BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP009C05 645 bp,:PolyA

Length=613
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABB45810.1|  acetoacetyl-CoA thiolase                                231   2e-73   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010473862.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    223   1e-70   Camelina sativa [gold-of-pleasure]
dbj|BAD95031.1|  3-ketoacyl-CoA thiolase                                229   2e-70   Arabidopsis thaliana [mouse-ear cress]
emb|CDO99410.1|  unnamed protein product                                231   1e-69   Coffea canephora [robusta coffee]
ref|XP_010696158.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    230   2e-69   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|AGC59769.1|  3-ketoacyl-CoA thiolase 1                               230   3e-69   Rehmannia glutinosa [Chinese foxglove]
pdb|2WU9|A  Chain A, Crystal Structure Of Peroxisomal Kat2 From A...    229   3e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294172.1|  hypothetical protein CARUB_v10023167mg             229   3e-69   Capsella rubella
gb|EYU32624.1|  hypothetical protein MIMGU_mgv1a005944mg                229   5e-69   Erythranthe guttata [common monkey flower]
ref|NP_180873.1|  3-ketoacyl-CoA thiolase 2                             229   6e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006360332.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    229   6e-69   Solanum tuberosum [potatoes]
emb|CDY23766.1|  BnaC04g43560D                                          229   8e-69   Brassica napus [oilseed rape]
emb|CDY37750.1|  BnaA04g19180D                                          229   8e-69   Brassica napus [oilseed rape]
gb|KJB72150.1|  hypothetical protein B456_011G161700                    229   9e-69   Gossypium raimondii
ref|XP_009143894.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    228   1e-68   Brassica rapa
emb|CDY19452.1|  BnaC04g11470D                                          228   1e-68   Brassica napus [oilseed rape]
emb|CAA63598.1|  glyoxysomal beta-ketoacyl-thiolase                     228   1e-68   Brassica napus [oilseed rape]
ref|XP_009141289.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    228   1e-68   Brassica rapa
gb|ACV70033.1|  3-ketoacyl CoA thiolase 2                               228   1e-68   Petunia x hybrida [garden petunia]
ref|XP_011091395.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    228   1e-68   Sesamum indicum [beniseed]
ref|XP_006410451.1|  hypothetical protein EUTSA_v10016622mg             228   2e-68   Eutrema salsugineum
ref|XP_011073762.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    228   2e-68   Sesamum indicum [beniseed]
gb|ACA58356.1|  3-ketoacyl-CoA thiolase                                 217   2e-68   Arachis diogoi
gb|KHG05724.1|  3-ketoacyl-CoA thiolase 2, peroxisomal -like protein    228   2e-68   Gossypium arboreum [tree cotton]
ref|XP_010509924.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    227   3e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010413914.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    227   3e-68   Camelina sativa [gold-of-pleasure]
ref|XP_009619812.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    227   3e-68   Nicotiana tomentosiformis
ref|XP_009132912.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    227   3e-68   Brassica rapa
gb|AGC24176.1|  3-ketoacyl-CoA thiolase 2                               227   3e-68   Rehmannia glutinosa [Chinese foxglove]
ref|XP_009784398.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    227   3e-68   Nicotiana sylvestris
ref|XP_010469514.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    227   3e-68   Camelina sativa [gold-of-pleasure]
emb|CDX79511.1|  BnaC03g18470D                                          227   4e-68   Brassica napus [oilseed rape]
emb|CDX84701.1|  BnaA03g15290D                                          227   4e-68   Brassica napus [oilseed rape]
ref|XP_004247828.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    226   7e-68   Solanum lycopersicum
ref|XP_002881265.1|  hypothetical protein ARALYDRAFT_482251             226   8e-68   Arabidopsis lyrata subsp. lyrata
ref|XP_007225741.1|  hypothetical protein PRUPE_ppa005421mg             223   4e-67   Prunus persica
ref|XP_010556945.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    224   5e-67   Tarenaya hassleriana [spider flower]
ref|XP_002518136.1|  3-ketoacyl-CoA thiolase B, putative                224   5e-67   
ref|XP_004296638.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    224   6e-67   Fragaria vesca subsp. vesca
ref|XP_007225742.1|  hypothetical protein PRUPE_ppa005421mg             224   7e-67   Prunus persica
ref|XP_007034450.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2    220   9e-67   Theobroma cacao [chocolate]
ref|XP_008224585.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    223   1e-66   Prunus mume [ume]
gb|EPS68937.1|  hypothetical protein M569_05826                         223   1e-66   Genlisea aurea
gb|KDO43605.1|  hypothetical protein CISIN_1g012506mg                   219   3e-66   Citrus sinensis [Valencia orange]
ref|XP_010069076.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    221   5e-66   Eucalyptus grandis [rose gum]
ref|XP_007034449.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1    221   6e-66   Theobroma cacao [chocolate]
ref|XP_009376354.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    221   8e-66   Pyrus x bretschneideri [bai li]
gb|KDO43604.1|  hypothetical protein CISIN_1g012506mg                   219   1e-65   Citrus sinensis [Valencia orange]
ref|XP_004138952.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    220   1e-65   Cucumis sativus [cucumbers]
ref|XP_004164123.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    220   1e-65   
gb|AFW68655.1|  hypothetical protein ZEAMMB73_512974                    213   1e-65   Zea mays [maize]
gb|ABK94786.1|  unknown                                                 216   2e-65   Populus trichocarpa [western balsam poplar]
emb|CAN81585.1|  hypothetical protein VITISV_023191                     219   2e-65   Vitis vinifera
ref|XP_002285653.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    219   2e-65   Vitis vinifera
ref|XP_008380600.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    219   3e-65   Malus domestica [apple tree]
gb|KDO43600.1|  hypothetical protein CISIN_1g012506mg                   219   3e-65   Citrus sinensis [Valencia orange]
ref|NP_001142099.1|  uncharacterized protein LOC100274263               212   4e-65   Zea mays [maize]
ref|XP_008457258.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    219   4e-65   Cucumis melo [Oriental melon]
gb|KDO43599.1|  hypothetical protein CISIN_1g012506mg                   219   4e-65   Citrus sinensis [Valencia orange]
ref|XP_006420604.1|  hypothetical protein CICLE_v10004931mg             219   5e-65   Citrus clementina
gb|AFK47277.1|  unknown                                                 209   6e-65   Medicago truncatula
gb|KDP20330.1|  hypothetical protein JCGZ_06416                         218   9e-65   Jatropha curcas
gb|AFW68656.1|  hypothetical protein ZEAMMB73_512974                    213   9e-65   Zea mays [maize]
ref|XP_010522426.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    217   2e-64   Tarenaya hassleriana [spider flower]
pir||S72532  acetyl-CoA C-acyltransferase (EC 2.3.1.16) precursor...    217   2e-64
gb|AFW68657.1|  hypothetical protein ZEAMMB73_512974                    214   2e-64   Zea mays [maize]
ref|XP_002299284.2|  hypothetical protein POPTR_0001s14280g             217   3e-64   Populus trichocarpa [western balsam poplar]
ref|XP_006662414.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    216   4e-64   Oryza brachyantha
ref|XP_004497755.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    216   4e-64   Cicer arietinum [garbanzo]
ref|XP_010243983.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    216   8e-64   Nelumbo nucifera [Indian lotus]
gb|AFK34605.1|  unknown                                                 211   9e-64   Lotus japonicus
ref|XP_006443651.1|  hypothetical protein CICLE_v10020068mg             216   9e-64   Citrus clementina
gb|ACV70032.1|  3-ketoacyl CoA thiolase 1                               215   1e-63   Petunia x hybrida [garden petunia]
ref|XP_010099126.1|  3-ketoacyl-CoA thiolase 2                          215   2e-63   Morus notabilis
ref|XP_011002175.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    214   2e-63   Populus euphratica
ref|NP_001267690.1|  3-ketoacyl-CoA thiolase 2, peroxisomal-like        214   3e-63   Cucumis sativus [cucumbers]
ref|XP_006368897.1|  hypothetical protein POPTR_0001s14290g             214   3e-63   Populus trichocarpa [western balsam poplar]
gb|ACN29136.1|  unknown                                                 213   5e-63   Zea mays [maize]
ref|XP_011034453.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    213   5e-63   Populus euphratica
ref|XP_011002176.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    213   6e-63   Populus euphratica
ref|XP_006854408.1|  hypothetical protein AMTR_s00039p00196630          213   1e-62   Amborella trichopoda
gb|ACN39947.1|  unknown                                                 213   1e-62   Picea sitchensis
ref|XP_009796304.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    212   4e-62   Nicotiana sylvestris
gb|KEH41248.1|  3-ketoacyl-CoA thiolase 2, peroxisomal-like protein     211   4e-62   Medicago truncatula
gb|EEC67095.1|  hypothetical protein OsI_33888                          211   4e-62   Oryza sativa Indica Group [Indian rice]
ref|NP_001064764.1|  Os10g0457600                                       211   4e-62   
ref|XP_007145410.1|  hypothetical protein PHAVU_007G236600g             211   4e-62   Phaseolus vulgaris [French bean]
ref|XP_009796305.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    211   5e-62   Nicotiana sylvestris
ref|XP_009629663.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    211   7e-62   Nicotiana tomentosiformis
ref|NP_001238475.1|  peroxisomal 3-ketoacyl-CoA thiolase                210   1e-61   Glycine max [soybeans]
pdb|2WUA|A  Chain A, Structure Of The Peroxisomal 3-Ketoacyl-Coa ...    209   1e-61   Helianthus annuus
ref|XP_010918893.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    210   1e-61   Elaeis guineensis
ref|XP_002467133.1|  hypothetical protein SORBIDRAFT_01g020150          209   3e-61   Sorghum bicolor [broomcorn]
ref|XP_011020688.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    209   3e-61   Populus euphratica
ref|XP_011020687.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    209   3e-61   Populus euphratica
gb|AAQ77242.1|  acetoacetyl CoA thiolase                                208   4e-61   Helianthus annuus
gb|EMS60447.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  208   4e-61   Triticum urartu
ref|XP_003555712.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    208   5e-61   Glycine max [soybeans]
ref|XP_009400955.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    208   7e-61   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR16781.1|  unknown                                                 208   8e-61   Picea sitchensis
ref|XP_008349047.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    202   1e-60   Malus domestica [apple tree]
gb|EMT31542.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  207   1e-60   Aegilops tauschii
ref|XP_008235516.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    207   1e-60   Prunus mume [ume]
dbj|BAI66423.1|  3-ketoacyl-CoA thiolase-like protein                   207   1e-60   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ87577.1|  predicted protein                                      207   2e-60   Hordeum vulgare subsp. vulgare [barley]
ref|XP_007201004.1|  hypothetical protein PRUPE_ppa005303mg             207   2e-60   Prunus persica
ref|XP_011006998.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    206   2e-60   Populus euphratica
ref|XP_004247103.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    206   2e-60   Solanum lycopersicum
ref|XP_002521123.1|  3-ketoacyl-CoA thiolase B, putative                207   2e-60   Ricinus communis
ref|XP_006350308.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    206   2e-60   Solanum tuberosum [potatoes]
ref|XP_004954382.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    206   5e-60   Setaria italica
gb|EMS48058.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  205   8e-60   Triticum urartu
gb|EYU17978.1|  hypothetical protein MIMGU_mgv1a005895mg                205   8e-60   Erythranthe guttata [common monkey flower]
ref|XP_008800565.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    204   1e-59   Phoenix dactylifera
ref|XP_003570403.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    204   1e-59   Brachypodium distachyon [annual false brome]
ref|XP_009411367.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    204   2e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001131193.1|  acetyl-CoA C-acyltransferase-like protein          204   2e-59   Zea mays [maize]
ref|XP_003574006.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    204   2e-59   Brachypodium distachyon [annual false brome]
ref|XP_010933143.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    204   3e-59   Elaeis guineensis
ref|XP_010547052.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    203   3e-59   Tarenaya hassleriana [spider flower]
ref|XP_010935683.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    204   3e-59   Elaeis guineensis
ref|XP_010547051.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    204   4e-59   Tarenaya hassleriana [spider flower]
ref|XP_008804745.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    203   6e-59   Phoenix dactylifera
emb|CDP03848.1|  unnamed protein product                                203   6e-59   Coffea canephora [robusta coffee]
ref|XP_010547050.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    203   6e-59   Tarenaya hassleriana [spider flower]
ref|XP_010940650.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    203   7e-59   Elaeis guineensis
ref|NP_001241698.1|  3-ketoacyl-CoA thiolase 2, peroxisomal precu...    202   7e-59   Zea mays [maize]
ref|XP_010038353.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    202   9e-59   Eucalyptus grandis [rose gum]
ref|XP_004982961.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    202   1e-58   Setaria italica
gb|ABR17647.1|  unknown                                                 202   1e-58   Picea sitchensis
ref|XP_008804452.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    202   2e-58   Phoenix dactylifera
gb|KJB10128.1|  hypothetical protein B456_001G185200                    201   2e-58   Gossypium raimondii
ref|XP_010484155.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    201   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_011083116.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    201   2e-58   Sesamum indicum [beniseed]
ref|XP_007049825.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1    201   3e-58   Theobroma cacao [chocolate]
ref|XP_010484150.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    201   3e-58   Camelina sativa [gold-of-pleasure]
ref|XP_008438387.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    201   3e-58   Cucumis melo [Oriental melon]
emb|CDX86611.1|  BnaC08g00920D                                          201   4e-58   Brassica napus [oilseed rape]
ref|XP_001762605.1|  predicted protein                                  200   6e-58   Physcomitrella patens
ref|XP_008372446.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    200   6e-58   Malus domestica [apple tree]
ref|XP_009385864.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    200   8e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009111084.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    199   9e-58   Brassica rapa
gb|KHG11493.1|  3-ketoacyl-CoA thiolase 2, peroxisomal -like protein    200   1e-57   Gossypium arboreum [tree cotton]
ref|XP_002889522.1|  hypothetical protein ARALYDRAFT_470458             199   1e-57   Arabidopsis lyrata subsp. lyrata
ref|XP_010457531.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    199   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_009371217.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    199   2e-57   Pyrus x bretschneideri [bai li]
gb|KDP26413.1|  hypothetical protein JCGZ_17571                         199   2e-57   Jatropha curcas
pdb|2C7Y|A  Chain A, Plant Enzyme                                       197   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002963753.1|  hypothetical protein SELMODRAFT_450889             199   2e-57   Selaginella moellendorffii
emb|CDY15520.1|  BnaA08g28040D                                          198   2e-57   Brassica napus [oilseed rape]
ref|XP_010475137.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    197   4e-57   Camelina sativa [gold-of-pleasure]
ref|XP_009336047.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    197   5e-57   Pyrus x bretschneideri [bai li]
ref|XP_006307517.1|  hypothetical protein CARUB_v10009140mg             197   6e-57   Capsella rubella
ref|NP_171965.1|  3-ketoacyl-CoA thiolase 1                             197   6e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010109695.1|  3-ketoacyl-CoA thiolase 2                          197   9e-57   Morus notabilis
ref|XP_002974835.1|  hypothetical protein SELMODRAFT_101898             197   9e-57   Selaginella moellendorffii
gb|AAB80634.1|  Strong similarity to Cucumis acetyl-CoA acyltrans...    197   1e-56   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD94007.1|  peroxisomal-3-keto-acyl-CoA thiolase 1                 190   1e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001764272.1|  predicted protein                                  196   2e-56   Physcomitrella patens
gb|KJB42403.1|  hypothetical protein B456_007G152600                    193   4e-56   Gossypium raimondii
emb|CDY05657.1|  BnaC02g38800D                                          195   6e-56   Brassica napus [oilseed rape]
gb|AAM61609.1|  putative acetyl-CoA acyltransferase                     194   8e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009129751.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    192   2e-55   Brassica rapa
gb|KJB42405.1|  hypothetical protein B456_007G152600                    193   3e-55   Gossypium raimondii
ref|XP_004290230.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    193   3e-55   Fragaria vesca subsp. vesca
gb|KJB42404.1|  hypothetical protein B456_007G152600                    193   3e-55   Gossypium raimondii
ref|XP_002865685.1|  KAT5/PKT1/PKT2 peroxisomal 3-keto-acyl-CoA t...    193   3e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_006395130.1|  hypothetical protein EUTSA_v10004174mg             192   4e-55   Eutrema salsugineum
gb|KHG13200.1|  3-ketoacyl-CoA thiolase 2, peroxisomal -like protein    192   4e-55   Gossypium arboreum [tree cotton]
emb|CDY33940.1|  BnaA02g30470D                                          192   5e-55   Brassica napus [oilseed rape]
ref|XP_009129750.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    192   6e-55   Brassica rapa
ref|XP_006395129.1|  hypothetical protein EUTSA_v10004174mg             192   7e-55   Eutrema salsugineum
ref|XP_008365692.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    183   1e-54   
gb|ACU19231.1|  unknown                                                 183   3e-54   Glycine max [soybeans]
ref|NP_851157.1|  3-keto-acyl-CoA thiolase 2                            189   3e-54   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF02017.1|  peroxisomal-3-keto-acyl-CoA thiolase 1                 189   3e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010442338.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    189   4e-54   Camelina sativa [gold-of-pleasure]
ref|XP_002301570.1|  hypothetical protein POPTR_0002s22410g             190   6e-54   Populus trichocarpa [western balsam poplar]
ref|NP_568704.2|  3-keto-acyl-CoA thiolase 2                            189   6e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010684942.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    189   9e-54   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010442336.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    189   9e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010439770.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    188   1e-53   Camelina sativa [gold-of-pleasure]
ref|XP_006280441.1|  hypothetical protein CARUB_v10026373mg             189   1e-53   Capsella rubella
ref|XP_009336051.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    188   2e-53   Pyrus x bretschneideri [bai li]
gb|AIB06952.1|  3-ketoacyl-CoA thiolase                                 188   3e-53   Vanda hybrid cultivar
ref|XP_010439766.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    188   3e-53   Camelina sativa [gold-of-pleasure]
ref|XP_006649171.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    187   7e-53   Oryza brachyantha
ref|XP_009384048.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    186   2e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001048523.1|  Os02g0817700                                       186   2e-52   
ref|XP_004152018.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    185   4e-52   Cucumis sativus [cucumbers]
ref|NP_001237076.1|  3-ketoacyl-CoA thiolase                            184   6e-52   Glycine max [soybeans]
ref|XP_008454505.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    184   9e-52   
gb|ADE77908.1|  unknown                                                 183   2e-51   Picea sitchensis
ref|XP_008454504.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    184   2e-51   
gb|AFK39397.1|  unknown                                                 173   4e-51   Lotus japonicus
ref|XP_008382649.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    174   7e-51   
ref|XP_003604976.1|  3-ketoacyl-CoA thiolase 2, peroxisomal             181   9e-51   Medicago truncatula
gb|KFK42814.1|  hypothetical protein AALP_AA1G042000                    181   1e-50   Arabis alpina [alpine rockcress]
ref|XP_005646163.1|  thiolase                                           181   1e-50   Coccomyxa subellipsoidea C-169
gb|KHN15993.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  180   2e-50   Glycine soja [wild soybean]
gb|AFK40880.1|  unknown                                                 179   3e-50   Medicago truncatula
ref|XP_003632434.2|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    179   4e-50   Vitis vinifera
ref|NP_001242568.1|  uncharacterized protein LOC100789930               179   6e-50   Glycine max [soybeans]
ref|XP_004506669.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    178   9e-50   Cicer arietinum [garbanzo]
ref|XP_007034451.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3    175   2e-49   Theobroma cacao [chocolate]
ref|XP_010482155.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    177   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_007153157.1|  hypothetical protein PHAVU_003G011600g             177   3e-49   Phaseolus vulgaris [French bean]
ref|XP_010482154.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    176   8e-49   Camelina sativa [gold-of-pleasure]
gb|KJB72152.1|  hypothetical protein B456_011G161700                    176   9e-49   Gossypium raimondii
ref|XP_008355236.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    166   2e-48   Malus domestica [apple tree]
ref|XP_004506590.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    174   2e-48   Cicer arietinum [garbanzo]
ref|XP_002989683.1|  hypothetical protein SELMODRAFT_447769             173   4e-48   Selaginella moellendorffii
gb|AAK76732.1|  3-ketoacyl-CoA thiolase                                 165   6e-48   Gossypium hirsutum [American cotton]
emb|CAA53078.1|  3-ketoacyl-CoA thiolase B                              170   8e-47   Mangifera indica
gb|KDO43601.1|  hypothetical protein CISIN_1g012506mg                   170   1e-46   Citrus sinensis [Valencia orange]
ref|XP_002991797.1|  hypothetical protein SELMODRAFT_236388             163   2e-44   Selaginella moellendorffii
ref|XP_008678417.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    158   4e-44   Zea mays [maize]
ref|XP_007049826.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2    155   6e-41   Theobroma cacao [chocolate]
gb|KCW50166.1|  hypothetical protein EUGRSUZ_K03601                     153   4e-40   Eucalyptus grandis [rose gum]
ref|XP_011400620.1|  3-ketoacyl-CoA thiolase 2, peroxisomal             151   2e-39   Auxenochlorella protothecoides
ref|XP_003061899.1|  predicted protein                                  149   2e-39   Micromonas pusilla CCMP1545
ref|XP_002946078.1|  hypothetical protein VOLCADRAFT_102696             149   8e-39   Volvox carteri f. nagariensis
ref|XP_002500295.1|  acetyl-coa acyltransferase                         149   1e-38   Micromonas commoda
gb|KDD73648.1|  beta-ketoacyl-ACP synthase                              147   4e-38   Helicosporidium sp. ATCC 50920
ref|XP_010206319.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    136   4e-37   Colius striatus
gb|ABR25554.1|  peroxisomal 3-ketoacyl-coa thiolase 2 precursor         140   4e-37   Oryza sativa Indica Group [Indian rice]
gb|EDL76925.1|  rCG25918, isoform CRA_d                                 137   6e-37   Rattus norvegicus [brown rat]
ref|XP_010172441.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    140   8e-37   Caprimulgus carolinensis
ref|XP_004676369.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    143   9e-37   Condylura cristata
ref|XP_003456538.2|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    143   1e-36   Oreochromis niloticus
gb|AAH26669.1|  Acaa1a protein                                          137   1e-36   Mus musculus [mouse]
gb|ELK29226.1|  3-ketoacyl-CoA thiolase, peroxisomal                    142   1e-36   Myotis davidii
gb|EAW64514.1|  acetyl-Coenzyme A acyltransferase 1 (peroxisomal ...    134   2e-36   Homo sapiens [man]
ref|XP_008522879.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    142   2e-36   Equus przewalskii [Przewalski horse]
ref|XP_010075883.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    141   2e-36   Pterocles gutturalis
ref|XP_004759760.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    142   2e-36   
gb|EAW64515.1|  acetyl-Coenzyme A acyltransferase 1 (peroxisomal ...    136   2e-36   Homo sapiens [man]
gb|EPQ17921.1|  3-ketoacyl-CoA thiolase, peroxisomal                    141   2e-36   Myotis brandtii
ref|XP_006109905.1|  PREDICTED: LOW QUALITY PROTEIN: acetyl-CoA a...    141   2e-36   
ref|XP_004823725.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    142   2e-36   
ref|XP_006765161.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    142   3e-36   Myotis davidii
ref|XP_003464147.2|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    142   3e-36   Cavia porcellus [guinea pig]
gb|EDL76924.1|  rCG25918, isoform CRA_c                                 139   3e-36   Rattus norvegicus [brown rat]
ref|XP_011217239.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    141   3e-36   Ailuropoda melanoleuca
ref|XP_006749538.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    140   3e-36   Leptonychotes weddellii
ref|WP_012281246.1|  acetyl-CoA acetyltransferase                       141   3e-36   Heliobacterium modesticaldum
ref|XP_004471223.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    135   4e-36   
ref|WP_013075085.1|  acetyl-CoA acetyltransferase                       141   4e-36   Kyrpidia tusciae
ref|XP_003781848.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    141   4e-36   
gb|EGW00823.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  138   4e-36   Cricetulus griseus [Chinese hamsters]
ref|XP_005634306.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    140   5e-36   Canis lupus familiaris [dogs]
gb|EOA95880.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  140   5e-36   Anas platyrhynchos [duck]
ref|XP_008153138.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    141   5e-36   Eptesicus fuscus
ref|XP_005882731.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    141   6e-36   
ref|XP_005027361.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    140   6e-36   Anas platyrhynchos [duck]
ref|XP_001697225.1|  acetyl-CoA acyltransferase                         141   6e-36   Chlamydomonas reinhardtii
ref|XP_004419563.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    141   6e-36   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_006806602.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    141   6e-36   Neolamprologus brichardi [lyretail cichlid]
ref|XP_011217238.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    140   7e-36   Ailuropoda melanoleuca
ref|XP_008844714.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    140   7e-36   
ref|XP_001488609.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    141   7e-36   Equus caballus [domestic horse]
ref|XP_005317428.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    140   7e-36   Ictidomys tridecemlineatus
ref|XP_007615644.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    139   7e-36   Cricetulus griseus [Chinese hamsters]
ref|XP_007081088.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    140   7e-36   Panthera tigris altaica
ref|XP_002914680.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    140   7e-36   Ailuropoda melanoleuca
ref|XP_009505170.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    137   8e-36   Phalacrocorax carbo [common cormorant]
ref|XP_003992303.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    140   8e-36   Felis catus [cat]
ref|XP_003132151.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    140   8e-36   Sus scrofa [pigs]
ref|XP_004642271.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    140   9e-36   
gb|KFV08282.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  139   9e-36   Tauraco erythrolophus
ref|XP_010785602.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    140   9e-36   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_006511987.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    137   9e-36   Mus musculus [mouse]
ref|XP_006512177.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    137   9e-36   Mus musculus [mouse]
gb|EDL09222.1|  mCG20972, isoform CRA_b                                 137   9e-36   Mus musculus [mouse]
ref|XP_004835307.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    140   1e-35   Heterocephalus glaber [naked mole rat]
gb|EHB16856.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  140   1e-35   Heterocephalus glaber [naked mole rat]
ref|XP_004906796.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    140   1e-35   
ref|XP_008250935.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    140   1e-35   
ref|XP_004339798.1|  acetylCoA acyltransferase, putative                140   1e-35   Acanthamoeba castellanii str. Neff
ref|XP_005386652.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    140   1e-35   
gb|ELU09588.1|  hypothetical protein CAPTEDRAFT_229355                  140   1e-35   
ref|XP_534222.2|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal...    140   1e-35   
gb|AHH81817.1|  3-ketoacyl- thiolase peroxisomal-like protein           132   2e-35   
ref|XP_007437964.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    136   2e-35   
ref|XP_004538713.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    140   2e-35   
ref|XP_008710007.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    140   2e-35   
ref|XP_005424411.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    139   2e-35   
ref|XP_005940527.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    140   2e-35   
gb|KFW92214.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  137   2e-35   
gb|EGW00828.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  139   2e-35   
gb|KFW09333.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  139   2e-35   
ref|XP_009975644.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    139   2e-35   
ref|XP_007910458.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    138   2e-35   
ref|XP_005748614.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    140   2e-35   
gb|EMC83181.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  139   2e-35   
ref|XP_004835306.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    140   2e-35   
ref|XP_006713186.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    136   2e-35   
ref|XP_005348137.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    139   2e-35   
dbj|BAC32386.1|  unnamed protein product                                137   2e-35   
ref|XP_009941382.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    138   2e-35   
ref|XP_004662051.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    139   2e-35   
gb|KFR17430.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  138   3e-35   
ref|XP_005317422.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    139   3e-35   
ref|WP_005826653.1|  MULTISPECIES: acetyl-CoA acetyltransferase         139   3e-35   
gb|ELV10533.1|  3-ketoacyl-CoA thiolase, peroxisomal                    138   3e-35   
ref|XP_009066824.1|  hypothetical protein LOTGIDRAFT_134529             139   3e-35   
ref|XP_005348140.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    139   3e-35   
ref|XP_009580990.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    139   3e-35   
ref|XP_004315495.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    138   3e-35   
ref|XP_011480271.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    138   3e-35   
ref|XP_006634258.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    139   3e-35   
ref|XP_006890653.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    139   3e-35   
ref|WP_027718458.1|  acetyl-CoA acetyltransferase                       139   3e-35   
ref|XP_005509181.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    138   3e-35   
ref|XP_005849380.1|  hypothetical protein CHLNCDRAFT_143854             139   3e-35   
ref|XP_003505982.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    139   3e-35   
sp|P21775.2|THIKA_RAT  RecName: Full=3-ketoacyl-CoA thiolase A, p...    139   4e-35   
ref|XP_009963091.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    137   4e-35   
gb|EDL76915.1|  rCG25819, isoform CRA_a                                 139   4e-35   
ref|XP_003415748.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    139   4e-35   
ref|XP_006986793.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    139   4e-35   
dbj|BAA14106.1|  peroxisomal 3-ketoacyl-CoA thiolase A                  139   4e-35   
ref|XP_001418570.1|  predicted protein                                  139   4e-35   
gb|KFW01783.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  137   4e-35   
sp|P07871.2|THIKB_RAT  RecName: Full=3-ketoacyl-CoA thiolase B, p...    139   4e-35   
gb|KFV42249.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  137   4e-35   
ref|NP_001035108.1|  3-ketoacyl-CoA thiolase B, peroxisomal precu...    139   4e-35   
ref|XP_007644623.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    139   5e-35   
ref|XP_011241272.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    137   5e-35   
gb|KFM05271.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  137   5e-35   
emb|CAA35825.1|  3-oxoacyl-CoA thiolase                                 137   5e-35   
ref|XP_004676370.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    137   5e-35   
ref|XP_002193705.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    138   5e-35   
ref|XP_007127846.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    138   6e-35   
ref|XP_009556582.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    137   6e-35   
ref|XP_006169029.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    138   6e-35   
gb|KFW87055.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  137   6e-35   
gb|KFP47895.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  137   6e-35   
ref|XP_010146289.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    137   6e-35   
ref|XP_002199792.2|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    137   6e-35   
gb|KFQ33519.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  137   6e-35   
ref|XP_008929499.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    137   6e-35   
ref|XP_010293422.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    137   6e-35   
gb|KFO74220.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  137   6e-35   
gb|KFR09032.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  137   6e-35   
ref|XP_004704131.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    138   6e-35   
ref|XP_009707186.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    137   6e-35   
ref|XP_009473628.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    137   7e-35   
ref|XP_007298178.1|  thiolase                                           138   7e-35   
ref|XP_005527826.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    137   7e-35   
ref|XP_008942616.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    137   7e-35   
gb|KFO38323.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  138   7e-35   
ref|WP_025844039.1|  acetyl-CoA acetyltransferase                       137   7e-35   
dbj|BAE35878.1|  unnamed protein product                                137   7e-35   
ref|XP_007462753.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    138   7e-35   
gb|KFW73684.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  137   8e-35   
ref|XP_004277954.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    138   8e-35   
ref|WP_027356783.1|  acetyl-CoA acetyltransferase                       137   8e-35   
gb|KGL97637.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  137   8e-35   
ref|XP_005442450.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    137   8e-35   
ref|NP_570934.1|  3-ketoacyl-CoA thiolase A, peroxisomal precursor      138   8e-35   
ref|XP_006869210.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    138   8e-35   
ref|XP_003762905.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    138   9e-35   
ref|XP_007127844.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    138   9e-35   
dbj|BAE25296.1|  unnamed protein product                                137   9e-35   
ref|NP_666342.1|  3-ketoacyl-CoA thiolase B, peroxisomal precursor      137   1e-34   
ref|XP_010190011.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    137   1e-34   
gb|EWM24705.1|  3-ketoacyl- thiolase peroxisomal                        137   1e-34   
ref|XP_005241038.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    137   1e-34   
ref|NP_036621.1|  3-ketoacyl-CoA thiolase A, peroxisomal                137   1e-34   
ref|XP_009484735.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    136   1e-34   
ref|XP_008276561.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    137   1e-34   
ref|XP_010114568.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    136   1e-34   
ref|XP_010616927.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    137   1e-34   
ref|WP_013172082.1|  acetyl-CoA acetyltransferase [                     137   1e-34   
gb|KFQ63006.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  137   1e-34   
ref|XP_005854303.1|  beta-ketoacyl-CoA thiolase                         137   1e-34   
gb|ACO51137.1|  acetyl-coenzyme A acyltransferase 1                     135   1e-34   
gb|KFP39992.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  136   1e-34   
ref|XP_007517129.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    137   1e-34   
ref|XP_007253620.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    137   1e-34   
ref|NP_001187475.1|  peroxisomal 3-ketoacyl-CoA thiolase A              137   1e-34   
ref|WP_013821404.1|  acetyl-CoA acetyltransferase                       137   1e-34   
gb|KFO08431.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  136   1e-34   
ref|XP_008949804.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    136   1e-34   
ref|XP_010311931.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    136   1e-34   
dbj|BAG57147.1|  unnamed protein product                                136   1e-34   
dbj|BAA14107.1|  peroxisomal 3-ketoacyl-CoA thiolase B                  137   1e-34   
ref|NP_001184217.1|  acetyl-Coenzyme A acyltransferase 1 (peroxis...    137   1e-34   
ref|XP_009820505.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    136   1e-34   
ref|XP_005297193.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    137   1e-34   
ref|XP_004588416.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    137   1e-34   
ref|XP_009888784.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    137   1e-34   
ref|XP_010710649.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    137   1e-34   
ref|XP_009078375.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    136   2e-34   
gb|KFV40730.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  136   2e-34   
ref|XP_008641380.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    136   2e-34   
gb|KFO66172.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  136   2e-34   
gb|KFV86553.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  136   2e-34   
ref|XP_004018276.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    136   2e-34   
gb|EMP29415.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  136   2e-34   
ref|WP_023558379.1|  acetyl-CoA acetyltransferase                       136   2e-34   
ref|WP_007726308.1|  acetyl-CoA acetyltransferase                       136   2e-34   
ref|XP_004412369.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    137   2e-34   
ref|XP_005491482.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    137   2e-34   
ref|XP_005040594.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    137   2e-34   
ref|WP_015893130.1|  acetyl-CoA acetyltransferase                       136   2e-34   
gb|KFQ13333.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  136   2e-34   
ref|XP_004823726.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    135   2e-34   
ref|XP_010865004.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    137   2e-34   
ref|XP_009084024.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    137   2e-34   
ref|XP_005849184.1|  hypothetical protein CHLNCDRAFT_143855             137   3e-34   
pdb|2IIK|A  Chain A, Crystal Structure Of Human Peroxisomal Acety...    136   3e-34   
ref|XP_007066606.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    135   3e-34   
ref|XP_003724378.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    137   3e-34   
ref|XP_009443455.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    136   3e-34   
gb|KFP20301.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  135   3e-34   
ref|XP_003256905.2|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    136   3e-34   
ref|XP_008161239.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    136   3e-34   
ref|XP_005994280.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    136   3e-34   
gb|KII93771.1|  hypothetical protein PLICRDRAFT_88102                   136   3e-34   
ref|XP_003930949.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    136   3e-34   
ref|XP_008314704.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    136   3e-34   
ref|XP_004880487.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    136   3e-34   
ref|XP_002813979.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    136   3e-34   
ref|XP_007943891.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    135   3e-34   
ref|XP_004854313.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    136   3e-34   
ref|NP_001598.1|  3-ketoacyl-CoA thiolase, peroxisomal isoform a        136   3e-34   
ref|XP_005297192.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    136   3e-34   
ref|XP_003283381.1|  acetyl-CoA C-acyltransferase                       136   3e-34   
ref|XP_003781849.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    134   4e-34   
ref|XP_003132152.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    134   4e-34   
ref|XP_008066531.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    136   4e-34   
ref|XP_001373770.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    136   4e-34   
ref|XP_007191535.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    136   4e-34   
ref|XP_004033892.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    136   4e-34   
ref|XP_006173724.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    135   4e-34   
ref|XP_010944140.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    135   4e-34   
emb|CBJ49265.1|  3-ketoacyl-CoA thiolase                                135   4e-34   
ref|XP_009274247.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    136   4e-34   
ref|XP_009683500.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    136   4e-34   
ref|XP_007578554.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    136   4e-34   
ref|XP_004419564.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    134   4e-34   
ref|XP_010393120.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    136   4e-34   
ref|XP_009642386.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    135   4e-34   
ref|XP_002591918.1|  hypothetical protein BRAFLDRAFT_284464             136   4e-34   
ref|WP_010676464.1|  acetyl-CoA acetyltransferase                       135   4e-34   
ref|XP_006200711.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    136   4e-34   
ref|XP_005975939.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    136   4e-34   
ref|XP_006023013.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    134   5e-34   
ref|XP_005150078.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    136   5e-34   
gb|KFP07326.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  135   5e-34   
ref|NP_001029491.1|  3-ketoacyl-CoA thiolase, peroxisomal               135   5e-34   
ref|WP_028988167.1|  acetyl-CoA acetyltransferase                       135   5e-34   
ref|XP_005383786.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    135   5e-34   
gb|KFV66334.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  135   5e-34   
ref|XP_009923469.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    135   5e-34   
ref|XP_002759778.2|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    135   5e-34   
ref|XP_009897418.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    134   5e-34   
ref|XP_003363186.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    134   5e-34   
ref|WP_016742937.1|  acetyl-CoA acetyltransferase                       135   6e-34   
gb|KDO30583.1|  hypothetical protein SPRG_04484                         135   6e-34   
ref|XP_010016183.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    134   6e-34   
ref|XP_010004292.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    135   6e-34   
ref|XP_010980336.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    135   7e-34   
ref|XP_004635291.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    135   7e-34   
ref|WP_039742527.1|  beta-ketoadipyl CoA thiolase                       135   7e-34   
ref|XP_004880486.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    135   7e-34   
ref|XP_008153145.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    134   7e-34   
gb|KFQ52653.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  134   7e-34   
ref|XP_004854312.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    135   7e-34   
ref|XP_003080093.1|  Dynein 1-alpha heavy chain, flagellar inner ...    140   7e-34   
dbj|GAC72686.1|  3-oxoacyl CoA thiolase                                 135   7e-34   
gb|KGG50758.1|  hypothetical protein DI09_57p130                        135   7e-34   
dbj|GAK62987.1|  thiolase                                               135   8e-34   
ref|XP_005001163.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    134   8e-34   
ref|XP_007943890.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    135   8e-34   
ref|XP_008500452.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    135   8e-34   
ref|XP_004835308.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    134   8e-34   
gb|EJK62852.1|  hypothetical protein THAOC_16519                        135   8e-34   
ref|XP_008584769.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    134   8e-34   
emb|CCA20150.1|  3ketoacylCoA thiolase A putative                       135   8e-34   
ref|XP_005695607.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    134   8e-34   
ref|WP_017251472.1|  acetyl-CoA acetyltransferase                       134   8e-34   
ref|NP_001002207.1|  3-ketoacyl-CoA thiolase, peroxisomal               135   9e-34   
ref|XP_010739674.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    135   9e-34   
ref|XP_006120630.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    134   9e-34   
ref|XP_009952311.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    135   9e-34   
ref|XP_005386653.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    134   9e-34   
emb|CEF98532.1|  Thiolase-like, subgroup                                135   1e-33   
ref|XP_010144408.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    134   1e-33   
ref|XP_003221941.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    135   1e-33   
ref|XP_010559421.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    135   1e-33   
ref|XP_001519626.3|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    132   1e-33   
ref|XP_005317423.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    133   1e-33   
dbj|GAK81920.1|  acetyl-CoA acetyltransferase                           127   1e-33   
ref|XP_005317429.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    133   1e-33   
ref|XP_859532.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal...    133   1e-33   
ref|WP_031411602.1|  acetyl-CoA acetyltransferase                       134   1e-33   
ref|WP_034673686.1|  acetyl-CoA acetyltransferase                       134   1e-33   



>gb|ABB45810.1| acetoacetyl-CoA thiolase [Salvia miltiorrhiza]
Length=172

 Score =   231 bits (589),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLEL+D DLFEINEAFASQ+LYC+ KLGLDPEKINVNGGAMAIGHPLGATGA
Sbjct  51   IPAAVKSAGLELEDIDLFEINEAFASQFLYCRNKLGLDPEKINVNGGAMAIGHPLGATGA  110

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAA VFERGDACDEL N RKVE   +LSKD
Sbjct  111  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAAVFERGDACDELCNTRKVEAQNFLSKD  170

Query  362  AR  367
            AR
Sbjct  171  AR  172



>ref|XP_010473862.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Camelina 
sativa]
Length=157

 Score =   223 bits (569),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLGATGA
Sbjct  36   IPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGATGA  95

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE  G LSKD
Sbjct  96   RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGLLSKD  155

Query  362  AR  367
            AR
Sbjct  156  AR  157



>dbj|BAD95031.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
Length=343

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQ++YC+ KLGLDPEKINVNGGAMAIGHPLGATGA
Sbjct  222  IPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGA  281

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE  G LSKD
Sbjct  282  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGLLSKD  341

Query  362  AR  367
            AR
Sbjct  342  AR  343



>emb|CDO99410.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLEL+D DLFEINEAFASQ++YC++KLGLDPEKINVNGGAMAIGHPLGATGA
Sbjct  340  IPAAVKSAGLELEDIDLFEINEAFASQFVYCREKLGLDPEKINVNGGAMAIGHPLGATGA  399

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD+CDEL NARK+E +  LSKD
Sbjct  400  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDSCDELCNARKIEANNLLSKD  459

Query  362  AR  367
            AR
Sbjct  460  AR  461



>ref|XP_010696158.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Beta vulgaris 
subsp. vulgaris]
Length=462

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQ+LYC+KKL LDPEKINVNGGAMAIGHPLGATGA
Sbjct  341  IPAAVKAAGLELDDIDLFEINEAFASQFLYCRKKLDLDPEKINVNGGAMAIGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGDA D+L NARKVE+HG LSKD
Sbjct  401  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDAADDLCNARKVESHGLLSKD  460

Query  362  AR  367
            A+
Sbjct  461  AK  462



>gb|AGC59769.1| 3-ketoacyl-CoA thiolase 1 [Rehmannia glutinosa]
Length=464

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLEL D DLFE+NEAFASQ++YC+KKL LDPEKINVNGGAMAIGHPLG TGA
Sbjct  343  IPAAVKSAGLELGDIDLFEVNEAFASQFVYCRKKLELDPEKINVNGGAMAIGHPLGVTGA  402

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD+CDELSNAR V TH +LSKD
Sbjct  403  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDSCDELSNARTVGTHNFLSKD  462

Query  362  AR  367
            AR
Sbjct  463  AR  464



>pdb|2WU9|A Chain A, Crystal Structure Of Peroxisomal Kat2 From Arabidopsis 
Thaliana
 pdb|2WU9|B Chain B, Crystal Structure Of Peroxisomal Kat2 From Arabidopsis 
Thaliana
Length=442

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQ++YC+ KLGLDPEKINVNGGAMAIGHPLGATGA
Sbjct  321  IPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGA  380

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE  G LSKD
Sbjct  381  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGLLSKD  440

Query  362  AR  367
            AR
Sbjct  441  AR  442



>ref|XP_006294172.1| hypothetical protein CARUB_v10023167mg [Capsella rubella]
 gb|EOA27070.1| hypothetical protein CARUB_v10023167mg [Capsella rubella]
Length=462

 Score =   229 bits (585),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLGATGA
Sbjct  341  IPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVET G LSKD
Sbjct  401  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVETQGLLSKD  460

Query  362  AR  367
            AR
Sbjct  461  AR  462



>gb|EYU32624.1| hypothetical protein MIMGU_mgv1a005944mg [Erythranthe guttata]
Length=464

 Score =   229 bits (584),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLEL D DLFEINEAFASQ+LYCQKKL LDP KINVNGGAMAIGHPLGATGA
Sbjct  343  IPAAVKAAGLELGDIDLFEINEAFASQFLYCQKKLELDPAKINVNGGAMAIGHPLGATGA  402

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+G VSMCIGTGMGAA VFERGD+CDELSNARK+E   +LSKD
Sbjct  403  RCVATLLHEMKRRGKDCRFGAVSMCIGTGMGAAAVFERGDSCDELSNARKIEAQNFLSKD  462

Query  362  AR  367
            AR
Sbjct  463  AR  464



>ref|NP_180873.1| 3-ketoacyl-CoA thiolase 2 [Arabidopsis thaliana]
 sp|Q56WD9.2|THIK2_ARATH RecName: Full=3-ketoacyl-CoA thiolase 2, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase 2; AltName: Full=Beta-ketothiolase 
2; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
2; AltName: Full=Peroxisome defective protein 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG42910.1|AF327529_1 putative 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAK15577.1|AF349530_1 putative 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAC04908.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 dbj|BAA25248.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 dbj|BAA25249.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAK96606.1| At2g33150/F25I18.11 [Arabidopsis thaliana]
 gb|AAL36070.1| At2g33150/F25I18.11 [Arabidopsis thaliana]
 gb|AAM65085.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AEC08791.1| 3-ketoacyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=462

 Score =   229 bits (584),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQ++YC+ KLGLDPEKINVNGGAMAIGHPLGATGA
Sbjct  341  IPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE  G LSKD
Sbjct  401  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGLLSKD  460

Query  362  AR  367
            AR
Sbjct  461  AR  462



>ref|XP_006360332.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Solanum 
tuberosum]
Length=465

 Score =   229 bits (584),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 117/122 (96%), Gaps = 1/122 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLEL+D DLFEINEAFASQ++YC+KKLGLDPEKINVNGGAMAIGHPLGATGA
Sbjct  343  IPAAVKSAGLELEDIDLFEINEAFASQFVYCRKKLGLDPEKINVNGGAMAIGHPLGATGA  402

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY-LSK  358
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD+CDEL NARK+++H + LSK
Sbjct  403  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDSCDELRNARKIDSHNHLLSK  462

Query  359  DA  364
            DA
Sbjct  463  DA  464



>emb|CDY23766.1| BnaC04g43560D [Brassica napus]
Length=462

 Score =   229 bits (583),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQ+LYC+ KLGLD EK+NVNGGAMAIGHPLGATGA
Sbjct  341  IPAAVKAAGLELDDIDLFEINEAFASQFLYCRNKLGLDAEKVNVNGGAMAIGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE  GYLSKD
Sbjct  401  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGYLSKD  460

Query  362  AR  367
            AR
Sbjct  461  AR  462



>emb|CDY37750.1| BnaA04g19180D [Brassica napus]
Length=462

 Score =   229 bits (583),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQ+LYC+ KLGLD EK+NVNGGAMAIGHPLGATGA
Sbjct  341  IPAAVKAAGLELDDIDLFEINEAFASQFLYCRNKLGLDEEKVNVNGGAMAIGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE  GYLSKD
Sbjct  401  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGYLSKD  460

Query  362  AR  367
            AR
Sbjct  461  AR  462



>gb|KJB72150.1| hypothetical protein B456_011G161700 [Gossypium raimondii]
Length=464

 Score =   229 bits (583),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLELDD DLFEINEAFASQ++YCQKKL LDP+KINVNGGAMAIGHPLG TGA
Sbjct  343  IPAAVKSAGLELDDVDLFEINEAFASQFVYCQKKLELDPQKINVNGGAMAIGHPLGVTGA  402

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVET+  LSKD
Sbjct  403  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDCVDELCNARKVETNSLLSKD  462

Query  362  AR  367
            AR
Sbjct  463  AR  464



>ref|XP_009143894.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brassica rapa]
 emb|CDY17140.1| BnaA05g10480D [Brassica napus]
Length=462

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQ++YC+ KLGLD EKINVNGGAMAIGHPLGATGA
Sbjct  341  IPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAMAIGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE+HG LSKD
Sbjct  401  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVESHGLLSKD  460

Query  362  AR  367
            AR
Sbjct  461  AR  462



>emb|CDY19452.1| BnaC04g11470D [Brassica napus]
Length=463

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQ++YC+ KLGLD EKINVNGGAMAIGHPLGATGA
Sbjct  342  IPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAMAIGHPLGATGA  401

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE+HG LSKD
Sbjct  402  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVESHGLLSKD  461

Query  362  AR  367
            AR
Sbjct  462  AR  463



>emb|CAA63598.1| glyoxysomal beta-ketoacyl-thiolase [Brassica napus]
Length=462

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQ++YC+ KLGLD EKINVNGGAMAIGHPLGATGA
Sbjct  341  IPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAMAIGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE+HG LSKD
Sbjct  401  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVESHGLLSKD  460

Query  362  AR  367
            AR
Sbjct  461  AR  462



>ref|XP_009141289.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brassica rapa]
Length=462

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQ+LYC+ KLGLD EK+NVNGGAMAIGHPLGATGA
Sbjct  341  IPAAVKAAGLELDDIDLFEINEAFASQFLYCRNKLGLDEEKVNVNGGAMAIGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE  GYLSKD
Sbjct  401  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGYLSKD  460

Query  362  AR  367
            AR
Sbjct  461  AR  462



>gb|ACV70033.1| 3-ketoacyl CoA thiolase 2 [Petunia x hybrida]
Length=463

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLEL+D DLFEINEAFASQY+YC+KKL LDPEKINVNG AMA+GHPLGATGA
Sbjct  342  IPAAVKSAGLELEDIDLFEINEAFASQYVYCRKKLELDPEKINVNGSAMALGHPLGATGA  401

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD+CDEL NARK+++H  LSKD
Sbjct  402  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDSCDELRNARKIDSHNLLSKD  461

Query  362  A  364
            A
Sbjct  462  A  462



>ref|XP_011091395.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Sesamum indicum]
Length=464

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLEL D DLFEINEAFASQ++YC+KKL LD EKINVNGGAMAIGHPLGATGA
Sbjct  343  IPAAVKSAGLELGDIDLFEINEAFASQFVYCRKKLELDAEKINVNGGAMAIGHPLGATGA  402

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAAGVFERGD+CDEL N RKVET  +LSKD
Sbjct  403  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAGVFERGDSCDELCNVRKVETQNFLSKD  462

Query  362  AR  367
            AR
Sbjct  463  AR  464



>ref|XP_006410451.1| hypothetical protein EUTSA_v10016622mg [Eutrema salsugineum]
 dbj|BAJ34444.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ51904.1| hypothetical protein EUTSA_v10016622mg [Eutrema salsugineum]
Length=462

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQ++YC+ KLGLD EKINVNGGAMAIGHPLGATGA
Sbjct  341  IPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAMAIGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE HG LSKD
Sbjct  401  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAHGLLSKD  460

Query  362  AR  367
            AR
Sbjct  461  AR  462



>ref|XP_011073762.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Sesamum 
indicum]
Length=464

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLEL D DLFEINEAFASQ++YC+KKL LDPEKINVNGGAMAIGHPLG TGA
Sbjct  343  IPAAVKSAGLELGDIDLFEINEAFASQFVYCRKKLELDPEKINVNGGAMAIGHPLGTTGA  402

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+CDEL N R V+TH +LSKD
Sbjct  403  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSCDELCNVRTVQTHNFLSKD  462

Query  362  AR  367
            AR
Sbjct  463  AR  464



>gb|ACA58356.1| 3-ketoacyl-CoA thiolase [Arachis diogoi]
Length=127

 Score =   217 bits (552),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AVK+AGLELDD DLFEINEAFASQ++YC+ KLGLD EKINVNGGAMA+GHPLGATGA
Sbjct  6    IPVAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAMALGHPLGATGA  65

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RC ATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DELSNARKV T+  LSKD
Sbjct  66   RCTATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDGVDELSNARKVATNNLLSKD  125

Query  362  AR  367
            AR
Sbjct  126  AR  127



>gb|KHG05724.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
Length=464

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLELDD DLFEINEAFASQ++YCQKKL LDP+KINVNGGAMAIGHPLGATGA
Sbjct  343  IPAAVKSAGLELDDVDLFEINEAFASQFVYCQKKLELDPQKINVNGGAMAIGHPLGATGA  402

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA V ERGD  DEL NARKVET+  LSKD
Sbjct  403  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVLERGDCVDELCNARKVETNSLLSKD  462

Query  362  AR  367
            AR
Sbjct  463  AR  464



>ref|XP_010509924.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Camelina 
sativa]
Length=462

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLGATGA
Sbjct  341  IPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE  G LSKD
Sbjct  401  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGLLSKD  460

Query  362  AR  367
            AR
Sbjct  461  AR  462



>ref|XP_010413914.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Camelina sativa]
Length=462

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLGATGA
Sbjct  341  IPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE  G LSKD
Sbjct  401  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGLLSKD  460

Query  362  AR  367
            AR
Sbjct  461  AR  462



>ref|XP_009619812.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nicotiana 
tomentosiformis]
Length=464

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLEL+D DLFEINEAFASQY+YC+KKL LDPEKINVNGGAMA+GHPLGATGA
Sbjct  343  IPAAVKSAGLELEDIDLFEINEAFASQYVYCRKKLELDPEKINVNGGAMALGHPLGATGA  402

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD+CDEL NARK+ +H  LSKD
Sbjct  403  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDSCDELCNARKIGSHNLLSKD  462

Query  362  A  364
            A
Sbjct  463  A  463



>ref|XP_009132912.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Brassica 
rapa]
Length=460

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQ++YC+ KLGLD EKINVNGGAMAIGHPLGATGA
Sbjct  339  IPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAMAIGHPLGATGA  398

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE  G+LSKD
Sbjct  399  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGFLSKD  458

Query  362  AR  367
            AR
Sbjct  459  AR  460



>gb|AGC24176.1| 3-ketoacyl-CoA thiolase 2 [Rehmannia glutinosa]
Length=464

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLEL D DLFEINEAFASQ++YC+KKL LDPEKINVNGGAMAIGHPLG TGA
Sbjct  343  IPAAVKSAGLELGDIDLFEINEAFASQFVYCRKKLELDPEKINVNGGAMAIGHPLGVTGA  402

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCV TLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD+CDELSN R V TH +LSKD
Sbjct  403  RCVVTLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDSCDELSNTRTVGTHNFLSKD  462

Query  362  AR  367
            AR
Sbjct  463  AR  464



>ref|XP_009784398.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nicotiana 
sylvestris]
Length=464

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLEL+D DLFEINEAFASQY+YC+KKL LDPEKINVNGGAMA+GHPLGATGA
Sbjct  343  IPAAVKSAGLELEDIDLFEINEAFASQYVYCRKKLELDPEKINVNGGAMALGHPLGATGA  402

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD+CDEL NARK+ +H  LSKD
Sbjct  403  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDSCDELCNARKIGSHNLLSKD  462

Query  362  A  364
            A
Sbjct  463  A  463



>ref|XP_010469514.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Camelina 
sativa]
Length=462

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLGATGA
Sbjct  341  IPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE  G LSKD
Sbjct  401  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGLLSKD  460

Query  362  AR  367
            AR
Sbjct  461  AR  462



>emb|CDX79511.1| BnaC03g18470D [Brassica napus]
Length=462

 Score =   227 bits (578),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQ++YC+ KLGLD EKINVNGGAMAIGHPLGATGA
Sbjct  341  IPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAMAIGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE  G+LSKD
Sbjct  401  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGFLSKD  460

Query  362  AR  367
            AR
Sbjct  461  AR  462



>emb|CDX84701.1| BnaA03g15290D [Brassica napus]
Length=462

 Score =   227 bits (578),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQ++YC+ KLGLD EKINVNGGAMAIGHPLGATGA
Sbjct  341  IPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAMAIGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE  G+LSKD
Sbjct  401  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGFLSKD  460

Query  362  AR  367
            AR
Sbjct  461  AR  462



>ref|XP_004247828.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Solanum lycopersicum]
Length=465

 Score =   226 bits (577),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 116/122 (95%), Gaps = 1/122 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLEL+D DLFEINEAFASQ++YC+KKL LDPEKINVNGGAMAIGHPLGATGA
Sbjct  343  IPAAVKSAGLELEDIDLFEINEAFASQFVYCRKKLELDPEKINVNGGAMAIGHPLGATGA  402

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY-LSK  358
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD+CDEL NARK+++H + LSK
Sbjct  403  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDSCDELRNARKIDSHNHLLSK  462

Query  359  DA  364
            DA
Sbjct  463  DA  464



>ref|XP_002881265.1| hypothetical protein ARALYDRAFT_482251 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57524.1| hypothetical protein ARALYDRAFT_482251 [Arabidopsis lyrata subsp. 
lyrata]
Length=462

 Score =   226 bits (576),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQ++YC+ KLGL+PEKINVNGGAMAIGHPLGATGA
Sbjct  341  IPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLNPEKINVNGGAMAIGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NA+KVE  G LSKD
Sbjct  401  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNAKKVEAQGLLSKD  460

Query  362  AR  367
            AR
Sbjct  461  AR  462



>ref|XP_007225741.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
 gb|EMJ26940.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
Length=429

 Score =   223 bits (569),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQY+YC+ KLGLDPEKINVNGGA+AIGHPLGATGA
Sbjct  308  IPAAVKAAGLELDDIDLFEINEAFASQYVYCRNKLGLDPEKINVNGGALAIGHPLGATGA  367

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            R VATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ DEL NARKVE+  +LSKD
Sbjct  368  RAVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSTDELCNARKVESLNHLSKD  427

Query  362  AR  367
            AR
Sbjct  428  AR  429



>ref|XP_010556945.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA thiolase 2, peroxisomal-like 
[Tarenaya hassleriana]
Length=463

 Score =   224 bits (571),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 114/123 (93%), Gaps = 1/123 (1%)
 Frame = +2

Query  2    IPAAVK-SAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATG  178
            IP AVK +AGLELDD DLFEINEAFASQ++YC+ KLGLDPE+INVNGGAMAIGHPLGATG
Sbjct  341  IPGAVKQAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPERINVNGGAMAIGHPLGATG  400

Query  179  ARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSK  358
            ARCV TLLHEMKRRG+DCRYGVVSMCIGTGMGAA VFERGD  D+LSNARKVE HG+LSK
Sbjct  401  ARCVGTLLHEMKRRGRDCRYGVVSMCIGTGMGAAAVFERGDGVDDLSNARKVEAHGFLSK  460

Query  359  DAR  367
            D+R
Sbjct  461  DSR  463



>ref|XP_002518136.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
 gb|EEF44269.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
Length=460

 Score =   224 bits (571),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLEL+D DLFEINEAFASQ++YC+KKL LDPE+INVNGGAMAIGHPLGATGA
Sbjct  339  IPAAVKAAGLELNDIDLFEINEAFASQFVYCRKKLELDPERINVNGGAMAIGHPLGATGA  398

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRG+DCR+GVVSMCIGTGMGAA VFERGDACD+L NARKVET   LSKD
Sbjct  399  RCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGDACDDLCNARKVETSNLLSKD  458

Query  362  A  364
            A
Sbjct  459  A  459



>ref|XP_004296638.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Fragaria vesca 
subsp. vesca]
Length=458

 Score =   224 bits (570),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AVK+AGLELDD DLFEINEAFASQ++YC+ KLGLDPEKINVNGGAMAIGHPLGATGA
Sbjct  337  IPVAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGA  396

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCRYGV+SMCIGTGMGAA VFERGD  DEL NARKV++  +LSKD
Sbjct  397  RCVATLLHEMKRRGKDCRYGVISMCIGTGMGAAAVFERGDRTDELCNARKVDSLNFLSKD  456

Query  362  AR  367
            AR
Sbjct  457  AR  458



>ref|XP_007225742.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
 gb|EMJ26941.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
Length=462

 Score =   224 bits (570),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQY+YC+ KLGLDPEKINVNGGA+AIGHPLGATGA
Sbjct  341  IPAAVKAAGLELDDIDLFEINEAFASQYVYCRNKLGLDPEKINVNGGALAIGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            R VATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ DEL NARKVE+  +LSKD
Sbjct  401  RAVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSTDELCNARKVESLNHLSKD  460

Query  362  AR  367
            AR
Sbjct  461  AR  462



>ref|XP_007034450.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2 [Theobroma cacao]
 gb|EOY05376.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2 [Theobroma cacao]
Length=355

 Score =   220 bits (561),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DL+EINEAFASQ++YC+KKL LDP+KINVNG AMAIGHPLGATGA
Sbjct  234  IPAAVKAAGLELDDIDLYEINEAFASQFVYCRKKLELDPKKINVNGAAMAIGHPLGATGA  293

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NARKVET+ +LSKD
Sbjct  294  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDHTDELCNARKVETNSFLSKD  353

Query  362  A  364
            A
Sbjct  354  A  354



>ref|XP_008224585.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Prunus mume]
Length=462

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQY+YC+ KLGLDPEKINVNGGA+AIGHPLGATGA
Sbjct  341  IPAAVKAAGLELDDIDLFEINEAFASQYVYCRNKLGLDPEKINVNGGALAIGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            R VATLLHEMKRRG+DCR+GV+SMCIGTGMGAA VFERGD+ DEL NARKVE+  +LSKD
Sbjct  401  RAVATLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFERGDSTDELCNARKVESPNHLSKD  460

Query  362  AR  367
            AR
Sbjct  461  AR  462



>gb|EPS68937.1| hypothetical protein M569_05826, partial [Genlisea aurea]
Length=457

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLE+ D DL+EINEAFASQ++YC+KKL LDPEKINVNGGA+AIGHPLGATGA
Sbjct  337  IPAAVKAAGLEISDIDLYEINEAFASQFVYCRKKLELDPEKINVNGGAIAIGHPLGATGA  396

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCV TLLHEMKRRG+DCR+GV+SMCIGTGMGAA VFERGD+CDELSNARK+E H +LS+D
Sbjct  397  RCVGTLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFERGDSCDELSNARKIERHNFLSRD  456

Query  362  A  364
            A
Sbjct  457  A  457



>gb|KDO43605.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
 gb|KDO43606.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
 gb|KDO43607.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=345

 Score =   219 bits (557),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGL+LDD DLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLG TGA
Sbjct  224  IPAAVKSAGLQLDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGTTGA  283

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRG+DCR+GV+SMCIGTGMGAA VFERGD  DEL N RKVE++ +LSKD
Sbjct  284  RCVATLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFERGDCADELCNVRKVESNNFLSKD  343



>ref|XP_010069076.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Eucalyptus 
grandis]
 gb|KCW57291.1| hypothetical protein EUGRSUZ_H00090 [Eucalyptus grandis]
Length=464

 Score =   221 bits (564),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQ++YC+ KLGL+PEK+NVNGGAMA+GHPLGATGA
Sbjct  343  IPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLEPEKVNVNGGAMAMGHPLGATGA  402

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA V ERGD+ DELSNARKV T+  LSKD
Sbjct  403  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVLERGDSVDELSNARKVGTNSLLSKD  462

Query  362  AR  367
            AR
Sbjct  463  AR  464



>ref|XP_007034449.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
 gb|EOY05375.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
Length=464

 Score =   221 bits (563),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DL+EINEAFASQ++YC+KKL LDP+KINVNG AMAIGHPLGATGA
Sbjct  343  IPAAVKAAGLELDDIDLYEINEAFASQFVYCRKKLELDPKKINVNGAAMAIGHPLGATGA  402

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NARKVET+ +LSKD
Sbjct  403  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDHTDELCNARKVETNSFLSKD  462

Query  362  A  364
            A
Sbjct  463  A  463



>ref|XP_009376354.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Pyrus x bretschneideri]
Length=459

 Score =   221 bits (562),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 114/123 (93%), Gaps = 1/123 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQYLYC+ KLGLDPEKINVNGGA+AIGHPLGATGA
Sbjct  337  IPAAVKAAGLELDDIDLFEINEAFASQYLYCRNKLGLDPEKINVNGGALAIGHPLGATGA  396

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY-LSK  358
            R VATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D L NARKVETH + LSK
Sbjct  397  RTVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDGLCNARKVETHIHLLSK  456

Query  359  DAR  367
            DAR
Sbjct  457  DAR  459



>gb|KDO43604.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=388

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGL+LDD DLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLG TGA
Sbjct  267  IPAAVKSAGLQLDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGTTGA  326

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRG+DCR+GV+SMCIGTGMGAA VFERGD  DEL N RKVE++ +LSKD
Sbjct  327  RCVATLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFERGDCADELCNVRKVESNNFLSKD  386



>ref|XP_004138952.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
sativus]
 gb|KGN61456.1| hypothetical protein Csa_2G129150 [Cucumis sativus]
Length=461

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQ++YC+ KL LDPEKINVNGGAMAIGHPLGATGA
Sbjct  340  IPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLELDPEKINVNGGAMAIGHPLGATGA  399

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NARKV+ H  LSKD
Sbjct  400  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDVADELCNARKVDNHNLLSKD  459



>ref|XP_004164123.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA thiolase 2, peroxisomal-like 
[Cucumis sativus]
Length=461

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQ++YC+ KL LDPEKINVNGGAMAIGHPLGATGA
Sbjct  340  IPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLELDPEKINVNGGAMAIGHPLGATGA  399

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NARKV+ H  LSKD
Sbjct  400  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDVADELCNARKVDNHNLLSKD  459



>gb|AFW68655.1| hypothetical protein ZEAMMB73_512974 [Zea mays]
Length=230

 Score =   213 bits (543),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGL++DD DLFEINEAFASQY+YC KKL LDP K+NVNGGAMA+GHPLGATGA
Sbjct  109  IPAAVKAAGLQMDDIDLFEINEAFASQYVYCCKKLKLDPAKVNVNGGAMALGHPLGATGA  168

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  DEL+NAR + TH +LSKD
Sbjct  169  RCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDGVDELTNARGISTHNWLSKD  228

Query  362  A  364
            A
Sbjct  229  A  229



>gb|ABK94786.1| unknown [Populus trichocarpa]
Length=346

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 114/123 (93%), Gaps = 1/123 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLEL+D DLFEINEAFASQ++YC+KKL LDP+KINVNGGAMAIGHPLGATGA
Sbjct  224  IPAAVKAAGLELEDIDLFEINEAFASQFVYCRKKLELDPQKINVNGGAMAIGHPLGATGA  283

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSN-ARKVETHGYLSK  358
            RCVATLLHEMKRRG+DCR+GVVSMCIGTGMGAA VFERGD CDEL N  RKVE++  LS+
Sbjct  284  RCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGDGCDELCNGGRKVESNNLLSR  343

Query  359  DAR  367
            D+R
Sbjct  344  DSR  346



>emb|CAN81585.1| hypothetical protein VITISV_023191 [Vitis vinifera]
Length=461

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLELDD DLFEINEAFASQ++YC+KKL LDPEKINVNGGAMAIGHPLGATGA
Sbjct  340  IPAAVKSAGLELDDIDLFEINEAFASQFVYCRKKLDLDPEKINVNGGAMAIGHPLGATGA  399

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCV TLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NAR  E +  LSKD
Sbjct  400  RCVGTLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDCVDELRNARTAENNNLLSKD  459

Query  362  AR  367
            A+
Sbjct  460  AQ  461



>ref|XP_002285653.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Vitis vinifera]
 emb|CBI33354.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLELDD DLFEINEAFASQ++YC+KKL LDPEKINVNGGAMAIGHPLGATGA
Sbjct  340  IPAAVKSAGLELDDIDLFEINEAFASQFVYCRKKLDLDPEKINVNGGAMAIGHPLGATGA  399

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCV TLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NAR  E +  LSKD
Sbjct  400  RCVGTLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDCVDELRNARTAENNNLLSKD  459

Query  362  AR  367
            A+
Sbjct  460  AQ  461



>ref|XP_008380600.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Malus domestica]
Length=459

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 114/123 (93%), Gaps = 1/123 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQYLYC+ KLGLDPEKINVNGGA+AIGHPLGATGA
Sbjct  337  IPAAVKAAGLELDDIDLFEINEAFASQYLYCRNKLGLDPEKINVNGGALAIGHPLGATGA  396

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY-LSK  358
            R VATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D L NARKVE+H + LSK
Sbjct  397  RAVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDGLCNARKVESHIHLLSK  456

Query  359  DAR  367
            DAR
Sbjct  457  DAR  459



>gb|KDO43600.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=438

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGL+LDD DLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLG TGA
Sbjct  317  IPAAVKSAGLQLDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGTTGA  376

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRG+DCR+GV+SMCIGTGMGAA VFERGD  DEL N RKVE++ +LSKD
Sbjct  377  RCVATLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFERGDCADELCNVRKVESNNFLSKD  436



>ref|NP_001142099.1| uncharacterized protein LOC100274263 [Zea mays]
 gb|ACF87638.1| unknown [Zea mays]
Length=230

 Score =   212 bits (540),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGL++DD DLFEINEAFASQY+YC +KL LDP K+NVNGGAMA+GHPLGATGA
Sbjct  109  IPAAVKAAGLQMDDIDLFEINEAFASQYVYCCRKLKLDPAKVNVNGGAMALGHPLGATGA  168

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  DEL+NAR + TH +LSKD
Sbjct  169  RCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDGVDELTNARGISTHNWLSKD  228

Query  362  A  364
            A
Sbjct  229  A  229



>ref|XP_008457258.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
melo]
Length=461

 Score =   219 bits (558),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQ++YC+ KL L+PEKINVNGGAMAIGHPLGATGA
Sbjct  340  IPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLELNPEKINVNGGAMAIGHPLGATGA  399

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NARKV+ H  LSKD
Sbjct  400  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDVADELCNARKVDNHNLLSKD  459



>gb|KDO43599.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=445

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGL+LDD DLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLG TGA
Sbjct  324  IPAAVKSAGLQLDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGTTGA  383

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRG+DCR+GV+SMCIGTGMGAA VFERGD  DEL N RKVE++ +LSKD
Sbjct  384  RCVATLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFERGDCADELCNVRKVESNNFLSKD  443



>ref|XP_006420604.1| hypothetical protein CICLE_v10004931mg [Citrus clementina]
 ref|XP_006489799.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Citrus 
sinensis]
 gb|ESR33844.1| hypothetical protein CICLE_v10004931mg [Citrus clementina]
 gb|KDO43598.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=462

 Score =   219 bits (557),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGL+LDD DLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLG TGA
Sbjct  341  IPAAVKSAGLQLDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGTTGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRG+DCR+GV+SMCIGTGMGAA VFERGD  DEL N RKVE++ +LSKD
Sbjct  401  RCVATLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFERGDCADELCNVRKVESNNFLSKD  460



>gb|AFK47277.1| unknown [Medicago truncatula]
Length=158

 Score =   209 bits (532),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 111/122 (91%), Gaps = 1/122 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AVK+AGLELDD DLFEINEAFASQ++YC+ KLGLD +KINVNGGAMAIGHPLGATGA
Sbjct  38   IPVAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDSQKINVNGGAMAIGHPLGATGA  97

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMK+RGKDCRYGV+SMCIGTGMGAA VFERGD+ DEL NARK +   +LSKD
Sbjct  98   RCVATLLHEMKKRGKDCRYGVISMCIGTGMGAAAVFERGDSVDELCNARKGDNL-FLSKD  156

Query  362  AR  367
            AR
Sbjct  157  AR  158



>gb|KDP20330.1| hypothetical protein JCGZ_06416 [Jatropha curcas]
Length=462

 Score =   218 bits (555),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLEL D DLFEINEAFASQ++YC+KKL LD EKINVNGGAMAIGHPLGATGA
Sbjct  341  IPAAVKSAGLELGDIDLFEINEAFASQFVYCRKKLELDSEKINVNGGAMAIGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRG+DCR+GVVSMCIGTGMGAA VFERGD CDEL NARK ET   LSKD
Sbjct  401  RCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGDGCDELCNARKAETDKLLSKD  460

Query  362  A  364
            A
Sbjct  461  A  461



>gb|AFW68656.1| hypothetical protein ZEAMMB73_512974 [Zea mays]
Length=295

 Score =   213 bits (543),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGL++DD DLFEINEAFASQY+YC KKL LDP K+NVNGGAMA+GHPLGATGA
Sbjct  174  IPAAVKAAGLQMDDIDLFEINEAFASQYVYCCKKLKLDPAKVNVNGGAMALGHPLGATGA  233

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  DEL+NAR + TH +LSKD
Sbjct  234  RCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDGVDELTNARGISTHNWLSKD  293

Query  362  A  364
            A
Sbjct  294  A  294



>ref|XP_010522426.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Tarenaya hassleriana]
Length=464

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 111/123 (90%), Gaps = 2/123 (2%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQ++YC+ KLGLD EKINVNGGAMAIGHPLGATGA
Sbjct  341  IPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAMAIGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVET--HGYLS  355
            RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAA VFERGDA D LSNAR+VE      LS
Sbjct  401  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAAVFERGDAVDSLSNARRVEAAHSSLLS  460

Query  356  KDA  364
            KD+
Sbjct  461  KDS  463



>pir||S72532 acetyl-CoA C-acyltransferase (EC 2.3.1.16) precursor - cucurbit
 dbj|BAA11117.1| 3-ketoacyl-CoA thiolase [Cucurbita cv. Kurokawa Amakuri]
Length=461

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLEL+D DLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLG TGA
Sbjct  340  IPAAVKAAGLELNDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAIAIGHPLGTTGA  399

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NA+KVE    LSKD
Sbjct  400  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDCVDELCNAKKVEGINLLSKD  459

Query  362  AR  367
            AR
Sbjct  460  AR  461



>gb|AFW68657.1| hypothetical protein ZEAMMB73_512974 [Zea mays]
Length=345

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGL++DD DLFEINEAFASQY+YC KKL LDP K+NVNGGAMA+GHPLGATGA
Sbjct  224  IPAAVKAAGLQMDDIDLFEINEAFASQYVYCCKKLKLDPAKVNVNGGAMALGHPLGATGA  283

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  DEL+NAR + TH +LSKD
Sbjct  284  RCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDGVDELTNARGISTHNWLSKD  343

Query  362  A  364
            A
Sbjct  344  A  344



>ref|XP_002299284.2| hypothetical protein POPTR_0001s14280g [Populus trichocarpa]
 gb|EEE84089.2| hypothetical protein POPTR_0001s14280g [Populus trichocarpa]
Length=461

 Score =   217 bits (552),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 114/123 (93%), Gaps = 1/123 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLEL+D DLFEINEAFASQ++YC+KKL LDP+KINVNGGAMAIGHPLGATGA
Sbjct  339  IPAAVKAAGLELEDIDLFEINEAFASQFVYCRKKLELDPQKINVNGGAMAIGHPLGATGA  398

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSN-ARKVETHGYLSK  358
            RCVATLLHEMKRRG+DCR+GVVSMCIGTGMGAA VFERGD CDEL N  RKVE++  LS+
Sbjct  399  RCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGDGCDELCNGGRKVESNNLLSR  458

Query  359  DAR  367
            D+R
Sbjct  459  DSR  461



>ref|XP_006662414.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Oryza 
brachyantha]
Length=460

 Score =   216 bits (551),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGL++DD DLFEINEAFASQY+YC KKLGLDP K+NVNGGAMA+GHPLGATGA
Sbjct  338  IPAAVKAAGLQIDDVDLFEINEAFASQYVYCCKKLGLDPTKVNVNGGAMALGHPLGATGA  397

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGDA DEL+NAR + +H +LSKD
Sbjct  398  RCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDAVDELTNARGIPSHNWLSKD  457

Query  362  A  364
            A
Sbjct  458  A  458



>ref|XP_004497755.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cicer 
arietinum]
Length=458

 Score =   216 bits (550),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 112/122 (92%), Gaps = 1/122 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AVK+AGLELDD DLFEINEAFASQ++YC+ KLGLD +KINVNGGAMAIGHPLGATGA
Sbjct  338  IPVAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDSQKINVNGGAMAIGHPLGATGA  397

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ DEL NARKV+   YLSKD
Sbjct  398  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDELRNARKVDDL-YLSKD  456

Query  362  AR  367
            AR
Sbjct  457  AR  458



>ref|XP_010243983.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nelumbo nucifera]
Length=460

 Score =   216 bits (549),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLELDD DLFEINEAFASQY+YC KKL LDPEK+NVNGGAMAIGHPLGATGA
Sbjct  339  IPAAVKSAGLELDDIDLFEINEAFASQYVYCCKKLELDPEKVNVNGGAMAIGHPLGATGA  398

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  D L NAR+V T+  LSKD
Sbjct  399  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDCVDPLCNARQVGTNNLLSKD  458



>gb|AFK34605.1| unknown [Lotus japonicus]
Length=296

 Score =   211 bits (536),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 110/121 (91%), Gaps = 1/121 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AVK+AGLELDD DLFEINEAFASQ++YC+ KLGLD EKINVNGGAMAIGHPLGATGA
Sbjct  174  IPVAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDLEKINVNGGAMAIGHPLGATGA  233

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRG+DCR+GV+SMCIGTGMGAA VFERGD  DEL NARKV+   +LSKD
Sbjct  234  RCVATLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFERGDGVDELRNARKVDNL-HLSKD  292

Query  362  A  364
            A
Sbjct  293  A  293



>ref|XP_006443651.1| hypothetical protein CICLE_v10020068mg [Citrus clementina]
 ref|XP_006480201.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Citrus 
sinensis]
 gb|ESR56891.1| hypothetical protein CICLE_v10020068mg [Citrus clementina]
Length=461

 Score =   216 bits (549),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGL+LDD +LFEINEAFASQY+YC KKLGLDPEK+NVNGGA+A+GHPLGATGA
Sbjct  340  IPAAVKSAGLQLDDINLFEINEAFASQYVYCIKKLGLDPEKVNVNGGAVALGHPLGATGA  399

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLL EMKRRGKDCR+GV+SMCIG+GMGAA V ERGD  DEL NAR V TH +LSKD
Sbjct  400  RCVATLLSEMKRRGKDCRFGVISMCIGSGMGAAAVLERGDCVDELCNARMVPTHTHLSKD  459

Query  362  AR  367
            A+
Sbjct  460  AK  461



>gb|ACV70032.1| 3-ketoacyl CoA thiolase 1 [Petunia x hybrida]
Length=462

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AVKSAGL+LDD DL+EINEAFASQ++YCQKKL LDPEK+NVNGGAMA+GHPLGATGA
Sbjct  341  IPPAVKSAGLDLDDIDLYEINEAFASQFVYCQKKLNLDPEKVNVNGGAMALGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GV+SMCIG+GMGAA VFERGDA D+L NAR    + +LSKD
Sbjct  401  RCVATLLHEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDAVDDLCNARVSNNNSFLSKD  460

Query  362  AR  367
            A+
Sbjct  461  AK  462



>ref|XP_010099126.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
 gb|EXB76920.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
Length=464

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQ++YC+ KLGLDPEKINVNGGAMAIGHPLGATGA
Sbjct  343  IPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGA  402

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFER    DEL NAR   T+  LSKD
Sbjct  403  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERAGHTDELCNARVAATNSLLSKD  462

Query  362  AR  367
            AR
Sbjct  463  AR  464



>ref|XP_011002175.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Populus euphratica]
Length=462

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 113/122 (93%), Gaps = 1/122 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLEL+D DLFEINEAFASQ++YC+KKL LDP+KINVNGGAMAIGHPLGATGA
Sbjct  340  IPAAVKAAGLELEDIDLFEINEAFASQFVYCRKKLELDPQKINVNGGAMAIGHPLGATGA  399

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSN-ARKVETHGYLSK  358
            RCVATLLHEMKRRG+DCR+GVVSMCIGTGMGAA VFERGD CDEL N  RKVE++  LS+
Sbjct  400  RCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGDGCDELCNGGRKVESNNLLSR  459

Query  359  DA  364
            D+
Sbjct  460  DS  461



>ref|NP_001267690.1| 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis sativus]
 emb|CAA47926.1| 3-ketoacyl-CoA thiolase [Cucumis sativus]
 gb|KGN56763.1| hypothetical protein Csa_3G133140 [Cucumis sativus]
Length=462

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 112/123 (91%), Gaps = 1/123 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLEL+D DLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLGATGA
Sbjct  340  IPAAVKAAGLELNDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAIAIGHPLGATGA  399

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETH-GYLSK  358
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NA+KVE     LSK
Sbjct  400  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDCVDELCNAKKVEGGVNLLSK  459

Query  359  DAR  367
            DAR
Sbjct  460  DAR  462



>ref|XP_006368897.1| hypothetical protein POPTR_0001s14290g [Populus trichocarpa]
 gb|ERP65466.1| hypothetical protein POPTR_0001s14290g [Populus trichocarpa]
Length=455

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLEL+D DLFEINEAFASQ++YC KKL LD +KINVNGGA+AIGHPLG TGA
Sbjct  334  IPAAVKAAGLELEDIDLFEINEAFASQFVYCCKKLELDLQKINVNGGAIAIGHPLGTTGA  393

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVAT+LHEMKRRG+DCR+GVVSMCIGTGMGAA VFERGD CDEL NARKVE++  LSKD
Sbjct  394  RCVATILHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGDGCDELCNARKVESNNLLSKD  453

Query  362  AR  367
            +R
Sbjct  454  SR  455



>gb|ACN29136.1| unknown [Zea mays]
 gb|AFW68658.1| hypothetical protein ZEAMMB73_512974 [Zea mays]
Length=461

 Score =   213 bits (543),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGL++DD DLFEINEAFASQY+YC KKL LDP K+NVNGGAMA+GHPLGATGA
Sbjct  340  IPAAVKAAGLQMDDIDLFEINEAFASQYVYCCKKLKLDPAKVNVNGGAMALGHPLGATGA  399

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  DEL+NAR + TH +LSKD
Sbjct  400  RCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDGVDELTNARGISTHNWLSKD  459

Query  362  A  364
            A
Sbjct  460  A  460



>ref|XP_011034453.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Populus 
euphratica]
Length=455

 Score =   213 bits (543),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLEL+D DLFEINEAFASQ++YC KKL LD +KINVNGGA+AIGHPLG TGA
Sbjct  334  IPAAVKAAGLELEDIDLFEINEAFASQFVYCCKKLELDLQKINVNGGAIAIGHPLGTTGA  393

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVAT+LHEMKRRG+DCR+GVVSMCIGTGMGAA VFERGD CDEL NARKVE++  LSKD
Sbjct  394  RCVATILHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGDDCDELCNARKVESNNLLSKD  453

Query  362  AR  367
            +R
Sbjct  454  SR  455



>ref|XP_011002176.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Populus 
euphratica]
Length=455

 Score =   213 bits (543),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLEL+D DLFEINEAFASQ++YC KKL LD +KINVNGGA+AIGHPLG TGA
Sbjct  334  IPAAVKAAGLELEDIDLFEINEAFASQFVYCCKKLELDLQKINVNGGAIAIGHPLGTTGA  393

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVAT+LHEMKRRG+DCR+GVVSMCIGTGMGAA VFERGD CDEL NARKVE++  LSKD
Sbjct  394  RCVATILHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGDDCDELCNARKVESNNLLSKD  453

Query  362  AR  367
            +R
Sbjct  454  SR  455



>ref|XP_006854408.1| hypothetical protein AMTR_s00039p00196630 [Amborella trichopoda]
 gb|ERN15875.1| hypothetical protein AMTR_s00039p00196630 [Amborella trichopoda]
Length=460

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLEL+D DLFEINEAF SQ++YC+ KLGLDPEK+NVNGGAMAIGHPLGATGA
Sbjct  339  IPAAVKAAGLELNDIDLFEINEAFGSQFVYCRNKLGLDPEKVNVNGGAMAIGHPLGATGA  398

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKR+GKDCR+GV+SMCIGTGMGAA VFERGD  D L+NARK+     LSKD
Sbjct  399  RCVATLLHEMKRQGKDCRFGVISMCIGTGMGAAAVFERGDGVDPLNNARKIGASNLLSKD  458

Query  362  A  364
            A
Sbjct  459  A  459



>gb|ACN39947.1| unknown [Picea sitchensis]
 gb|ACN40646.1| unknown [Picea sitchensis]
Length=462

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLE+DD DLFEINEAFASQ+ YC +KL LDPEK+NVNGGA+A+GHPLGATGA
Sbjct  341  IPAAVKAAGLEIDDIDLFEINEAFASQFTYCSQKLELDPEKVNVNGGALALGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERG A D+L NAR ++ H  LSKD
Sbjct  401  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGSAVDQLCNARPIKDHTSLSKD  460

Query  362  AR  367
            A+
Sbjct  461  AQ  462



>ref|XP_009796304.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Nicotiana sylvestris]
Length=486

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLELD+ DLFEINEAFASQ++YC+KKL LD EK+NVNGGAMA+GHPLGATGA
Sbjct  365  IPAAVKSAGLELDNIDLFEINEAFASQFVYCRKKLNLDSEKVNVNGGAMALGHPLGATGA  424

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GV+SMCIG+GMGAA VFERGDA D+L NAR    + +LSKD
Sbjct  425  RCVATLLHEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDAVDDLCNARVNNNNNFLSKD  484

Query  362  AR  367
            A+
Sbjct  485  AK  486



>gb|KEH41248.1| 3-ketoacyl-CoA thiolase 2, peroxisomal-like protein [Medicago 
truncatula]
Length=462

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 111/122 (91%), Gaps = 1/122 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AVK+AGLELDD DLFEINEAFASQ++YC+ KLGLD +KINVNGGAMAIGHPLGATGA
Sbjct  342  IPVAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDSQKINVNGGAMAIGHPLGATGA  401

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMK+RGKDCRYGV+SMCIGTGMGAA VFERGD+ DEL NARK +   +LSKD
Sbjct  402  RCVATLLHEMKKRGKDCRYGVISMCIGTGMGAAAVFERGDSVDELCNARKGDNL-FLSKD  460

Query  362  AR  367
            AR
Sbjct  461  AR  462



>gb|EEC67095.1| hypothetical protein OsI_33888 [Oryza sativa Indica Group]
Length=461

 Score =   211 bits (537),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGL++DD DLFEINEAFASQY+YC KKLGLDP K+NVNGGAMA+GHPLGATGA
Sbjct  340  IPAAVKAAGLQIDDVDLFEINEAFASQYVYCCKKLGLDPAKVNVNGGAMALGHPLGATGA  399

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            R V+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGDA DEL+NAR + TH  LSKD
Sbjct  400  RSVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDAVDELTNARCIPTHNRLSKD  459

Query  362  A  364
            A
Sbjct  460  A  460



>ref|NP_001064764.1| Os10g0457600 [Oryza sativa Japonica Group]
 gb|AAK54299.1|AC034258_17 putative thiolase [Oryza sativa Japonica Group]
 gb|AAP54100.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26678.1| Os10g0457600 [Oryza sativa Japonica Group]
 gb|EAZ16317.1| hypothetical protein OsJ_31778 [Oryza sativa Japonica Group]
 dbj|BAG92981.1| unnamed protein product [Oryza sativa Japonica Group]
Length=461

 Score =   211 bits (537),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGL++DD DLFEINEAFASQY+YC KKLGLDP K+NVNGGAMA+GHPLGATGA
Sbjct  340  IPAAVKAAGLQIDDVDLFEINEAFASQYVYCCKKLGLDPAKVNVNGGAMALGHPLGATGA  399

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            R V+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGDA DEL+NAR + TH  LSKD
Sbjct  400  RSVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDAVDELTNARCIPTHNRLSKD  459

Query  362  A  364
            A
Sbjct  460  A  460



>ref|XP_007145410.1| hypothetical protein PHAVU_007G236600g [Phaseolus vulgaris]
 gb|ESW17404.1| hypothetical protein PHAVU_007G236600g [Phaseolus vulgaris]
Length=458

 Score =   211 bits (537),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 110/122 (90%), Gaps = 1/122 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AVK+AGLELDD DLFEINEAFASQ+LYC+ KLGLDPEKINVNGGAMAIGHPLGATGA
Sbjct  338  IPVAVKAAGLELDDIDLFEINEAFASQFLYCRNKLGLDPEKINVNGGAMAIGHPLGATGA  397

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEM++RG+DCR+GV+SMCIGTGMGAA VFE GD  DEL NARKV+    LSKD
Sbjct  398  RCVATLLHEMRKRGRDCRFGVISMCIGTGMGAAAVFESGDCADELCNARKVDDL-LLSKD  456

Query  362  AR  367
            AR
Sbjct  457  AR  458



>ref|XP_009796305.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X2 [Nicotiana sylvestris]
Length=462

 Score =   211 bits (537),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLELD+ DLFEINEAFASQ++YC+KKL LD EK+NVNGGAMA+GHPLGATGA
Sbjct  341  IPAAVKSAGLELDNIDLFEINEAFASQFVYCRKKLNLDSEKVNVNGGAMALGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GV+SMCIG+GMGAA VFERGDA D+L NAR    + +LSKD
Sbjct  401  RCVATLLHEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDAVDDLCNARVNNNNNFLSKD  460

Query  362  AR  367
            A+
Sbjct  461  AK  462



>ref|XP_009629663.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Nicotiana 
tomentosiformis]
Length=494

 Score =   211 bits (538),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLELD+ DLFEINEAFASQ++YC+KKL LD EK+NVNGGAMA+GHPLGATGA
Sbjct  373  IPAAVKSAGLELDNIDLFEINEAFASQFVYCRKKLNLDSEKVNVNGGAMALGHPLGATGA  432

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GV+SMCIG+GMGAA VFERGDA D+L NAR    + +LSKD
Sbjct  433  RCVATLLHEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDAVDDLCNARVNNNNNFLSKD  492

Query  362  AR  367
            A+
Sbjct  493  AK  494



>ref|NP_001238475.1| peroxisomal 3-ketoacyl-CoA thiolase [Glycine max]
 dbj|BAG09380.1| peroxisomal 3-ketoacyl-CoA thiolase precursor [Glycine max]
 gb|KHN21671.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=463

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 110/122 (90%), Gaps = 1/122 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AVK+AGLELDD DLFEINEAFASQ++YC+ KLGLDPEKINVNGGAMAIGHPLG+TGA
Sbjct  341  IPVAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGSTGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMK+RG+DCR+GV+SMCIGTGMGAA VFE GD  DEL NARKV+    LSKD
Sbjct  401  RCVATLLHEMKKRGRDCRFGVISMCIGTGMGAAAVFESGDCADELCNARKVDDL-LLSKD  459

Query  362  AR  367
            AR
Sbjct  460  AR  461



>pdb|2WUA|A Chain A, Structure Of The Peroxisomal 3-Ketoacyl-Coa Thiolase 
From Sunflower
 pdb|2WUA|B Chain B, Structure Of The Peroxisomal 3-Ketoacyl-Coa Thiolase 
From Sunflower
Length=440

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGL++DD DLFEINEAFASQ++YCQKKL +DP+KINVNGGAMAIGHPLGATGA
Sbjct  324  IPAAVKAAGLQIDDIDLFEINEAFASQFVYCQKKLEIDPQKINVNGGAMAIGHPLGATGA  383

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  328
            RCVATLLHEMKRRG+DCR+GVVSMCIGTGMGAA VFERGDACDEL NA+
Sbjct  384  RCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGDACDELCNAK  432



>ref|XP_010918893.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=460

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGL++DD DLFEINEAFASQY+YC KKL LDP K+NVNGGAMA GHPLGATGA
Sbjct  339  IPAAVKAAGLQIDDIDLFEINEAFASQYVYCCKKLELDPSKVNVNGGAMAFGHPLGATGA  398

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  D+LSNAR+++++  LSKD
Sbjct  399  RCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDVVDQLSNARRIQSNNQLSKD  458

Query  362  A  364
            A
Sbjct  459  A  459



>ref|XP_002467133.1| hypothetical protein SORBIDRAFT_01g020150 [Sorghum bicolor]
 gb|EER94131.1| hypothetical protein SORBIDRAFT_01g020150 [Sorghum bicolor]
Length=462

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGL++DD DLFEINEAFASQY+YC KKL LDP K+NVNGGAMA+GHPLG TGA
Sbjct  341  IPAAVKAAGLQMDDIDLFEINEAFASQYVYCCKKLELDPAKVNVNGGAMALGHPLGCTGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  DEL+N+R + TH +LSKD
Sbjct  401  RCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDCVDELTNSRGIPTHNWLSKD  460

Query  362  A  364
            A
Sbjct  461  A  461



>ref|XP_011020688.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X2 [Populus euphratica]
Length=458

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGL L+D DLFEINEAFASQ++YC+KKL LD +KINVNGGAMAIGHPLGATGA
Sbjct  339  IPAAVKAAGLALEDIDLFEINEAFASQFVYCRKKLELDSQKINVNGGAMAIGHPLGATGA  398

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLS  355
            RCVATLLHEMKRRG+DCR+GVVSMCIGTGMGAA VFERGD CDEL N RKVE++  LS
Sbjct  399  RCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGDGCDELCNGRKVESNNLLS  456



>ref|XP_011020687.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Populus euphratica]
Length=460

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGL L+D DLFEINEAFASQ++YC+KKL LD +KINVNGGAMAIGHPLGATGA
Sbjct  341  IPAAVKAAGLALEDIDLFEINEAFASQFVYCRKKLELDSQKINVNGGAMAIGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLS  355
            RCVATLLHEMKRRG+DCR+GVVSMCIGTGMGAA VFERGD CDEL N RKVE++  LS
Sbjct  401  RCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGDGCDELCNGRKVESNNLLS  458



>gb|AAQ77242.1| acetoacetyl CoA thiolase [Helianthus annuus]
Length=449

 Score =   208 bits (530),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGL++DD DLFEINEAFASQ++YCQKKL +DP+KINVNGGAMAIGHPLGATGA
Sbjct  339  IPAAVKAAGLQIDDIDLFEINEAFASQFVYCQKKLEIDPQKINVNGGAMAIGHPLGATGA  398

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  328
            RCVATLLHEMKRRG+DCR+GVVSMCIGTGMGAA VFERGDACDEL NA+
Sbjct  399  RCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGDACDELCNAK  447



>gb|EMS60447.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Triticum urartu]
Length=435

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGL+++D DLFEINEAFASQY+YC KKL LDP K+NVNGGA+A+GHPLGATGA
Sbjct  314  IPAAVKAAGLQINDVDLFEINEAFASQYVYCSKKLDLDPAKVNVNGGAIALGHPLGATGA  373

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGDA DEL+NAR V +  +LSKD
Sbjct  374  RCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDAVDELTNARGVPSLNWLSKD  433



>ref|XP_003555712.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Glycine max]
 gb|KHN18010.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=461

 Score =   208 bits (530),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 109/122 (89%), Gaps = 1/122 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AVK+AGLELDD DLFEINEAFASQ++YC+  LGLDPEKINVNGGAMAIGHPLG+TGA
Sbjct  341  IPVAVKAAGLELDDIDLFEINEAFASQFVYCRNNLGLDPEKINVNGGAMAIGHPLGSTGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMK+RG+DCR+GV+SMCIGTGMGAA VFE GD  DEL NARKV+    LSKD
Sbjct  401  RCVATLLHEMKKRGRDCRFGVISMCIGTGMGAAAVFESGDCADELCNARKVDDL-LLSKD  459

Query  362  AR  367
            AR
Sbjct  460  AR  461



>ref|XP_009400955.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009400962.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=459

 Score =   208 bits (529),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGL+++D DLFEINEAFASQ++YC+KKL LDP K+NVNGGA+A+GHPLGATGA
Sbjct  338  IPAAVKSAGLQIEDVDLFEINEAFASQFVYCRKKLELDPAKVNVNGGAIALGHPLGATGA  397

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGDA D L+NAR++ +H  LS+D
Sbjct  398  RCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDAVDGLTNARQIHSHNLLSED  457

Query  362  A  364
            A
Sbjct  458  A  458



>gb|ABR16781.1| unknown [Picea sitchensis]
Length=462

 Score =   208 bits (529),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLE+DD DLFEINEAFASQ+ YC +KL LDPEK+NVNGGA+A+GHPLGATGA
Sbjct  341  IPAAVKAAGLEIDDIDLFEINEAFASQFTYCSQKLELDPEKVNVNGGAIALGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFER  A D+L NAR ++ H  LS+D
Sbjct  401  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERSGAVDQLCNARPIKDHTSLSRD  460

Query  362  AR  367
            A+
Sbjct  461  AQ  462



>ref|XP_008349047.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA thiolase 2, peroxisomal-like 
[Malus domestica]
Length=292

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AVKSAGLELDD DLFEINEAFASQY+YC KKL LDPEK+NVNGGA+A+GHPLGATGA
Sbjct  171  IPVAVKSAGLELDDIDLFEINEAFASQYVYCCKKLELDPEKVNVNGGAIALGHPLGATGA  230

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLL+EMKRRG+D R+GV+SMCIG+GMGAA VFERGD+ DEL NAR V ++  +S D
Sbjct  231  RCVATLLNEMKRRGRDHRFGVISMCIGSGMGAAAVFERGDSVDELCNARTVXSNNLVSND  290

Query  362  AR  367
            A+
Sbjct  291  AK  292



>gb|EMT31542.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Aegilops tauschii]
Length=459

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLE+DD DLFE+NEAFASQ++YC  KLGLD  K+NVNGGA+A+GHPLGATGA
Sbjct  337  IPAAVKSAGLEIDDIDLFELNEAFASQFVYCCNKLGLDRSKVNVNGGAIAMGHPLGATGA  396

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RC++TLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFERGD+ DELSN R +++H +LSKD
Sbjct  397  RCISTLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFERGDSVDELSNVRHIQSHNFLSKD  456

Query  362  A  364
            A
Sbjct  457  A  457



>ref|XP_008235516.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Prunus mume]
Length=467

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AVKSAGLELDD DLFEINEAFASQY+YC KKL LDPEK+NVNGGA+A+GHPLGATGA
Sbjct  346  IPVAVKSAGLELDDIDLFEINEAFASQYVYCCKKLELDPEKVNVNGGAIALGHPLGATGA  405

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLL+EMKRRGKD R+GV+SMCIG+GMGAA VFERGD+ DEL N R VE +  LS D
Sbjct  406  RCVATLLNEMKRRGKDHRFGVISMCIGSGMGAAAVFERGDSVDELCNVRTVERNNLLSND  465

Query  362  AR  367
            AR
Sbjct  466  AR  467



>dbj|BAI66423.1| 3-ketoacyl-CoA thiolase-like protein [Triticum aestivum]
Length=459

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLE+DD DLFE+NEAFASQ++YC  KLGLD  K+NVNGGA+A+GHPLGATGA
Sbjct  337  IPAAVKSAGLEIDDIDLFELNEAFASQFVYCCNKLGLDRSKVNVNGGAIAMGHPLGATGA  396

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RC++TLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFERGD+ DELSN R +++H +LSKD
Sbjct  397  RCISTLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFERGDSVDELSNVRHIQSHNFLSKD  456

Query  362  A  364
            A
Sbjct  457  A  457



>dbj|BAJ87577.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=460

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLE+DD DLFE+NEAFASQ++YC  KLGLD  K+NVNGGA+A+GHPLGATGA
Sbjct  338  IPAAVKSAGLEIDDIDLFELNEAFASQFVYCCNKLGLDRSKVNVNGGAIAMGHPLGATGA  397

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RC++TLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFERGD+ DELSN R +++H +LSKD
Sbjct  398  RCISTLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFERGDSVDELSNVRHIQSHNFLSKD  457

Query  362  A  364
            A
Sbjct  458  A  458



>ref|XP_007201004.1| hypothetical protein PRUPE_ppa005303mg [Prunus persica]
 gb|EMJ02203.1| hypothetical protein PRUPE_ppa005303mg [Prunus persica]
Length=467

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AVKSAGLELDD DLFEINEAFASQY+YC KKL LDPEK+NVNGGA+A+GHPLGATGA
Sbjct  346  IPVAVKSAGLELDDIDLFEINEAFASQYVYCCKKLELDPEKVNVNGGAIALGHPLGATGA  405

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLL+EMKRRGKD R+GV+SMCIG+GMGAA VFERGD+ DEL N R VE +  LS D
Sbjct  406  RCVATLLNEMKRRGKDHRFGVISMCIGSGMGAAAVFERGDSVDELCNVRTVERNNLLSND  465

Query  362  AR  367
            AR
Sbjct  466  AR  467



>ref|XP_011006998.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Populus 
euphratica]
Length=457

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAV+SAGLEL+D DLFEINEAFASQY+YC KKL LDPEK+NVNGGA+A+GHPLGATGA
Sbjct  336  IPAAVQSAGLELNDIDLFEINEAFASQYVYCIKKLELDPEKVNVNGGAIALGHPLGATGA  395

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCV TLL+EMKRRGKD R+GV+SMCIG+GMGAA VFERGD  D L N RKVE++  LSKD
Sbjct  396  RCVGTLLNEMKRRGKDSRFGVISMCIGSGMGAAAVFERGDCVDALCNVRKVESNDLLSKD  455

Query  362  AR  367
            AR
Sbjct  456  AR  457



>ref|XP_004247103.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Solanum lycopersicum]
Length=456

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLEL++ DLFEINEAFASQY+YCQKKL LDPE +NVNGGA+A+GHPLGATGA
Sbjct  335  IPAAVKSAGLELNNIDLFEINEAFASQYVYCQKKLNLDPENVNVNGGALALGHPLGATGA  394

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GV+SMCIG+GMGAA VFERGDA D+L NAR    + +LSKD
Sbjct  395  RCVATLLHEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDAVDDLCNARANNNNNFLSKD  454

Query  362  AR  367
            A+
Sbjct  455  AK  456



>ref|XP_002521123.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
 gb|EEF41274.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
Length=467

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELD+ DLFEINEAFASQY+YC KKL LDPEK+NVNGGA+A+GHPLGATGA
Sbjct  346  IPAAVKAAGLELDNIDLFEINEAFASQYVYCCKKLELDPEKVNVNGGAIALGHPLGATGA  405

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKR GKDCR+GV+SMCIGTGMGAA VFERGD  DEL NAR V  +  LSKD
Sbjct  406  RCVATLLHEMKRCGKDCRFGVISMCIGTGMGAAAVFERGDCVDELCNARPVNGNDLLSKD  465

Query  362  A  364
            A
Sbjct  466  A  466



>ref|XP_006350308.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Solanum 
tuberosum]
Length=456

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLEL++ DLFEINEAFASQY+YCQKKL LDPE +NVNGGA+A+GHPLGATGA
Sbjct  335  IPAAVKSAGLELNNIDLFEINEAFASQYVYCQKKLNLDPENVNVNGGALALGHPLGATGA  394

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GV+SMCIG+GMGAA VFERGDA D+L NAR    + +LSKD
Sbjct  395  RCVATLLHEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDAVDDLCNARANNNNNFLSKD  454

Query  362  AR  367
            A+
Sbjct  455  AK  456



>ref|XP_004954382.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Setaria 
italica]
Length=461

 Score =   206 bits (523),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLE++D DLFE+NEAFASQ++YC  KLGLD  K+NVNGGA+A+GHPLGATGA
Sbjct  340  IPAAVKSAGLEIEDIDLFELNEAFASQFVYCCNKLGLDRSKVNVNGGAIAMGHPLGATGA  399

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFERGD  DELSN R +++H +LS+D
Sbjct  400  RCVATLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFERGDTVDELSNVRDIQSHNFLSRD  459

Query  362  AR  367
            A+
Sbjct  460  AK  461



>gb|EMS48058.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Triticum urartu]
Length=453

 Score =   205 bits (521),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGL++DD DLFE+NEAFASQ++YC  KLGLD  K+NVNGGA+A+GHPLGATGA
Sbjct  331  IPAAVKSAGLDIDDIDLFELNEAFASQFVYCCNKLGLDRSKVNVNGGAIAMGHPLGATGA  390

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RC++TLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFERGD+ DELSN R +++H +LSKD
Sbjct  391  RCISTLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFERGDSVDELSNVRHIQSHNFLSKD  450

Query  362  A  364
            A
Sbjct  451  A  451



>gb|EYU17978.1| hypothetical protein MIMGU_mgv1a005895mg [Erythranthe guttata]
Length=466

 Score =   205 bits (522),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAV SAGLE+ D DLFEINEAFASQ++YC KKL LDPEK+NVNGGAMA+GHPLGATGA
Sbjct  345  IPAAVNSAGLEIADIDLFEINEAFASQFVYCCKKLDLDPEKVNVNGGAMALGHPLGATGA  404

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLL+EMKRRGKDCR+GV+SMCIG+GMGAA V ERGD  DELSNA+ +    +LSKD
Sbjct  405  RCVATLLNEMKRRGKDCRFGVISMCIGSGMGAAAVLERGDCVDELSNAQAISAQNFLSKD  464

Query  362  A  364
            A
Sbjct  465  A  465



>ref|XP_008800565.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Phoenix 
dactylifera]
Length=461

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGL+++D DLFE+NEAFASQ++YC KKL LDP K+NVNGGA+A+GHPLGATGA
Sbjct  340  IPAAVKSAGLQIEDIDLFELNEAFASQFVYCCKKLELDPAKVNVNGGAIALGHPLGATGA  399

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLL+EMKR+GKDCR+GVV+MCIG+GMGAA VFERGD  DEL NARK+++   LSKD
Sbjct  400  RCVATLLNEMKRKGKDCRFGVVTMCIGSGMGAAAVFERGDGVDELCNARKIQSQNLLSKD  459

Query  362  A  364
            A
Sbjct  460  A  460



>ref|XP_003570403.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brachypodium 
distachyon]
Length=461

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLE+DD DLFE+NEAFASQ++YC K LGLD  K+NVNGGA+A+GHPLGATGA
Sbjct  340  IPAAVKSAGLEIDDIDLFELNEAFASQFVYCCKTLGLDRSKVNVNGGAIAMGHPLGATGA  399

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RC+ATLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFERGD+ DELSN R V +  +LS+D
Sbjct  400  RCIATLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFERGDSVDELSNVRHVPSQNFLSRD  459

Query  362  AR  367
            A+
Sbjct  460  AK  461



>ref|XP_009411367.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=459

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAV++AGL+ DD D+FEINEAFASQ++YC KKL LDPEK+NVNGGA+A+GHPLGATGA
Sbjct  338  IPAAVRAAGLQPDDIDIFEINEAFASQFVYCCKKLELDPEKVNVNGGAIALGHPLGATGA  397

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFE GD  D+L+NAR+VE + +LSKD
Sbjct  398  RCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFEHGDVVDQLTNARQVEANSFLSKD  457

Query  362  A  364
            A
Sbjct  458  A  458



>ref|NP_001131193.1| acetyl-CoA C-acyltransferase-like protein [Zea mays]
 gb|ACF79501.1| unknown [Zea mays]
 gb|AFW74042.1| LOW QUALITY PROTEIN: acetyl-CoA C-acyltransferase-like protein 
[Zea mays]
Length=461

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLE+ D DLFE+NEAFASQ++YC  KLGLD  K+NVNGGA+A+GHPLGATGA
Sbjct  340  IPAAVKSAGLEIGDIDLFELNEAFASQFVYCCNKLGLDRSKVNVNGGAIALGHPLGATGA  399

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFERGDA D LSN R ++ H +LSKD
Sbjct  400  RCVATLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFERGDAVDGLSNVRDIQAHNFLSKD  459

Query  362  AR  367
            A+
Sbjct  460  AK  461



>ref|XP_003574006.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Brachypodium 
distachyon]
Length=453

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGL+++D DLFEINEAFASQ++YC KKL LDP KINVNGGAMA+GHPLGATGA
Sbjct  332  IPAAVKAAGLQINDVDLFEINEAFASQFVYCAKKLELDPVKINVNGGAMALGHPLGATGA  391

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGDA DEL+NAR   +   LSKD
Sbjct  392  RCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDAVDELTNARGTPSLNLLSKD  451



>ref|XP_010933143.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=460

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGL++DD DLFEINEAFASQ++YC KKL LDP K+NVNGGA+A+GHPLGATGA
Sbjct  339  IPAAVKAAGLQIDDIDLFEINEAFASQFVYCCKKLELDPSKVNVNGGAIALGHPLGATGA  398

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCV TLL+EMKRRGK CR+GV+SMCIG+GMGAA VFERGD  D+LSNAR++++   LSKD
Sbjct  399  RCVITLLNEMKRRGKKCRFGVISMCIGSGMGAAAVFERGDVVDQLSNARRIQSTSLLSKD  458

Query  362  A  364
            A
Sbjct  459  A  459



>ref|XP_010547052.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X3 
[Tarenaya hassleriana]
Length=426

 Score =   203 bits (516),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA K AGL + D DLFEINEAFASQ++Y  KKL LD EK+NVNGGA+A+GHPLGATGA
Sbjct  305  IPAAAKLAGLRVSDIDLFEINEAFASQFVYSCKKLELDREKVNVNGGAIALGHPLGATGA  364

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGDA D+LSNAR V  +G+LSKD
Sbjct  365  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDAVDDLSNARTVNLNGHLSKD  424

Query  362  AR  367
            A+
Sbjct  425  AK  426



>ref|XP_010935683.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=461

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGL+++D DLFE+NEAFASQ++YC KKL LDP K+NVNGGA+A+GHPLGATGA
Sbjct  340  IPAAVKSAGLQIEDIDLFELNEAFASQFVYCCKKLELDPAKVNVNGGAIALGHPLGATGA  399

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCV+TLL+EMKRRGKDCR+GVV+MCIG+GMGAA VFERGD  D L NARK+ +   LSKD
Sbjct  400  RCVSTLLNEMKRRGKDCRFGVVTMCIGSGMGAAAVFERGDGVDALCNARKIPSQNLLSKD  459

Query  362  AR  367
            AR
Sbjct  460  AR  461



>ref|XP_010547051.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X2 
[Tarenaya hassleriana]
Length=468

 Score =   204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA K AGL + D DLFEINEAFASQ++Y  KKL LD EK+NVNGGA+A+GHPLGATGA
Sbjct  347  IPAAAKLAGLRVSDIDLFEINEAFASQFVYSCKKLELDREKVNVNGGAIALGHPLGATGA  406

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGDA D+LSNAR V  +G+LSKD
Sbjct  407  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDAVDDLSNARTVNLNGHLSKD  466

Query  362  AR  367
            A+
Sbjct  467  AK  468



>ref|XP_008804745.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Phoenix dactylifera]
Length=460

 Score =   203 bits (516),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGL++DD DLFEINEAFASQ++YC KKL LDP K+NVNGGA+A+GHPLGATGA
Sbjct  339  IPAAVKAAGLQIDDIDLFEINEAFASQFVYCCKKLELDPSKVNVNGGAIALGHPLGATGA  398

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            R V+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  D+LSN R+++++  LSKD
Sbjct  399  RSVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDVVDQLSNVRRIQSNNLLSKD  458

Query  362  A  364
            A
Sbjct  459  A  459



>emb|CDP03848.1| unnamed protein product [Coffea canephora]
Length=466

 Score =   203 bits (516),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA KSAGL +DD DLFEINEAFASQY+YC KKL LD EK+NVNGGAMA+GHPLGATGA
Sbjct  345  IPAAAKSAGLGVDDIDLFEINEAFASQYVYCCKKLELDMEKVNVNGGAMALGHPLGATGA  404

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRG+DCR+GV+SMCIG+GMGAAGVFERGD+ D+L NAR V     LSKD
Sbjct  405  RCVATLLHEMKRRGRDCRFGVISMCIGSGMGAAGVFERGDSTDDLCNARPVSKVNLLSKD  464

Query  362  AR  367
             +
Sbjct  465  VK  466



>ref|XP_010547050.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X1 
[Tarenaya hassleriana]
Length=474

 Score =   203 bits (516),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA K AGL + D DLFEINEAFASQ++Y  KKL LD EK+NVNGGA+A+GHPLGATGA
Sbjct  353  IPAAAKLAGLRVSDIDLFEINEAFASQFVYSCKKLELDREKVNVNGGAIALGHPLGATGA  412

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGDA D+LSNAR V  +G+LSKD
Sbjct  413  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDAVDDLSNARTVNLNGHLSKD  472

Query  362  AR  367
            A+
Sbjct  473  AK  474



>ref|XP_010940650.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=461

 Score =   203 bits (516),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGL+++D DLFE+NEAFASQ++YC KKL LDP K+NVNGGA+A+GHPLGATGA
Sbjct  340  IPAAVKSAGLQIEDIDLFELNEAFASQFVYCCKKLELDPAKVNVNGGAIALGHPLGATGA  399

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCV TLL+EMKRRGKDCR+GVV+MCIG+GMGAA VFERGD  DEL N RK+++   LSKD
Sbjct  400  RCVGTLLNEMKRRGKDCRFGVVTMCIGSGMGAAAVFERGDGVDELCNTRKIQSQNLLSKD  459

Query  362  A  364
            A
Sbjct  460  A  460



>ref|NP_001241698.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor [Zea mays]
 gb|ACG36949.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor [Zea mays]
Length=461

 Score =   202 bits (515),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLE+ D DLFE+NEAFASQ++YC  KLGLD  K+NVNGGA+A+GHPLGATGA
Sbjct  340  IPAAVKSAGLEIGDIDLFELNEAFASQFVYCCNKLGLDRSKVNVNGGAIALGHPLGATGA  399

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFERGDA D LSN R ++ H +LSKD
Sbjct  400  RCVATLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFERGDAVDGLSNVRDMQAHNFLSKD  459

Query  362  AR  367
            A+
Sbjct  460  AK  461



>ref|XP_010038353.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Eucalyptus 
grandis]
 ref|XP_010038354.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Eucalyptus 
grandis]
 gb|KCW50167.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
 gb|KCW50168.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
Length=466

 Score =   202 bits (515),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGL LDD DL EINEAFASQY+YC KKLGLDPEK+NVNGGA+A+GHPLGATGA
Sbjct  345  IPAAVKSAGLTLDDIDLLEINEAFASQYVYCCKKLGLDPEKVNVNGGALALGHPLGATGA  404

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLL+EMKR+G+D R+GV+SMCIG+GMGAA VFERGD  DEL NAR ++ +  LS+D
Sbjct  405  RCVATLLNEMKRQGRDSRFGVISMCIGSGMGAAAVFERGDCADELCNARPIKINNLLSRD  464

Query  362  AR  367
            A+
Sbjct  465  AQ  466



>ref|XP_004982961.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Setaria 
italica]
Length=461

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAV++AGL++ D DLFEINEAFASQY+YC KKL LDP K+NVNGGA+A+GHPLGATGA
Sbjct  340  IPAAVQAAGLQIGDIDLFEINEAFASQYVYCCKKLELDPTKVNVNGGAIALGHPLGATGA  399

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  DEL+NAR + +  +LSKD
Sbjct  400  RCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDGVDELTNARDIPSLNWLSKD  459

Query  362  A  364
            A
Sbjct  460  A  460



>gb|ABR17647.1| unknown [Picea sitchensis]
Length=462

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLE+DD DLFEINEAFASQ+ YC +KL LDPEK+NVNGGA+A+GHPLGATGA
Sbjct  341  IPAAVKAAGLEIDDIDLFEINEAFASQFTYCSQKLELDPEKVNVNGGAIALGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
             CVATLLHEMK RGKDCR+GV+SMCIGTGMGAA VFER  A D+L NAR ++ H  LS+D
Sbjct  401  LCVATLLHEMKLRGKDCRFGVISMCIGTGMGAAAVFERSGAVDQLCNARPIKDHTSLSRD  460

Query  362  AR  367
            A+
Sbjct  461  AQ  462



>ref|XP_008804452.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Phoenix 
dactylifera]
Length=460

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAV +AGL+ DD DLFEINEAFASQ++YC KKL LDP K+NVNGGA+A+GHPLG TGA
Sbjct  339  IPAAVNAAGLQTDDIDLFEINEAFASQFVYCCKKLELDPSKVNVNGGALALGHPLGDTGA  398

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  D+LSNAR++ ++  LSKD
Sbjct  399  RCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDVVDQLSNARRIRSNNLLSKD  458

Query  362  A  364
            A
Sbjct  459  A  459



>gb|KJB10128.1| hypothetical protein B456_001G185200 [Gossypium raimondii]
Length=465

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA+KSAGLELDD DLFEINEAFASQ++Y  KKLGLD EK+NVNGGA+A+GHPLGATGA
Sbjct  344  IPAAIKSAGLELDDIDLFEINEAFASQFVYSCKKLGLDREKVNVNGGAIALGHPLGATGA  403

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCV TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  D+  NAR V+ +  LSKD
Sbjct  404  RCVGTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDCVDDFCNARAVQKNDLLSKD  463

Query  362  AR  367
            AR
Sbjct  464  AR  465



>ref|XP_010484155.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X2 [Camelina sativa]
Length=440

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQY+YC+ KLGL+PEKINVNGGA+AIGHPLGATGA
Sbjct  330  IPAAVKAAGLELDDIDLFEINEAFASQYVYCRNKLGLNPEKINVNGGAIAIGHPLGATGA  389

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNA  325
            RCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAA VFERG + DEL N+
Sbjct  390  RCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFERGGSVDELPNS  437



>ref|XP_011083116.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Sesamum indicum]
Length=463

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AVKSAGLEL D DLFEINEAFASQ++YC KKL LD EK+NVNGGAMA+GHPLGATGA
Sbjct  342  IPPAVKSAGLELSDIDLFEINEAFASQFVYCCKKLDLDREKVNVNGGAMALGHPLGATGA  401

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLL+EMKRRGKDCR+GV+SMCIG+GMGAA V ERGD  D+L NAR V  + +LSKD
Sbjct  402  RCVATLLNEMKRRGKDCRFGVISMCIGSGMGAAAVLERGDCVDDLCNARAVSENNFLSKD  461

Query  362  A  364
            A
Sbjct  462  A  462



>ref|XP_007049825.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
 gb|EOX93982.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
Length=470

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAG+EL D DLFEINEAFASQY+YC KKL LD EK+NVNGGA+A+GHPLGATGA
Sbjct  349  IPAAVKSAGIELADIDLFEINEAFASQYVYCCKKLELDSEKVNVNGGAIALGHPLGATGA  408

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCV TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  DE  N R V+ + +LSKD
Sbjct  409  RCVGTLLYEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDCVDEFCNVRAVKYNEFLSKD  468

Query  362  AR  367
            AR
Sbjct  469  AR  470



>ref|XP_010484150.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X1 [Camelina sativa]
Length=446

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQY+YC+ KLGL+PEKINVNGGA+AIGHPLGATGA
Sbjct  336  IPAAVKAAGLELDDIDLFEINEAFASQYVYCRNKLGLNPEKINVNGGAIAIGHPLGATGA  395

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNA  325
            RCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAA VFERG + DEL N+
Sbjct  396  RCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFERGGSVDELPNS  443



>ref|XP_008438387.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Cucumis melo]
Length=462

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 105/115 (91%), Gaps = 1/115 (1%)
 Frame = +2

Query  26   GLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLH  205
            GLEL+D DLFEINEAFASQ++YC++KLGLDPEKINVNGGA+AIGHPLGATGARCVATLLH
Sbjct  348  GLELNDIDLFEINEAFASQFVYCREKLGLDPEKINVNGGAIAIGHPLGATGARCVATLLH  407

Query  206  EMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETH-GYLSKDAR  367
            EMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NA+KVE     LSKDAR
Sbjct  408  EMKRRGKDCRFGVISMCIGTGMGAAAVFERGDCVDELCNAKKVEGGVNLLSKDAR  462



>emb|CDX86611.1| BnaC08g00920D [Brassica napus]
Length=451

 Score =   201 bits (510),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +2

Query  26   GLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLH  205
            GLELDD DLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLGATGARCVATLLH
Sbjct  348  GLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAIAIGHPLGATGARCVATLLH  407

Query  206  EMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  337
            EMKRRGKDCR+GVV+MCIG+GMGAAGVFERGD  DELSN RKVE
Sbjct  408  EMKRRGKDCRFGVVTMCIGSGMGAAGVFERGDGVDELSNVRKVE  451



>ref|XP_001762605.1| predicted protein [Physcomitrella patens]
 gb|EDQ72728.1| predicted protein [Physcomitrella patens]
Length=455

 Score =   200 bits (509),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLEL D DLFEINEAFASQ+ YC ++LGLD EK+NVNGGAMA+GHPLGATGA
Sbjct  334  IPAAVKAAGLELSDIDLFEINEAFASQFTYCAQELGLDEEKVNVNGGAMALGHPLGATGA  393

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RC ATLLHEMK+RGKDCR+G+VSMCIG+GMGAA VFE+G A D LSNAR V  +  LS+D
Sbjct  394  RCTATLLHEMKKRGKDCRFGIVSMCIGSGMGAAAVFEQGGAIDPLSNARAVGQNNLLSRD  453

Query  362  AR  367
            A+
Sbjct  454  AK  455



>ref|XP_008372446.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Malus domestica]
Length=453

 Score =   200 bits (508),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AVKSAGLE+DD DLFEINEAFASQY+YC KKL LDPEK+NVNGGA+A+GHPLGATGA
Sbjct  343  IPVAVKSAGLEIDDIDLFEINEAFASQYVYCVKKLELDPEKVNVNGGAIALGHPLGATGA  402

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  334
            RCVATLL+EMKRRGKD R+GV+SMCIG+GMGAA VFERGD+ DELSNAR V
Sbjct  403  RCVATLLNEMKRRGKDNRFGVISMCIGSGMGAAAVFERGDSVDELSNARAV  453



>ref|XP_009385864.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=463

 Score =   200 bits (508),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGL+++D DLFEINEAFASQ++YC KKL LD  K+NVNGGA+A+GHPLGATGA
Sbjct  341  IPAAVKSAGLQIEDIDLFEINEAFASQFVYCCKKLELDATKVNVNGGAIALGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            R V+TLL+EMKRRGKDCR GV+SMCIGTGMGAA VFERGDA D L+NAR++++H  LSKD
Sbjct  401  RSVSTLLNEMKRRGKDCRLGVISMCIGTGMGAAAVFERGDATDGLTNARRMQSHNLLSKD  460

Query  362  A  364
            A
Sbjct  461  A  461



>ref|XP_009111084.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal [Brassica rapa]
Length=451

 Score =   199 bits (507),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +2

Query  26   GLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLH  205
            GLE+DD DLFEINEAFASQ++YC+ KLGLDP+KINVNGGA+AIGHPLGATGARCVATLLH
Sbjct  348  GLEVDDIDLFEINEAFASQFVYCRNKLGLDPQKINVNGGAIAIGHPLGATGARCVATLLH  407

Query  206  EMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  337
            EMKRRGKDCR+GVVSMCIG+GMGAAGVFERGD  DELSN RKVE
Sbjct  408  EMKRRGKDCRFGVVSMCIGSGMGAAGVFERGDGVDELSNVRKVE  451



>gb|KHG11493.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
Length=463

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA+KSAGLELDD DLFEINEAFASQ++Y  KKLGLD EK+NVNGGA+A+GHPLGATGA
Sbjct  343  IPAAIKSAGLELDDIDLFEINEAFASQFVYSCKKLGLDREKVNVNGGAIALGHPLGATGA  402

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCV TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  DE  NAR V  +  LSKD
Sbjct  403  RCVGTLLNEMKRRGKDCRFGVISMCIGSGMGAASVFERGDCVDEFCNARAVHKNELLSKD  462

Query  362  A  364
            A
Sbjct  463  A  463



>ref|XP_002889522.1| hypothetical protein ARALYDRAFT_470458 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65781.1| hypothetical protein ARALYDRAFT_470458 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLEL+D DLFEINEAFASQ++YC+ KLG+DPEK+NVNGGA+AIGHPLGATGA
Sbjct  307  IPAAVKAAGLELNDIDLFEINEAFASQFVYCRNKLGIDPEKVNVNGGAIAIGHPLGATGA  366

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  334
            RCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAA VFERG   DEL + RKV
Sbjct  367  RCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFERGGGVDELCDVRKV  417



>ref|XP_010457531.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal [Camelina sativa]
Length=439

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQY+YC+ KLGL+PE INVNGGA+AIGHPLGATGA
Sbjct  330  IPAAVKAAGLELDDIDLFEINEAFASQYVYCRNKLGLNPENINVNGGAIAIGHPLGATGA  389

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARK  331
            RCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAA VFERG + DEL N  +
Sbjct  390  RCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFERGGSVDELPNVSR  439



>ref|XP_009371217.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Pyrus x bretschneideri]
Length=453

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AVKSAGLELDD DLFE+NEAFASQY+YC KKL LDPEK+NVNGGA+A+GHPLGATGA
Sbjct  343  IPVAVKSAGLELDDIDLFEMNEAFASQYVYCIKKLELDPEKVNVNGGAIALGHPLGATGA  402

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  334
            RCVATLL+EMKRRGKD R+GV+SMCIG+GMGAA VFERGD+ DELSNAR V
Sbjct  403  RCVATLLNEMKRRGKDNRFGVISMCIGSGMGAAAVFERGDSVDELSNARAV  453



>gb|KDP26413.1| hypothetical protein JCGZ_17571 [Jatropha curcas]
Length=452

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLEL+D  LFEINEAFASQY+YC KKLGLDPEK+NVNGGA+A+GHPLGATGA
Sbjct  345  IPAAVKAAGLELNDISLFEINEAFASQYVYCIKKLGLDPEKVNVNGGALALGHPLGATGA  404

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNA  325
            RCV+T+LHEMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  DELS+A
Sbjct  405  RCVSTILHEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDGVDELSSA  452



>pdb|2C7Y|A Chain A, Plant Enzyme
 pdb|2C7Y|B Chain B, Plant Enzyme
 pdb|2C7Z|A Chain A, Plant Enzyme Crystal Form Ii
Length=404

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/100 (92%), Positives = 97/100 (97%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQ++YC+ KLGLDPEKINVNGGAMAIGHPLGATGA
Sbjct  304  IPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGA  363

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  301
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD
Sbjct  364  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGD  403



>ref|XP_002963753.1| hypothetical protein SELMODRAFT_450889 [Selaginella moellendorffii]
 gb|EFJ35624.1| hypothetical protein SELMODRAFT_450889 [Selaginella moellendorffii]
Length=462

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AVK AGLE+ D DLFE+NEAFASQ+ Y  KKL LD EK+NVNGGAMA+GHPLGATGA
Sbjct  341  IPKAVKDAGLEISDIDLFELNEAFASQFTYSCKKLDLDIEKVNVNGGAMALGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEM +RGKDCR+GV+SMCIG+GMGAA VFERG+A D LSNAR V+ +  LSKD
Sbjct  401  RCVATLLHEMSKRGKDCRFGVISMCIGSGMGAAAVFERGNAVDNLSNARPVQNNSLLSKD  460

Query  362  AR  367
            AR
Sbjct  461  AR  462



>emb|CDY15520.1| BnaA08g28040D [Brassica napus]
Length=451

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +2

Query  26   GLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLH  205
            GLELDD DLFEINEAFASQ++YC+ KLGL PEKINVNGGA+AIGHPLGATGARCVATLLH
Sbjct  348  GLELDDIDLFEINEAFASQFVYCRNKLGLVPEKINVNGGAIAIGHPLGATGARCVATLLH  407

Query  206  EMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  337
            EMKRRGKDCR+GVVSMCIG+GMGAAGVFERGD  DELSN RKVE
Sbjct  408  EMKRRGKDCRFGVVSMCIGSGMGAAGVFERGDGVDELSNVRKVE  451



>ref|XP_010475137.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like [Camelina 
sativa]
Length=446

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQY+YC+ KLG++PEKINVNGGA+AIGHPLGATGA
Sbjct  329  IPAAVKAAGLELDDIDLFEINEAFASQYVYCRNKLGINPEKINVNGGAIAIGHPLGATGA  388

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  337
            RCVATLLHEMKRRGK CR+GVVSMCIG+GMGAA VFERG + DEL N  K E
Sbjct  389  RCVATLLHEMKRRGKYCRFGVVSMCIGSGMGAAAVFERGGSVDELRNVSKGE  440



>ref|XP_009336047.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Pyrus 
x bretschneideri]
Length=443

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AVKS GLELDD DLFEINEAFASQY+YC KKLGLDPEK+NVNGGA+A+GHPLGATGA
Sbjct  333  IPVAVKSPGLELDDIDLFEINEAFASQYVYCCKKLGLDPEKVNVNGGAIALGHPLGATGA  392

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  334
            RCVATLL+EMKRRG+D R+GV+SMCIG+GMGAA VFERGD+ DEL NAR V
Sbjct  393  RCVATLLNEMKRRGRDHRFGVISMCIGSGMGAAAVFERGDSVDELCNARTV  443



>ref|XP_006307517.1| hypothetical protein CARUB_v10009140mg [Capsella rubella]
 gb|EOA40415.1| hypothetical protein CARUB_v10009140mg [Capsella rubella]
Length=444

 Score =   197 bits (501),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AVK+A LELDD DLFEINEAFASQ++YC+ KLG++PEKINVNGGA+AIGHPLGATGA
Sbjct  333  IPTAVKAASLELDDIDLFEINEAFASQFVYCRNKLGINPEKINVNGGAIAIGHPLGATGA  392

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSN  322
            RCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAA VFERGD+ DEL N
Sbjct  393  RCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFERGDSVDELRN  439



>ref|NP_171965.1| 3-ketoacyl-CoA thiolase 1 [Arabidopsis thaliana]
 sp|Q8LF48.2|THIK1_ARATH RecName: Full=3-ketoacyl-CoA thiolase 1, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase 1; AltName: Full=Beta-ketothiolase 
1; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAM20592.1| putative acetyl-CoA acyltransferase [Arabidopsis thaliana]
 gb|AAO30078.1| putative acetyl-CoA acyltransferase [Arabidopsis thaliana]
 gb|AEE27736.1| 3-ketoacyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=443

 Score =   197 bits (501),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLEL+D DLFEINEAFASQ++YC+ KLGLD EKINVNGGA+AIGHPLGATGA
Sbjct  333  IPAAVKAAGLELNDVDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAIAIGHPLGATGA  392

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  334
            RCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAA VFERG   DEL + RKV
Sbjct  393  RCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFERGGGVDELCDVRKV  443



>ref|XP_010109695.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
 gb|EXC24165.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
Length=452

 Score =   197 bits (500),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLEL+D DLFEINEAFASQY+YC KKLGLDPEK+NVNGGA+A+GHPLGATGA
Sbjct  342  IPAAVKSAGLELNDIDLFEINEAFASQYVYCIKKLGLDPEKVNVNGGALALGHPLGATGA  401

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  328
            R V+TLL+EMKRRGKDCR+G++SMCIG+GMGAA V ERGD+ DEL NAR
Sbjct  402  RSVSTLLNEMKRRGKDCRFGIISMCIGSGMGAAAVLERGDSVDELRNAR  450



>ref|XP_002974835.1| hypothetical protein SELMODRAFT_101898 [Selaginella moellendorffii]
 gb|EFJ24355.1| hypothetical protein SELMODRAFT_101898 [Selaginella moellendorffii]
Length=454

 Score =   197 bits (500),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AVK AGLE+ D DLFE+NEAFASQ+ Y  KKL LD EK+NVNGGA+A+GHPLGATGA
Sbjct  333  IPKAVKDAGLEISDIDLFELNEAFASQFTYSCKKLDLDMEKVNVNGGAIALGHPLGATGA  392

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEM +RGKDCR+GV+SMCIG+GMGAA VFERG+A D LSNAR V+ +  LSKD
Sbjct  393  RCVATLLHEMSKRGKDCRFGVISMCIGSGMGAAAVFERGNAVDNLSNARPVQNNSLLSKD  452

Query  362  AR  367
            AR
Sbjct  453  AR  454



>gb|AAB80634.1| Strong similarity to Cucumis acetyl-CoA acyltransferase (gb|D70895) 
[Arabidopsis thaliana]
Length=460

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLEL+D DLFEINEAFASQ++YC+ KLGLD EKINVNGGA+AIGHPLGATGA
Sbjct  350  IPAAVKAAGLELNDVDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAIAIGHPLGATGA  409

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  334
            RCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAA VFERG   DEL + RKV
Sbjct  410  RCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFERGGGVDELCDVRKV  460



>dbj|BAD94007.1| peroxisomal-3-keto-acyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=213

 Score =   190 bits (482),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA K AGL + D DLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AIGHPLGATGA
Sbjct  98   IPAATKLAGLNVSDIDLFEINEAFASQYVYSCKKLELDMEKVNVNGGAIAIGHPLGATGA  157

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  328
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D LSNAR
Sbjct  158  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNAR  206



>ref|XP_001764272.1| predicted protein [Physcomitrella patens]
 gb|EDQ70826.1| predicted protein [Physcomitrella patens]
Length=460

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA+K+AGLE++D DLFEINEAFASQ+ YC ++LGLD EKINVNGGA+A+GHPLGATGA
Sbjct  339  IPAAIKAAGLEINDIDLFEINEAFASQFTYCAQELGLDEEKINVNGGAIALGHPLGATGA  398

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RC ATLLHEMK+RGKDCR+GV+SMCIG+GMGAA VFE+G A D LSN R V  +  LS+D
Sbjct  399  RCTATLLHEMKKRGKDCRFGVISMCIGSGMGAAAVFEQGGAIDPLSNVRAVGQNNLLSRD  458

Query  362  AR  367
            A+
Sbjct  459  AK  460



>gb|KJB42403.1| hypothetical protein B456_007G152600 [Gossypium raimondii]
Length=372

 Score =   193 bits (491),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLE+DD DLFEINEAFASQ++Y  KKLGLD EK+NVNGGA+A+GHPLG TGA
Sbjct  260  IPAAVKSAGLEIDDIDLFEINEAFASQFVYSCKKLGLDREKVNVNGGAIALGHPLGVTGA  319

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  337
            RCV TLL+EMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NAR V+
Sbjct  320  RCVGTLLYEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDCVDELCNARAVK  371



>emb|CDY05657.1| BnaC02g38800D [Brassica napus]
Length=462

 Score =   195 bits (495),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 104/115 (90%), Gaps = 1/115 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA   AGL++ D DLFEINEAFASQY+YC KKL LD EK+NVNGGA+AIGHPLGATGA
Sbjct  346  IPAAANLAGLKVSDIDLFEINEAFASQYVYCCKKLELDVEKVNVNGGAIAIGHPLGATGA  405

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHG  346
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D+LSNAR VET+G
Sbjct  406  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDDLSNAR-VETNG  459



>gb|AAM61609.1| putative acetyl-CoA acyltransferase [Arabidopsis thaliana]
Length=443

 Score =   194 bits (493),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLEL+D DLFEINEAFASQ++YC+ KLG D EKINVNGGA+AIGHPLGATGA
Sbjct  333  IPAAVKAAGLELNDVDLFEINEAFASQFVYCRNKLGQDAEKINVNGGAIAIGHPLGATGA  392

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  334
            RCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAA VFERG   DEL + RKV
Sbjct  393  RCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFERGGDVDELCDVRKV  443



>ref|XP_009129751.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X2 
[Brassica rapa]
Length=415

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA   AGL++ D DLFEINEAFASQY+YC KKL LD EK+NVNGGA+AIGHPLGATGA
Sbjct  299  IPAAANLAGLKVSDIDLFEINEAFASQYVYCCKKLELDVEKVNVNGGAIAIGHPLGATGA  358

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  334
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D+LSNAR V
Sbjct  359  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDDLSNARVV  409



>gb|KJB42405.1| hypothetical protein B456_007G152600 [Gossypium raimondii]
Length=454

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLE+DD DLFEINEAFASQ++Y  KKLGLD EK+NVNGGA+A+GHPLG TGA
Sbjct  342  IPAAVKSAGLEIDDIDLFEINEAFASQFVYSCKKLGLDREKVNVNGGAIALGHPLGVTGA  401

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  337
            RCV TLL+EMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NAR V+
Sbjct  402  RCVGTLLYEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDCVDELCNARAVK  453



>ref|XP_004290230.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Fragaria 
vesca subsp. vesca]
Length=456

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AVKSAGLEL D DLFEINEAFASQY+YCQKKL LD +K+NVNGGA+A+GHPLGATGA
Sbjct  345  IPVAVKSAGLELGDIDLFEINEAFASQYVYCQKKLELDSDKVNVNGGAIALGHPLGATGA  404

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  328
            RCVATLL+EMKRRGKDCR+GV+SMCIG+GMGAA V ERGD+ DEL NAR
Sbjct  405  RCVATLLNEMKRRGKDCRFGVISMCIGSGMGAAAVLERGDSVDELCNAR  453



>gb|KJB42404.1| hypothetical protein B456_007G152600 [Gossypium raimondii]
Length=453

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLE+DD DLFEINEAFASQ++Y  KKLGLD EK+NVNGGA+A+GHPLG TGA
Sbjct  341  IPAAVKSAGLEIDDIDLFEINEAFASQFVYSCKKLGLDREKVNVNGGAIALGHPLGVTGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  337
            RCV TLL+EMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NAR V+
Sbjct  401  RCVGTLLYEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDCVDELCNARAVK  452



>ref|XP_002865685.1| KAT5/PKT1/PKT2 peroxisomal 3-keto-acyl-CoA thiolase [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH41944.1| KAT5/PKT1/PKT2 peroxisomal 3-keto-acyl-CoA thiolase [Arabidopsis 
lyrata subsp. lyrata]
Length=457

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA K AGL + D DLFEINEAFASQY+YC KKL LD EK+NVNGGA+AIGHPLGATGA
Sbjct  342  IPAATKLAGLNVSDIDLFEINEAFASQYVYCCKKLELDMEKVNVNGGAIAIGHPLGATGA  401

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  328
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D LSNAR
Sbjct  402  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNAR  450



>ref|XP_006395130.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
 gb|ESQ32416.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
Length=414

 Score =   192 bits (487),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA   AGL++ D DLFEINEAFASQY+YC KKL LD EK+NVNGGA+AIGHPLGATGA
Sbjct  299  IPAATNLAGLKVSDIDLFEINEAFASQYVYCCKKLELDLEKVNVNGGAIAIGHPLGATGA  358

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  349
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ DELSNA+     G+
Sbjct  359  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDELSNAQVANGDGH  414



>gb|KHG13200.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
 gb|KHG18802.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
Length=454

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLE+DD DLFEINEAFASQ++Y  KKLGLD EK+NVNGGA+A+GHPLG TGA
Sbjct  342  IPAAVKSAGLEIDDIDLFEINEAFASQFVYSCKKLGLDREKVNVNGGAIALGHPLGVTGA  401

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  337
            RCV TLL+EMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NAR V+
Sbjct  402  RCVGTLLNEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDCVDELCNARAVK  453



>emb|CDY33940.1| BnaA02g30470D [Brassica napus]
Length=456

 Score =   192 bits (489),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA   AGL++ D DLFEINEAFASQY+YC KKL LD EK+NVNGGA+AIGHPLGATGA
Sbjct  340  IPAAANLAGLKVSDIDLFEINEAFASQYVYCCKKLELDVEKVNVNGGAIAIGHPLGATGA  399

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  334
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D+LSNAR V
Sbjct  400  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDDLSNARVV  450



>ref|XP_009129750.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X1 
[Brassica rapa]
Length=456

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA   AGL++ D DLFEINEAFASQY+YC KKL LD EK+NVNGGA+AIGHPLGATGA
Sbjct  340  IPAAANLAGLKVSDIDLFEINEAFASQYVYCCKKLELDVEKVNVNGGAIAIGHPLGATGA  399

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  334
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D+LSNAR V
Sbjct  400  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDDLSNARVV  450



>ref|XP_006395129.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
 gb|ESQ32415.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
Length=460

 Score =   192 bits (488),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA   AGL++ D DLFEINEAFASQY+YC KKL LD EK+NVNGGA+AIGHPLGATGA
Sbjct  345  IPAATNLAGLKVSDIDLFEINEAFASQYVYCCKKLELDLEKVNVNGGAIAIGHPLGATGA  404

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  349
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ DELSNA+     G+
Sbjct  405  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDELSNAQVANGDGH  460



>ref|XP_008365692.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like, partial 
[Malus domestica]
Length=162

 Score =   183 bits (465),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AVKSAGLELDD DLFEINEAFASQY+YC KKL LDPEK+N NGGA+A+GHPLGATGA
Sbjct  52   IPVAVKSAGLELDDIDLFEINEAFASQYVYCCKKLELDPEKVNXNGGAIALGHPLGATGA  111

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  334
            RCVAT L+EMKRRG+D  +GV SMCIG+GM AA VFERGD+ DEL NAR V
Sbjct  112  RCVATXLNEMKRRGRDHXFGVXSMCIGSGMXAAAVFERGDSVDELCNARTV  162



>gb|ACU19231.1| unknown [Glycine max]
Length=198

 Score =   183 bits (464),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKS GLEL + DLFEINEAFASQY+YC KKLGLDP K+NVNGGA+A+GHPLG TGA
Sbjct  98   IPAAVKSVGLELGNIDLFEINEAFASQYVYCLKKLGLDPRKVNVNGGAIALGHPLGVTGA  157

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  301
            RCVATLL EMKRRGKDCRYGV+SMCIG+GMGAA VFERGD
Sbjct  158  RCVATLLSEMKRRGKDCRYGVISMCIGSGMGAAAVFERGD  197



>ref|NP_851157.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAC17876.1| 3-keto-acyl-CoA-thiolase 1 [Arabidopsis thaliana]
 gb|AAC19122.1| peroxisomal-3-keto-acyl-CoA thiolase 1 [Arabidopsis thaliana]
 gb|AAM97120.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAO00954.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AED95736.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=414

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA K AGL + D DLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AIGHPLGATGA
Sbjct  299  IPAATKLAGLNVSDIDLFEINEAFASQYVYSCKKLELDMEKVNVNGGAIAIGHPLGATGA  358

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  328
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D LSNAR
Sbjct  359  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNAR  407



>dbj|BAF02017.1| peroxisomal-3-keto-acyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=414

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA K AGL + D DLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AIGHPLGATGA
Sbjct  299  IPAATKLAGLNVSDIDLFEINEAFASQYVYSCKKLELDMEKVNVNGGAIAIGHPLGATGA  358

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  328
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D LSNAR
Sbjct  359  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNAR  407



>ref|XP_010442338.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X2 [Camelina sativa]
Length=414

 Score =   189 bits (480),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA   AGL + D DLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AIGHPLGATGA
Sbjct  299  IPAATNLAGLNVSDIDLFEINEAFASQYVYSCKKLDLDMEKVNVNGGAIAIGHPLGATGA  358

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  349
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D LSNAR     G+
Sbjct  359  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNARVANGEGH  414



>ref|XP_002301570.1| hypothetical protein POPTR_0002s22410g [Populus trichocarpa]
 gb|EEE80843.1| hypothetical protein POPTR_0002s22410g [Populus trichocarpa]
Length=457

 Score =   190 bits (482),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  26   GLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLH  205
            GLEL+D DLFEINEAFASQY+YC KKL LDPEK+NVNGGA+A+GHPLGATGARCV TLL+
Sbjct  344  GLELNDIDLFEINEAFASQYVYCIKKLELDPEKVNVNGGAIALGHPLGATGARCVGTLLN  403

Query  206  EMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  367
            EMKRRGKD R+GV+SMCIG+GMGAA VFERGD  D L N RKV ++  LSKDAR
Sbjct  404  EMKRRGKDSRFGVISMCIGSGMGAAAVFERGDCVDALCNVRKVGSNDLLSKDAR  457



>ref|NP_568704.2| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 ref|NP_001032037.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 sp|Q570C8.2|THIK5_ARATH RecName: Full=3-ketoacyl-CoA thiolase 5, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase 5; AltName: Full=Beta-ketothiolase 
5; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
5; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC17877.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAC23571.1| peroxisomal 3-keto-acyl-CoA thiolase 2 precursor [Arabidopsis 
thaliana]
 dbj|BAB09441.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAL84980.1| AT5g48880/K24G6_22 [Arabidopsis thaliana]
 gb|AED95737.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AED95738.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=457

 Score =   189 bits (481),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA K AGL + D DLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AIGHPLGATGA
Sbjct  342  IPAATKLAGLNVSDIDLFEINEAFASQYVYSCKKLELDMEKVNVNGGAIAIGHPLGATGA  401

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  328
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D LSNAR
Sbjct  402  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNAR  450



>ref|XP_010684942.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Beta vulgaris 
subsp. vulgaris]
Length=453

 Score =   189 bits (480),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGL+LDD +LFEINEAFASQY+YC KKL LDP K+NVNGGA+A+GHPLGATGA
Sbjct  339  IPAAVKSAGLKLDDINLFEINEAFASQYVYCCKKLNLDPAKVNVNGGALALGHPLGATGA  398

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETH  343
            RCVATLL+EM RRG DCR+GV+SMCIG+GMGAA VFERGD  + L+N R  +T+
Sbjct  399  RCVATLLNEMNRRGTDCRFGVISMCIGSGMGAAAVFERGDHANGLTNTRAAQTN  452



>ref|XP_010442336.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X1 [Camelina sativa]
Length=458

 Score =   189 bits (480),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA   AGL + D DLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AIGHPLGATGA
Sbjct  343  IPAATNLAGLNVSDIDLFEINEAFASQYVYSCKKLDLDMEKVNVNGGAIAIGHPLGATGA  402

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  349
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D LSNAR     G+
Sbjct  403  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNARVANGEGH  458



>ref|XP_010439770.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X2 
[Camelina sativa]
Length=414

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA   AGL + D DLFEINEAFASQY+Y  KKL LD +K+NVNGGA+AIGHPLGATGA
Sbjct  299  IPAATNLAGLNVSDIDLFEINEAFASQYVYSCKKLDLDMKKVNVNGGAIAIGHPLGATGA  358

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  349
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD+ D LSNAR     G+
Sbjct  359  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDSVDNLSNARVANGEGH  414



>ref|XP_006280441.1| hypothetical protein CARUB_v10026373mg [Capsella rubella]
 gb|EOA13339.1| hypothetical protein CARUB_v10026373mg [Capsella rubella]
Length=457

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA   AGL + D DLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AIGHPLGATGA
Sbjct  342  IPAATNLAGLNVSDIDLFEINEAFASQYVYSCKKLELDMEKVNVNGGAIAIGHPLGATGA  401

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  349
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D LSNAR     G+
Sbjct  402  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNARVANGDGH  457



>ref|XP_009336051.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Pyrus 
x bretschneideri]
Length=453

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AVKSAGLELDD DLFEINEAFASQY+YC KKLGLDPEK+NVNGGA+A+GHPLGAT  
Sbjct  343  IPVAVKSAGLELDDIDLFEINEAFASQYVYCCKKLGLDPEKVNVNGGAIALGHPLGATXX  402

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  334
              VATLL+EMKRRG+D R+GV+SMCIG+GMGAA VFERGD+ DEL NAR V
Sbjct  403  XXVATLLNEMKRRGRDHRFGVISMCIGSGMGAAAVFERGDSVDELCNARTV  453



>gb|AIB06952.1| 3-ketoacyl-CoA thiolase [Vanda hybrid cultivar]
Length=450

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGL++ D DL+EINEAFASQ++YC K+LGLDPEK+NVNGGA+A+GHPLGATGA
Sbjct  338  IPAAVKAAGLQIKDIDLYEINEAFASQFVYCIKELGLDPEKVNVNGGAIALGHPLGATGA  397

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  328
            RCV+TLL+EMKRRG DCR+G++SMCIG+GMGAA VFERGD  D LSN +
Sbjct  398  RCVSTLLNEMKRRGNDCRFGIISMCIGSGMGAAAVFERGDVADRLSNVQ  446



>ref|XP_010439766.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X1 
[Camelina sativa]
Length=456

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA   AGL + D DLFEINEAFASQY+Y  KKL LD +K+NVNGGA+AIGHPLGATGA
Sbjct  341  IPAATNLAGLNVSDIDLFEINEAFASQYVYSCKKLDLDMKKVNVNGGAIAIGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  349
            RCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD+ D LSNAR     G+
Sbjct  401  RCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDSVDNLSNARVANGEGH  456



>ref|XP_006649171.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Oryza 
brachyantha]
Length=449

 Score =   187 bits (474),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGL+++D DLFE+NEAFASQ++YC  KLGLD  K+NVNGGA+A+GHPLGATGA
Sbjct  339  IPAAVKSAGLQIEDIDLFELNEAFASQFVYCCNKLGLDRSKVNVNGGAIALGHPLGATGA  398

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  328
            RCVATLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFERGD+ D+ SN R
Sbjct  399  RCVATLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFERGDSVDQFSNVR  447



>ref|XP_009384048.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=451

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +2

Query  26   GLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLH  205
            GLELDD DLFEINEAFASQY+YC KKL LDP K+NVNGGAMA+GHPLG TGARCV+TLL+
Sbjct  345  GLELDDIDLFEINEAFASQYVYCCKKLKLDPAKVNVNGGAMALGHPLGCTGARCVSTLLY  404

Query  206  EMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  334
            EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  D+LSNAR+V
Sbjct  405  EMKRRGKDCRFGVISMCIGSGMGAAAVFERGDGVDQLSNARQV  447



>ref|NP_001048523.1| Os02g0817700 [Oryza sativa Japonica Group]
 gb|AAO72588.1| 3-ketoacyl-CoA thiolase-like protein [Oryza sativa Japonica Group]
 dbj|BAD21525.1| putative 3-ketoacyl-CoA thiolase; acetyl-CoA acyltransferase 
[Oryza sativa Japonica Group]
 dbj|BAF10437.1| Os02g0817700 [Oryza sativa Japonica Group]
 gb|EAY88029.1| hypothetical protein OsI_09452 [Oryza sativa Indica Group]
Length=448

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGL+++D DLFE+NEAFASQ++YC  KLGLD  K+NVNGGA+A+GHPLGATGA
Sbjct  338  IPAAVKSAGLQIEDIDLFELNEAFASQFVYCCNKLGLDRSKVNVNGGAIALGHPLGATGA  397

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  328
            RCVATLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFERGD+ D+ SN R
Sbjct  398  RCVATLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFERGDSVDQFSNVR  446



>ref|XP_004152018.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
sativus]
 ref|XP_004163039.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
sativus]
 gb|KGN58339.1| hypothetical protein Csa_3G624070 [Cucumis sativus]
Length=452

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGL L D DLFEINEAFASQY+YC KKL LD EK+NVNGGA+A+GHPLG TGA
Sbjct  340  IPAAVKSAGLTLQDIDLFEINEAFASQYVYCCKKLNLDTEKVNVNGGAIALGHPLGTTGA  399

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  328
            RCVATLL EMKRRG+D R+GV+SMCIGTGMGAA V ERGD  DEL NAR
Sbjct  400  RCVATLLSEMKRRGRDSRFGVISMCIGTGMGAAAVIERGDYVDELRNAR  448



>ref|NP_001237076.1| 3-ketoacyl-CoA thiolase [Glycine max]
 ref|XP_006605407.1| PREDICTED: 3-ketoacyl-CoA thiolase isoform X1 [Glycine max]
 gb|AAQ93070.1| 3-ketoacyl-CoA thiolase [Glycine max]
 gb|KHM99006.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=445

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKS GLEL + DLFEINEAFASQY+YC KKLGLDP K+NVNGGA+A+GHPLG TGA
Sbjct  345  IPAAVKSVGLELGNIDLFEINEAFASQYVYCLKKLGLDPRKVNVNGGAIALGHPLGVTGA  404

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  301
            RCVATLL+EMKRRGKDCRYGV+SMCIG+GMGAA VFERGD
Sbjct  405  RCVATLLNEMKRRGKDCRYGVISMCIGSGMGAAAVFERGD  444



>ref|XP_008454505.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X2 [Cucumis melo]
Length=461

 Score =   184 bits (467),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGL L D DLFEINEAFASQY+YC KKL LD EK+NVNGGA+A+GHPLGATGA
Sbjct  349  IPAAVKSAGLTLQDIDLFEINEAFASQYVYCCKKLKLDTEKVNVNGGAIALGHPLGATGA  408

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  328
            RCVATLL EMKRRG+D R+GV+SMCIGTGMGAA V ERGD  DE  NAR
Sbjct  409  RCVATLLSEMKRRGRDSRFGVISMCIGTGMGAAAVIERGDYVDEFCNAR  457



>gb|ADE77908.1| unknown [Picea sitchensis]
Length=444

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 98/111 (88%), Gaps = 6/111 (5%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGL++ D DLFEINEAFASQY+YC +KL LDPEK+NVNGGA+A+GHPLGATGA
Sbjct  340  IPAAVKAAGLQIGDIDLFEINEAFASQYVYCCQKLELDPEKVNVNGGAIALGHPLGATGA  399

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  334
            RCV TLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERG      SNAR +
Sbjct  400  RCVGTLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERG------SNARPI  444



>ref|XP_008454504.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X1 [Cucumis melo]
Length=502

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGL L D DLFEINEAFASQY+YC KKL LD EK+NVNGGA+A+GHPLGATGA
Sbjct  390  IPAAVKSAGLTLQDIDLFEINEAFASQYVYCCKKLKLDTEKVNVNGGAIALGHPLGATGA  449

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  328
            RCVATLL EMKRRG+D R+GV+SMCIGTGMGAA V ERGD  DE  NAR
Sbjct  450  RCVATLLSEMKRRGRDSRFGVISMCIGTGMGAAAVIERGDYVDEFCNAR  498



>gb|AFK39397.1| unknown [Lotus japonicus]
Length=138

 Score =   173 bits (438),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLEL + DLFEINEAFASQ++Y  KKLGLD  K+NVNGGA+A+GHPLGATGA
Sbjct  38   IPAAVKSAGLELGNIDLFEINEAFASQFVYSCKKLGLDTRKVNVNGGAIALGHPLGATGA  97

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  301
            RCVATLL+EMKRRGKDCR+G +SMCIG+GMGAA VFERGD
Sbjct  98   RCVATLLNEMKRRGKDCRFGAISMCIGSGMGAAAVFERGD  137



>ref|XP_008382649.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Malus 
domestica]
 ref|XP_008382650.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Malus 
domestica]
 ref|XP_008382651.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Malus 
domestica]
Length=181

 Score =   174 bits (441),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 96/111 (86%), Gaps = 1/111 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AVKSAGLELDD DLFEINEAFASQY+ C KKL LDPEK+N NGGA+A+GH LGATGA
Sbjct  72   IPVAVKSAGLELDDIDLFEINEAFASQYVXCCKKLELDPEKVNANGGAIALGH-LGATGA  130

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  334
            RCVAT+L+EMKRRG+D  +GV SMCIG+GM AA VFERGD+ DEL NAR V
Sbjct  131  RCVATVLNEMKRRGRDHSFGVTSMCIGSGMEAAAVFERGDSVDELCNARTV  181



>ref|XP_003604976.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Medicago truncatula]
 gb|AES87173.1| 3-ketoacyl-CoA thiolase 2, peroxisomal-like protein [Medicago 
truncatula]
Length=435

 Score =   181 bits (458),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLEL + DL+EINEAFASQ++Y  KKLGLDP K+NVNGGAMA GHPLGATGA
Sbjct  335  IPAAVKSAGLELSNIDLYEINEAFASQFVYSCKKLGLDPTKVNVNGGAMAFGHPLGATGA  394

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  301
            RCVATLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD
Sbjct  395  RCVATLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGD  434



>gb|KFK42814.1| hypothetical protein AALP_AA1G042000 [Arabis alpina]
Length=439

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/92 (90%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +2

Query  26   GLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLH  205
            GLEL+D DLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLGATGARCVATLLH
Sbjct  344  GLELNDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAIAIGHPLGATGARCVATLLH  403

Query  206  EMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  301
            EMKRRGKDCR+GVVSMCIG+GMGAAGVFERGD
Sbjct  404  EMKRRGKDCRFGVVSMCIGSGMGAAGVFERGD  435



>ref|XP_005646163.1| thiolase [Coccomyxa subellipsoidea C-169]
 gb|EIE21619.1| thiolase [Coccomyxa subellipsoidea C-169]
Length=470

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAV+ AGL +DD D+FE+NEAFASQ  YC KKLGLDPE++N NGGA+A+GHPLG TGA
Sbjct  348  IPAAVQKAGLSIDDIDVFELNEAFASQATYCVKKLGLDPERVNPNGGAVALGHPLGCTGA  407

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RC ATLLHEM +RGK  R+GVVSMCIG+GMGAA VFERG   D L NA      G+LS D
Sbjct  408  RCTATLLHEMNKRGKASRFGVVSMCIGSGMGAAAVFERGGEVDALRNAAPTHAQGFLSHD  467

Query  362  A  364
            A
Sbjct  468  A  468



>gb|KHN15993.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=445

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLEL + DLFEINEAFASQY+YC KKLGLDP K+NVNGGA+A+GHPLG TGA
Sbjct  345  IPAAVKSAGLELGNIDLFEINEAFASQYVYCLKKLGLDPRKVNVNGGAIALGHPLGVTGA  404

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  301
            RCVATLL+EMKR GKDCR+GV+SMCIG+GMGAA VFERGD
Sbjct  405  RCVATLLNEMKRGGKDCRFGVISMCIGSGMGAAAVFERGD  444



>gb|AFK40880.1| unknown [Medicago truncatula]
Length=435

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLEL + DL+EINEAFASQ++Y  KKLGLDP K+NVNGGAMA GHPLGATGA
Sbjct  335  IPAAVKSAGLELSNIDLYEINEAFASQFVYSCKKLGLDPTKVNVNGGAMAFGHPLGATGA  394

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  301
            RCVATLL+EMKRRGKDCR+GV+SMCIG GMGAA VFERGD
Sbjct  395  RCVATLLNEMKRRGKDCRFGVISMCIGFGMGAAAVFERGD  434



>ref|XP_003632434.2| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Vitis 
vinifera]
 emb|CBI37268.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP A K+AGLE+ D DLFEINEAFASQY+YC KKL LDP+K+NVNGGA+A+GHPLGATGA
Sbjct  342  IPIAAKNAGLEVADIDLFEINEAFASQYVYCCKKLDLDPKKVNVNGGALALGHPLGATGA  401

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDA  304
            RCV+TLL+EMKRRGKDCRYGV+SMCIG+GMGAA VFERGD+
Sbjct  402  RCVSTLLYEMKRRGKDCRYGVISMCIGSGMGAAAVFERGDS  442



>ref|NP_001242568.1| uncharacterized protein LOC100789930 [Glycine max]
 gb|ACU23006.1| unknown [Glycine max]
Length=445

 Score =   179 bits (453),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLEL + DLFEINEAFASQY+YC KKLGLDP K+NVNGGA+A+GHPLG TGA
Sbjct  345  IPAAVKSAGLELGNIDLFEINEAFASQYVYCLKKLGLDPRKVNVNGGAIALGHPLGVTGA  404

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  301
            RCVATLL+EMKR GKDCR+GV+SMCIG+GMGA  VFERGD
Sbjct  405  RCVATLLNEMKRGGKDCRFGVISMCIGSGMGATAVFERGD  444



>ref|XP_004506669.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cicer 
arietinum]
Length=440

 Score =   178 bits (452),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLEL + DLFEINEAFASQ++Y  KKLGLDP K+NVNGGA+A+GHPLGATGA
Sbjct  340  IPAAVKSAGLELGNIDLFEINEAFASQFVYSCKKLGLDPSKVNVNGGAIALGHPLGATGA  399

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  301
            R VATLL+EMKRRGKDCRYGV+SMCIG+GMGAA VFERGD
Sbjct  400  RTVATLLNEMKRRGKDCRYGVISMCIGSGMGAAAVFERGD  439



>ref|XP_007034451.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3 [Theobroma cacao]
 gb|EOY05377.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3 [Theobroma cacao]
Length=326

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 95/121 (79%), Gaps = 19/121 (16%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DL+EINEAFASQ++YC+KKL LDP                   GA
Sbjct  224  IPAAVKAAGLELDDIDLYEINEAFASQFVYCRKKLELDP-------------------GA  264

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NARKVET+ +LSKD
Sbjct  265  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDHTDELCNARKVETNSFLSKD  324

Query  362  A  364
            A
Sbjct  325  A  325



>ref|XP_010482155.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X2 [Camelina sativa]
Length=414

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA   AGL + D DLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AIGHPLGATGA
Sbjct  299  IPAATNLAGLNVSDIDLFEINEAFASQYVYSCKKLDLDMEKVNVNGGAIAIGHPLGATGA  358

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  349
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE GD+    S+A+     G+
Sbjct  359  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFESGDSFKNNSDAQVANGEGH  414



>ref|XP_007153157.1| hypothetical protein PHAVU_003G011600g [Phaseolus vulgaris]
 gb|ESW25151.1| hypothetical protein PHAVU_003G011600g [Phaseolus vulgaris]
Length=445

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLEL +  L+EINEAFASQY+YC KKLGLDP K+NVNGGA+A+GHPLGATGA
Sbjct  345  IPAAVKSAGLELGNIGLYEINEAFASQYVYCCKKLGLDPRKVNVNGGAIALGHPLGATGA  404

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  301
            RCVATLL+EMKR GKDCRYGV+SMCIG+GMGAA VFERG+
Sbjct  405  RCVATLLNEMKRHGKDCRYGVISMCIGSGMGAAAVFERGE  444



>ref|XP_010482154.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X1 [Camelina sativa]
Length=458

 Score =   176 bits (446),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA   AGL + D DLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AIGHPLGATGA
Sbjct  343  IPAATNLAGLNVSDIDLFEINEAFASQYVYSCKKLDLDMEKVNVNGGAIAIGHPLGATGA  402

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  349
            RCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE GD+    S+A+     G+
Sbjct  403  RCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFESGDSFKNNSDAQVANGEGH  458



>gb|KJB72152.1| hypothetical protein B456_011G161700 [Gossypium raimondii]
Length=453

 Score =   176 bits (446),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLELDD DLFEINEAFASQ++YCQKKL LDP+KINVNGGAMAIGHPLG TGA
Sbjct  343  IPAAVKSAGLELDDVDLFEINEAFASQFVYCQKKLELDPQKINVNGGAMAIGHPLGVTGA  402

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGT  265
            RCVATLLHEMKRRGKDCR+GVVSMCIGT
Sbjct  403  RCVATLLHEMKRRGKDCRFGVVSMCIGT  430



>ref|XP_008355236.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Malus 
domestica]
Length=145

 Score =   166 bits (421),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 93/111 (84%), Gaps = 3/111 (3%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AVKSAGLELDD DLFEINEAFASQY+ C KKL LDPEK+N NGGA+A+G   GATGA
Sbjct  38   IPVAVKSAGLELDDIDLFEINEAFASQYVSCCKKLELDPEKVNANGGAIALG---GATGA  94

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  334
            RCVAT L+EMKRRG+D  +GV SMCIG+GM AA VFERGD+ DEL NAR V
Sbjct  95   RCVATXLNEMKRRGRDHSFGVTSMCIGSGMEAAAVFERGDSVDELCNARTV  145



>ref|XP_004506590.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cicer 
arietinum]
Length=440

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLEL + DLFEINEAFASQ++Y  KKLGLD  K+NVNGGA+A+GHPLGATGA
Sbjct  340  IPAAVKSAGLELGNIDLFEINEAFASQFVYSCKKLGLDRSKVNVNGGAIALGHPLGATGA  399

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  301
            R VATLL+EMKRRGKDCRYGV+SMCIG+GMGAA VFERGD
Sbjct  400  RSVATLLNEMKRRGKDCRYGVISMCIGSGMGAAAVFERGD  439



>ref|XP_002989683.1| hypothetical protein SELMODRAFT_447769 [Selaginella moellendorffii]
 gb|EFJ09160.1| hypothetical protein SELMODRAFT_447769 [Selaginella moellendorffii]
Length=408

 Score =   173 bits (438),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP A+K AGLE+ D  LFEINEAFASQY YC KKL LDP K+NVNGGA+A+GHPLGATGA
Sbjct  308  IPKAIKDAGLEISDIHLFEINEAFASQYTYCCKKLQLDPAKVNVNGGAIALGHPLGATGA  367

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  301
            RCVATLLHEM +RG  CRYGVVSMCIGTGMGAA VFERGD
Sbjct  368  RCVATLLHEMAKRGSACRYGVVSMCIGTGMGAAAVFERGD  407



>gb|AAK76732.1| 3-ketoacyl-CoA thiolase [Gossypium hirsutum]
Length=133

 Score =   165 bits (417),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGLE+DD DLFEINEAFASQ++Y  KKLGLD EK+NVNGGA+A+GHPLG TGA
Sbjct  38   IPAAVKSAGLEIDDIDLFEINEAFASQFVYSCKKLGLDREKVNVNGGAIALGHPLGVTGA  97

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVF  289
            RCV TLL+EMKRRGKDCR+GV+SMCIGTGMG +  F
Sbjct  98   RCVGTLLYEMKRRGKDCRFGVISMCIGTGMGGSSCF  133



>emb|CAA53078.1| 3-ketoacyl-CoA thiolase B [Mangifera indica]
Length=430

 Score =   170 bits (431),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK+AGLELDD DLFEINEAFASQ++YC+ KLGLDPEKINVNGGAMAIGHPLGATGA
Sbjct  341  IPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCI  259
            RCVATLLHEMKRRG+DCR+GV+SMCI
Sbjct  401  RCVATLLHEMKRRGRDCRFGVISMCI  426



>gb|KDO43601.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=437

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGL+LDD DLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLG TGA
Sbjct  341  IPAAVKSAGLQLDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGTTGA  400

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIG  262
            RCVATLLHEMKRRG+DCR+GV+SMCIG
Sbjct  401  RCVATLLHEMKRRGRDCRFGVISMCIG  427



>ref|XP_002991797.1| hypothetical protein SELMODRAFT_236388 [Selaginella moellendorffii]
 gb|EFJ07201.1| hypothetical protein SELMODRAFT_236388 [Selaginella moellendorffii]
Length=395

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 84/100 (84%), Gaps = 3/100 (3%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AVK AGLE+ D  LFEINEAFASQY YC KKL LDP K+NVNGGA+A+GHPL   GA
Sbjct  298  IPKAVKDAGLEISDIHLFEINEAFASQYTYCCKKLQLDPAKVNVNGGAIALGHPL---GA  354

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  301
            RCVATLLHEM +RG  CRYGVVSMCIGTGMGAA VFERGD
Sbjct  355  RCVATLLHEMAKRGSACRYGVVSMCIGTGMGAAAVFERGD  394



>ref|XP_008678417.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Zea mays]
Length=230

 Score =   158 bits (400),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK AGLE+ D DLFE+NE FASQ++YC  KLGLD  K+NVNGGA+A+GHPL ATGA
Sbjct  84   IPAAVKFAGLEIGDIDLFELNEPFASQFVYCCNKLGLDRSKVNVNGGAIALGHPLDATGA  143

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSN  322
            RC+ATLL+EMKR+G DCR+GVV+MCIG+GMGAA VFE   A  E+S 
Sbjct  144  RCMATLLNEMKRQGIDCRFGVVTMCIGSGMGAAAVFELCSARLEVST  190



>ref|XP_007049826.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2 [Theobroma cacao]
 gb|EOX93983.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2 [Theobroma cacao]
Length=472

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAG+EL D DLFEINEAFASQY+YC KKL LD EK+NVNGGA+A+GHPLGATGA
Sbjct  349  IPAAVKSAGIELADIDLFEINEAFASQYVYCCKKLELDSEKVNVNGGAIALGHPLGATGA  408

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCI  259
            RCV TLL+EMKRRGKDCR+GV+SMCI
Sbjct  409  RCVGTLLYEMKRRGKDCRFGVISMCI  434



>gb|KCW50166.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
Length=474

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVKSAGL LDD DL EINEAFASQY+YC KKLGLDPEK+NVNGGA+A+GHPLGATGA
Sbjct  345  IPAAVKSAGLTLDDIDLLEINEAFASQYVYCCKKLGLDPEKVNVNGGALALGHPLGATGA  404

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMG  274
            RCVATLL+EMKR+G+D R+GV+S+ I + +G
Sbjct  405  RCVATLLNEMKRQGRDSRFGVISILITSCLG  435



>ref|XP_011400620.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Auxenochlorella protothecoides]
 gb|KFM27633.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Auxenochlorella protothecoides]
Length=455

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 91/120 (76%), Gaps = 1/120 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AV+ AGL LDD D+FEINEAFASQ LY  KKLGLD E++N NGGA+A+GHPLG TGA
Sbjct  332  IPEAVRRAGLGLDDVDVFEINEAFASQALYTVKKLGLDLERVNPNGGAIALGHPLGCTGA  391

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE-THGYLSK  358
            R  ATL++EM+RRGK  R+GV+SMCIG+GMGAA V ER  + D   +AR     H  LS+
Sbjct  392  RQAATLINEMQRRGKAARFGVISMCIGSGMGAAAVLERDFSDDAERSARPATGVHAGLSR  451



>ref|XP_003061899.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53611.1| predicted protein [Micromonas pusilla CCMP1545]
Length=332

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 83/99 (84%), Gaps = 3/99 (3%)
 Frame = +2

Query  2    IPAAVKSAG-LELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATG  178
            IP A+K AG L +DD DLFE+NEAFASQ  YC +KLGLD EK+NVNGGA+A+GHPLGATG
Sbjct  234  IPEALKRAGNLSVDDVDLFELNEAFASQATYCAEKLGLDSEKVNVNGGAIALGHPLGATG  293

Query  179  ARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFER  295
            ARCVATL+HEM RR  D   GVVSMCIG+GMGAAGVF R
Sbjct  294  ARCVATLMHEMHRRRSDV--GVVSMCIGSGMGAAGVFAR  330



>ref|XP_002946078.1| hypothetical protein VOLCADRAFT_102696 [Volvox carteri f. nagariensis]
 gb|EFJ53073.1| hypothetical protein VOLCADRAFT_102696 [Volvox carteri f. nagariensis]
Length=462

 Score =   149 bits (376),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AV  AGL LDD D++EINEAFASQ  YC  KLG+D  K+N NGGA+A+GHPLGATGA
Sbjct  340  IPEAVARAGLSLDDIDVYEINEAFASQASYCVAKLGIDENKVNPNGGAIAMGHPLGATGA  399

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            RC ATLLHE++RRG+  R+GVVSMCIG+GMGAA VFE G   D+   AR V+    LSKD
Sbjct  400  RCTATLLHELRRRGRGSRFGVVSMCIGSGMGAAAVFETGGEVDKFMTARAVKGQVLLSKD  459

Query  362  A  364
            A
Sbjct  460  A  460



>ref|XP_002500295.1| acetyl-coa acyltransferase [Micromonas sp. RCC299]
 gb|ACO61553.1| acetyl-coa acyltransferase [Micromonas sp. RCC299]
Length=425

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 83/98 (85%), Gaps = 3/98 (3%)
 Frame = +2

Query  2    IPAAVKSAGLE-LDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATG  178
            IP A++ AGL  + D DLFE+NEAFASQ  YC  KLGLD EK+NVNGGA+A+GHPLGATG
Sbjct  327  IPVAIEKAGLRSVADVDLFELNEAFASQATYCATKLGLDVEKVNVNGGAIALGHPLGATG  386

Query  179  ARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  292
            ARCVATL+HEM+RRG   R GVVSMCIG+GMGAAGVFE
Sbjct  387  ARCVATLMHEMQRRG--ARNGVVSMCIGSGMGAAGVFE  422



>gb|KDD73648.1| beta-ketoacyl-ACP synthase, partial [Helicosporidium sp. ATCC 
50920]
Length=427

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 87/122 (71%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAVK AGL + D D++EINEAFASQ  Y    L +DP K+N NGGA+A+GHPLG TGA
Sbjct  306  IPAAVKLAGLGVQDVDVYEINEAFASQASYSVDTLKIDPAKVNPNGGAIALGHPLGCTGA  365

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  361
            R  ATLL+EM RRGK  R+GVVSMCIG+GMGAA VFER  + D  S A        LS D
Sbjct  366  RQTATLLYEMARRGKTARFGVVSMCIGSGMGAAAVFEREGSEDRTSFAAPATARTGLSAD  425

Query  362  AR  367
            A+
Sbjct  426  AQ  427



>ref|XP_010206319.1| PREDICTED: 3-ketoacyl-CoA thiolase A, peroxisomal-like, partial 
[Colius striatus]
Length=99

 Score =   136 bits (342),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 81/96 (84%), Gaps = 1/96 (1%)
 Frame = +2

Query  5    PAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGAR  184
            PAA+++AGL LDD D++EINEAFASQ +YC +KLG+  EK+N  GGA+A+GHPLG TGAR
Sbjct  1    PAALRNAGLTLDDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALGHPLGCTGAR  60

Query  185  CVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  292
             V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  61   QVVTLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  95



>gb|ABR25554.1| peroxisomal 3-ketoacyl-coa thiolase 2 precursor [Oryza sativa 
Indica Group]
Length=243

 Score =   140 bits (353),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAV SAGL+++D DLFE+NEAFASQ +YC  KLGLD  K+NVNGGA+A+GHPLGAT A
Sbjct  153  IPAAVNSAGLQIEDIDLFELNEAFASQLVYCCNKLGLDRSKVNVNGGAIALGHPLGATRA  212

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMG  274
            +CVATLL+EM RRG DC + VV+MCI +GMG
Sbjct  213  QCVATLLNEMNRRGTDCIFSVVTMCIVSGMG  243



>gb|EDL76925.1| rCG25918, isoform CRA_d [Rattus norvegicus]
Length=171

 Score =   137 bits (346),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 81/97 (84%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA++ AGL ++D D+FEINEAFASQ LYC +KLG+  EK+N  GGA+A+GHPLG TGA
Sbjct  72   IPAALQKAGLTVNDIDIFEINEAFASQALYCVEKLGIPAEKVNPLGGAIALGHPLGCTGA  131

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  292
            R V TLL+E+KRRG+   YGVVSMCIGTGMGAA VFE
Sbjct  132  RQVVTLLNELKRRGRRA-YGVVSMCIGTGMGAAAVFE  167



>ref|XP_010172441.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal [Caprimulgus 
carolinensis]
Length=272

 Score =   140 bits (353),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 80/97 (82%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP AV+ AGL L+D D++EINEAFASQ +YC +KLG+  EK+N  GGA+A+GHPLG TGA
Sbjct  173  IPVAVEKAGLTLNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALGHPLGCTGA  232

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  292
            R V TLLHE+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  233  RQVVTLLHELKRRGKRA-YGVVSMCIGTGMGAAAVFE  268



>ref|XP_004676369.1| PREDICTED: 3-ketoacyl-CoA thiolase A, peroxisomal isoform X1 
[Condylura cristata]
Length=426

 Score =   143 bits (361),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 81/97 (84%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP A++ AGL +DD D+FEINEAFASQ +YC +KLGL PEK+N  GGA+A+GHPLG TGA
Sbjct  327  IPVALQKAGLTIDDVDIFEINEAFASQAVYCVEKLGLPPEKVNPLGGAVALGHPLGCTGA  386

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  292
            R V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  387  RQVVTLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  422



>ref|XP_003456538.2| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal-like [Oreochromis 
niloticus]
Length=479

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 82/97 (85%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA++ AGL + D D+FEINEAFASQ +YC +KLG+ PEK+N NGGA+A+GHPLG TGA
Sbjct  380  IPAALQQAGLSVADIDVFEINEAFASQAVYCVEKLGIPPEKVNPNGGAIALGHPLGCTGA  439

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  292
            R V TLL+E+KRRG+   YGVVSMCIGTGMGAA VFE
Sbjct  440  RQVVTLLNELKRRGRRA-YGVVSMCIGTGMGAAAVFE  475



>gb|AAH26669.1| Acaa1a protein [Mus musculus]
 gb|EDL09237.1| mCG21883, isoform CRA_b [Mus musculus]
Length=171

 Score =   137 bits (344),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 81/97 (84%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA++ AGL ++D D+FEINEAFASQ +YC +KLG+  EK+N  GGA+A+GHPLG TGA
Sbjct  72   IPAALQKAGLTVNDIDIFEINEAFASQAVYCVEKLGIPAEKVNPLGGAIALGHPLGCTGA  131

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  292
            R V TLL+E+KRRG+   YGVVSMCIGTGMGAA VFE
Sbjct  132  RQVVTLLNELKRRGRRA-YGVVSMCIGTGMGAAAVFE  167



>gb|ELK29226.1| 3-ketoacyl-CoA thiolase, peroxisomal, partial [Myotis davidii]
Length=369

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 80/97 (82%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP A+K AGL + D D+FEINEAFASQ +YC +KLGL PEK+N  GGA+A+GHPLG TGA
Sbjct  270  IPVALKKAGLTVHDVDIFEINEAFASQAVYCMEKLGLPPEKVNPLGGAVALGHPLGCTGA  329

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  292
            R V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  330  RQVITLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  365



>gb|EAW64514.1| acetyl-Coenzyme A acyltransferase 1 (peroxisomal 3-oxoacyl-Coenzyme 
A thiolase), isoform CRA_b [Homo sapiens]
Length=108

 Score =   134 bits (338),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 78/97 (80%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP A++ AGL + D D+FEINEAFASQ  YC +KL L PEK+N  GGA+A+GHPLG TGA
Sbjct  9    IPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGA  68

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  292
            R V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  69   RQVITLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  104



>ref|XP_008522879.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal [Equus przewalskii]
Length=426

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 81/97 (84%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP A++ AGL ++D D+FEINEAFASQ +YC KKLGL PEK+N  GGA+A+GHPLG TGA
Sbjct  327  IPVALQKAGLTVNDVDIFEINEAFASQAVYCVKKLGLPPEKVNPLGGAVALGHPLGCTGA  386

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  292
            R V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  387  RQVITLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  422



>ref|XP_010075883.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal, partial [Pterocles 
gutturalis]
Length=367

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 82/97 (85%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAAV++AGL LDD D+FEINEAFASQ LYC +KLG+  EK+N  GGA+A+GHPLG TGA
Sbjct  268  IPAAVENAGLTLDDIDVFEINEAFASQALYCVEKLGIPMEKVNPLGGAIALGHPLGCTGA  327

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  292
            R V TLL+E+KRRGK   YGVVSMCIGTGMGAA VF+
Sbjct  328  RQVVTLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFK  363



>ref|XP_004759760.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal [Mustela putorius 
furo]
Length=405

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 81/97 (84%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP A++ AGL +DD D+FEINEAFASQ +YC +KLGL PEK+N  GGA+A+GHPLG TGA
Sbjct  301  IPVALQKAGLTVDDVDIFEINEAFASQAVYCVEKLGLPPEKVNPLGGAVALGHPLGCTGA  360

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  292
            R V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  361  RQVITLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  396



>gb|EAW64515.1| acetyl-Coenzyme A acyltransferase 1 (peroxisomal 3-oxoacyl-Coenzyme 
A thiolase), isoform CRA_c [Homo sapiens]
Length=162

 Score =   136 bits (342),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 78/97 (80%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP A++ AGL + D D+FEINEAFASQ  YC +KL L PEK+N  GGA+A+GHPLG TGA
Sbjct  63   IPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGA  122

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  292
            R V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  123  RQVITLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  158



>gb|EPQ17921.1| 3-ketoacyl-CoA thiolase, peroxisomal, partial [Myotis brandtii]
Length=369

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 80/97 (82%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP A+K AGL + D D+FEINEAFASQ +YC +KLGL PEK+N  GGA+A+GHPLG TGA
Sbjct  270  IPEALKKAGLTVHDVDIFEINEAFASQAVYCMEKLGLPPEKVNPLGGAVALGHPLGCTGA  329

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  292
            R V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  330  RQVITLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  365



>ref|XP_006109905.1| PREDICTED: LOW QUALITY PROTEIN: acetyl-CoA acyltransferase 1 
[Myotis lucifugus]
Length=385

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 80/97 (82%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP A+K AGL + D D+FEINEAFASQ +YC +KLGL PEK+N  GGA+A+GHPLG TGA
Sbjct  286  IPEALKKAGLTVHDVDIFEINEAFASQAVYCMEKLGLPPEKVNPLGGAVALGHPLGCTGA  345

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  292
            R V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  346  RQVITLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  381



>ref|XP_004823725.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal isoform X1 [Mustela 
putorius furo]
Length=431

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 81/97 (84%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP A++ AGL +DD D+FEINEAFASQ +YC +KLGL PEK+N  GGA+A+GHPLG TGA
Sbjct  327  IPVALQKAGLTVDDVDIFEINEAFASQAVYCVEKLGLPPEKVNPLGGAVALGHPLGCTGA  386

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  292
            R V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  387  RQVITLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  422



>ref|XP_006765161.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal [Myotis davidii]
Length=419

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 80/97 (82%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP A+K AGL + D D+FEINEAFASQ +YC +KLGL PEK+N  GGA+A+GHPLG TGA
Sbjct  320  IPVALKKAGLTVHDVDIFEINEAFASQAVYCMEKLGLPPEKVNPLGGAVALGHPLGCTGA  379

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  292
            R V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  380  RQVITLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  415



>ref|XP_003464147.2| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal-like isoform 
X1 [Cavia porcellus]
Length=432

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 82/97 (85%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA++ AGL ++D D+FEINEAFASQ +YC +KLG+ PEK+N  GGA+A+GHPLG TGA
Sbjct  333  IPAALQKAGLTVNDVDIFEINEAFASQAVYCVEKLGIPPEKVNPLGGAVALGHPLGCTGA  392

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  292
            R V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  393  RQVITLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  428



>gb|EDL76924.1| rCG25918, isoform CRA_c [Rattus norvegicus]
Length=272

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 81/97 (84%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA++ AGL ++D D+FEINEAFASQ LYC +KLG+  EK+N  GGA+A+GHPLG TGA
Sbjct  173  IPAALQKAGLTVNDIDIFEINEAFASQALYCVEKLGIPAEKVNPLGGAIALGHPLGCTGA  232

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  292
            R V TLL+E+KRRG+   YGVVSMCIGTGMGAA VFE
Sbjct  233  RQVVTLLNELKRRGRRA-YGVVSMCIGTGMGAAAVFE  268



>ref|XP_011217239.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal isoform X3 [Ailuropoda 
melanoleuca]
Length=376

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 81/97 (84%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP A++ AGL ++D D+FEINEAFASQ +YC +KLGL PEK+N  GGA+A+GHPLG TGA
Sbjct  277  IPVALQKAGLTVNDVDIFEINEAFASQAVYCVEKLGLPPEKVNPLGGAVALGHPLGCTGA  336

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  292
            R V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  337  RQVITLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  372



>ref|XP_006749538.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal [Leptonychotes 
weddellii]
Length=346

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 80/97 (82%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP A++ AGL ++D D+FEINEAFASQ +YC +KLGL PEK+N  GGA+A+GHPLG TGA
Sbjct  247  IPVALQKAGLTVNDVDIFEINEAFASQAVYCVEKLGLPPEKVNPLGGAVALGHPLGCTGA  306

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  292
            R V TLLHE+K RGK   YGVVSMCIGTGMGAA VFE
Sbjct  307  RQVITLLHELKHRGKRA-YGVVSMCIGTGMGAAAVFE  342



>ref|WP_012281246.1| acetyl-CoA acetyltransferase [Heliobacterium modesticaldum]
 gb|ABZ82697.1| acetyl-CoA acetyltransferase [Heliobacterium modesticaldum Ice1]
Length=392

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 79/98 (81%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP A+K AG++ DD DLFE+NEAFA+Q LY    LGLDPE++NVNGGA+A+GHPLG TG+
Sbjct  296  IPKALKLAGIDQDDVDLFELNEAFAAQALYVMNHLGLDPERVNVNGGAIALGHPLGCTGS  355

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFER  295
            +   TLL+EMKRR    RYGVVSMCIG GMGAA VFER
Sbjct  356  KLTTTLLYEMKRR--QARYGVVSMCIGGGMGAAAVFER  391



>ref|XP_004471223.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal-like [Dasypus 
novemcinctus]
Length=149

 Score =   135 bits (339),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 77/95 (81%), Gaps = 1/95 (1%)
 Frame = +2

Query  8    AAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARC  187
            +A   AGL +DD D+FEINEAFASQ +YC +KLGL  EK+N  GGA+A+GHPLG TGAR 
Sbjct  52   SAPSPAGLTVDDVDIFEINEAFASQAVYCVEKLGLPLEKVNPLGGAVALGHPLGCTGARQ  111

Query  188  VATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  292
            V TLLHE+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  112  VVTLLHELKRRGKRA-YGVVSMCIGTGMGAAAVFE  145



>ref|WP_013075085.1| acetyl-CoA acetyltransferase [Kyrpidia tusciae]
 gb|ADG05794.1| acetyl-CoA acetyltransferase [Kyrpidia tusciae DSM 2912]
Length=392

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 81/98 (83%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            +P A+K AGL +DD DLFE+NEAFA+Q L   +KLG+DPEK NVNGGA+A+GHPLG TG+
Sbjct  296  VPKALKKAGLSIDDIDLFELNEAFAAQSLAVMRKLGMDPEKTNVNGGAIALGHPLGCTGS  355

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFER  295
            +   +L++EM+RRG   RYGVV+MCIG GMGAAGVFER
Sbjct  356  KLTVSLMNEMRRRG--SRYGVVTMCIGGGMGAAGVFER  391



>ref|XP_003781848.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal isoform 1 [Otolemur 
garnettii]
Length=424

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 81/97 (84%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IP A++ AGL ++D D+FEINEAFASQ +YC +KLGL PEK+N  GGA+A+GHPLG TGA
Sbjct  325  IPVALQKAGLTVNDVDIFEINEAFASQAVYCVEKLGLPPEKVNPLGGAVALGHPLGCTGA  384

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  292
            R V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  385  RQVITLLNELKRRGKKA-YGVVSMCIGTGMGAAAVFE  420



>gb|EGW00823.1| 3-ketoacyl-CoA thiolase B, peroxisomal [Cricetulus griseus]
Length=279

 Score =   138 bits (348),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 81/97 (84%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    IPAAVKSAGLELDDTDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGA  181
            IPAA++ AGL ++D D+FEINEAFASQ +YC +KLG+  EK+N  GGA+A+GHPLG TGA
Sbjct  180  IPAALQKAGLTVNDIDIFEINEAFASQAVYCVEKLGIPAEKVNPLGGAIALGHPLGCTGA  239

Query  182  RCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  292
            R V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  240  RQVVTLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  275



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660