positives = 49/101 (49%), Gaps = 0/101 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            DH G  +  F+T       F+ ELW + +GL LA  +G++ +  E DS SVV  ++ +  
Sbjct  279  DHMGNPICAFVTKAPRDGIFSLELWAVWRGLVLALGQGIKDIWVESDSMSVVKVINKEWP  338

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANL  315
              + + S  K    +    +     H+ RE N+  +HLA +
Sbjct  339  HPQKAGSCLKHIWEMLRKFDKYRVSHSWREANRAADHLARM  379



>ref|NP_001049023.1| Os03g0158600 [Oryza sativa Japonica Group]
 gb|AAN06838.1| Unknown protein [Oryza sativa Japonica Group]
 dbj|BAF10937.1| Os03g0158600 [Oryza sativa Japonica Group]
 gb|EAZ25647.1| hypothetical protein OsJ_09477 [Oryza sativa Japonica Group]
Length=210

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 53/108 (49%), Gaps = 3/108 (3%)
 Frame = +1

Query  13   DHKGE*LFGFITN--IGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGD  186
            DH+G  + G+     +G ++SF AEL  LR+GL LA   G RRV  E DS +VV  + G 
Sbjct  78   DHEGAFVAGYAERMIVGGASSFTAELAALRRGLELAARYGWRRVWAEGDSRAVVDVVHGR  137

Query  187  K-IAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTA  327
              +  E       +   L  +++ V   H  R+ NK  +  A LG  A
Sbjct  138  AGVRSEEDRRQCGEIAALLPALDGVAVSHLCRDENKVAHGFAKLGHKA  185



>ref|XP_007015619.1| Uncharacterized protein TCM_041190 [Theobroma cacao]
 gb|EOY33238.1| Uncharacterized protein TCM_041190 [Theobroma cacao]
Length=152

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +1

Query  22   GE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMS  180
            GE + GF+ NIGI++S AA+L G+R+GL LAK   ++  V ELD+  VV  ++
Sbjct  100  GEWVHGFVVNIGITDSLAAKLLGIREGLLLAKRLQIQPFVVELDATMVVKFLT  152



>gb|ABF94077.1| expressed protein [Oryza sativa Japonica Group]
Length=205

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 53/108 (49%), Gaps = 3/108 (3%)
 Frame = +1

Query  13   DHKGE*LFGFITN--IGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGD  186
            DH+G  + G+     +G ++SF AEL  LR+GL LA   G RRV  E DS +VV  + G 
Sbjct  73   DHEGAFVAGYAERMIVGGASSFTAELAALRRGLELAARYGWRRVWAEGDSRAVVDVVHGR  132

Query  187  K-IAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTA  327
              +  E       +   L  +++ V   H  R+ NK  +  A LG  A
Sbjct  133  AGVRSEEDRRQCGEIAALLPALDGVAVSHLCRDENKVAHGFAKLGHKA  180



>gb|AAG28895.1|AC008113_11 F12A21.24 [Arabidopsis thaliana]
Length=803

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 33/92 (36%), Positives = 45/92 (49%), Gaps = 0/92 (0%)
 Frame = +1

Query  37   GFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSI  216
            GF  NIG  ++  AELWG+  G  LA  + L RV  E+DSE VV  +      +   S +
Sbjct  674  GFALNIGRCSAPLAELWGVYYGFYLAWTKALTRVELEVDSELVVGFLKTGIGDQHPLSFL  733

Query  217  FKDCRFLATSMEHVIFRHTLREGNKCVNHLAN  312
             + C  L +    V   H  RE N+  + LAN
Sbjct  734  VRLCHGLLSKDWIVRITHVYREANRLADGLAN  765



>ref|WP_026476332.1| hypothetical protein [Alkaliphilus transvaalensis]
Length=133

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 48/105 (46%), Gaps = 1/105 (1%)
 Frame = +1

Query  4    LTWDHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSG  183
            L  D +GE +      IG   +  AE   L KGL  A D G+  +   LDSE VV  + G
Sbjct  23   LLEDEQGEVIKEISQYIGKQTNNVAEYQALYKGLETALDLGVNDITCYLDSELVVKQIKG  82

Query  184  D-KIAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANL  315
            + K+  E    I++    L    +    +H  RE NK  + LANL
Sbjct  83   EYKVKNEGLIPIYQMVLPLTRKFQSFKIQHVRREHNKRADALANL  127



>ref|XP_008224410.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=232

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/98 (29%), Positives = 46/98 (47%), Gaps = 1/98 (1%)
 Frame = +1

Query  22   GE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAE-  198
            G+ + GF  N+G       E+WGL  GL+LA +RG+  +V E+DS + V  +   +    
Sbjct  94   GDWVTGFTVNLGKGQILDVEIWGLFFGLKLAAERGISNLVVEMDSATAVHLLQRSETPSF  153

Query  199  ECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLAN  312
               + +  DCR     + +    H  R+ N   + LA 
Sbjct  154  HPLAGVLSDCRKFVEQLGNCGVNHVYRDQNCVADSLAQ  191



>ref|XP_007141283.1| hypothetical protein PHAVU_008G183100g [Phaseolus vulgaris]
 gb|ESW13277.1| hypothetical protein PHAVU_008G183100g [Phaseolus vulgaris]
Length=439

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/109 (27%), Positives = 57/109 (52%), Gaps = 4/109 (4%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D++GE + GF++ +   + F  ELW + +GL L    G++ +  E DS SVV +++  + 
Sbjct  306  DYRGEPMCGFVSKVPQGDVFLVELWAIWRGLVLCGGLGIKAIWVESDSMSVVKTVNRKQH  365

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWGS  339
              +    + +  + L    ++ I  H+ RE N+  +HL+ +     WG+
Sbjct  366  CPKAYGYLKQIWKLLKKFDKYQI-SHSWRETNRAADHLSKM---VVWGN  410



>ref|XP_003626609.1| hypothetical protein MTR_7g118250 [Medicago truncatula]
Length=111

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  94   RKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSIFKDCRFLATSMEHVIFRHT  273
            ++G+ LA+  G  +V F++DS  V ++++  ++      S+ ++ R L      +  RH+
Sbjct  17   KQGMVLARLHGFYKVEFDIDSSVVASTLALWEVGSVEGWSLLQNIRRLLELKWKIEIRHS  76

Query  274  LREGNKCVNHLANL  315
             RE NKCVN LAN+
Sbjct  77   YREANKCVNALANM  90



>ref|XP_010254587.1| PREDICTED: uncharacterized protein LOC104595530 isoform X1 [Nelumbo 
nucifera]
Length=435

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/101 (29%), Positives = 49/101 (49%), Gaps = 0/101 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            DH G  +  F+T       F+ ELW + +GL LA  +G++ +  E DS SVV  ++ +  
Sbjct  300  DHMGNPICAFVTKAPRDGIFSLELWAVWRGLVLALGQGIKDIWVESDSMSVVKVINKEWP  359

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANL  315
              + + S  K    +    +     H+ RE N+  +HLA +
Sbjct  360  HPQKAGSCLKHIWEMLRKFDKYRVSHSWREANRAADHLARM  400



>ref|XP_008803873.1| PREDICTED: putative ribonuclease H protein At1g65750 [Phoenix 
dactylifera]
Length=205

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 54/104 (52%), Gaps = 3/104 (3%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            +H+G  LFG+   IG + S  AEL   ++GL LA   G   +  E D++ VV  ++ +++
Sbjct  66   NHEGVFLFGYAERIGKATSSVAELVAAKRGLELAIKNGWFNIWIEGDAKGVVDLIT-NRM  124

Query  193  AEECSSSI--FKDCRFLATSMEHVIFRHTLREGNKCVNHLANLG  318
              +    +  F++   L   +++    H  REGNK  + LA LG
Sbjct  125  RSKSKEDLRHFREISVLIPQLKYFKASHIYREGNKVAHRLAKLG  168



>ref|XP_008391104.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=359

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 42/95 (44%), Gaps = 0/95 (0%)
 Frame = +1

Query  37   GFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSI  216
            GF  NIG+ +    ELWGL  GL LA   G R+V  E+DS   V  +     + +  + +
Sbjct  227  GFTINIGVGSVLNVELWGLLHGLSLALRLGYRKVFVEMDSVIAVTLVMDFNSSMDPLAHL  286

Query  217  FKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQ  321
               CR L          H  RE N+    + NLG 
Sbjct  287  ITACRELLRRDWICSVSHVYRENNRVTAGMTNLGH  321



>ref|WP_022914789.1| bifunctional RNase H/acid phosphatase [Frankia sp. Iso899]
Length=394

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 49/109 (45%), Gaps = 1/109 (1%)
 Frame = +1

Query  22   GE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGD-KIAE  198
            GE L     +IG+  +  AE  GL  GL  AK+ G R V   +DS+ VV  MSG  ++  
Sbjct  39   GEVLAERKQSIGVETNNVAEYQGLLAGLTAAKELGARSVAVRMDSKLVVEQMSGRWQVKH  98

Query  199  ECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWGSTC  345
                 + +    L  + + V F    RE NK  + LAN    AA G   
Sbjct  99   PAMRPLARQAADLKRAFDEVTFTWIPREQNKYADRLANEAMDAAAGKPL  147



>ref|XP_010678904.1| PREDICTED: uncharacterized protein LOC104894381 [Beta vulgaris 
subsp. vulgaris]
Length=329

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 45/96 (47%), Gaps = 0/96 (0%)
 Frame = +1

Query  43   ITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSIFK  222
            +   G +++  AE WGLR GL LA  + +  +  E D++ V+  + G         ++  
Sbjct  211  VYRFGQTSALFAEAWGLRNGLILAIQQHIHDLYIEGDNQVVIRVLQGQYTCPWTIQALID  270

Query  223  DCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAA  330
            D R L     +   +H  RE N+  + L+  G T++
Sbjct  271  DIRQLLQHFRYYTIKHIFREANRVADLLSKKGHTSS  306



>ref|XP_004292219.1| PREDICTED: uncharacterized protein LOC101302904 [Fragaria vesca 
subsp. vesca]
Length=170

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = +1

Query  16   HKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIA  195
            + G+ L     N G +N   AE   LR  L  AK++G+ +V  E DS+ ++  ++G    
Sbjct  34   NDGKPLVSAAFNSGTANVPLAEALTLRNNLLCAKEKGVLKVEVEGDSKLIIDIVNGVCDL  93

Query  196  EECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQ  321
                  + +D + L+   E + F+H  RE N   N LANLG 
Sbjct  94   PWRLLKVVQDIKLLSCHFESIRFKHVFREANFVANALANLGH  135



>ref|XP_008227731.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=322

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 44/94 (47%), Gaps = 0/94 (0%)
 Frame = +1

Query  37   GFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSI  216
            GF+ N+G+     AELWG+  GL++A D G   VV E DS + V  ++ +       +++
Sbjct  194  GFVVNLGVKQVLEAELWGIYLGLKIAWDIGCSPVVLESDSATAVHLLNKNVEDFHPLATM  253

Query  217  FKDCRFLATSMEHVIFRHTLREGNKCVNHLANLG  318
               C+            H  RE N   + LA LG
Sbjct  254  LWGCQDYINKNWVCSIHHVYRECNMVADKLAELG  287



>ref|XP_008232726.1| PREDICTED: uncharacterized protein LOC103331839 [Prunus mume]
Length=278

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/101 (26%), Positives = 47/101 (47%), Gaps = 0/101 (0%)
 Frame = +1

Query  43   ITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSIFK  222
            I  + +       +W L +GL L  + G+RR+  E DS + V+ ++G+       SS+  
Sbjct  178  IWELHVPPKIKTFVWLLFQGLLLTWNEGIRRIKVECDSFTAVSLINGETRPSHPLSSLIY  237

Query  223  DCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWGSTC  345
             C+++          H  RE N   +H+A++ +   W S C
Sbjct  238  SCKYMLFRDWECSISHIYREQNIVADHMAHMVKVPIWLSCC  278



>ref|XP_007216097.1| hypothetical protein PRUPE_ppa018451mg [Prunus persica]
 gb|EMJ17296.1| hypothetical protein PRUPE_ppa018451mg [Prunus persica]
Length=395

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 48/110 (44%), Gaps = 2/110 (2%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D +G+   GF  N+G      AEL GL  GL+L   + + RV+ E DSE  V  +     
Sbjct  256  DSQGKWFAGFAVNLGKGGVLEAELQGLYHGLKLVVQKRISRVLVESDSEIAVKFLQNPHR  315

Query  193  AEECS-SSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWGS  339
               C    +  DC  L   +   +  H  RE N   ++LANL      GS
Sbjct  316  LASCPYRDLVSDCLELMQEI-GCVPTHVYREKNSVADYLANLSYDLDAGS  364



>ref|XP_007212728.1| hypothetical protein PRUPE_ppa019009mg, partial [Prunus persica]
 gb|EMJ13927.1| hypothetical protein PRUPE_ppa019009mg, partial [Prunus persica]
Length=259

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 46/102 (45%), Gaps = 0/102 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G+ + GF  N+G+     AELWG+  GL++A D G   VV E DS + V  +  +  
Sbjct  64   DSSGQWMRGFAVNLGVGQVLEAELWGIYLGLKIAWDIGCSAVVLESDSTTAVHLLHKNVE  123

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLG  318
                  ++   C+            H  RE N  V+ LA LG
Sbjct  124  DLHPLVAMLWGCQDYINKNWVCSIHHVYRECNMLVDKLAELG  165



>ref|WP_029774884.1| hypothetical protein, partial [candidate division TM7 bacterium 
JGI 0001002-L20]
Length=152

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 44/88 (50%), Gaps = 1/88 (1%)
 Frame = +1

Query  52   IGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSG-DKIAEECSSSIFKDC  228
            +GI+ +  AE  G+R GL  A + G R V F LDS  VV  M+G  KI       I +  
Sbjct  54   LGITTNNQAEYHGVRLGLEKALEMGARTVDFRLDSLLVVNQMNGIYKIKNRELWPIHERI  113

Query  229  RFLATSMEHVIFRHTLREGNKCVNHLAN  312
            R L T  E V F H  RE N+  + + N
Sbjct  114  RELMTKFEKVTFMHVRREFNQLADGMVN  141



>ref|XP_006575359.1| PREDICTED: uncharacterized protein LOC102661917 isoform X3 [Glycine 
max]
Length=414

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/101 (28%), Positives = 54/101 (53%), Gaps = 1/101 (1%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D++GE +  F++     + F AELW + +GL L+   G++ +  E DS SVV +++  + 
Sbjct  281  DYRGEPICAFVSKAPQGDIFLAELWAMWRGLVLSLGLGIKAIWVESDSMSVVKTVNRKQF  340

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANL  315
              +    + +  + L    ++ I  HT R+ N+  +HLA +
Sbjct  341  CPKAVGYLKQIWKLLKKFDKYQI-SHTWRQTNRAADHLAKM  380



>ref|XP_007028676.1| Uncharacterized protein TCM_024574 [Theobroma cacao]
 gb|EOY09178.1| Uncharacterized protein TCM_024574 [Theobroma cacao]
Length=122

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 32/58 (55%), Gaps = 0/58 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGD  186
            DH    +FGF+ N G  NS   EL  L +GL L  +  + RV  E+D++ VV  + GD
Sbjct  44   DHSSNIIFGFLKNFGPQNSLQVELMALYRGLHLCIEHNVSRVWIEMDAQIVVQMIQGD  101



>ref|WP_023524696.1| MULTISPECIES: Putative ribonuclease H [Leptospirillum]
 gb|EDZ40159.1| Putative ribonuclease H [Leptospirillum sp. Group II '5-way CG']
 gb|EIJ76144.1| Putative ribonuclease H [Leptospirillum sp. Group II 'C75']
 gb|KGA94527.1| Phosphoglycerate mutase family [Leptospirillum ferriphilum]
Length=134

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 53/106 (50%), Gaps = 5/106 (5%)
 Frame = +1

Query  4    LTWDHKGE*LF--GFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASM  177
            L  D +G  +F  G +   G +N   AE   L  GL+ A+DRG+R ++   DSE ++  M
Sbjct  21   LLQDEEGRVIFSEGRVLPPGTNNQ--AEYQALIAGLQAARDRGVRNLLVRADSELMIRQM  78

Query  178  SGD-KIAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLAN  312
            +G  ++      + ++    L+ S + + F H  RE N   + LAN
Sbjct  79   TGKYRVRHPGLLACYEQATNLSRSFDTIQFEHIPREQNAQADRLAN  124



>ref|XP_009599431.1| PREDICTED: uncharacterized protein LOC104095089 [Nicotiana tomentosiformis]
Length=202

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 45/102 (44%), Gaps = 3/102 (3%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            +H G+ + GF   +   +   AEL  L KGL LA    L  +  E D + +   +  D  
Sbjct  49   NHVGDWMVGFAGPVPHVHCITAELQALIKGLSLALQMQLLPLEVETDVKEITTLLDSDS-  107

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLG  318
                 S++  DCR L   +   + RH  RE N   + LA LG
Sbjct  108  --SKYSNLICDCRHLLRMLHDAVVRHAYREQNGVADQLAKLG  147



>ref|XP_007037316.1| Ribonuclease H-like protein [Theobroma cacao]
 gb|EOY21817.1| Ribonuclease H-like protein [Theobroma cacao]
Length=326

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 49/92 (53%), Gaps = 0/92 (0%)
 Frame = +1

Query  37   GFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSI  216
            GF+  +G   ++ AELWG+   LRLA D   ++V+ ++D++ VV ++  DK+    ++ +
Sbjct  223  GFVAKLGKCLAYRAELWGVLHDLRLAWDSRFKKVMVQVDNKMVVQAILMDKLLPCANTDL  282

Query  217  FKDCRFLATSMEHVIFRHTLREGNKCVNHLAN  312
             +  + +      V F H  RE N   + + N
Sbjct  283  IRAIKDILQKEWEVHFVHIYREDNNSCSGILN  314



>ref|XP_008383873.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=389

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 57/116 (49%), Gaps = 9/116 (8%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G  L GF  ++G   SF AEL  +   + LA  RG + +  E DS SV++  +    
Sbjct  252  DSTGYFLGGFSLSLGHRTSFYAELHAVILAIELAHARGWKNLWLESDSSSVISCFASGSF  311

Query  193  AEECS-SSIFKDCRFLATSMEHVIFR--HTLREGNKCVNHLANLG---QTAAWGST  342
            +   S  + + +C      +++++FR  H  REGN   + LANLG    +  W ST
Sbjct  312  SPPWSLQTRWNNCTL---HLQNMVFRCSHIFREGNVVADKLANLGLLSSSLVWHST  364



>ref|XP_010667872.1| PREDICTED: uncharacterized protein LOC104884867 [Beta vulgaris 
subsp. vulgaris]
Length=183

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/105 (28%), Positives = 50/105 (48%), Gaps = 1/105 (1%)
 Frame = +1

Query  13   DHKGE*LFGFIT-NIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDK  189
            DH GE +        G S+   AE    RKG+++A   G  R++ E+D + +   +   +
Sbjct  53   DHDGEVVVALCCREQGGSDVAVAEALSARKGIQVAMQAGFSRLMVEVDCQQLFFHLKERR  112

Query  190  IAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQT  324
                    I  D + +A++ + V+F H  R GNK  + LA L ++
Sbjct  113  STASPFGKIVNDIQVMASNCQQVVFSHVRRSGNKVAHCLAQLSKS  157



>ref|XP_008225019.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=200

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 50/106 (47%), Gaps = 5/106 (5%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSES---VVASMSG  183
            +HK + L G+   IG +NS  AEL  LR+GL L  + G   V  E D+++   ++A    
Sbjct  64   NHKADFLLGYAEPIGRANSIIAELAALRRGLELVLENGWSDVWLEGDAKTLLQIIAQRRQ  123

Query  184  DKIAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQ  321
             + AE  +         +   + + I  H  REGN+  +  A +G 
Sbjct  124  IRCAE--AQRHISHINLIIPEINNCILTHIYREGNRAADKFAQMGH  167



>gb|EKP95067.1| putative SAM-dependent methyltransferase [Thermaerobacter subterraneus 
DSM 13965]
Length=504

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 33/90 (37%), Positives = 46/90 (51%), Gaps = 1/90 (1%)
 Frame = +1

Query  52   IGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGD-KIAEECSSSIFKDC  228
            IG + +  AE   L  GL+ A DRG RR+    DSE +V  ++G  ++  E    +F+  
Sbjct  400  IGAATNNVAEYTALITGLQRALDRGARRLDVYSDSELMVRQLNGQYRVKNEGLKPLFEQA  459

Query  229  RFLATSMEHVIFRHTLREGNKCVNHLANLG  318
              LA   E V F H  RE N+  + LAN G
Sbjct  460  ARLAAQFERVRFIHVPRERNREADRLANQG  489



>ref|XP_004300849.1| PREDICTED: uncharacterized protein LOC101302842 [Fragaria vesca 
subsp. vesca]
Length=170

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 41/83 (49%), Gaps = 0/83 (0%)
 Frame = +1

Query  73   AAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSIFKDCRFLATSME  252
             AE   LR  L  AK++G   +  E DS+ V+ S++G          I +  R LA S  
Sbjct  53   VAEASALRSNLLFAKEKGFVNIKVEGDSKLVIDSVNGSIAPPWRLLKIVEYIRALAFSFT  112

Query  253  HVIFRHTLREGNKCVNHLANLGQ  321
             + F+H  RE N  V+ LANLG 
Sbjct  113  IIFFKHVFREINFVVDALANLGH  135



>ref|XP_009782743.1| PREDICTED: uncharacterized protein LOC104231438, partial [Nicotiana 
sylvestris]
Length=134

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 51/97 (53%), Gaps = 6/97 (6%)
 Frame = +1

Query  22   GE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELD-SESVVASMSGDKIAE  198
            G  + GF      + S AAEL  L++GLR AK+  L  +  E D SE++ A  +G+K+  
Sbjct  8    GSWVVGFAKLEHANGSLAAELKALQEGLRTAKEWNLFSLEIETDCSEAIQAIQNGNKLFN  67

Query  199  ECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLA  309
            +       DCR L    + V  +HT R+GN+  + LA
Sbjct  68   KT----VNDCRPL-MHQQRVTLQHTFRQGNRIAHQLA  99



>ref|XP_007224782.1| hypothetical protein PRUPE_ppa023938mg, partial [Prunus persica]
 gb|EMJ25981.1| hypothetical protein PRUPE_ppa023938mg, partial [Prunus persica]
Length=189

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 47/101 (47%), Gaps = 0/101 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G  L G+  N+GI +   AELWG+   L LA D G R V  E DS+  V  ++   I
Sbjct  52   DATGAWLKGYSVNLGIGSVLEAELWGIFWRLSLAWDFGFRTVEVESDSKVAVTLLNSLTI  111

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANL  315
            +     SI   C+   +   +   RH L E N   + LA +
Sbjct  112  STHPLFSIINCCKVKMSVDWNCSVRHILLEQNCAADALAAI  152



>ref|XP_007040952.1| Uncharacterized protein TCM_005954 [Theobroma cacao]
 gb|EOX96783.1| Uncharacterized protein TCM_005954 [Theobroma cacao]
Length=1134

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 35/103 (34%), Positives = 55/103 (53%), Gaps = 1/103 (1%)
 Frame = +1

Query  13    DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
             DH G+ +FGF  NIG  NS  AEL  L +GL L K+R + ++  E+D+ + +  +   K 
Sbjct  999   DHTGKLIFGFSENIGPCNSLQAELRALLRGLLLCKERHIEKLWIEMDALAAIQLIQPSKK  1058

Query  193   AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQ  321
                    + +  R   +S  + +  HT REGNK  ++L+N G 
Sbjct  1059  GPYDIRYLLESIRMCLSSFSYRL-SHTFREGNKAADYLSNEGH  1100



>ref|XP_007226572.1| hypothetical protein PRUPE_ppa024162mg [Prunus persica]
 gb|EMJ27771.1| hypothetical protein PRUPE_ppa024162mg [Prunus persica]
Length=297

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 43/92 (47%), Gaps = 1/92 (1%)
 Frame = +1

Query  37   GFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGD-KIAEECSSS  213
            GF  N+G      AELWGL  GLR+A ++G   ++ E+DS   +  +     +     +S
Sbjct  205  GFAINLGKGQILEAELWGLFFGLRMAVEKGFNNLIVEMDSAVAIHLVQQHGSLTLHPLAS  264

Query  214  IFKDCRFLATSMEHVIFRHTLREGNKCVNHLA  309
            +   C  L   +E+    H  RE N   + LA
Sbjct  265  LASSCWQLMQKLENCSLHHIFREKNSVADQLA  296



>ref|XP_007036030.1| Uncharacterized protein TCM_021518 [Theobroma cacao]
 gb|EOY06956.1| Uncharacterized protein TCM_021518 [Theobroma cacao]
Length=1702

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/106 (29%), Positives = 51/106 (48%), Gaps = 5/106 (5%)
 Frame = +1

Query  13    DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
             DH    +FGF  N G  NS  AEL  L +GL L  +  + RV  E+D++++V  +     
Sbjct  1569  DHTSTMIFGFSENFGPYNSTQAELMALHRGLLLCNEYNISRVWIEIDAKAIVQMLHEGHK  1628

Query  193   AEECSSSIFKDCRFLATSMEHVIFR--HTLREGNKCVNHLANLGQT  324
                 +  +     F+   +  + +R  H  RE N+  ++L+N G T
Sbjct  1629  GYSRTQYLLS---FICQCLSGISYRISHIHRESNQAADYLSNQGHT  1671


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 38/108 (35%), Positives = 56/108 (52%), Gaps = 9/108 (8%)
 Frame = +1

Query  13    DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDS----ESVVASMS  180
             DH G  +FGF  NIG SNS  AEL  L +GL L K+R + ++  E+D+    + +  S  
Sbjct  1401  DHTGTLVFGFSENIGPSNSLQAELRALLRGLLLCKERNIEKLWIEMDALVAIQMIQQSQK  1460

Query  181   GDKIAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQT  324
             G    +   +SI K   F +  + H+      REGN+  + L+N G T
Sbjct  1461  GSHDIQYLLASIRKCLSFFSFRISHI-----FREGNQVADFLSNKGHT  1503



>ref|WP_006768136.1| RNase H [Corynebacterium efficiens]
 gb|EEW49097.1| ribonuclease HI [Corynebacterium efficiens YS-314]
Length=391

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 48/91 (53%), Gaps = 1/91 (1%)
 Frame = +1

Query  61   SNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGD-KIAEECSSSIFKDCRFL  237
            S +  AE  GL +GLR+A++ G   V   +DS+ VV  MSG  KI      ++  + R L
Sbjct  44   STNNVAEYRGLIEGLRVARELGATEVEVFMDSKLVVEQMSGRWKIKHPDMKTLAMEARNL  103

Query  238  ATSMEHVIFRHTLREGNKCVNHLANLGQTAA  330
            A  +  V +    RE NK  +HL+N+   AA
Sbjct  104  AGDIGRVTYTWIPREKNKAADHLSNVAMDAA  134



>ref|XP_011037145.1| PREDICTED: uncharacterized protein LOC105134437 [Populus euphratica]
Length=149

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 62/118 (53%), Gaps = 2/118 (2%)
 Frame = +1

Query  67   SFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGD--KIAEECSSSIFKDCRFLA  240
            +  AEL  +R+ L+LA D+GL+RV+ E DSESVV  +     +  +    ++  +C+   
Sbjct  5    ALEAELLAVREALKLAWDKGLKRVIVESDSESVVNRIRNQLTRQPKNQIEAVILECQSYV  64

Query  241  TSMEHVIFRHTLREGNKCVNHLANLGQTAAWGSTCldlpplslnpllTADAFGTSTAR  414
            +   +   +HT REGN   + L  +  + ++     + PP SL+ +L AD  G +  R
Sbjct  65   SREWNCFLQHTHREGNFAADALTKIIISESFDLHVFNHPPKSLSLILLADKIGMAVPR  122



>ref|XP_006601510.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=191

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 46/95 (48%), Gaps = 0/95 (0%)
 Frame = +1

Query  16   HKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIA  195
            H G+ L GF   +G  +  A ELWG+  G++    +G   +V E +SE VV  +    + 
Sbjct  59   HNGKFLVGFSVGLGSVSVVAVELWGIFYGIQTTLKKGFLYIVVESNSEEVVNLIENSGLI  118

Query  196  EECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVN  300
               + S+ ++   ++      + +H L E NK V+
Sbjct  119  THPNVSLVEEIHKMSKLPSRFVVKHVLWEQNKVVD  153



>ref|XP_006575358.1| PREDICTED: uncharacterized protein LOC102661917 isoform X2 [Glycine 
max]
Length=441

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 52/103 (50%), Gaps = 5/103 (5%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D++GE +  F++     + F AELW + +GL L+   G++ +  E DS SVV +++  + 
Sbjct  308  DYRGEPICAFVSKAPQGDIFLAELWAMWRGLVLSLGLGIKAIWVESDSMSVVKTVNRKQF  367

Query  193  AEECSSSI--FKDCRFLATSMEHVIFRHTLREGNKCVNHLANL  315
               C  ++   K    L    +     HT R+ N+  +HLA +
Sbjct  368  ---CPKAVGYLKQIWKLLKKFDKYQISHTWRQTNRAADHLAKM  407



>gb|ABV21218.1| At4g21420 [Arabidopsis thaliana]
Length=197

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 54/103 (52%), Gaps = 1/103 (1%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMS-GDK  189
            +HK E L G+  +IG + S  AE   L++GL LA + GL  +  E D++ ++  +S   +
Sbjct  65   NHKAEFLLGYSESIGEATSTMAEFAALKRGLELALENGLTDLWLEGDAKIIMDIISRRGR  124

Query  190  IAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLG  318
            +  E ++      + +   + + +  H  REGN+  + LA LG
Sbjct  125  LRCEKTNKHVNYIKVVMPELNNCVLSHVYREGNRVADKLAKLG  167



>dbj|BAC18943.1| conserved hypothetical protein [Corynebacterium efficiens YS-314]
Length=435

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 48/91 (53%), Gaps = 1/91 (1%)
 Frame = +1

Query  61   SNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGD-KIAEECSSSIFKDCRFL  237
            S +  AE  GL +GLR+A++ G   V   +DS+ VV  MSG  KI      ++  + R L
Sbjct  88   STNNVAEYRGLIEGLRVARELGATEVEVFMDSKLVVEQMSGRWKIKHPDMKTLAMEARNL  147

Query  238  ATSMEHVIFRHTLREGNKCVNHLANLGQTAA  330
            A  +  V +    RE NK  +HL+N+   AA
Sbjct  148  AGDIGRVTYTWIPREKNKAADHLSNVAMDAA  178



>ref|XP_007036697.1| Uncharacterized protein TCM_012582 [Theobroma cacao]
 gb|EOY21198.1| Uncharacterized protein TCM_012582 [Theobroma cacao]
Length=947

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 31/102 (30%), Positives = 45/102 (44%), Gaps = 32/102 (31%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            DH G  +FGF+ N G  NS  AEL  L +GL L  +  +RR+  E+D++ V++       
Sbjct  864  DHTGTLIFGFVENFGPYNSLQAELMALYRGLLLCIEHNVRRLWIEMDAKVVIS-------  916

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLG  318
                                     H  REGN+ V+ L+N G
Sbjct  917  -------------------------HIHREGNQAVDLLSNQG  933



>ref|XP_009107495.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=305

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 48/106 (45%), Gaps = 0/106 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G  L GF  NIG  ++  AELWG+  GL +A  + +R V  E+DS  VV        
Sbjct  199  DENGSWLCGFGLNIGRCSAPLAELWGVYYGLLIAWQKRVRCVEVEVDSAVVVGFFQTGIA  258

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAA  330
                 S + + C    +    V F+H  RE N   + LA  G + A
Sbjct  259  ETHPLSFLVRLCYGFISRDWIVRFKHVYREANGLADGLATYGFSPA  304



>ref|XP_009107896.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=416

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 51/108 (47%), Gaps = 0/108 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  GE   GF  NIG  ++  A+LWG+  GL +A +  + R+  E+DS+ VV  +S    
Sbjct  279  DGNGEWYGGFALNIGRCSAPLADLWGVYYGLVIAWENNISRLEVEVDSKMVVGFLSAGIE  338

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWG  336
                 S +   C    T    V   H  RE N+  + LANL  +  +G
Sbjct  339  DTHPLSFLVCLCHGFLTRDWLVRIVHVYREANRLADGLANLAISLPFG  386



>ref|XP_007221764.1| hypothetical protein PRUPE_ppb024359mg [Prunus persica]
 gb|EMJ22963.1| hypothetical protein PRUPE_ppb024359mg [Prunus persica]
Length=222

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/101 (29%), Positives = 45/101 (45%), Gaps = 0/101 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G+ + GF  N+G+     A+LWG+  GL++  D G   VV E DS + V  ++ +  
Sbjct  86   DSYGQWMRGFAVNLGVGQVLEAKLWGIYLGLKITWDIGCSAVVLEYDSATAVHLLNKNVE  145

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANL  315
                 +++   C+            H  RE N   N LA L
Sbjct  146  DFHPLATMLWGCQAYINKNWVCSIHHVYRECNMVANKLAEL  186



>ref|XP_008239854.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=467

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 31/92 (34%), Positives = 42/92 (46%), Gaps = 0/92 (0%)
 Frame = +1

Query  40   FITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSIF  219
            F  N+G    F AE W L  GL LA   GLR+++   DS  VV  ++GD +     S + 
Sbjct  339  FSANLGHGEVFVAEAWALYYGLNLAWQLGLRQIMVNSDSALVVDMINGDWVDFHPMSMLL  398

Query  220  KDCRFLATSMEHVIFRHTLREGNKCVNHLANL  315
              CR L  +  +       RE N   N LA +
Sbjct  399  TKCRELLKNQWNCCVLRVYRETNFAANFLAKM  430



>ref|XP_008218223.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=204

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 42/100 (42%), Gaps = 0/100 (0%)
 Frame = +1

Query  37   GFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSI  216
            GF  N+G       E W L  GL+LA   GL +++   D   VV  ++G+ +     S +
Sbjct  75   GFFANLGHGKVLVVEAWALYYGLKLAWQLGLHQIIVNSDYALVVDMINGEWVDSHPMSVL  134

Query  217  FKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWG  336
                R    S  +    H  RE N   + LA +G   A G
Sbjct  135  LTKYREFLESQWNCSILHVYRETNFVADFLAKMGHHKALG  174



>ref|XP_010695795.1| PREDICTED: tetraspanin-8-like [Beta vulgaris subsp. vulgaris]
Length=333

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/98 (27%), Positives = 45/98 (46%), Gaps = 0/98 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G+ +   +   G +++  AE WGLR GL LA  R ++ +  E D++ V+  + G   
Sbjct  224  DSTGQIVGAQVYRFGQTSALVAEAWGLRDGLLLALHRDIKELYIEGDNQMVIRILQGQYA  283

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHL  306
                  ++ +D R L +        H  RE N+  + L
Sbjct  284  CPWIIQTLIEDIRQLLSQFRFYTINHIFREANRVADIL  321



>gb|EMS61533.1| putative disease resistance RPP8-like protein 4 [Triticum urartu]
Length=1043

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 45/90 (50%), Gaps = 0/90 (0%)
 Frame = +1

Query  61    SNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSIFKDCRFLA  240
             ++  AAE   LR GL LA+  G  R+V   D+  V+ +M+        ++ IF DC +LA
Sbjct  928   ADILAAEALALRYGLSLAQRIGCNRLVINSDNLEVIETMNNGGGHAIAAAVIFDDCYYLA  987

Query  241   TSMEHVIFRHTLREGNKCVNHLANLGQTAA  330
                    F H  RE NK  + LA L + +A
Sbjct  988   CDFPISRFEHCNREANKVAHELARLARFSA  1017



>ref|XP_007216426.1| hypothetical protein PRUPE_ppa022108mg [Prunus persica]
 gb|EMJ17625.1| hypothetical protein PRUPE_ppa022108mg [Prunus persica]
Length=154

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 45/99 (45%), Gaps = 0/99 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G  L G+  N+GI +   AELWG+  GL LA + G R V  E DS+  V  +    I
Sbjct  17   DATGAWLKGYSVNLGIGSVLEAELWGIFWGLSLAWNFGFRTVEVESDSKVAVILLDSLTI  76

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLA  309
            +     +I   C+       +   RH  R+ N   + LA
Sbjct  77   STHLLFNIINCCKLKMGDDWNCSVRHIFRQQNCATDALA  115



>ref|XP_007037560.1| Uncharacterized protein TCM_014255 [Theobroma cacao]
 gb|EOY22061.1| Uncharacterized protein TCM_014255 [Theobroma cacao]
Length=956

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 30/102 (29%), Positives = 47/102 (46%), Gaps = 0/102 (0%)
 Frame = +1

Query  4    LTWDHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSG  183
            L  D  G+ + G+  N+G  +S + +LW L +G++   DRG R+V+ E D  + V  +  
Sbjct  806  LIRDKLGKWIVGYNLNLGRCSSLSTDLWALFQGIKFTWDRGYRKVLVESDCVAAVECLRK  865

Query  184  DKIAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLA  309
                   + ++ K CR L             RE N C N LA
Sbjct  866  APSLLNSNIALIKSCRDLLNRKWDCKVHPIRREENLCANWLA  907



>ref|XP_007217546.1| hypothetical protein PRUPE_ppa022869mg [Prunus persica]
 gb|EMJ18745.1| hypothetical protein PRUPE_ppa022869mg [Prunus persica]
Length=137

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 41/83 (49%), Gaps = 0/83 (0%)
 Frame = +1

Query  73   AAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSIFKDCRFLATSME  252
             AE   +R GL  A + G R+V+ E DS+ V+  ++           + +D R L++  E
Sbjct  48   VAECLAIRDGLAHAINNGWRKVLIEGDSKLVIDCINNKVSVPWSIRLLVQDIRLLSSYCE  107

Query  253  HVIFRHTLREGNKCVNHLANLGQ  321
             + F H  RE N   + LANLG 
Sbjct  108  EISFHHVFREANFTTDALANLGH  130



>gb|ABN08768.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=275

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 65/133 (49%), Gaps = 17/133 (13%)
 Frame = +1

Query  19   KGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAE  198
            +G+ + GF  N+   N++ +EL G+  GL++A++RG  +V   +DS  VV ++   K   
Sbjct  157  EGKWISGFSHNLSRCNAYLSELCGVFDGLQIARERGFSKVELHVDSSVVVWTLQTTKDG-  215

Query  199  ECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWGSTCldlpplslnpl  378
               S   K C             H+ RE N C + LAN+    A G    +  P  L+ +
Sbjct  216  ---SWEVKIC-------------HSYREVNSCADTLANMDCEHAPGLRVYEQCPARLSSM  259

Query  379  lTADAFGTSTARV  417
            L AD  G +T+RV
Sbjct  260  LLADVMGITTSRV  272



>gb|KHN26153.1| Putative ribonuclease H protein [Glycine soja]
Length=435

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 52/103 (50%), Gaps = 5/103 (5%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D++GE +  F++     + F AELW + +GL L+   G++ +  E DS SVV +++  + 
Sbjct  302  DYRGEPICAFVSKAPQGDIFLAELWAMWRGLVLSLGLGIKAIWVESDSMSVVKTVNRKQF  361

Query  193  AEECSSSI--FKDCRFLATSMEHVIFRHTLREGNKCVNHLANL  315
               C  ++   K    L    +     HT R+ N+  +HLA +
Sbjct  362  ---CPKAVGYLKQIWKLLKKFDKYQISHTWRQTNRAADHLAKM  401



>gb|ABW81175.1| non-LTR retrotransposon transposase [Arabidopsis cebennensis]
Length=799

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 48/100 (48%), Gaps = 0/100 (0%)
 Frame = +1

Query  37   GFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSI  216
            GF  NIGI ++  AELW +  GL +A +R + R+  E+DSE VV  ++         S +
Sbjct  665  GFAVNIGICSAPLAELWRVYYGLYIAWERKITRLEVEVDSELVVGFLTTWISDSHPLSFL  724

Query  217  FKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWG  336
             + C    +    V   H  RE N+  + LAN   +   G
Sbjct  725  VRLCYGFISRDWIVRISHVYREANRLADGLANYASSLPLG  764



>ref|XP_011468499.1| PREDICTED: uncharacterized protein LOC101309181 [Fragaria vesca 
subsp. vesca]
Length=340

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 42/90 (47%), Gaps = 0/90 (0%)
 Frame = +1

Query  52   IGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSIFKDCR  231
            +G +    AE   LR  L  A+DRG   V  E DS+ V+ +++G          I +D R
Sbjct  204  LGSTTIPTAEATALRDNLVKARDRGYMNVQVEGDSKLVIDAINGKLSPPWRLQKIVQDIR  263

Query  232  FLATSMEHVIFRHTLREGNKCVNHLANLGQ  321
             +ATS   V F H  RE N   +  AN G 
Sbjct  264  TIATSFSSVCFNHVYREANFVADAFANEGH  293



>ref|XP_007023230.1| Non-LTR retroelement reverse transcriptase [Theobroma cacao]
 gb|EOY25852.1| Non-LTR retroelement reverse transcriptase [Theobroma cacao]
Length=1011

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMS  180
            D  G  + G+   +  S+ F AELWG+ KGL+LA +RG R+V  + D+++VV ++S
Sbjct  911  DSHGTWIVGYACKLETSSVFRAELWGVYKGLQLAWERGFRKVKLQSDNKAVVQAIS  966



>ref|XP_002523031.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF39335.1| nucleic acid binding protein, putative [Ricinus communis]
Length=209

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 45/99 (45%), Gaps = 0/99 (0%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            D  G  L GF   +      A ELWGL +GL LA   G+RR+  E+D++ VV  + G ++
Sbjct  73   DDIGNWLRGFFMKMSFCIVTATELWGLYQGLELAWKIGIRRIQVEVDNKRVVKLIYGHRV  132

Query  193  AEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLA  309
               C   +      L +    V   H   + +K  N LA
Sbjct  133  HASCLILLIASIHHLLSRNWQVNIGHVYCKSSKVANCLA  171



>ref|XP_002530315.1| nuclease, putative [Ricinus communis]
 gb|EEF32082.1| nuclease, putative [Ricinus communis]
Length=219

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/87 (29%), Positives = 46/87 (53%), Gaps = 3/87 (3%)
 Frame = +1

Query  64   NSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGD---KIAEECSSSIFKDCRF  234
            ++F AEL+G+  GL +A + G R ++ E D+++ V  + GD   K   +    +    + 
Sbjct  95   SAFVAELFGILNGLNIAWNAGFRNIILETDNKTSVDKIYGDSDTKRMGDLEDLLITSIKE  154

Query  235  LATSMEHVIFRHTLREGNKCVNHLANL  315
            + T   ++  +H  REGN+  + LAN 
Sbjct  155  MLTKEWNIKLQHQYREGNRVADALANF  181



>ref|XP_003604942.1| Cyclin D3 [Medicago truncatula]
Length=238

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 40/79 (51%), Gaps = 0/79 (0%)
 Frame = +1

Query  88   GLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSIFKDCRFLATSMEHVIFR  267
             ++KGL+   D     ++ E D+ +VV +++  +       SI +DC  +  S   +IF 
Sbjct  145  AMQKGLKFVNDMSFLNLIAESDASNVVLALNARQQPPNYVGSIIRDCISIKGSFRSLIFL  204

Query  268  HTLREGNKCVNHLANLGQT  324
            H  RE N+   +LAN  QT
Sbjct  205  HVRREVNQAAYYLANYCQT  223



>ref|XP_009115103.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=308

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 52/105 (50%), Gaps = 0/105 (0%)
 Frame = +1

Query  22   GE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEE  201
            GE   GF+ NIG  ++  AELWG+  GL +A ++G+ R+  E+DS+ VV  ++       
Sbjct  174  GEWCGGFVLNIGRCSAPLAELWGVYYGLVIAWEKGISRLEVEVDSKMVVEFLTMGIGETH  233

Query  202  CSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAAWG  336
              S + + C    T    V   H  RE N   + L +L  +  +G
Sbjct  234  PLSFLVRLCHGFLTRDWLVRILHVYREANHLADGLTHLAFSFPFG  278



>ref|XP_004513875.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Cicer 
arietinum]
Length=217

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 47/108 (44%), Gaps = 0/108 (0%)
 Frame = +1

Query  4    LTWDHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSG  183
            L  DHKG  + GF  +I  +++   EL  +  GL LA D G + V    D    ++ +  
Sbjct  40   LIRDHKGSWVLGFSAHISFADNLEVELLAVLNGLMLAWDIGCKDVSCRSDCMEALSLIQD  99

Query  184  DKIAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTA  327
                      I    + L +    V F HT RE N+C + +A LG  A
Sbjct  100  PTSQPHKYDEIILSIKELVSRDWVVSFAHTYREDNQCADFMAKLGANA  147



>ref|XP_004146631.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Cucumis 
sativus]
 ref|XP_004158057.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Cucumis 
sativus]
 gb|KGN64619.1| hypothetical protein Csa_1G071820 [Cucumis sativus]
Length=205

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 54/105 (51%), Gaps = 3/105 (3%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            DHK + L G+  +IG + S  AEL  L KGL L  + G + V  E D++ +V  ++ ++ 
Sbjct  69   DHKAQFLLGYAESIGRAYSSMAELKALTKGLELVLENGWKDVWVEGDAKGLVEILAENRE  128

Query  193  AEEC--SSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQ  321
              +C  + S  +  + L    ++    H  REGNK  +  A++G 
Sbjct  129  V-KCMEARSYLRHIKSLLLDFDNCKVSHIYREGNKVADRFASIGH  172



>gb|ABD32321.2| Ribonuclease H [Medicago truncatula]
Length=220

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 52/102 (51%), Gaps = 2/102 (2%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGD-K  189
            D  G  + G+   IG  ++  AE+WGL  GL +A       ++ E DS+ ++  +S + K
Sbjct  83   DLDGRWIKGYTKKIGACDALHAEMWGLYLGLDMAWREHYSHLIVESDSKILIDMISDNFK  142

Query  190  IAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANL  315
                    +++  + L TS  +V   HT REGN+  + LANL
Sbjct  143  FNGNIPVLVYRIRKLLKTSW-NVQLNHTWREGNRSADWLANL  183



>ref|XP_007025838.1| Polynucleotidyl transferase [Theobroma cacao]
 gb|EOY28460.1| Polynucleotidyl transferase [Theobroma cacao]
Length=285

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 51/105 (49%), Gaps = 3/105 (3%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKI  192
            +HK E L G+  +IG S S  AEL  LR+GL L  + G   V  E D++++V  +   + 
Sbjct  66   NHKAEFLLGYAESIGRSTSTIAELAALRRGLELVLENGWTDVWLEGDAKTLVDVIVQRRQ  125

Query  193  AEECS--SSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQ  321
              +C+           +   + + I  H  REGN+  + LA +G 
Sbjct  126  V-KCAELQRHVSHINLIIPELNNCIVTHIYREGNRAADKLAQIGH  169



>ref|WP_015676147.1| ribonuclease HI [Leptospira yanagawae]
 gb|EOQ90123.1| ribonuclease HI [Leptospira yanagawae serovar Saopaulo str. Sao 
Paulo = ATCC 700523]
Length=137

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 50/100 (50%), Gaps = 2/100 (2%)
 Frame = +1

Query  34   FGFIT-NIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSS  210
            F F++  IG + +  AE   L +G+  A  + +++  F LDSE VV  M G+   +    
Sbjct  36   FFFVSEKIGNATNNIAEWHALLRGMEEAIKQNIKKTKFRLDSELVVKQMKGEYKVKNKDL  95

Query  211  SIFK-DCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTA  327
             +FK  C  L +S E+   ++  RE N   + LAN  Q +
Sbjct  96   MVFKSKCEELKSSFENFEIQYIPREQNARADQLANFAQDS  135



>ref|WP_038591689.1| acid phosphatase [Corynebacterium imitans]
 gb|AIJ33951.1| acid phosphatase [Corynebacterium imitans]
Length=386

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 52/111 (47%), Gaps = 2/111 (2%)
 Frame = +1

Query  4    LTWDHKGE*LFGFITNIGI-SNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMS  180
            + +D  G+ L   +  +G  S++  AE  GL +GL  A D G   V   +DS+ VV  M+
Sbjct  23   VVYDEAGKTLAEIVYVVGAKSSNNVAEYHGLLRGLEAAADLGATEVAVSMDSKLVVEQMN  82

Query  181  GD-KIAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQTAA  330
            G  KI       +    R LA S E V +    R  NK  + L+NL   AA
Sbjct  83   GRWKIKHPDMQKLAVQARKLAGSFERVTYTWVPRAKNKKADELSNLAMDAA  133



>ref|XP_010671945.1| PREDICTED: uncharacterized protein LOC104888619 [Beta vulgaris 
subsp. vulgaris]
Length=734

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 46/93 (49%), Gaps = 3/93 (3%)
 Frame = +1

Query  76   AELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSIFKDCRFLATSMEH  255
            AE   L   ++LAK  G   ++ E DS+ +V  +S   I      SI +D  FL++S+  
Sbjct  626  AECKALLLAIKLAKRYGYDNIILESDSQVLVNRLSRAAIFLSDFDSILEDILFLSSSLST  685

Query  256  VIFRHTLREGNKCVNHLANL---GQTAAWGSTC  345
            V++ H  R GN   +HLA L   G    W + C
Sbjct  686  VVWSHVKRGGNYVAHHLAKLVPFGVEQVWENHC  718



>ref|WP_035165042.1| hypothetical protein, partial [Caloranaerobacter azorensis]
Length=134

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 45/89 (51%), Gaps = 1/89 (1%)
 Frame = +1

Query  52   IGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGD-KIAEECSSSIFKDC  228
            IGI  +  AE   L + L L+ + G++ V F +DSE VV  + G+ K+  E     ++  
Sbjct  40   IGIQTNNVAEYKALVRALELSYEMGIKDVEFYMDSELVVKQIKGEYKVKNERMKLFYEIA  99

Query  229  RFLATSMEHVIFRHTLREGNKCVNHLANL  315
              L +  ++    H  RE NK  + LANL
Sbjct  100  NSLISQFDNFSIHHVRRERNKKADELANL  128



>ref|XP_008221996.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=545

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 29/95 (31%), Positives = 45/95 (47%), Gaps = 0/95 (0%)
 Frame = +1

Query  37   GFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGDKIAEECSSSI  216
            GF  N G+ ++  AELWG+  GL LA + G R +  E D+ SVV+ ++G   +     S+
Sbjct  416  GFAVNQGVGSTLEAELWGVFWGLHLAWEIGCRHIEVECDANSVVSLLTGSIASTHPLFSL  475

Query  217  FKDCRFLATSMEHVIFRHTLREGNKCVNHLANLGQ  321
               C+            H  RE N   + LA++  
Sbjct  476  LSCCKLKLQQDWVCSLTHVFREQNCVADGLAHMSH  510



>emb|CAA18706.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAA20207.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB81249.1| hypothetical protein [Arabidopsis thaliana]
Length=229

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 54/103 (52%), Gaps = 1/103 (1%)
 Frame = +1

Query  13   DHKGE*LFGFITNIGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGD-K  189
            +HK E L G+  +IG + S  AE   L++GL LA + GL  +  E D++ ++  +S   +
Sbjct  93   NHKAEFLLGYSESIGEATSTMAEFAALKRGLELALENGLTDLWLEGDAKIIMDIISRRGR  152

Query  190  IAEECSSSIFKDCRFLATSMEHVIFRHTLREGNKCVNHLANLG  318
            +  E ++      + +   + + +  H  REGN+  + LA LG
Sbjct  153  LRCEKTNKHVNYIKVVMPELNNCVLSHVYREGNRVADKLAKLG  195



>ref|WP_033430344.1| acid phosphatase [Saccharothrix syringae]
Length=376

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 42/88 (48%), Gaps = 1/88 (1%)
 Frame = +1

Query  52   IGISNSFAAELWGLRKGLRLAKDRGLRRVVFELDSESVVASMSGD-KIAEECSSSIFKDC  228
            IG++ +  AE  GL  GLR A + G   VV  +DS+ VV  MSG  K+       +    
Sbjct  39   IGVATNNVAEYQGLLAGLRAAAELGASEVVVRMDSKLVVEQMSGRWKVKHPAMQPLNAQA  98

Query  229  RFLATSMEHVIFRHTLREGNKCVNHLAN  312
            R LA     V +    RE NK  + LAN
Sbjct  99   RELAREFARVGYEWVPRERNKRADRLAN  126



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559272306750