BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP009B11 659 bp,

Length=614
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010089788.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-m...  75.5    2e-14   Morus notabilis
ref|XP_009765388.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  73.9    2e-14   Nicotiana sylvestris
ref|XP_011088786.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  73.2    2e-14   Sesamum indicum [beniseed]
ref|XP_007134415.1|  hypothetical protein PHAVU_010G045600g           76.6    2e-14   Phaseolus vulgaris [French bean]
ref|XP_006576707.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  74.7    2e-14   
ref|XP_007134414.1|  hypothetical protein PHAVU_010G045600g           76.3    3e-14   Phaseolus vulgaris [French bean]
ref|XP_011088778.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  72.8    3e-14   Sesamum indicum [beniseed]
ref|XP_009765385.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  73.6    3e-14   Nicotiana sylvestris
ref|XP_007134412.1|  hypothetical protein PHAVU_010G045600g           75.9    3e-14   Phaseolus vulgaris [French bean]
ref|NP_001077448.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-m...  70.9    3e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009765384.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  73.6    3e-14   Nicotiana sylvestris
ref|XP_003521056.2|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  73.9    3e-14   
ref|NP_001077446.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-m...  70.9    3e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011088772.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  72.4    4e-14   Sesamum indicum [beniseed]
ref|XP_007134413.1|  hypothetical protein PHAVU_010G045600g           75.9    4e-14   Phaseolus vulgaris [French bean]
gb|ABF59128.1|  unknown protein                                       70.5    4e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001117214.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-m...  70.5    4e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009765386.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  73.2    5e-14   Nicotiana sylvestris
ref|XP_002892023.1|  hypothetical protein ARALYDRAFT_887214           70.1    6e-14   Arabidopsis lyrata subsp. lyrata
gb|AIE43865.1|  WRKY transcription factor 25                          72.0    7e-14   Gossypium hirsutum [American cotton]
ref|XP_006418502.1|  hypothetical protein EUTSA_v10007459mg           68.9    2e-13   Eutrema salsugineum
ref|XP_006418501.1|  hypothetical protein EUTSA_v10007459mg           68.6    2e-13   Eutrema salsugineum
ref|XP_006418503.1|  hypothetical protein EUTSA_v10007459mg           68.9    2e-13   Eutrema salsugineum
ref|XP_002301238.2|  hypothetical protein POPTR_0002s14010g           72.0    3e-13   Populus trichocarpa [western balsam poplar]
ref|XP_006306188.1|  hypothetical protein CARUB_v10011809mg           67.8    3e-13   Capsella rubella
ref|XP_007052356.1|  Asparagine-linked glycosylation 12 isoform 3     73.6    3e-13   Theobroma cacao [chocolate]
ref|XP_009603142.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  71.6    3e-13   Nicotiana tomentosiformis
gb|EYU40344.1|  hypothetical protein MIMGU_mgv1a005831mg              71.2    4e-13   Erythranthe guttata [common monkey flower]
ref|XP_007052355.1|  Asparagine-linked glycosylation 12 isoform 2     73.2    4e-13   Theobroma cacao [chocolate]
ref|XP_007052354.1|  Asparagine-linked glycosylation 12 isoform 1     73.2    4e-13   Theobroma cacao [chocolate]
ref|NP_001077447.2|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-m...  67.4    4e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006445446.1|  hypothetical protein CICLE_v10019843mg           70.1    4e-13   Citrus clementina
gb|KFK42589.1|  hypothetical protein AALP_AA1G015000                  69.3    4e-13   Arabis alpina [alpine rockcress]
emb|CDY38057.1|  BnaCnng09180D                                        72.4    4e-13   Brassica napus [oilseed rape]
gb|KJB24899.1|  hypothetical protein B456_004G166900                  72.8    4e-13   Gossypium raimondii
ref|XP_009603143.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  71.2    6e-13   Nicotiana tomentosiformis
gb|KJB24901.1|  hypothetical protein B456_004G166900                  72.4    6e-13   Gossypium raimondii
gb|KJB24902.1|  hypothetical protein B456_004G166900                  72.0    7e-13   Gossypium raimondii
ref|XP_010692030.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  73.2    7e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006464407.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  70.9    7e-13   Citrus sinensis [apfelsine]
ref|XP_004307243.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  70.9    7e-13   Fragaria vesca subsp. vesca
ref|XP_006464408.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  70.9    8e-13   Citrus sinensis [apfelsine]
ref|XP_004229733.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  70.5    8e-13   Solanum lycopersicum
ref|XP_008460079.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  68.9    8e-13   
gb|KJB24900.1|  hypothetical protein B456_004G166900                  72.0    9e-13   Gossypium raimondii
ref|XP_010325203.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  70.1    1e-12   Solanum lycopersicum
emb|CDY15127.1|  BnaC05g00060D                                        67.4    1e-12   Brassica napus [oilseed rape]
ref|XP_009119758.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  67.4    1e-12   Brassica rapa
emb|CDX90078.1|  BnaA10g00040D                                        67.4    1e-12   Brassica napus [oilseed rape]
ref|XP_009119757.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  67.4    1e-12   Brassica rapa
emb|CDP09422.1|  unnamed protein product                              68.2    1e-12   Coffea canephora [robusta coffee]
ref|XP_008460077.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  68.2    1e-12   Cucumis melo [Oriental melon]
ref|XP_009375362.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  74.7    1e-12   Pyrus x bretschneideri [bai li]
ref|XP_008460078.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  68.2    1e-12   Cucumis melo [Oriental melon]
ref|XP_009375365.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  75.5    2e-12   Pyrus x bretschneideri [bai li]
ref|XP_008375733.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  75.5    2e-12   Malus domestica [apple tree]
ref|XP_008232378.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  73.6    2e-12   Prunus mume [ume]
ref|XP_004160680.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  68.2    2e-12   
ref|XP_004145015.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  68.2    2e-12   
ref|XP_010540209.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  75.1    3e-12   Tarenaya hassleriana [spider flower]
ref|XP_011017393.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  71.2    3e-12   Populus euphratica
ref|XP_010540210.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  75.1    3e-12   Tarenaya hassleriana [spider flower]
ref|XP_011017394.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  71.2    3e-12   Populus euphratica
ref|XP_008375731.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  74.7    3e-12   Malus domestica [apple tree]
ref|XP_011017391.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  71.2    3e-12   Populus euphratica
ref|XP_011017392.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  71.2    3e-12   Populus euphratica
ref|XP_006583508.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  73.6    5e-12   
ref|XP_010496471.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  65.9    6e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010496472.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  65.9    6e-12   Camelina sativa [gold-of-pleasure]
ref|XP_006583509.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  73.9    6e-12   Glycine max [soybeans]
ref|XP_010496473.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  65.5    7e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010246099.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  73.6    8e-12   Nelumbo nucifera [Indian lotus]
ref|XP_003636166.1|  Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-a...  73.2    9e-12   
ref|XP_010246100.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  73.2    9e-12   Nelumbo nucifera [Indian lotus]
ref|XP_002448266.1|  hypothetical protein SORBIDRAFT_06g024210        69.3    1e-11   Sorghum bicolor [broomcorn]
gb|KEH17914.1|  Alg9-like mannosyltransferase family protein          72.8    1e-11   Medicago truncatula
ref|XP_006347991.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  72.0    2e-11   
ref|XP_010496687.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  67.0    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_009118862.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  71.6    2e-11   Brassica rapa
ref|XP_002271419.2|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  67.4    2e-11   Vitis vinifera
ref|XP_009118864.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  71.6    2e-11   Brassica rapa
ref|XP_010496685.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  66.6    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010496684.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  66.6    2e-11   Camelina sativa [gold-of-pleasure]
emb|CBI16681.3|  unnamed protein product                              67.4    2e-11   Vitis vinifera
ref|XP_003580264.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  72.0    2e-11   Brachypodium distachyon [annual false brome]
ref|XP_003491108.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  72.8    3e-11   
ref|XP_004515328.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  68.9    3e-11   Cicer arietinum [garbanzo]
ref|XP_004515329.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  68.9    3e-11   Cicer arietinum [garbanzo]
ref|XP_006652601.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  72.0    3e-11   
ref|XP_008786178.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  67.0    3e-11   
ref|XP_008786179.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  67.0    3e-11   Phoenix dactylifera
ref|XP_008786180.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  67.0    3e-11   Phoenix dactylifera
ref|XP_008786181.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  67.0    3e-11   Phoenix dactylifera
ref|XP_010496686.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  66.2    3e-11   Camelina sativa [gold-of-pleasure]
ref|XP_008786177.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  67.0    3e-11   
ref|XP_006347988.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  71.6    4e-11   
ref|XP_008786182.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  67.0    4e-11   
ref|XP_006347989.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  71.2    4e-11   Solanum tuberosum [potatoes]
ref|XP_003402011.1|  PREDICTED: hypothetical protein LOC100650099     72.0    4e-11   
gb|KDP28876.1|  hypothetical protein JCGZ_14647                       69.7    4e-11   Jatropha curcas
ref|XP_004956421.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  70.9    6e-11   Setaria italica
ref|XP_004956422.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  70.9    6e-11   Setaria italica
gb|KCW73099.1|  hypothetical protein EUGRSUZ_E015451                  70.1    6e-11   Eucalyptus grandis [rose gum]
ref|XP_003700215.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  71.2    7e-11   
gb|EPS65150.1|  hypothetical protein M569_09628                       70.1    8e-11   Genlisea aurea
ref|XP_002526470.1|  glycosyltransferase, putative                    70.9    8e-11   
ref|XP_010056387.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  69.7    9e-11   Eucalyptus grandis [rose gum]
ref|XP_002969331.1|  mannosyltransferase-like protein                 70.1    1e-10   Selaginella moellendorffii
gb|EFN68776.1|  Probable dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolich...  70.5    1e-10   Camponotus floridanus
ref|XP_010056385.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  69.7    1e-10   Eucalyptus grandis [rose gum]
ref|XP_011255575.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  70.5    1e-10   Camponotus floridanus
ref|XP_010056384.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  69.7    1e-10   Eucalyptus grandis [rose gum]
ref|XP_010056383.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  69.7    1e-10   Eucalyptus grandis [rose gum]
ref|XP_009118863.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  69.3    2e-10   Brassica rapa
tpg|DAA36629.1|  TPA: hypothetical protein ZEAMMB73_968947            69.3    2e-10   Zea mays [maize]
ref|XP_008667967.1|  PREDICTED: dolichyl-P-Man Man isoform X1         69.3    2e-10   Zea mays [maize]
tpg|DAA36628.1|  TPA: hypothetical protein ZEAMMB73_968947            69.3    2e-10   Zea mays [maize]
ref|NP_001053463.1|  Os04g0544900                                     69.3    2e-10   
tpg|DAA36630.1|  TPA: dolichyl-P-Man Man                              69.3    2e-10   Zea mays [maize]
ref|XP_006617369.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  69.7    2e-10   Apis dorsata [rock honeybee]
ref|XP_011349260.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  69.3    3e-10   Cerapachys biroi
ref|XP_006838582.1|  hypothetical protein AMTR_s00002p00214180        68.6    4e-10   Amborella trichopoda
ref|XP_011153544.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  68.9    4e-10   Harpegnathos saltator
ref|XP_010479311.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  68.2    4e-10   Camelina sativa [gold-of-pleasure]
ref|XP_011163791.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  68.6    5e-10   Solenopsis invicta [imported red fire ant]
ref|XP_003689857.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  68.6    5e-10   
ref|XP_008205527.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  68.2    7e-10   
ref|NP_001148825.1|  dolichyl-P-Man Man                               67.4    8e-10   Zea mays [maize]
gb|AJC98491.1|  AGAP000102                                            67.8    8e-10   Anopheles coluzzii
ref|XP_006557963.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  67.8    9e-10   
ref|XP_006557961.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  67.8    9e-10   
gb|AJC98474.1|  AGAP000102                                            67.4    1e-09   Anopheles coluzzii
gb|EGI70265.1|  Putative dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolich...  67.4    1e-09   Acromyrmex echinatior
ref|XP_011063596.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  67.4    1e-09   Acromyrmex echinatior
ref|XP_010933573.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  62.8    2e-09   Elaeis guineensis
ref|XP_010933576.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  62.8    2e-09   Elaeis guineensis
ref|XP_010933572.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  62.8    2e-09   Elaeis guineensis
ref|XP_010933577.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  62.8    2e-09   Elaeis guineensis
ref|XP_008549304.1|  PREDICTED: LOW QUALITY PROTEIN: dol-P-Man:Ma...  66.6    2e-09   
ref|XP_009381984.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  65.5    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDR17512.1|  putative dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolich...  66.2    3e-09   Zootermopsis nevadensis
ref|XP_009381985.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  65.5    3e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001850969.1|  glycosyltransferase                              65.1    5e-09   Culex quinquefasciatus
gb|EHJ73778.1|  putative glycosyltransferase                          65.1    6e-09   Danaus plexippus [American monarch]
ref|XP_001663288.1|  AAEL013078-PA                                    64.7    7e-09   Aedes aegypti
ref|XP_001648338.1|  AAEL014279-PA                                    64.7    7e-09   Aedes aegypti
gb|AJC98479.1|  AGAP000102                                            64.7    8e-09   Anopheles coluzzii
gb|AJC98482.1|  AGAP000102                                            64.7    8e-09   Anopheles coluzzii
gb|AJC98477.1|  AGAP000102                                            64.7    8e-09   Anopheles coluzzii
gb|AJC98489.1|  AGAP000102                                            64.7    8e-09   Anopheles coluzzii
gb|AJC98486.1|  AGAP000102                                            64.7    8e-09   Anopheles coluzzii
gb|AJC98481.1|  AGAP000102                                            64.7    9e-09   Anopheles coluzzii
gb|AJC98494.1|  AGAP000102                                            64.7    9e-09   Anopheles merus
gb|AJC98480.1|  AGAP000102                                            64.7    9e-09   Anopheles coluzzii
gb|AJC98478.1|  AGAP000102                                            64.7    9e-09   Anopheles coluzzii
gb|AJC98492.1|  AGAP000102                                            64.7    9e-09   Anopheles coluzzii
ref|XP_311046.4|  AGAP000102-PA                                       64.7    9e-09   Anopheles gambiae str. PEST
gb|AJC98475.1|  AGAP000102                                            64.7    9e-09   Anopheles coluzzii
gb|AJC98485.1|  AGAP000102                                            64.7    9e-09   Anopheles coluzzii
gb|AJC98483.1|  AGAP000102                                            64.7    9e-09   Anopheles coluzzii
gb|AJC98484.1|  AGAP000102                                            64.7    9e-09   Anopheles coluzzii
gb|AJC98490.1|  AGAP000102                                            64.7    9e-09   Anopheles coluzzii
gb|AJC98488.1|  AGAP000102                                            64.7    9e-09   Anopheles coluzzii
gb|AJC98493.1|  AGAP000102                                            64.7    9e-09   Anopheles coluzzii
gb|AJC98476.1|  AGAP000102                                            64.7    9e-09   Anopheles coluzzii
ref|XP_007889176.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  62.4    2e-08   Callorhinchus milii [Australian ghost shark]
gb|AAI55513.1|  asparagine-linked glycosylation 12, alpha-1,6-man...  62.8    3e-08   Xenopus tropicalis [western clawed frog]
ref|NP_001016120.1|  ALG12, alpha-1,6-mannosyltransferase precursor   62.8    3e-08   Xenopus tropicalis [western clawed frog]
ref|XP_008399364.1|  PREDICTED: bromodomain-containing protein 1-...  63.2    3e-08   
ref|XP_009030087.1|  hypothetical protein HELRODRAFT_70039            62.4    3e-08   Helobdella robusta
ref|XP_007889175.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  62.0    4e-08   Callorhinchus milii [Australian ghost shark]
ref|XP_002104066.1|  GD18643                                          62.0    5e-08   
gb|ENN80093.1|  hypothetical protein YQE_03452                        62.0    6e-08   Dendroctonus ponderosae
ref|NP_649939.1|  CG8412                                              62.0    6e-08   Drosophila melanogaster
ref|XP_011504718.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  62.0    6e-08   Ceratosolen solmsi marchali
ref|XP_001994768.1|  GH17417                                          61.6    7e-08   Drosophila grimshawi
ref|XP_002031835.1|  GM23833                                          61.6    8e-08   Drosophila sechellia
ref|XP_002070263.1|  GK11961                                          61.6    8e-08   Drosophila willistoni
ref|XP_011303562.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  61.6    9e-08   Fopius arisanus
ref|XP_006119662.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.8    9e-08   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_001117738.2|  PREDICTED: dolichyl-P-Man:Man(7)GlcNAc(2)-PP...  57.8    9e-08   
ref|XP_007054631.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  61.2    1e-07   Chelonia mydas [green seaturtle]
gb|KFB34980.1|  AGAP000102-PA-like protein                            61.2    1e-07   Anopheles sinensis
ref|XP_001758628.1|  predicted protein                                60.8    1e-07   Physcomitrella patens
ref|XP_011210461.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  61.2    1e-07   Bactrocera dorsalis
gb|KFV12894.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  60.8    1e-07   Pterocles gutturalis
ref|XP_006780630.1|  PREDICTED: bromodomain-containing protein 1-...  61.2    1e-07   Neolamprologus brichardi [lyretail cichlid]
ref|XP_006780629.1|  PREDICTED: bromodomain-containing protein 1-...  61.2    1e-07   Neolamprologus brichardi [lyretail cichlid]
ref|XP_001964465.1|  GF23035                                          60.8    1e-07   Drosophila ananassae
gb|KFV77693.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  60.8    1e-07   Struthio camelus australis
ref|XP_010078902.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.8    1e-07   Pterocles gutturalis
ref|XP_009666099.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.8    1e-07   Struthio camelus australis
ref|XP_002097006.1|  GE25981                                          60.8    1e-07   Drosophila yakuba
ref|XP_001980759.1|  GG17092                                          60.8    2e-07   Drosophila erecta
ref|XP_002054547.1|  GJ22748                                          60.8    2e-07   Drosophila virilis
ref|XP_010933575.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  56.2    2e-07   Elaeis guineensis
ref|XP_006119658.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.1    2e-07   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_010304542.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.7    2e-07   Balearica regulorum gibbericeps
ref|XP_009927917.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.1    2e-07   Haliaeetus albicilla
gb|KFO05594.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  58.9    2e-07   Balearica regulorum gibbericeps
ref|XP_004521212.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  60.1    2e-07   Ceratitis capitata
ref|XP_005519263.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.1    2e-07   
ref|XP_003770822.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.1    2e-07   Sarcophilus harrisii
gb|AAX25758.2|  SJCHGC04766 protein                                   59.7    2e-07   Schistosoma japonicum
ref|XP_004458227.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.7    2e-07   
ref|XP_008934732.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.7    3e-07   Merops nubicus
gb|EOB00345.1|  Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-...  59.7    3e-07   Anas platyrhynchos [duck]
ref|XP_010172344.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.7    3e-07   Caprimulgus carolinensis
emb|CAX69859.1|  alpha-1,6-mannosyltransferase                        59.3    3e-07   Schistosoma japonicum
ref|XP_001640825.1|  predicted protein                                59.3    3e-07   Nematostella vectensis
ref|XP_005020901.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.7    3e-07   Anas platyrhynchos [duck]
ref|XP_002013739.1|  GL24301                                          59.7    3e-07   Drosophila persimilis
ref|XP_009941547.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.3    3e-07   Opisthocomus hoazin [hoatzin]
ref|XP_007232458.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.3    3e-07   Astyanax mexicanus [blind cave fish]
ref|XP_001358592.2|  GA21058                                          59.7    3e-07   Drosophila pseudoobscura pseudoobscura
ref|NP_001092219.1|  dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-m...  59.3    3e-07   Danio rerio [leopard danio]
gb|KFV76590.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  59.3    4e-07   Picoides pubescens
gb|KFO86029.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  59.3    4e-07   Buceros rhinoceros silvestris
ref|XP_009317042.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.3    4e-07   Pygoscelis adeliae
ref|XP_010143942.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.3    4e-07   Buceros rhinoceros silvestris
ref|XP_009701833.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.3    4e-07   Cariama cristata
ref|XP_008924845.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.3    4e-07   Manacus vitellinus
ref|XP_009289185.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.3    4e-07   Aptenodytes forsteri
gb|KFP76651.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  59.3    4e-07   Acanthisitta chloris
ref|XP_009069265.1|  PREDICTED: LOW QUALITY PROTEIN: dol-P-Man:Ma...  59.3    4e-07   Acanthisitta chloris
ref|XP_009907509.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.3    4e-07   Picoides pubescens
gb|KFP30903.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  59.3    4e-07   Colius striatus
ref|XP_005150100.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.3    4e-07   Melopsittacus undulatus
ref|XP_010284497.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.9    4e-07   Phaethon lepturus
ref|XP_010198175.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.3    4e-07   Colius striatus
ref|XP_010010445.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.3    4e-07   Nestor notabilis
ref|XP_009498471.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.3    4e-07   Phalacrocorax carbo [common cormorant]
gb|KFQ64312.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  58.9    4e-07   Phaethon lepturus
ref|XP_009085055.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.3    4e-07   Serinus canaria [canary]
ref|XP_008640763.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.3    4e-07   Corvus brachyrhynchos
gb|KGL77880.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  59.3    4e-07   Tinamus guttatus
ref|XP_010213853.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.3    4e-07   Tinamus guttatus
ref|XP_005039300.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.3    4e-07   Ficedula albicollis
ref|XP_002188335.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.3    4e-07   Taeniopygia guttata
ref|XP_005481972.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.3    4e-07   Zonotrichia albicollis
ref|XP_005428578.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.3    4e-07   Geospiza fortis
gb|KFQ78426.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  58.9    4e-07   Phoenicopterus ruber ruber
ref|XP_001489274.3|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.9    4e-07   Equus caballus [domestic horse]
ref|XP_003225017.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.9    5e-07   Anolis carolinensis [Carolina anole]
ref|XP_008115325.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.9    5e-07   
ref|XP_004921841.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  59.3    5e-07   Bombyx mori [silk moth]
ref|XP_006267869.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.9    5e-07   Alligator mississippiensis
ref|XP_006633542.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.9    5e-07   
gb|KFV93233.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  58.9    5e-07   Eurypyga helias
ref|XP_009997748.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.9    5e-07   Chaetura pelagica
ref|XP_009461136.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.9    5e-07   Nipponia nippon
ref|XP_010121704.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.9    5e-07   Chlamydotis macqueenii
ref|XP_009578588.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.9    5e-07   Fulmarus glacialis
ref|XP_009482482.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.9    5e-07   Pelecanus crispus
ref|XP_010149724.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.9    5e-07   Eurypyga helias
emb|CCD59088.1|  glycosyltransferase, putative                        58.9    6e-07   Schistosoma mansoni
ref|XP_009819306.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.9    6e-07   Gavia stellata
ref|XP_010371872.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.5    6e-07   Rhinopithecus roxellana
ref|XP_009232780.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.2    6e-07   Pongo abelii [orang utan]
ref|XP_009984093.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.9    6e-07   Tauraco erythrolophus
ref|XP_005438718.1|  PREDICTED: LOW QUALITY PROTEIN: dol-P-Man:Ma...  58.9    6e-07   
gb|KFP46705.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  58.5    6e-07   Cathartes aura
ref|XP_005244060.1|  PREDICTED: LOW QUALITY PROTEIN: dol-P-Man:Ma...  58.9    6e-07   
ref|XP_009868394.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.5    6e-07   Apaloderma vittatum
gb|KFP76475.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  58.5    6e-07   Apaloderma vittatum
ref|XP_971608.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alp...  58.9    6e-07   Tribolium castaneum [rust-red flour beetle]
ref|XP_006016560.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.5    6e-07   Alligator sinensis
ref|XP_009957696.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.5    6e-07   Leptosomus discolor
ref|XP_009232781.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.8    6e-07   Pongo abelii [orang utan]
ref|XP_006267868.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.5    6e-07   Alligator mississippiensis
gb|ERL87612.1|  hypothetical protein D910_05003                       58.2    7e-07   Dendroctonus ponderosae
ref|XP_010371868.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.5    7e-07   Rhinopithecus roxellana
ref|XP_007578036.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.5    7e-07   
ref|XP_007974352.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.2    8e-07   Chlorocebus sabaeus
ref|XP_004521214.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  58.5    8e-07   Ceratitis capitata
ref|XP_005176687.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  58.5    8e-07   Musca domestica
ref|XP_003732200.1|  PREDICTED: LOW QUALITY PROTEIN: dol-P-Man:Ma...  58.2    8e-07   Callithrix jacchus [common marmoset]
ref|XP_009215805.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.2    9e-07   
gb|KFQ24125.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  58.2    9e-07   Mesitornis unicolor
gb|EHH20343.1|  hypothetical protein EGK_03180                        58.2    9e-07   
ref|XP_009215802.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.2    9e-07   
ref|XP_010186119.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.2    1e-06   
ref|XP_003905777.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.2    1e-06   
ref|XP_007974351.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.2    1e-06   
ref|NP_001034359.2|  alpha-1,6-mannosyltransferase ALG12 precursor    58.2    1e-06   
ref|XP_004845419.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.2    1e-06   
ref|XP_004885549.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.2    1e-06   
ref|XP_005567025.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.2    1e-06   
gb|AAM94900.1|AF311904_1  membrane protein SB87 precursor             58.2    1e-06   
ref|XP_010727311.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.8    1e-06   
gb|EFX74600.1|  hypothetical protein DAPPUDRAFT_307223                57.8    1e-06   
ref|XP_004845421.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.8    1e-06   
gb|ETM00928.1|  hypothetical protein L917_02424                       57.8    1e-06   
gb|ETO83325.1|  hypothetical protein F444_02634                       57.8    1e-06   
ref|XP_008915926.1|  hypothetical protein PPTG_19333                  57.8    1e-06   
gb|ETM54104.1|  hypothetical protein L914_02513                       57.8    1e-06   
gb|ETP52374.1|  hypothetical protein F442_02612                       57.8    1e-06   
gb|ETK94438.1|  hypothetical protein L915_02518                       57.8    1e-06   
gb|ETI54568.1|  hypothetical protein F443_02633                       57.8    1e-06   
ref|XP_007974353.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.8    1e-06   
ref|XP_009215804.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.8    1e-06   
ref|XP_007974350.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.8    1e-06   
ref|XP_004521213.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  58.2    1e-06   
ref|XP_004885551.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.8    1e-06   
ref|XP_011282655.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.8    1e-06   
ref|XP_005096585.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  57.8    1e-06   
ref|XP_002000049.1|  GI22746                                          57.8    1e-06   
gb|ETO83331.1|  hypothetical protein, variant 6                       57.4    1e-06   
ref|XP_009646240.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.8    1e-06   
gb|EFX61262.1|  hypothetical protein DAPPUDRAFT_340335                57.8    1e-06   
gb|ETO83326.1|  hypothetical protein, variant 1                       57.8    1e-06   
gb|ETI54569.1|  hypothetical protein, variant 1                       57.8    1e-06   
ref|XP_008915925.1|  hypothetical protein, variant                    57.4    1e-06   
gb|ETM00929.1|  hypothetical protein, variant                         57.4    1e-06   
ref|XP_009966320.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.8    1e-06   
ref|XP_008491198.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.8    1e-06   
ref|XP_003972973.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.8    1e-06   
gb|ETI54574.1|  hypothetical protein, variant 6                       57.4    1e-06   
gb|ETK94444.1|  hypothetical protein, variant 6                       57.4    1e-06   
gb|ETO83327.1|  hypothetical protein, variant 2                       57.4    1e-06   
gb|ETM54105.1|  hypothetical protein, variant 1                       57.8    1e-06   
gb|ETK94439.1|  hypothetical protein, variant 1                       57.8    1e-06   
gb|ETI54570.1|  hypothetical protein, variant 2                       57.4    1e-06   
ref|XP_004650701.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.8    1e-06   
gb|ETM54106.1|  hypothetical protein, variant 2                       57.4    1e-06   
ref|XP_007428146.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.8    1e-06   
ref|XP_005067129.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.4    1e-06   
ref|XP_002405545.1|  glycosyltransferase, putative                    57.4    1e-06   
gb|EGW09352.1|  Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-...  57.4    2e-06   
ref|XP_009554679.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.4    2e-06   
ref|XP_005915756.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.4    2e-06   
ref|XP_006976191.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.4    2e-06   
ref|XP_007651110.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.4    2e-06   
ref|XP_005797321.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.4    2e-06   
ref|XP_005725189.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.4    2e-06   
ref|XP_010738758.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.4    2e-06   
ref|XP_007651107.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.4    2e-06   
ref|XP_010778995.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.4    2e-06   
gb|EKC27855.1|  Putative dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolich...  57.4    2e-06   
ref|XP_011419681.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.4    2e-06   
ref|XP_002427647.1|  glycosyltransferase, putative                    57.4    2e-06   
ref|XP_001914875.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.0    2e-06   
ref|XP_001952055.2|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  57.4    2e-06   
gb|ERE86443.1|  dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  57.4    2e-06   
gb|KFZ49122.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  57.0    2e-06   
ref|XP_003932812.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.0    2e-06   
ref|XP_002831329.2|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.0    2e-06   
ref|XP_004610821.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.4    2e-06   
ref|XP_011178105.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  57.4    2e-06   
ref|XP_001140006.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.0    2e-06   
ref|XP_009436925.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.0    2e-06   
emb|CAC83681.1|  putative dolichyl-p-man: Man7GlcNAc2-PP-dolichyl...  57.0    2e-06   
ref|XP_009881948.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.0    2e-06   
ref|XP_004063719.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.0    2e-06   
ref|XP_007519500.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.0    2e-06   
ref|NP_077010.1|  dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mann...  57.0    2e-06   
gb|AAH98562.1|  Asparagine-linked glycosylation 12, alpha-1,6-man...  57.0    2e-06   
ref|XP_003783146.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.0    2e-06   
ref|XP_002163655.2|  PREDICTED: uncharacterized protein LOC100214068  57.0    2e-06   
ref|XP_005681294.1|  PREDICTED: LOW QUALITY PROTEIN: dol-P-Man:Ma...  56.6    3e-06   
ref|XP_005286150.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  56.6    3e-06   
gb|ACN30752.1|  unknown                                               56.2    3e-06   
ref|XP_008171235.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  56.6    3e-06   
ref|XP_007664896.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  56.6    3e-06   
ref|XP_003461623.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  56.6    3e-06   
ref|XP_004554006.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  56.6    3e-06   
ref|XP_009058090.1|  hypothetical protein LOTGIDRAFT_228830           56.6    3e-06   
ref|XP_002831330.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  56.2    3e-06   
emb|CDS09080.1|  hypothetical protein LRAMOSA10440                    56.6    3e-06   
ref|XP_004438054.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  56.6    3e-06   
gb|EHH65944.1|  hypothetical protein EGM_02821                        56.2    3e-06   
ref|XP_011282653.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  56.2    4e-06   
ref|XP_008051475.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  56.2    4e-06   
ref|XP_002901657.1|  dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-a...  56.2    4e-06   
ref|XP_848418.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alp...  56.2    4e-06   
ref|XP_004642467.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  56.2    4e-06   
ref|XP_004409739.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  56.2    4e-06   
ref|XP_008567178.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  56.2    4e-06   
gb|KHN85099.1|  putative valine--tRNA ligase, cytoplasmic             56.2    4e-06   
ref|XP_005354435.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  56.2    4e-06   
ref|XP_011220646.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.8    5e-06   
ref|XP_009516633.1|  hypothetical protein PHYSODRAFT_469873           55.8    5e-06   
ref|XP_005335067.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.8    5e-06   
ref|XP_008567176.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.8    5e-06   
ref|XP_010600391.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.8    5e-06   
ref|XP_008539918.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.8    5e-06   
ref|XP_002917304.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.8    5e-06   
ref|XP_008567177.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.8    5e-06   
ref|XP_003445116.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.8    6e-06   
ref|XP_010600392.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.5    6e-06   
gb|ETN63789.1|  glycosyltransferase                                   55.8    6e-06   
gb|EJK72529.1|  hypothetical protein THAOC_05935                      55.5    6e-06   
ref|XP_011406378.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.5    6e-06   
ref|XP_007126834.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.5    6e-06   
ref|XP_003422895.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.5    6e-06   
ref|XP_008701210.1|  PREDICTED: LOW QUALITY PROTEIN: dol-P-Man:Ma...  55.5    6e-06   
ref|XP_008832938.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.5    6e-06   
ref|XP_007189282.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.5    6e-06   
ref|XP_005981168.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.5    7e-06   
ref|XP_008832941.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.5    7e-06   
ref|XP_008832939.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.5    7e-06   
ref|XP_004007716.1|  PREDICTED: LOW QUALITY PROTEIN: dol-P-Man:Ma...  55.5    7e-06   
ref|XP_004775482.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.5    7e-06   
ref|XP_006876482.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.5    7e-06   
ref|XP_005207555.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.5    7e-06   
ref|XP_004320671.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.5    7e-06   
ref|XP_004279649.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.5    7e-06   
ref|XP_008832937.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.5    7e-06   
ref|XP_010600390.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.5    7e-06   
ref|XP_003280777.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.5    8e-06   
ref|XP_006066368.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.5    8e-06   
ref|NP_001096816.1|  dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-m...  55.5    8e-06   
ref|XP_010804119.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.5    8e-06   
ref|XP_004775484.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.5    8e-06   
ref|XP_005903965.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.5    8e-06   
ref|XP_011489250.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.5    8e-06   
ref|XP_004987604.1|  hypothetical protein PTSG_11395                  55.1    8e-06   
ref|XP_004818788.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.1    9e-06   
ref|XP_011489251.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.1    9e-06   
ref|XP_007453957.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.1    9e-06   
ref|XP_004818790.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.1    9e-06   
ref|XP_004818787.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.1    9e-06   
ref|XP_004818782.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.1    1e-05   
ref|XP_010830422.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.1    1e-05   
gb|EJK52362.1|  hypothetical protein THAOC_28372                      55.1    1e-05   
emb|CDQ57116.1|  unnamed protein product                              55.1    1e-05   
ref|XP_006735449.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.1    1e-05   
ref|XP_005379586.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.1    1e-05   
ref|XP_004818791.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  54.7    1e-05   
ref|XP_004818783.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.1    1e-05   
ref|XP_004818789.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  54.7    1e-05   
gb|EJW79963.1|  plasmid Maintenance protein containing protein        54.7    1e-05   
ref|XP_002290603.1|  dolichyl-phosphate-mannose-glycolipid alpha-...  54.7    1e-05   
ref|XP_008610854.1|  hypothetical protein SDRG_06828                  54.3    1e-05   
ref|XP_008280049.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  54.3    2e-05   
gb|ELW49022.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  54.3    2e-05   
emb|CDH58106.1|  dolichyl-p-man:man c-pp-dolichyl-alpha-6-mannosy...  54.7    2e-05   
ref|NP_001135829.1|  dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-m...  54.3    2e-05   
gb|EDL04396.1|  asparagine-linked glycosylation 12 homolog (yeast...  53.9    2e-05   
ref|NP_001101574.2|  dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-m...  53.9    2e-05   
dbj|GAM21373.1|  hypothetical protein SAMD00019534_045480             54.3    2e-05   
ref|XP_002114556.1|  hypothetical protein TRIADDRAFT_28195            53.9    2e-05   
ref|XP_005653255.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  53.9    2e-05   
ref|XP_010885418.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  53.9    2e-05   
gb|ACN31485.1|  unknown                                               53.1    3e-05   
gb|ELK24636.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  53.5    3e-05   
ref|XP_003741534.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  53.5    3e-05   
ref|XP_004380126.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  53.5    3e-05   
ref|NP_001133910.1|  dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-a...  53.5    3e-05   
ref|XP_005646870.1|  Alg9-like mannosyltransferase                    53.5    4e-05   
ref|XP_004364979.1|  membrane protein SB87                            53.5    4e-05   
gb|EPY81494.1|  dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  53.5    4e-05   
gb|KDO22510.1|  hypothetical protein SPRG_11694                       53.1    4e-05   
ref|XP_006157656.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  53.1    4e-05   
ref|XP_006157653.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  53.1    4e-05   
ref|XP_009827625.1|  hypothetical protein, variant                    53.1    4e-05   
ref|XP_005710744.1|  Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-a...  53.1    4e-05   
gb|EHK45225.1|  glycosyltransferase family 22 protein                 53.1    4e-05   
ref|XP_009827624.1|  hypothetical protein H257_04713                  53.1    5e-05   
emb|CDQ75547.1|  unnamed protein product                              52.4    5e-05   
ref|XP_006212635.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  53.1    5e-05   
ref|XP_008153642.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  53.1    5e-05   
ref|XP_004700681.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  53.1    5e-05   
ref|XP_010955584.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  53.1    5e-05   
ref|XP_006184325.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  52.8    5e-05   
ref|XP_006771159.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  52.8    5e-05   
ref|XP_010979931.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  52.8    5e-05   
ref|XP_005839081.1|  hypothetical protein GUITHDRAFT_65500            52.8    5e-05   
ref|XP_795966.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alp...  52.8    5e-05   
ref|XP_004589764.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  52.8    6e-05   
ref|XP_006107904.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  52.4    7e-05   
ref|XP_005878034.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  52.4    7e-05   
gb|ELK07527.1|  Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-...  52.0    7e-05   
gb|ETS01232.1|  hypothetical protein M419DRAFT_130862                 52.4    8e-05   
ref|XP_001901623.1|  Plasmid Maintenance Protein containing protein   52.4    8e-05   
ref|XP_008861839.1|  hypothetical protein H310_00735                  52.4    8e-05   
ref|XP_008861840.1|  hypothetical protein, variant                    52.4    8e-05   
ref|XP_006888086.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  52.4    8e-05   
ref|XP_006966286.1|  predicted protein                                52.4    8e-05   
ref|XP_010632593.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  52.4    8e-05   
ref|XP_002724007.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  52.4    9e-05   
ref|XP_011374734.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  52.4    9e-05   
ref|XP_011397453.1|  putative Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol al...  52.0    9e-05   
ref|XP_007952949.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  52.0    1e-04   
gb|EFA84739.1|  glycosyltransferase                                   52.4    1e-04   
ref|XP_006917916.1|  PREDICTED: LOW QUALITY PROTEIN: dol-P-Man:Ma...  52.0    1e-04   
ref|XP_008314120.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  52.0    1e-04   
gb|KDO18106.1|  hypothetical protein SPRG_16521                       51.6    1e-04   
emb|CDJ81963.1|  Alg9 mannosyltransferase domain containing protein   51.2    2e-04   
gb|EIE78569.1|  hypothetical protein RO3G_03273                       50.8    2e-04   
ref|XP_001743896.1|  hypothetical protein                             50.8    3e-04   
ref|XP_647384.1|  hypothetical protein DDB_G0267884                   50.8    3e-04   
emb|CAD22101.1|  putative mannosyltransferase                         50.8    3e-04   
ref|XP_002126504.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  50.8    3e-04   
gb|EJD76603.1|  glycosyltransferase family 22 protein                 50.4    3e-04   
ref|XP_002594362.1|  hypothetical protein BRAFLDRAFT_72229            50.1    5e-04   
emb|CEG68799.1|  hypothetical protein RMATCC62417_04989               49.7    7e-04   
gb|EHK26367.1|  glycosyltransferase family 22 protein                 49.3    8e-04   
ref|XP_003289352.1|  hypothetical protein DICPUDRAFT_80121            49.3    0.001   



>ref|XP_010089788.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Morus notabilis]
 gb|EXB38380.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Morus notabilis]
Length=482

 Score = 75.5 bits (184),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  233  LYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            L+  GLT+++DS+MWRRLLWPEFEVFWFNSVLNRSSEWG    H
Sbjct  205  LFCIGLTVLIDSIMWRRLLWPEFEVFWFNSVLNRSSEWGTHTFH  248


 Score = 30.4 bits (67),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -3

Query  387  TKSISLWKAVISCFGTALCCIGL  319
            TKSISLW+ +  CF  AL CIGL
Sbjct  188  TKSISLWETLKCCFWFALFCIGL  210



>ref|XP_009765388.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X4 [Nicotiana sylvestris]
Length=402

 Score = 73.9 bits (180),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            GLT++VDSVMWRRLLWPE EVFWFNSVLNRSSEWG    H
Sbjct  232  GLTVLVDSVMWRRLLWPELEVFWFNSVLNRSSEWGTHPFH  271


 Score = 31.6 bits (70),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L TKS+S WKA+ SC   A   IGL
Sbjct  209  LLTKSVSFWKALTSCLAAAFLSIGL  233



>ref|XP_011088786.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X3 [Sesamum indicum]
Length=403

 Score = 73.2 bits (178),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  233  LYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            L+  GLTI+VDSV+WR+LLWPE EVFWFNSVLNRSSEWG 
Sbjct  218  LFCIGLTILVDSVLWRKLLWPELEVFWFNSVLNRSSEWGT  257


 Score = 32.3 bits (72),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L ++SISL KA++SC  TAL CIGL
Sbjct  199  LLSRSISLRKAILSCLVTALFCIGL  223



>ref|XP_007134415.1| hypothetical protein PHAVU_010G045600g [Phaseolus vulgaris]
 gb|ESW06409.1| hypothetical protein PHAVU_010G045600g [Phaseolus vulgaris]
Length=365

 Score = 76.6 bits (187),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  233  LYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            L+  GLTI+VDS+MW+RLLWPEFEVFWFNSVLN+SSEWG +  H
Sbjct  251  LFCIGLTIIVDSIMWKRLLWPEFEVFWFNSVLNKSSEWGTNAFH  294


 Score = 28.9 bits (63),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L T  IS+W A+  C G AL CIGL
Sbjct  232  LLTNKISVWGALKHCTGMALFCIGL  256



>ref|XP_006576707.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X2 [Glycine max]
Length=465

 Score = 74.7 bits (182),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  233  LYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            L+  GLTI+VDS+MW+RLLWPEFEVFWFNSVLN+SSEWG    H
Sbjct  253  LFCIGLTILVDSIMWKRLLWPEFEVFWFNSVLNKSSEWGTHAFH  296


 Score = 30.8 bits (68),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L TK IS+W A+  C G AL CIGL
Sbjct  234  LLTKKISVWGALKHCTGMALFCIGL  258



>ref|XP_007134414.1| hypothetical protein PHAVU_010G045600g [Phaseolus vulgaris]
 gb|ESW06408.1| hypothetical protein PHAVU_010G045600g [Phaseolus vulgaris]
Length=336

 Score = 76.3 bits (186),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  233  LYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            L+  GLTI+VDS+MW+RLLWPEFEVFWFNSVLN+SSEWG +  H
Sbjct  222  LFCIGLTIIVDSIMWKRLLWPEFEVFWFNSVLNKSSEWGTNAFH  265


 Score = 28.9 bits (63),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L T  IS+W A+  C G AL CIGL
Sbjct  203  LLTNKISVWGALKHCTGMALFCIGL  227



>ref|XP_011088778.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Sesamum indicum]
Length=428

 Score = 72.8 bits (177),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  233  LYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            L+  GLTI+VDSV+WR+LLWPE EVFWFNSVLNRSSEWG 
Sbjct  218  LFCIGLTILVDSVLWRKLLWPELEVFWFNSVLNRSSEWGT  257


 Score = 32.3 bits (72),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L ++SISL KA++SC  TAL CIGL
Sbjct  199  LLSRSISLRKAILSCLVTALFCIGL  223



>ref|XP_009765385.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Nicotiana sylvestris]
Length=499

 Score = 73.6 bits (179),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            GLT++VDSVMWRRLLWPE EVFWFNSVLNRSSEWG    H
Sbjct  223  GLTVLVDSVMWRRLLWPELEVFWFNSVLNRSSEWGTHPFH  262


 Score = 31.6 bits (70),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L TKS+S WKA+ SC   A   IGL
Sbjct  200  LLTKSVSFWKALTSCLAAAFLSIGL  224



>ref|XP_007134412.1| hypothetical protein PHAVU_010G045600g [Phaseolus vulgaris]
 gb|ESW06406.1| hypothetical protein PHAVU_010G045600g [Phaseolus vulgaris]
Length=528

 Score = 75.9 bits (185),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  233  LYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            L+  GLTI+VDS+MW+RLLWPEFEVFWFNSVLN+SSEWG +  H
Sbjct  251  LFCIGLTIIVDSIMWKRLLWPEFEVFWFNSVLNKSSEWGTNAFH  294


 Score = 28.9 bits (63),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L T  IS+W A+  C G AL CIGL
Sbjct  232  LLTNKISVWGALKHCTGMALFCIGL  256



>ref|NP_001077448.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Arabidopsis thaliana]
 sp|A8MR93.1|ALG12_ARATH RecName: Full=Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase; 
AltName: Full=Alpha-1,6-mannosyltransferase 
ALG12; AltName: Full=Asparagine-linked glycosylation protein 
12; AltName: Full=EMS-mutagenized BRI1 suppressor 4 [Arabidopsis 
thaliana]
 gb|AEE27391.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Arabidopsis thaliana]
Length=497

 Score = 70.9 bits (172),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 52/84 (62%), Gaps = 11/84 (13%)
 Frame = -1

Query  233  LYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH---------HILICAC  81
            L   GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG    H          +L+   
Sbjct  221  LLAVGLTIFVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTHSIHWYFTSALPRSLLVAYP  280

Query  80   ISLNYVLVDIYMPVHWHIYSVVSF  9
            +SL   LVD  +P  + I  V+SF
Sbjct  281  LSLLGTLVDRRVP--FFIVPVLSF  302


 Score = 33.9 bits (76),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L TKSIS WKA+  C GTAL  +GL
Sbjct  202  LLTKSISFWKALKYCVGTALLAVGL  226



>ref|XP_009765384.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Nicotiana sylvestris]
Length=508

 Score = 73.6 bits (179),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            GLT++VDSVMWRRLLWPE EVFWFNSVLNRSSEWG    H
Sbjct  232  GLTVLVDSVMWRRLLWPELEVFWFNSVLNRSSEWGTHPFH  271


 Score = 31.6 bits (70),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L TKS+S WKA+ SC   A   IGL
Sbjct  209  LLTKSVSFWKALTSCLAAAFLSIGL  233



>ref|XP_003521056.2| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X1 [Glycine max]
Length=529

 Score = 73.9 bits (180),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  233  LYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            L+  GLTI+VDS+MW+RLLWPEFEVFWFNSVLN+SSEWG    H
Sbjct  253  LFCIGLTILVDSIMWKRLLWPEFEVFWFNSVLNKSSEWGTHAFH  296


 Score = 30.8 bits (68),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L TK IS+W A+  C G AL CIGL
Sbjct  234  LLTKKISVWGALKHCTGMALFCIGL  258



>ref|NP_001077446.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Arabidopsis thaliana]
 gb|AEE27389.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Arabidopsis thaliana]
Length=493

 Score = 70.9 bits (172),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 52/84 (62%), Gaps = 11/84 (13%)
 Frame = -1

Query  233  LYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH---------HILICAC  81
            L   GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG    H          +L+   
Sbjct  217  LLAVGLTIFVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTHSIHWYFTSALPRSLLVAYP  276

Query  80   ISLNYVLVDIYMPVHWHIYSVVSF  9
            +SL   LVD  +P  + I  V+SF
Sbjct  277  LSLLGTLVDRRVP--FFIVPVLSF  298


 Score = 33.9 bits (76),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L TKSIS WKA+  C GTAL  +GL
Sbjct  198  LLTKSISFWKALKYCVGTALLAVGL  222



>ref|XP_011088772.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Sesamum indicum]
Length=494

 Score = 72.4 bits (176),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  233  LYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            L+  GLTI+VDSV+WR+LLWPE EVFWFNSVLNRSSEWG 
Sbjct  218  LFCIGLTILVDSVLWRKLLWPELEVFWFNSVLNRSSEWGT  257


 Score = 32.3 bits (72),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L ++SISL KA++SC  TAL CIGL
Sbjct  199  LLSRSISLRKAILSCLVTALFCIGL  223



>ref|XP_007134413.1| hypothetical protein PHAVU_010G045600g [Phaseolus vulgaris]
 gb|ESW06407.1| hypothetical protein PHAVU_010G045600g [Phaseolus vulgaris]
Length=499

 Score = 75.9 bits (185),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  233  LYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            L+  GLTI+VDS+MW+RLLWPEFEVFWFNSVLN+SSEWG +  H
Sbjct  222  LFCIGLTIIVDSIMWKRLLWPEFEVFWFNSVLNKSSEWGTNAFH  265


 Score = 28.9 bits (63),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L T  IS+W A+  C G AL CIGL
Sbjct  203  LLTNKISVWGALKHCTGMALFCIGL  227



>gb|ABF59128.1| unknown protein [Arabidopsis thaliana]
Length=449

 Score = 70.5 bits (171),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 52/87 (60%), Gaps = 11/87 (13%)
 Frame = -1

Query  242  NAILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH---------HILI  90
               L   GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG    H          +L+
Sbjct  170  GTALLAVGLTIFVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTHSIHWYFTSALPRSLLV  229

Query  89   CACISLNYVLVDIYMPVHWHIYSVVSF  9
               +SL   LVD  +P  + I  V+SF
Sbjct  230  AYPLSLLGTLVDRRVP--FFIVPVLSF  254


 Score = 33.9 bits (76),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L TKSIS WKA+  C GTAL  +GL
Sbjct  154  LLTKSISFWKALKYCVGTALLAVGL  178



>ref|NP_001117214.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Arabidopsis thaliana]
 gb|AEE27392.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Arabidopsis thaliana]
Length=453

 Score = 70.5 bits (171),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 52/87 (60%), Gaps = 11/87 (13%)
 Frame = -1

Query  242  NAILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH---------HILI  90
               L   GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG    H          +L+
Sbjct  174  GTALLAVGLTIFVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTHSIHWYFTSALPRSLLV  233

Query  89   CACISLNYVLVDIYMPVHWHIYSVVSF  9
               +SL   LVD  +P  + I  V+SF
Sbjct  234  AYPLSLLGTLVDRRVP--FFIVPVLSF  258


 Score = 33.9 bits (76),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L TKSIS WKA+  C GTAL  +GL
Sbjct  158  LLTKSISFWKALKYCVGTALLAVGL  182



>ref|XP_009765386.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X3 [Nicotiana sylvestris]
Length=484

 Score = 73.2 bits (178),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            GLT++VDSVMWRRLLWPE EVFWFNSVLNRSSEWG 
Sbjct  208  GLTVLVDSVMWRRLLWPELEVFWFNSVLNRSSEWGT  243


 Score = 30.8 bits (68),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -3

Query  387  TKSISLWKAVISCFGTALCCIGL  319
            TKS+S WKA+ SC   A   IGL
Sbjct  187  TKSVSFWKALTSCLAAAFLSIGL  209



>ref|XP_002892023.1| hypothetical protein ARALYDRAFT_887214 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68282.1| hypothetical protein ARALYDRAFT_887214 [Arabidopsis lyrata subsp. 
lyrata]
Length=491

 Score = 70.1 bits (170),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 52/84 (62%), Gaps = 11/84 (13%)
 Frame = -1

Query  233  LYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH---------HILICAC  81
            L   GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG    H          +L+   
Sbjct  215  LLAVGLTISVDSIMWKKCVWPEFEVFWFNSILNRSSDWGTHSIHWYFTSALPRSLLVAYP  274

Query  80   ISLNYVLVDIYMPVHWHIYSVVSF  9
            +SL   LVD  +P  + I  V+SF
Sbjct  275  LSLLGTLVDRRVP--FFILPVLSF  296


 Score = 33.9 bits (76),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L TKSIS WKA+  C GTAL  +GL
Sbjct  196  LLTKSISFWKALKYCVGTALLAVGL  220



>gb|AIE43865.1| WRKY transcription factor 25 [Gossypium hirsutum]
Length=679

 Score = 72.0 bits (175),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            GLT++VDS+MW+R LWPEFEVFWFNSVLNRSSEWG 
Sbjct  406  GLTVLVDSIMWKRFLWPEFEVFWFNSVLNRSSEWGT  441


 Score = 31.6 bits (70),  Expect(2) = 7e-14, Method: Composition-based stats.
 Identities = 14/23 (61%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -3

Query  387  TKSISLWKAVISCFGTALCCIGL  319
            TKSIS W+A   C  T L CIGL
Sbjct  385  TKSISFWRAFKCCTVTTLLCIGL  407



>ref|XP_006418502.1| hypothetical protein EUTSA_v10007459mg [Eutrema salsugineum]
 gb|ESQ36855.1| hypothetical protein EUTSA_v10007459mg [Eutrema salsugineum]
Length=417

 Score = 68.9 bits (167),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 51/80 (64%), Gaps = 11/80 (14%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH---------HILICACISLN  69
            GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG    H          +L+   +SL 
Sbjct  225  GLTISVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTHSIHWYFTSALPRSLLVAYPLSLL  284

Query  68   YVLVDIYMPVHWHIYSVVSF  9
              L+D  +P  + I  V+SF
Sbjct  285  GTLLDRRVP--FLILPVLSF  302


 Score = 33.9 bits (76),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L TKSIS WKA+  C GTA+  +GL
Sbjct  202  LMTKSISFWKALKYCVGTAVVAVGL  226



>ref|XP_006418501.1| hypothetical protein EUTSA_v10007459mg [Eutrema salsugineum]
 gb|ESQ36854.1| hypothetical protein EUTSA_v10007459mg [Eutrema salsugineum]
Length=495

 Score = 68.6 bits (166),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 51/80 (64%), Gaps = 11/80 (14%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH---------HILICACISLN  69
            GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG    H          +L+   +SL 
Sbjct  225  GLTISVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTHSIHWYFTSALPRSLLVAYPLSLL  284

Query  68   YVLVDIYMPVHWHIYSVVSF  9
              L+D  +P  + I  V+SF
Sbjct  285  GTLLDRRVP--FLILPVLSF  302


 Score = 33.9 bits (76),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L TKSIS WKA+  C GTA+  +GL
Sbjct  202  LMTKSISFWKALKYCVGTAVVAVGL  226



>ref|XP_006418503.1| hypothetical protein EUTSA_v10007459mg [Eutrema salsugineum]
 gb|ESQ36856.1| hypothetical protein EUTSA_v10007459mg [Eutrema salsugineum]
Length=419

 Score = 68.9 bits (167),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 51/80 (64%), Gaps = 11/80 (14%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH---------HILICACISLN  69
            GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG    H          +L+   +SL 
Sbjct  225  GLTISVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTHSIHWYFTSALPRSLLVAYPLSLL  284

Query  68   YVLVDIYMPVHWHIYSVVSF  9
              L+D  +P  + I  V+SF
Sbjct  285  GTLLDRRVP--FLILPVLSF  302


 Score = 33.9 bits (76),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L TKSIS WKA+  C GTA+  +GL
Sbjct  202  LMTKSISFWKALKYCVGTAVVAVGL  226



>ref|XP_002301238.2| hypothetical protein POPTR_0002s14010g [Populus trichocarpa]
 gb|EEE80511.2| hypothetical protein POPTR_0002s14010g [Populus trichocarpa]
Length=475

 Score = 72.0 bits (175),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            G TI+VDS+MW+R+LWPEFEVFWFNSVLNRSSEWG 
Sbjct  223  GFTIMVDSIMWKRILWPEFEVFWFNSVLNRSSEWGT  258


 Score = 30.0 bits (66),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -3

Query  387  TKSISLWKAVISCFGTALCCIGL  319
            TKSISLW A+  C G AL  IG 
Sbjct  202  TKSISLWGAIKYCIGPALLSIGF  224



>ref|XP_006306188.1| hypothetical protein CARUB_v10011809mg [Capsella rubella]
 gb|EOA39086.1| hypothetical protein CARUB_v10011809mg [Capsella rubella]
Length=497

 Score = 67.8 bits (164),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  233  LYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            L   GLTI +DS+MW++ +WPEFEVFWFNS+LNRSS+WG 
Sbjct  221  LLAVGLTIFIDSIMWKKFVWPEFEVFWFNSILNRSSDWGT  260


 Score = 33.9 bits (76),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L TKSIS WKA+  C GTAL  +GL
Sbjct  202  LLTKSISFWKALKYCVGTALLAVGL  226



>ref|XP_007052356.1| Asparagine-linked glycosylation 12 isoform 3 [Theobroma cacao]
 gb|EOX96513.1| Asparagine-linked glycosylation 12 isoform 3 [Theobroma cacao]
Length=419

 Score = 73.6 bits (179),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            GLTI+VDS+MW+R LWPEFEVFWFNSVLNRSSEWG    H
Sbjct  220  GLTILVDSIMWKRFLWPEFEVFWFNSVLNRSSEWGTHSIH  259


 Score = 28.5 bits (62),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L TKSI+ WKA+  C   +L CIGL
Sbjct  197  LLTKSIAFWKALKCCIMISLLCIGL  221



>ref|XP_009603142.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Nicotiana tomentosiformis]
Length=499

 Score = 71.6 bits (174),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            GLT++VDSV+WRRLLWPE EVFWFNSVLNRSSEWG    H
Sbjct  223  GLTVLVDSVIWRRLLWPELEVFWFNSVLNRSSEWGTHPFH  262


 Score = 30.0 bits (66),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L TKS+S WKA+ SC   A   IGL
Sbjct  200  LLTKSVSFWKALTSCLAAASLSIGL  224



>gb|EYU40344.1| hypothetical protein MIMGU_mgv1a005831mg [Erythranthe guttata]
Length=468

 Score = 71.2 bits (173),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  233  LYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            L+  GLT++VDS++WR+LLWPE EVFWFNSVLNRSSEWG    H
Sbjct  192  LFCIGLTVLVDSILWRKLLWPELEVFWFNSVLNRSSEWGTHAFH  235


 Score = 30.0 bits (66),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L ++SISL KA++SC  TAL CIGL
Sbjct  173  LLSRSISLPKALLSCTVTALFCIGL  197



>ref|XP_007052355.1| Asparagine-linked glycosylation 12 isoform 2 [Theobroma cacao]
 gb|EOX96512.1| Asparagine-linked glycosylation 12 isoform 2 [Theobroma cacao]
Length=493

 Score = 73.2 bits (178),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            GLTI+VDS+MW+R LWPEFEVFWFNSVLNRSSEWG    H
Sbjct  220  GLTILVDSIMWKRFLWPEFEVFWFNSVLNRSSEWGTHSIH  259


 Score = 28.5 bits (62),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L TKSI+ WKA+  C   +L CIGL
Sbjct  197  LLTKSIAFWKALKCCIMISLLCIGL  221



>ref|XP_007052354.1| Asparagine-linked glycosylation 12 isoform 1 [Theobroma cacao]
 gb|EOX96511.1| Asparagine-linked glycosylation 12 isoform 1 [Theobroma cacao]
Length=558

 Score = 73.2 bits (178),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            GLTI+VDS+MW+R LWPEFEVFWFNSVLNRSSEWG    H
Sbjct  285  GLTILVDSIMWKRFLWPEFEVFWFNSVLNRSSEWGTHSIH  324


 Score = 28.1 bits (61),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L TKSI+ WKA+  C   +L CIGL
Sbjct  262  LLTKSIAFWKALKCCIMISLLCIGL  286



>ref|NP_001077447.2| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Arabidopsis thaliana]
 gb|ABF59127.1| unknown protein [Arabidopsis thaliana]
 gb|AEE27390.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Arabidopsis thaliana]
Length=332

 Score = 67.4 bits (163),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -1

Query  242  NAILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWG  117
               L   GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG
Sbjct  174  GTALLAVGLTIFVDSIMWKKFVWPEFEVFWFNSILNRSSDWG  215


 Score = 33.9 bits (76),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L TKSIS WKA+  C GTAL  +GL
Sbjct  158  LLTKSISFWKALKYCVGTALLAVGL  182



>ref|XP_006445446.1| hypothetical protein CICLE_v10019843mg [Citrus clementina]
 gb|ESR58686.1| hypothetical protein CICLE_v10019843mg [Citrus clementina]
Length=496

 Score = 70.1 bits (170),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  233  LYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            L   GLT++VDS+MW++L+WPEFEV WFNSVLNRSSEWG 
Sbjct  220  LLSVGLTVLVDSIMWKKLVWPEFEVLWFNSVLNRSSEWGT  259


 Score = 31.2 bits (69),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -3

Query  387  TKSISLWKAVISCFGTALCCIGL  319
            TKSISLWKA+  C G AL  +GL
Sbjct  203  TKSISLWKALKCCIGMALLSVGL  225



>gb|KFK42589.1| hypothetical protein AALP_AA1G015000 [Arabis alpina]
Length=432

 Score = 69.3 bits (168),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 46/70 (66%), Gaps = 9/70 (13%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH---------HILICACISLN  69
            GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG    H          +L+   +SL 
Sbjct  216  GLTIFVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTHSIHWYFTSALPRSLLVAYPLSLV  275

Query  68   YVLVDIYMPV  39
              L+D  +P+
Sbjct  276  GTLLDRRVPL  285


 Score = 32.0 bits (71),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L T+SIS WKA+  C GTA+  +GL
Sbjct  193  LLTRSISFWKALKYCVGTAVLAVGL  217



>emb|CDY38057.1| BnaCnng09180D [Brassica napus]
Length=482

 Score = 72.4 bits (176),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 54/83 (65%), Gaps = 13/83 (16%)
 Frame = -1

Query  224  AGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRHHILICA------CISLNY-  66
            AGLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG    H     A      CIS+N+ 
Sbjct  207  AGLTISVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTHSIHWYFTSALPRRSDCISINFS  266

Query  65   ----VLVDIYMPVHWHIYSVVSF  9
                +L+D  +P  + +  V+SF
Sbjct  267  HLFGILLDRRVP--FLVIPVISF  287


 Score = 28.5 bits (62),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -3

Query  387  TKSISLWKAVISCFGTALCCIGL  319
            TKSIS WK +  C GTA+   GL
Sbjct  187  TKSISFWKTLKYCVGTAVVTAGL  209



>gb|KJB24899.1| hypothetical protein B456_004G166900, partial [Gossypium raimondii]
Length=421

 Score = 72.8 bits (177),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            GLT++VDS+MW+R LWPEFEVFWFNSVLNRSSEWG 
Sbjct  240  GLTVLVDSIMWKRFLWPEFEVFWFNSVLNRSSEWGT  275


 Score = 28.1 bits (61),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -3

Query  387  TKSISLWKAVISCFGTALCCIGL  319
            TKSIS W+A   C  T L CIGL
Sbjct  219  TKSISFWRAFKCCTVTTLLCIGL  241



>ref|XP_009603143.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Nicotiana tomentosiformis]
Length=475

 Score = 71.2 bits (173),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            GLT++VDSV+WRRLLWPE EVFWFNSVLNRSSEWG 
Sbjct  199  GLTVLVDSVIWRRLLWPELEVFWFNSVLNRSSEWGT  234


 Score = 29.3 bits (64),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -3

Query  387  TKSISLWKAVISCFGTALCCIGL  319
            TKS+S WKA+ SC   A   IGL
Sbjct  178  TKSVSFWKALTSCLAAASLSIGL  200



>gb|KJB24901.1| hypothetical protein B456_004G166900, partial [Gossypium raimondii]
Length=513

 Score = 72.4 bits (176),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            GLT++VDS+MW+R LWPEFEVFWFNSVLNRSSEWG 
Sbjct  240  GLTVLVDSIMWKRFLWPEFEVFWFNSVLNRSSEWGT  275


 Score = 28.5 bits (62),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -3

Query  387  TKSISLWKAVISCFGTALCCIGL  319
            TKSIS W+A   C  T L CIGL
Sbjct  219  TKSISFWRAFKCCTVTTLLCIGL  241



>gb|KJB24902.1| hypothetical protein B456_004G166900, partial [Gossypium raimondii]
Length=454

 Score = 72.0 bits (175),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            GLT++VDS+MW+R LWPEFEVFWFNSVLNRSSEWG 
Sbjct  181  GLTVLVDSIMWKRFLWPEFEVFWFNSVLNRSSEWGT  216


 Score = 28.5 bits (62),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -3

Query  387  TKSISLWKAVISCFGTALCCIGL  319
            TKSIS W+A   C  T L CIGL
Sbjct  160  TKSISFWRAFKCCTVTTLLCIGL  182



>ref|XP_010692030.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Beta vulgaris subsp. vulgaris]
Length=494

 Score = 73.2 bits (178),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -1

Query  239  AILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            A +   GLT++VDS+MWRR+LWPEFEV WFNSVL+RSSEWGVS  H
Sbjct  217  AAILSIGLTVMVDSLMWRRVLWPEFEVLWFNSVLDRSSEWGVSPFH  262


 Score = 27.3 bits (59),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L T+S+SLWKA+  C   A+  IGL
Sbjct  200  LLTRSVSLWKAIKCCIVAAILSIGL  224



>ref|XP_006464407.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X1 [Citrus sinensis]
 gb|KDO85470.1| hypothetical protein CISIN_1g010929mg [Citrus sinensis]
Length=497

 Score = 70.9 bits (172),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  236  ILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            +L   GLT++VDS+MW++L+WPEFEV WFNSVLNRSSEWG 
Sbjct  220  VLLSVGLTVLVDSIMWKKLVWPEFEVLWFNSVLNRSSEWGT  260


 Score = 29.6 bits (65),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -3

Query  387  TKSISLWKAVISCFGTALCCIGL  319
            TKSISLWKA+  C G  L  +GL
Sbjct  204  TKSISLWKALKCCIGMVLLSVGL  226



>ref|XP_004307243.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Fragaria vesca subsp. vesca]
Length=496

 Score = 70.9 bits (172),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            GLT+ VDS+MWRR+LWPEFEV WFNSVLNRSSEWG    H
Sbjct  223  GLTVFVDSIMWRRVLWPEFEVLWFNSVLNRSSEWGTHPFH  262


 Score = 29.6 bits (65),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L T+SISLWKA+  C   AL CIGL
Sbjct  200  LLTRSISLWKALKYCTLCALLCIGL  224



>ref|XP_006464408.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X2 [Citrus sinensis]
 gb|KDO85469.1| hypothetical protein CISIN_1g010929mg [Citrus sinensis]
Length=496

 Score = 70.9 bits (172),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  236  ILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            +L   GLT++VDS+MW++L+WPEFEV WFNSVLNRSSEWG 
Sbjct  219  VLLSVGLTVLVDSIMWKKLVWPEFEVLWFNSVLNRSSEWGT  259


 Score = 29.6 bits (65),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -3

Query  387  TKSISLWKAVISCFGTALCCIGL  319
            TKSISLWKA+  C G  L  +GL
Sbjct  203  TKSISLWKALKCCIGMVLLSVGL  225



>ref|XP_004229733.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Solanum lycopersicum]
Length=499

 Score = 70.5 bits (171),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            GLT++VDSV+W+RLLWPE EVFWFNSVLNRSSEWG 
Sbjct  223  GLTVLVDSVIWKRLLWPELEVFWFNSVLNRSSEWGT  258


 Score = 29.6 bits (65),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L TKS+S WKA+ SC       IGL
Sbjct  200  LLTKSVSFWKALTSCLAATFLSIGL  224



>ref|XP_008460079.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X3 [Cucumis melo]
Length=384

 Score = 68.9 bits (167),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            GLT+ +DS++W++LLWPEF VFWFNSVLNRSSEWG    H
Sbjct  223  GLTVFIDSILWKKLLWPEFHVFWFNSVLNRSSEWGTHPMH  262


 Score = 31.6 bits (70),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L  KSIS W A+  C G AL CIGL
Sbjct  200  LVIKSISFWGALKRCIGVALLCIGL  224



>gb|KJB24900.1| hypothetical protein B456_004G166900 [Gossypium raimondii]
Length=432

 Score = 72.0 bits (175),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            GLT++VDS+MW+R LWPEFEVFWFNSVLNRSSEWG 
Sbjct  159  GLTVLVDSIMWKRFLWPEFEVFWFNSVLNRSSEWGT  194


 Score = 28.1 bits (61),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -3

Query  387  TKSISLWKAVISCFGTALCCIGL  319
            TKSIS W+A   C  T L CIGL
Sbjct  138  TKSISFWRAFKCCTVTTLLCIGL  160



>ref|XP_010325203.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Solanum lycopersicum]
 ref|XP_010325204.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Solanum lycopersicum]
Length=414

 Score = 70.1 bits (170),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -1

Query  239  AILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            A     GLT++VDSV+W+RLLWPE EVFWFNSVLNRSSEWG 
Sbjct  132  ATFLSIGLTVLVDSVIWKRLLWPELEVFWFNSVLNRSSEWGT  173


 Score = 29.6 bits (65),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L TKS+S WKA+ SC       IGL
Sbjct  115  LLTKSVSFWKALTSCLAATFLSIGL  139



>emb|CDY15127.1| BnaC05g00060D [Brassica napus]
Length=498

 Score = 67.4 bits (163),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG 
Sbjct  226  GLTISVDSIMWKKFVWPEFEVFWFNSILNRSSDWGT  261


 Score = 32.3 bits (72),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L T+SIS WKA+  C GTA+  +GL
Sbjct  203  LLTRSISFWKALKYCVGTAVVAVGL  227



>ref|XP_009119758.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Brassica rapa]
Length=472

 Score = 67.4 bits (163),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG 
Sbjct  222  GLTISVDSIMWKKFVWPEFEVFWFNSILNRSSDWGT  257


 Score = 32.3 bits (72),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L T+SIS WKA+  C GTA+  +GL
Sbjct  199  LLTRSISFWKALKYCVGTAVVAVGL  223



>emb|CDX90078.1| BnaA10g00040D [Brassica napus]
Length=495

 Score = 67.4 bits (163),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG 
Sbjct  223  GLTISVDSIMWKKFVWPEFEVFWFNSILNRSSDWGT  258


 Score = 32.3 bits (72),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L T+SIS WKA+  C GTA+  +GL
Sbjct  200  LLTRSISFWKALKYCVGTAVVAVGL  224



>ref|XP_009119757.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Brassica rapa]
Length=494

 Score = 67.4 bits (163),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG 
Sbjct  222  GLTISVDSIMWKKFVWPEFEVFWFNSILNRSSDWGT  257


 Score = 32.3 bits (72),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L T+SIS WKA+  C GTA+  +GL
Sbjct  199  LLTRSISFWKALKYCVGTAVVAVGL  223



>emb|CDP09422.1| unnamed protein product [Coffea canephora]
Length=421

 Score = 68.2 bits (165),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -1

Query  224  AGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
              LT++VDSVMWRR LWPE EVFWFNSVLNRSSEWG+
Sbjct  223  GSLTVLVDSVMWRRWLWPELEVFWFNSVLNRSSEWGI  259


 Score = 31.2 bits (69),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIG  322
            L +KSISLWKA+ +C    L CIG
Sbjct  200  LLSKSISLWKAIRTCIAATLFCIG  223



>ref|XP_008460077.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Cucumis melo]
Length=494

 Score = 68.2 bits (165),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            GLT+ +DS++W++LLWPEF VFWFNSVLNRSSEWG    H
Sbjct  223  GLTVFIDSILWKKLLWPEFHVFWFNSVLNRSSEWGTHPMH  262


 Score = 31.2 bits (69),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L  KSIS W A+  C G AL CIGL
Sbjct  200  LVIKSISFWGALKRCIGVALLCIGL  224



>ref|XP_009375362.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009375364.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Pyrus x bretschneideri]
Length=495

 Score = 74.7 bits (182),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            GLT++VDS+MW+RLLWPEFEVFWFNSVLNRSSEWG+
Sbjct  223  GLTVIVDSIMWKRLLWPEFEVFWFNSVLNRSSEWGI  258


 Score = 24.6 bits (52),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -3

Query  387  TKSISLWKAVISCFGTALCCIGL  319
            T+ ISLWKA+  C   A+ C+GL
Sbjct  202  TRRISLWKALKCCSLCAVLCVGL  224



>ref|XP_008460078.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Cucumis melo]
Length=473

 Score = 68.2 bits (165),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            GLT+ +DS++W++LLWPEF VFWFNSVLNRSSEWG    H
Sbjct  202  GLTVFIDSILWKKLLWPEFHVFWFNSVLNRSSEWGTHPMH  241


 Score = 31.2 bits (69),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L  KSIS W A+  C G AL CIGL
Sbjct  179  LVIKSISFWGALKRCIGVALLCIGL  203



>ref|XP_009375365.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Pyrus x bretschneideri]
Length=494

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -1

Query  224  AGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            +GLT++VDS+MW+RLLWPEFEVFWFNSVLNRSSEWG+
Sbjct  221  SGLTVIVDSIMWKRLLWPEFEVFWFNSVLNRSSEWGI  257



>ref|XP_008375733.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Malus domestica]
Length=494

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -1

Query  224  AGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            +GLT++VDS+MW+RLLWPEFEVFWFNSVLNRSSEWG+
Sbjct  221  SGLTVIVDSIMWKRLLWPEFEVFWFNSVLNRSSEWGI  257



>ref|XP_008232378.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Prunus mume]
 ref|XP_008232379.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Prunus mume]
Length=496

 Score = 73.6 bits (179),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            GLT++VDS+MW+RLLWPEFEVFWFNSVLNRSSEWG 
Sbjct  223  GLTVLVDSIMWKRLLWPEFEVFWFNSVLNRSSEWGT  258


 Score = 25.4 bits (54),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -3

Query  387  TKSISLWKAVISCFGTALCCIGL  319
            T+ ISLWKA+  C   A+ CIGL
Sbjct  202  TRRISLWKALKCCSLCAILCIGL  224



>ref|XP_004160680.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
[Cucumis sativus]
Length=494

 Score = 68.2 bits (165),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            GLT+ +DS++W++LLWPEF VFWFNSVLNRSSEWG    H
Sbjct  223  GLTVFIDSILWKKLLWPEFHVFWFNSVLNRSSEWGTHPMH  262


 Score = 30.4 bits (67),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L  KSIS W A+  C G AL CIGL
Sbjct  200  LVIKSISFWGALKRCTGVALLCIGL  224



>ref|XP_004145015.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
[Cucumis sativus]
 ref|XP_004154129.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
[Cucumis sativus]
Length=494

 Score = 68.2 bits (165),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            GLT+ +DS++W++LLWPEF VFWFNSVLNRSSEWG    H
Sbjct  223  GLTVFIDSILWKKLLWPEFHVFWFNSVLNRSSEWGTHPMH  262


 Score = 30.4 bits (67),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L  KSIS W A+  C G AL CIGL
Sbjct  200  LVIKSISFWGALKRCTGVALLCIGL  224



>ref|XP_010540209.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Tarenaya hassleriana]
Length=501

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  242  NAILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
             A +   GLTI VDS+MWRR +WPEFEVFWFNS+LNRSSEWG S  H
Sbjct  221  GAAVLSTGLTIFVDSIMWRRFVWPEFEVFWFNSILNRSSEWGTSPIH  267



>ref|XP_011017393.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X3 [Populus euphratica]
Length=499

 Score = 71.2 bits (173),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            G TI+VDS+MW+R LWPEFEVFWFNSVLNRSSEWG 
Sbjct  223  GFTIMVDSIMWKRKLWPEFEVFWFNSVLNRSSEWGT  258


 Score = 27.3 bits (59),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 14/23 (61%), Gaps = 0/23 (0%)
 Frame = -3

Query  387  TKSISLWKAVISCFGTALCCIGL  319
            TKSIS W A+  C G AL  IG 
Sbjct  202  TKSISSWGAIKYCIGPALLSIGF  224



>ref|XP_010540210.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Tarenaya hassleriana]
Length=500

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  242  NAILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
             A +   GLTI VDS+MWRR +WPEFEVFWFNS+LNRSSEWG S  H
Sbjct  220  GAAVLSTGLTIFVDSIMWRRFVWPEFEVFWFNSILNRSSEWGTSPIH  266



>ref|XP_011017394.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X4 [Populus euphratica]
Length=495

 Score = 71.2 bits (173),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            G TI+VDS+MW+R LWPEFEVFWFNSVLNRSSEWG 
Sbjct  223  GFTIMVDSIMWKRKLWPEFEVFWFNSVLNRSSEWGT  258


 Score = 27.3 bits (59),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 14/23 (61%), Gaps = 0/23 (0%)
 Frame = -3

Query  387  TKSISLWKAVISCFGTALCCIGL  319
            TKSIS W A+  C G AL  IG 
Sbjct  202  TKSISSWGAIKYCIGPALLSIGF  224



>ref|XP_008375731.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Malus domestica]
 ref|XP_008375732.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Malus domestica]
Length=495

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            GLT++VDS+MW+RLLWPEFEVFWFNSVLNRSSEWG+
Sbjct  223  GLTVIVDSIMWKRLLWPEFEVFWFNSVLNRSSEWGI  258



>ref|XP_011017391.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Populus euphratica]
Length=522

 Score = 71.2 bits (173),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            G TI+VDS+MW+R LWPEFEVFWFNSVLNRSSEWG 
Sbjct  223  GFTIMVDSIMWKRKLWPEFEVFWFNSVLNRSSEWGT  258


 Score = 26.9 bits (58),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 14/23 (61%), Gaps = 0/23 (0%)
 Frame = -3

Query  387  TKSISLWKAVISCFGTALCCIGL  319
            TKSIS W A+  C G AL  IG 
Sbjct  202  TKSISSWGAIKYCIGPALLSIGF  224



>ref|XP_011017392.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Populus euphratica]
Length=518

 Score = 71.2 bits (173),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            G TI+VDS+MW+R LWPEFEVFWFNSVLNRSSEWG 
Sbjct  223  GFTIMVDSIMWKRKLWPEFEVFWFNSVLNRSSEWGT  258


 Score = 26.9 bits (58),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 14/23 (61%), Gaps = 0/23 (0%)
 Frame = -3

Query  387  TKSISLWKAVISCFGTALCCIGL  319
            TKSIS W A+  C G AL  IG 
Sbjct  202  TKSISSWGAIKYCIGPALLSIGF  224



>ref|XP_006583508.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X1 [Glycine max]
Length=394

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  245  SNAILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            +   L+  GLTI+VDS+MW+RLLWPEFEVFWFNSVLN+SSEWG 
Sbjct  114  TGMALFCIGLTILVDSIMWKRLLWPEFEVFWFNSVLNKSSEWGT  157



>ref|XP_010496471.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Camelina sativa]
Length=505

 Score = 65.9 bits (159),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -1

Query  242  NAILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
               L   GL+I VDS+MW++ +WPEF+VFWFNS+LNRSS+WG 
Sbjct  225  GTTLLAVGLSIFVDSIMWKKFVWPEFDVFWFNSILNRSSDWGT  267


 Score = 31.6 bits (70),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L T+SIS WKA+  C GT L  +GL
Sbjct  209  LLTRSISFWKALKYCVGTTLLAVGL  233



>ref|XP_010496472.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Camelina sativa]
Length=500

 Score = 65.9 bits (159),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -1

Query  242  NAILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
               L   GL+I VDS+MW++ +WPEF+VFWFNS+LNRSS+WG 
Sbjct  220  GTTLLAVGLSIFVDSIMWKKFVWPEFDVFWFNSILNRSSDWGT  262


 Score = 31.6 bits (70),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L T+SIS WKA+  C GT L  +GL
Sbjct  204  LLTRSISFWKALKYCVGTTLLAVGL  228



>ref|XP_006583509.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X2 [Glycine max]
Length=497

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -1

Query  245  SNAILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            +   L+  GLTI+VDS+MW+RLLWPEFEVFWFNSVLN+SSEWG    H
Sbjct  217  TGMALFCIGLTILVDSIMWKRLLWPEFEVFWFNSVLNKSSEWGTHAFH  264



>ref|XP_010496473.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X3 [Camelina sativa]
Length=459

 Score = 65.5 bits (158),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -1

Query  242  NAILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
               L   GL+I VDS+MW++ +WPEF+VFWFNS+LNRSS+WG 
Sbjct  179  GTTLLAVGLSIFVDSIMWKKFVWPEFDVFWFNSILNRSSDWGT  221


 Score = 31.6 bits (70),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L T+SIS WKA+  C GT L  +GL
Sbjct  163  LLTRSISFWKALKYCVGTTLLAVGL  187



>ref|XP_010246099.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Nelumbo nucifera]
Length=500

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  233  LYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWG  117
            L+  GLT++VD+VMWRRL+WPEFEVFWFNSV+NRSSEWG
Sbjct  219  LFCIGLTVMVDTVMWRRLVWPEFEVFWFNSVMNRSSEWG  257



>ref|XP_003636166.1| Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase 
[Medicago truncatula]
Length=412

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            G+TI++DS+MW+RLLWPEFEVFWFNSVLN+SSEWG    H
Sbjct  247  GITILIDSIMWKRLLWPEFEVFWFNSVLNKSSEWGTHAFH  286



>ref|XP_010246100.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Nelumbo nucifera]
Length=489

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  233  LYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWG  117
            L+  GLT++VD+VMWRRL+WPEFEVFWFNSV+NRSSEWG
Sbjct  208  LFCIGLTVMVDTVMWRRLVWPEFEVFWFNSVMNRSSEWG  246



>ref|XP_002448266.1| hypothetical protein SORBIDRAFT_06g024210 [Sorghum bicolor]
 gb|EES12594.1| hypothetical protein SORBIDRAFT_06g024210 [Sorghum bicolor]
Length=500

 Score = 69.3 bits (168),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            G T++VDS+MWRR+LWPEF+V WFNSVLNRSSEWG    H
Sbjct  230  GFTMLVDSIMWRRILWPEFQVLWFNSVLNRSSEWGTHSVH  269


 Score = 26.9 bits (58),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -3

Query  387  TKSISLWKAVISCFGTALCCIGL  319
            ++S+SL +AV  C  TAL CIG 
Sbjct  209  SRSVSLLEAVKYCISTALICIGF  231



>gb|KEH17914.1| Alg9-like mannosyltransferase family protein [Medicago truncatula]
Length=494

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            G+TI++DS+MW+RLLWPEFEVFWFNSVLN+SSEWG    H
Sbjct  222  GITILIDSIMWKRLLWPEFEVFWFNSVLNKSSEWGTHAFH  261



>ref|XP_006347991.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X4 [Solanum tuberosum]
Length=370

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            GLT++VDSV+W+RLLWPE EVFWFNSVLNRSSEWG    H
Sbjct  223  GLTVLVDSVIWKRLLWPELEVFWFNSVLNRSSEWGTHPFH  262



>ref|XP_010496687.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X4 [Camelina sativa]
Length=431

 Score = 67.0 bits (162),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            GLTI VDS+MW++ +WPEF+VFWFNS+LNRSS+WG    H
Sbjct  232  GLTIFVDSIMWKKFVWPEFDVFWFNSILNRSSDWGTHSVH  271


 Score = 28.5 bits (62),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L T+SIS WKA+  C  T L  +GL
Sbjct  209  LLTRSISFWKALKYCVATTLLALGL  233



>ref|XP_009118862.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X1 [Brassica rapa]
Length=491

 Score = 71.6 bits (174),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 53/81 (65%), Gaps = 11/81 (14%)
 Frame = -1

Query  224  AGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH---------HILICACISL  72
            AGLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG    H          +L+   +SL
Sbjct  218  AGLTISVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTHSIHWYFTSALPRSLLVAYPLSL  277

Query  71   NYVLVDIYMPVHWHIYSVVSF  9
              +L+D  +P  + +  V+SF
Sbjct  278  FGILLDRRVP--FLVIPVISF  296


 Score = 23.9 bits (50),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L T+SIS  K +  C GTA+   GL
Sbjct  196  LLTRSISFLKTLKYCVGTAVVAAGL  220



>ref|XP_002271419.2| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Vitis vinifera]
Length=496

 Score = 67.4 bits (163),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            GLT +VD++MW++L+WPEFEV WFNSVLNRSSEWG    H
Sbjct  223  GLTTLVDTIMWKKLVWPEFEVLWFNSVLNRSSEWGTHSFH  262


 Score = 28.1 bits (61),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -3

Query  387  TKSISLWKAVISCFGTALCCIGL  319
            TKSISLW+++     TAL CIGL
Sbjct  202  TKSISLWESLKCGISTALLCIGL  224



>ref|XP_009118864.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X3 [Brassica rapa]
Length=413

 Score = 71.6 bits (174),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 53/81 (65%), Gaps = 11/81 (14%)
 Frame = -1

Query  224  AGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH---------HILICACISL  72
            AGLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG    H          +L+   +SL
Sbjct  218  AGLTISVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTHSIHWYFTSALPRSLLVAYPLSL  277

Query  71   NYVLVDIYMPVHWHIYSVVSF  9
              +L+D  +P  + +  V+SF
Sbjct  278  FGILLDRRVP--FLVIPVISF  296


 Score = 23.9 bits (50),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L T+SIS  K +  C GTA+   GL
Sbjct  196  LLTRSISFLKTLKYCVGTAVVAAGL  220



>ref|XP_010496685.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X2 [Camelina sativa]
Length=501

 Score = 66.6 bits (161),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            GLTI VDS+MW++ +WPEF+VFWFNS+LNRSS+WG    H
Sbjct  227  GLTIFVDSIMWKKFVWPEFDVFWFNSILNRSSDWGTHSVH  266


 Score = 28.9 bits (63),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L T+SIS WKA+  C  T L  +GL
Sbjct  204  LLTRSISFWKALKYCVATTLLALGL  228



>ref|XP_010496684.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X1 [Camelina sativa]
Length=506

 Score = 66.6 bits (161),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            GLTI VDS+MW++ +WPEF+VFWFNS+LNRSS+WG    H
Sbjct  232  GLTIFVDSIMWKKFVWPEFDVFWFNSILNRSSDWGTHSVH  271


 Score = 28.9 bits (63),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L T+SIS WKA+  C  T L  +GL
Sbjct  209  LLTRSISFWKALKYCVATTLLALGL  233



>emb|CBI16681.3| unnamed protein product [Vitis vinifera]
Length=469

 Score = 67.4 bits (163),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            GLT +VD++MW++L+WPEFEV WFNSVLNRSSEWG    H
Sbjct  196  GLTTLVDTIMWKKLVWPEFEVLWFNSVLNRSSEWGTHSFH  235


 Score = 28.1 bits (61),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -3

Query  387  TKSISLWKAVISCFGTALCCIGL  319
            TKSISLW+++     TAL CIGL
Sbjct  175  TKSISLWESLKCGISTALLCIGL  197



>ref|XP_003580264.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Brachypodium distachyon]
Length=498

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            G T++VDS+MW+R+LWPEFEVFWFNSVLNRSSEWG 
Sbjct  228  GFTVLVDSIMWQRILWPEFEVFWFNSVLNRSSEWGT  263



>ref|XP_003491108.1| PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
[Bombus impatiens]
Length=948

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 46/68 (68%), Gaps = 3/68 (4%)
 Frame = -1

Query  239  AILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLN  69
            A ++   LTI VDS+ WRRLLWPE EVF+FN++LN+SSEWG S   W  +  +   + L+
Sbjct  204  AGIFFLTLTITVDSIFWRRLLWPEGEVFYFNTILNKSSEWGTSPFLWYFYSALPRGLGLS  263

Query  68   YVLVDIYM  45
            Y L+ + M
Sbjct  264  YFLIPLGM  271



>ref|XP_004515328.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X1 [Cicer arietinum]
Length=533

 Score = 68.9 bits (167),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            G+T +VDS+MW+R LWPEFEVFWFNSVLN+SSEWG    H
Sbjct  261  GITSLVDSIMWKRFLWPEFEVFWFNSVLNKSSEWGTHAFH  300


 Score = 26.2 bits (56),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -3

Query  387  TKSISLWKAVISCFGTALCCIGL  319
            T+ IS+W A+  C G A  C+G+
Sbjct  240  TRKISVWGALKHCTGMAFFCVGI  262



>ref|XP_004515329.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X2 [Cicer arietinum]
Length=531

 Score = 68.9 bits (167),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            G+T +VDS+MW+R LWPEFEVFWFNSVLN+SSEWG    H
Sbjct  261  GITSLVDSIMWKRFLWPEFEVFWFNSVLNKSSEWGTHAFH  300


 Score = 26.2 bits (56),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -3

Query  387  TKSISLWKAVISCFGTALCCIGL  319
            T+ IS+W A+  C G A  C+G+
Sbjct  240  TRKISVWGALKHCTGMAFFCVGI  262



>ref|XP_006652601.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
[Oryza brachyantha]
Length=466

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            G T++VDS+MWRR+LWPEFEV WFNSVLNRSSEWG 
Sbjct  196  GFTVLVDSIMWRRILWPEFEVLWFNSVLNRSSEWGT  231



>ref|XP_008786178.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Phoenix dactylifera]
Length=515

 Score = 67.0 bits (162),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -1

Query  239  AILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            A L   G T+++D+VMW+R++WPE EVFWFNS+LNRSSEWG 
Sbjct  237  AALLSIGFTVLLDTVMWQRIVWPELEVFWFNSILNRSSEWGT  278


 Score = 28.1 bits (61),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L +KSISLWKA+  C   AL  IG 
Sbjct  220  LLSKSISLWKAMKCCIAAALLSIGF  244



>ref|XP_008786179.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X3 [Phoenix dactylifera]
Length=506

 Score = 67.0 bits (162),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -1

Query  239  AILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            A L   G T+++D+VMW+R++WPE EVFWFNS+LNRSSEWG 
Sbjct  228  AALLSIGFTVLLDTVMWQRIVWPELEVFWFNSILNRSSEWGT  269


 Score = 27.7 bits (60),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L +KSISLWKA+  C   AL  IG 
Sbjct  211  LLSKSISLWKAMKCCIAAALLSIGF  235



>ref|XP_008786180.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X4 [Phoenix dactylifera]
Length=503

 Score = 67.0 bits (162),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -1

Query  239  AILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            A L   G T+++D+VMW+R++WPE EVFWFNS+LNRSSEWG 
Sbjct  225  AALLSIGFTVLLDTVMWQRIVWPELEVFWFNSILNRSSEWGT  266


 Score = 28.1 bits (61),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L +KSISLWKA+  C   AL  IG 
Sbjct  208  LLSKSISLWKAMKCCIAAALLSIGF  232



>ref|XP_008786181.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X5 [Phoenix dactylifera]
Length=502

 Score = 67.0 bits (162),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -1

Query  239  AILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            A L   G T+++D+VMW+R++WPE EVFWFNS+LNRSSEWG 
Sbjct  224  AALLSIGFTVLLDTVMWQRIVWPELEVFWFNSILNRSSEWGT  265


 Score = 28.1 bits (61),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L +KSISLWKA+  C   AL  IG 
Sbjct  207  LLSKSISLWKAMKCCIAAALLSIGF  231



>ref|XP_010496686.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X3 [Camelina sativa]
Length=460

 Score = 66.2 bits (160),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            GLTI VDS+MW++ +WPEF+VFWFNS+LNRSS+WG    H
Sbjct  186  GLTIFVDSIMWKKFVWPEFDVFWFNSILNRSSDWGTHSVH  225


 Score = 28.9 bits (63),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L T+SIS WKA+  C  T L  +GL
Sbjct  163  LLTRSISFWKALKYCVATTLLALGL  187



>ref|XP_008786177.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Phoenix dactylifera]
Length=519

 Score = 67.0 bits (162),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -1

Query  239  AILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            A L   G T+++D+VMW+R++WPE EVFWFNS+LNRSSEWG 
Sbjct  241  AALLSIGFTVLLDTVMWQRIVWPELEVFWFNSILNRSSEWGT  282


 Score = 27.7 bits (60),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L +KSISLWKA+  C   AL  IG 
Sbjct  224  LLSKSISLWKAMKCCIAAALLSIGF  248



>ref|XP_006347988.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X1 [Solanum tuberosum]
Length=499

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            GLT++VDSV+W+RLLWPE EVFWFNSVLNRSSEWG    H
Sbjct  223  GLTVLVDSVIWKRLLWPELEVFWFNSVLNRSSEWGTHPFH  262



>ref|XP_008786182.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X6 [Phoenix dactylifera]
Length=412

 Score = 67.0 bits (162),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -1

Query  239  AILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            A L   G T+++D+VMW+R++WPE EVFWFNS+LNRSSEWG 
Sbjct  134  AALLSIGFTVLLDTVMWQRIVWPELEVFWFNSILNRSSEWGT  175


 Score = 27.7 bits (60),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCIGL  319
            L +KSISLWKA+  C   AL  IG 
Sbjct  117  LLSKSISLWKAMKCCIAAALLSIGF  141



>ref|XP_006347989.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006347990.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X3 [Solanum tuberosum]
Length=414

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            GLT++VDSV+W+RLLWPE EVFWFNSVLNRSSEWG    H
Sbjct  138  GLTVLVDSVIWKRLLWPELEVFWFNSVLNRSSEWGTHPFH  177



>ref|XP_003402011.1| PREDICTED: hypothetical protein LOC100650099 [Bombus terrestris]
Length=1038

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/68 (47%), Positives = 46/68 (68%), Gaps = 3/68 (4%)
 Frame = -1

Query  239  AILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLN  69
            A ++   LTI +DS+ WRRLLWPE EVF+FN++LN+SSEWG S   W  +  +   + L+
Sbjct  204  AGIFFLTLTITIDSIFWRRLLWPEGEVFYFNTILNKSSEWGTSPFLWYFYSALPRGLGLS  263

Query  68   YVLVDIYM  45
            Y L+ + M
Sbjct  264  YFLIPLGM  271



>gb|KDP28876.1| hypothetical protein JCGZ_14647 [Jatropha curcas]
Length=500

 Score = 69.7 bits (169),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -1

Query  233  LYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            L   GLTI+VDS+MW+R  WPEFEV WFNSVLNRSSEWG 
Sbjct  219  LLSVGLTILVDSIMWKRFTWPEFEVLWFNSVLNRSSEWGT  258


 Score = 24.6 bits (52),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -3

Query  387  TKSISLWKAVISCFGTALCCIGL  319
            T+SISL +A+  C G AL  +GL
Sbjct  202  TRSISLSEAIKYCTGIALLSVGL  224



>ref|XP_004956421.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X1 [Setaria italica]
Length=501

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            G T+++DS+MWRR+LWPEFEV WFNSVLNRSSEWG 
Sbjct  231  GFTVLIDSIMWRRILWPEFEVLWFNSVLNRSSEWGT  266



>ref|XP_004956422.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X2 [Setaria italica]
Length=475

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            G T+++DS+MWRR+LWPEFEV WFNSVLNRSSEWG 
Sbjct  231  GFTVLIDSIMWRRILWPEFEVLWFNSVLNRSSEWGT  266



>gb|KCW73099.1| hypothetical protein EUGRSUZ_E015451, partial [Eucalyptus grandis]
 gb|KCW73100.1| hypothetical protein EUGRSUZ_E015451, partial [Eucalyptus grandis]
Length=332

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  233  LYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            L + G+T  VDS MW+R+LWPEFEVFWFNSVLNRSSEWG 
Sbjct  219  LLYVGVTTFVDSFMWKRILWPEFEVFWFNSVLNRSSEWGT  258



>ref|XP_003700215.1| PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
[Megachile rotundata]
Length=930

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 47/68 (69%), Gaps = 3/68 (4%)
 Frame = -1

Query  239  AILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLN  69
            A L+   LT+++DS+ WRRL+WPE EVF+FN+VLN+SSEWG S   W  +  +   + L+
Sbjct  204  AGLFFLTLTVMIDSIFWRRLVWPEGEVFYFNTVLNKSSEWGTSPFLWYFYSALPRGLVLS  263

Query  68   YVLVDIYM  45
            Y LV + M
Sbjct  264  YFLVPLGM  271



>gb|EPS65150.1| hypothetical protein M569_09628, partial [Genlisea aurea]
Length=407

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  245  SNAILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            + A L   GLT  +DSV+WR+LLWPE EVFWFNSVLNRSSEWG 
Sbjct  203  AAASLLSIGLTTTIDSVLWRKLLWPELEVFWFNSVLNRSSEWGT  246



>ref|XP_002526470.1| glycosyltransferase, putative [Ricinus communis]
 gb|EEF35861.1| glycosyltransferase, putative [Ricinus communis]
Length=608

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  245  SNAILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            S   L   GLTI+VDS+MW + +WPEFEVFWFNSVLNRSSEWG 
Sbjct  333  SGITLLSIGLTILVDSIMWEKKIWPEFEVFWFNSVLNRSSEWGT  376



>ref|XP_010056387.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X4 [Eucalyptus grandis]
 ref|XP_010056388.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X4 [Eucalyptus grandis]
Length=366

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  233  LYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            L + G+T  VDS MW+R+LWPEFEVFWFNSVLNRSSEWG 
Sbjct  219  LLYVGVTTFVDSFMWKRILWPEFEVFWFNSVLNRSSEWGT  258



>ref|XP_002969331.1| mannosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ29419.1| mannosyltransferase-like protein [Selaginella moellendorffii]
Length=485

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -1

Query  239  AILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            A +  AGLT  VDS++WRR +WPE+EVFWFNSVLNRSSEWGVS  H
Sbjct  175  AAIVSAGLTFAVDSILWRRWVWPEWEVFWFNSVLNRSSEWGVSPFH  220



>gb|EFN68776.1| Probable dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1, 
6-mannosyltransferase [Camponotus floridanus]
Length=948

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = -1

Query  218  LTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDIY  48
            LT+ VDS+ WRRL+WPE EVF+FN++LN+SSEWG S   W  +  +   ++L+Y LV + 
Sbjct  201  LTVAVDSIFWRRLVWPEGEVFYFNAILNKSSEWGTSPFLWYFYSALPRGLALSYFLVPVG  260

Query  47   M  45
            M
Sbjct  261  M  261



>ref|XP_010056385.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X3 [Eucalyptus grandis]
Length=411

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  233  LYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            L + G+T  VDS MW+R+LWPEFEVFWFNSVLNRSSEWG 
Sbjct  134  LLYVGVTTFVDSFMWKRILWPEFEVFWFNSVLNRSSEWGT  173



>ref|XP_011255575.1| PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Camponotus floridanus]
Length=958

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = -1

Query  218  LTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDIY  48
            LT+ VDS+ WRRL+WPE EVF+FN++LN+SSEWG S   W  +  +   ++L+Y LV + 
Sbjct  211  LTVAVDSIFWRRLVWPEGEVFYFNAILNKSSEWGTSPFLWYFYSALPRGLALSYFLVPVG  270

Query  47   M  45
            M
Sbjct  271  M  271



>ref|XP_010056384.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Eucalyptus grandis]
Length=495

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  233  LYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            L + G+T  VDS MW+R+LWPEFEVFWFNSVLNRSSEWG 
Sbjct  219  LLYVGVTTFVDSFMWKRILWPEFEVFWFNSVLNRSSEWGT  258



>ref|XP_010056383.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Eucalyptus grandis]
Length=496

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  233  LYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            L + G+T  VDS MW+R+LWPEFEVFWFNSVLNRSSEWG 
Sbjct  219  LLYVGVTTFVDSFMWKRILWPEFEVFWFNSVLNRSSEWGT  258



>ref|XP_009118863.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X2 [Brassica rapa]
Length=462

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%), Gaps = 11/80 (14%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH---------HILICACISLN  69
            GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG    H          +L+   +SL 
Sbjct  190  GLTISVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTHSIHWYFTSALPRSLLVAYPLSLF  249

Query  68   YVLVDIYMPVHWHIYSVVSF  9
             +L+D  +P  + +  V+SF
Sbjct  250  GILLDRRVP--FLVIPVISF  267



>tpg|DAA36629.1| TPA: hypothetical protein ZEAMMB73_968947 [Zea mays]
Length=426

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            G T+++DS+MWRR+LWPEF+V WFNSVLNRSSEWG    H
Sbjct  228  GFTVLIDSIMWRRILWPEFQVLWFNSVLNRSSEWGTHSIH  267



>ref|XP_008667967.1| PREDICTED: dolichyl-P-Man Man isoform X1 [Zea mays]
Length=436

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            G T+++DS+MWRR+LWPEF+V WFNSVLNRSSEWG    H
Sbjct  228  GFTVLIDSIMWRRILWPEFQVLWFNSVLNRSSEWGTHSIH  267



>tpg|DAA36628.1| TPA: hypothetical protein ZEAMMB73_968947 [Zea mays]
Length=474

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            G T+++DS+MWRR+LWPEF+V WFNSVLNRSSEWG 
Sbjct  204  GFTVLIDSIMWRRILWPEFQVLWFNSVLNRSSEWGT  239



>ref|NP_001053463.1| Os04g0544900 [Oryza sativa Japonica Group]
 emb|CAE04348.2| OSJNBb0038F03.12 [Oryza sativa Japonica Group]
 dbj|BAF15377.1| Os04g0544900 [Oryza sativa Japonica Group]
 emb|CAH67249.1| OSIGBa0101C23.1 [Oryza sativa Indica Group]
 gb|EEC77738.1| hypothetical protein OsI_16854 [Oryza sativa Indica Group]
 gb|EEE61433.1| hypothetical protein OsJ_15658 [Oryza sativa Japonica Group]
Length=497

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            G T++VDS++WRR+LWPEFEV WFNSVLNRSSEWG 
Sbjct  227  GFTVLVDSILWRRILWPEFEVLWFNSVLNRSSEWGT  262



>tpg|DAA36630.1| TPA: dolichyl-P-Man Man [Zea mays]
Length=498

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            G T+++DS+MWRR+LWPEF+V WFNSVLNRSSEWG    H
Sbjct  228  GFTVLIDSIMWRRILWPEFQVLWFNSVLNRSSEWGTHSIH  267



>ref|XP_006617369.1| PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
[Apis dorsata]
Length=959

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 46/68 (68%), Gaps = 3/68 (4%)
 Frame = -1

Query  239  AILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLN  69
            A ++   LTI +DS+ W+RLLWPE EVF+FN++LN+SSEWG S   W  +  +   ++ +
Sbjct  204  AGIFFLTLTIAIDSIFWKRLLWPEGEVFYFNTILNKSSEWGTSPFLWYFYSALPRGLAFS  263

Query  68   YVLVDIYM  45
            Y L+ + M
Sbjct  264  YFLIPLGM  271



>ref|XP_011349260.1| PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Cerapachys biroi]
 gb|EZA47769.1| putative dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1, 
6-mannosyltransferase [Cerapachys biroi]
Length=1043

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 31/78 (40%), Positives = 49/78 (63%), Gaps = 5/78 (6%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLV--  57
             LT+  DS+ WRRL+WPE EVF+FN++LN+SSEWG S   W  +  +   ++L+Y L+  
Sbjct  210  ALTVATDSIFWRRLVWPEGEVFYFNAILNKSSEWGTSPFLWYFYSALPRGLALSYFLIPL  269

Query  56   DIYMPVHWHIYSVVSFAF  3
             I++     + +V +  F
Sbjct  270  GIFLDARVRVLTVPAITF  287



>ref|XP_006838582.1| hypothetical protein AMTR_s00002p00214180 [Amborella trichopoda]
 gb|ERN01151.1| hypothetical protein AMTR_s00002p00214180 [Amborella trichopoda]
Length=508

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            G TI+VDS MWRR+LWPE EVFWFNSVLNRSSEWG 
Sbjct  235  GCTILVDSFMWRRILWPEMEVFWFNSVLNRSSEWGT  270



>ref|XP_011153544.1| PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Harpegnathos saltator]
 gb|EFN75071.1| Probable dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1, 
6-mannosyltransferase [Harpegnathos saltator]
Length=1081

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 32/68 (47%), Positives = 47/68 (69%), Gaps = 4/68 (6%)
 Frame = -1

Query  239  AILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLN  69
             IL+ A LTI  DS+ WRRL+WPE EVF+FN++LN+SS+WG S   W  +  +   ++L+
Sbjct  205  GILFLA-LTIATDSIFWRRLVWPEGEVFYFNAILNKSSDWGTSPFLWYFYSALPRGLALS  263

Query  68   YVLVDIYM  45
            Y L+ + M
Sbjct  264  YFLIPLGM  271



>ref|XP_010479311.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
[Camelina sativa]
Length=493

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 4/73 (5%)
 Frame = -1

Query  320  CEMHSGLGILSRDSLL----DFVVAVFI*SNAILYHAGLTIVVDSVMWRRLLWPEFEVFW  153
            C+M   LG +  + LL     F  A+       L   GLTI+VDS+MW++ +WPEF+VFW
Sbjct  183  CDMMLLLGPIGLELLLTRSISFWKALKYCVRTTLLAVGLTILVDSIMWKKFVWPEFDVFW  242

Query  152  FNSVLNRSSEWGV  114
            FNS+LNRSS+WG 
Sbjct  243  FNSILNRSSDWGT  255



>ref|XP_011163791.1| PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Solenopsis invicta]
Length=1054

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
             LTI  DS+ WRRL+WPE EVF+FN++LN+SSEWG S   W  +  +   ++L+Y LV  
Sbjct  298  ALTIATDSIFWRRLVWPEGEVFYFNTILNKSSEWGTSPFLWYFYSALPRGLALSYFLVPF  357

Query  50   YM  45
             M
Sbjct  358  GM  359



>ref|XP_003689857.1| PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
[Apis florea]
Length=880

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 46/68 (68%), Gaps = 3/68 (4%)
 Frame = -1

Query  239  AILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLN  69
            A ++   LTI +DS+ W+RLLWPE EVF+FN++LN+SSEWG S   W  +  +   ++ +
Sbjct  204  AGIFFLTLTIAIDSIFWKRLLWPEGEVFYFNTILNKSSEWGTSPFLWYFYSALPRGLAFS  263

Query  68   YVLVDIYM  45
            Y L+ + M
Sbjct  264  YFLIPLGM  271



>ref|XP_008205527.1| PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Nasonia vitripennis]
Length=992

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
            GLTI VDS  W+R LWPE EV +FN++LN+SSEWG S   W  +  +   ++L+Y LV +
Sbjct  202  GLTITVDSYFWKRALWPEGEVLYFNTILNKSSEWGTSPFLWYFYSALPRGMALSYFLVPL  261

Query  50   YM  45
             M
Sbjct  262  GM  263



>ref|NP_001148825.1| dolichyl-P-Man Man [Zea mays]
 gb|ACG33037.1| dolichyl-P-Man Man [Zea mays]
Length=498

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            G T+++DS+MWRR+LWPEF+V WFNSVLN+SSEWG    H
Sbjct  228  GFTVLIDSIMWRRILWPEFQVLWFNSVLNQSSEWGTHSIH  267



>gb|AJC98491.1| AGAP000102 [Anopheles coluzzii]
Length=720

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
             LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V +
Sbjct  210  ALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVPL  269

Query  50   YMPVHWHIYSVV  15
             + +   I S+V
Sbjct  270  GLYLETRIRSLV  281



>ref|XP_006557963.1| PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X3 [Apis mellifera]
Length=873

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 29/68 (43%), Positives = 45/68 (66%), Gaps = 3/68 (4%)
 Frame = -1

Query  239  AILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLN  69
            A ++   LT  +DS+ W+RLLWPE EVF+FN++LN+SSEWG S   W  +  +   ++ +
Sbjct  73   AGIFFLTLTTAIDSIFWKRLLWPEGEVFYFNTILNKSSEWGTSPFLWYFYSALPRGLAFS  132

Query  68   YVLVDIYM  45
            Y L+ + M
Sbjct  133  YFLIPLGM  140



>ref|XP_006557961.1| PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X1 [Apis mellifera]
Length=1004

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 29/68 (43%), Positives = 45/68 (66%), Gaps = 3/68 (4%)
 Frame = -1

Query  239  AILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLN  69
            A ++   LT  +DS+ W+RLLWPE EVF+FN++LN+SSEWG S   W  +  +   ++ +
Sbjct  204  AGIFFLTLTTAIDSIFWKRLLWPEGEVFYFNTILNKSSEWGTSPFLWYFYSALPRGLAFS  263

Query  68   YVLVDIYM  45
            Y L+ + M
Sbjct  264  YFLIPLGM  271



>gb|AJC98474.1| AGAP000102 [Anopheles coluzzii]
Length=723

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
             LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V +
Sbjct  210  ALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVPL  269

Query  50   YMPVHWHIYSVV  15
             + +   I S+V
Sbjct  270  GLYLETRIRSLV  281



>gb|EGI70265.1| Putative dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1, 
6-mannosyltransferase [Acromyrmex echinatior]
Length=967

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/68 (46%), Positives = 44/68 (65%), Gaps = 5/68 (7%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
             LTI  DS+ WRRL+WPE EVF+FN++LN+SSEWG S   W  +  +   ++ +Y L+ +
Sbjct  210  ALTIATDSIFWRRLVWPEGEVFYFNTILNKSSEWGTSPFLWYFYSALPRGLAFSYFLIPL  269

Query  50   YMPVHWHI  27
             M   W I
Sbjct  270  GM--FWDI  275



>ref|XP_011063596.1| PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Acromyrmex echinatior]
Length=939

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/62 (47%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
             LTI  DS+ WRRL+WPE EVF+FN++LN+SSEWG S   W  +  +   ++ +Y L+ +
Sbjct  210  ALTIATDSIFWRRLVWPEGEVFYFNTILNKSSEWGTSPFLWYFYSALPRGLAFSYFLIPL  269

Query  50   YM  45
             M
Sbjct  270  GM  271



>ref|XP_010933573.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Elaeis guineensis]
Length=502

 Score = 62.8 bits (151),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  215  TIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            T+++D+VMW+R++WPE EVFWFNS+LNRSSEWG 
Sbjct  232  TVLLDTVMWQRIVWPELEVFWFNSILNRSSEWGT  265


 Score = 26.2 bits (56),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCI  325
            L +KSISLW+A+  C  TAL  I
Sbjct  207  LLSKSISLWRAMKCCIATALLSI  229



>ref|XP_010933576.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X4 [Elaeis guineensis]
Length=466

 Score = 62.8 bits (151),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  215  TIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            T+++D+VMW+R++WPE EVFWFNS+LNRSSEWG 
Sbjct  196  TVLLDTVMWQRIVWPELEVFWFNSILNRSSEWGT  229


 Score = 26.2 bits (56),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCI  325
            L +KSISLW+A+  C  TAL  I
Sbjct  171  LLSKSISLWRAMKCCIATALLSI  193



>ref|XP_010933572.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Elaeis guineensis]
Length=503

 Score = 62.8 bits (151),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  215  TIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            T+++D+VMW+R++WPE EVFWFNS+LNRSSEWG 
Sbjct  233  TVLLDTVMWQRIVWPELEVFWFNSILNRSSEWGT  266


 Score = 26.2 bits (56),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCI  325
            L +KSISLW+A+  C  TAL  I
Sbjct  208  LLSKSISLWRAMKCCIATALLSI  230



>ref|XP_010933577.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X5 [Elaeis guineensis]
Length=465

 Score = 62.8 bits (151),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  215  TIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            T+++D+VMW+R++WPE EVFWFNS+LNRSSEWG 
Sbjct  195  TVLLDTVMWQRIVWPELEVFWFNSILNRSSEWGT  228


 Score = 26.2 bits (56),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCI  325
            L +KSISLW+A+  C  TAL  I
Sbjct  170  LLSKSISLWRAMKCCIATALLSI  192



>ref|XP_008549304.1| PREDICTED: LOW QUALITY PROTEIN: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol 
alpha-1,6-mannosyltransferase [Microplitis demolitor]
Length=886

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 43/62 (69%), Gaps = 3/62 (5%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
             LT+V+DS  W+R+LWPE EV +FN+VLN+SS+WG S   W  +  +   + L+YVLV +
Sbjct  217  ALTLVIDSYFWKRILWPEGEVLYFNTVLNKSSQWGTSPFLWYFYSALPRGLGLSYVLVPL  276

Query  50   YM  45
             M
Sbjct  277  GM  278



>ref|XP_009381984.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=505

 Score = 65.5 bits (158),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -1

Query  215  TIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            T+++D+VMW+R+LWPE EVFWFNSVLNRSSEWG    H
Sbjct  235  TVLLDTVMWQRILWPELEVFWFNSVLNRSSEWGTQSFH  272


 Score = 23.1 bits (48),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCI  325
            LQ+KSIS+ +A+  C  +A  CI
Sbjct  210  LQSKSISISEAIKCCISSAFLCI  232



>gb|KDR17512.1| putative dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1, 
6-mannosyltransferase [Zootermopsis nevadensis]
Length=1138

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  218  LTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            LTI+VDS+ WRRLLWPE EV +FN+VLNRS +WG S
Sbjct  223  LTIIVDSIFWRRLLWPEGEVLFFNTVLNRSHQWGTS  258



>ref|XP_009381985.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=504

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -1

Query  215  TIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            T+++D+VMW+R+LWPE EVFWFNSVLNRSSEWG    H
Sbjct  234  TVLLDTVMWQRILWPELEVFWFNSVLNRSSEWGTQSFH  271



>ref|XP_001850969.1| glycosyltransferase [Culex quinquefasciatus]
 gb|EDS32860.1| glycosyltransferase [Culex quinquefasciatus]
Length=679

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 41/72 (57%), Gaps = 22/72 (31%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRHHILICACISLNYVLVDIYMP  42
             LT+ VDS +WRRLLWPE EVFWFN++LN+SSE+G S                      P
Sbjct  210  ALTVTVDSFLWRRLLWPEAEVFWFNTILNKSSEYGTS----------------------P  247

Query  41   VHWHIYSVVSFA  6
            + W+IYS +  A
Sbjct  248  ILWYIYSALPRA  259



>gb|EHJ73778.1| putative glycosyltransferase [Danaus plexippus]
Length=728

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  218  LTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            +T+ VDS+ W RLLWPE EVFWFNSVLN+SSEWG S
Sbjct  185  ITVSVDSLFWGRLLWPEAEVFWFNSVLNKSSEWGTS  220



>ref|XP_001663288.1| AAEL013078-PA [Aedes aegypti]
 gb|EAT34715.1| AAEL013078-PA [Aedes aegypti]
Length=689

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  218  LTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            LT+ VDS  WRRLLWPE EVFWFN++LN+SSEWG S
Sbjct  211  LTVAVDSFFWRRLLWPEAEVFWFNTILNKSSEWGTS  246



>ref|XP_001648338.1| AAEL014279-PA [Aedes aegypti]
 gb|EAT33447.1| AAEL014279-PA [Aedes aegypti]
Length=680

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  218  LTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            LT+ VDS  WRRLLWPE EVFWFN++LN+SSEWG S
Sbjct  211  LTVAVDSFFWRRLLWPEAEVFWFNTILNKSSEWGTS  246



>gb|AJC98479.1| AGAP000102 [Anopheles coluzzii]
Length=723

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
             LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V +
Sbjct  210  ALTVTVDSYFWRRLLWPEVEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVPL  269

Query  50   YMPVHWHIYSVV  15
             + +   I S+V
Sbjct  270  GLYLETRIRSLV  281



>gb|AJC98482.1| AGAP000102 [Anopheles coluzzii]
Length=723

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
             LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V +
Sbjct  210  ALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVPL  269

Query  50   YMPVHWHIYSVV  15
             + +   I S+V
Sbjct  270  GLYLETRIRSLV  281



>gb|AJC98477.1| AGAP000102 [Anopheles coluzzii]
Length=723

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
             LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V +
Sbjct  210  ALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVPL  269

Query  50   YMPVHWHIYSVV  15
             + +   I S+V
Sbjct  270  GLYLETRIRSLV  281



>gb|AJC98489.1| AGAP000102 [Anopheles coluzzii]
Length=722

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
             LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V +
Sbjct  210  ALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVPL  269

Query  50   YMPVHWHIYSVV  15
             + +   I S+V
Sbjct  270  GLYLETRIRSLV  281



>gb|AJC98486.1| AGAP000102 [Anopheles coluzzii]
Length=723

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
             LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V +
Sbjct  210  ALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVPL  269

Query  50   YMPVHWHIYSVV  15
             + +   I S+V
Sbjct  270  GLYLETRIRSLV  281



>gb|AJC98481.1| AGAP000102 [Anopheles coluzzii]
Length=723

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
             LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V +
Sbjct  210  ALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVPL  269

Query  50   YMPVHWHIYSVV  15
             + +   I S+V
Sbjct  270  GLYLETRIRSLV  281



>gb|AJC98494.1| AGAP000102 [Anopheles merus]
Length=721

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
             LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V +
Sbjct  210  ALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVPL  269

Query  50   YMPVHWHIYSVV  15
             + +   I S+V
Sbjct  270  GLYLETRIRSLV  281



>gb|AJC98480.1| AGAP000102 [Anopheles coluzzii]
Length=722

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
             LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V +
Sbjct  210  ALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVPL  269

Query  50   YMPVHWHIYSVV  15
             + +   I S+V
Sbjct  270  GLYLETRIRSLV  281



>gb|AJC98478.1| AGAP000102 [Anopheles coluzzii]
Length=722

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
             LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V +
Sbjct  210  ALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVPL  269

Query  50   YMPVHWHIYSVV  15
             + +   I S+V
Sbjct  270  GLYLETRIRSLV  281



>gb|AJC98492.1| AGAP000102 [Anopheles coluzzii]
Length=723

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
             LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V +
Sbjct  210  ALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVPL  269

Query  50   YMPVHWHIYSVV  15
             + +   I S+V
Sbjct  270  GLYLETRIRSLV  281



>ref|XP_311046.4| AGAP000102-PA [Anopheles gambiae str. PEST]
 gb|EAA06341.4| AGAP000102-PA [Anopheles gambiae str. PEST]
Length=722

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
             LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V +
Sbjct  210  ALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVPL  269

Query  50   YMPVHWHIYSVV  15
             + +   I S+V
Sbjct  270  GLYLETRIRSLV  281



>gb|AJC98475.1| AGAP000102 [Anopheles coluzzii]
Length=723

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
             LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V +
Sbjct  210  ALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVPL  269

Query  50   YMPVHWHIYSVV  15
             + +   I S+V
Sbjct  270  GLYLETRIRSLV  281



>gb|AJC98485.1| AGAP000102 [Anopheles coluzzii]
Length=722

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
             LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V +
Sbjct  210  ALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVPL  269

Query  50   YMPVHWHIYSVV  15
             + +   I S+V
Sbjct  270  GLYLETRIRSLV  281



>gb|AJC98483.1| AGAP000102 [Anopheles coluzzii]
Length=722

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
             LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V +
Sbjct  210  ALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVPL  269

Query  50   YMPVHWHIYSVV  15
             + +   I S+V
Sbjct  270  GLYLETRIRSLV  281



>gb|AJC98484.1| AGAP000102 [Anopheles coluzzii]
 gb|AJC98487.1| AGAP000102 [Anopheles coluzzii]
Length=723

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
             LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V +
Sbjct  210  ALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVPL  269

Query  50   YMPVHWHIYSVV  15
             + +   I S+V
Sbjct  270  GLYLETRIRSLV  281



>gb|AJC98490.1| AGAP000102 [Anopheles coluzzii]
Length=722

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
             LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V +
Sbjct  210  ALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVPL  269

Query  50   YMPVHWHIYSVV  15
             + +   I S+V
Sbjct  270  GLYLETRIRSLV  281



>gb|AJC98488.1| AGAP000102 [Anopheles coluzzii]
Length=723

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
             LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V +
Sbjct  210  ALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVPL  269

Query  50   YMPVHWHIYSVV  15
             + +   I S+V
Sbjct  270  GLYLETRIRSLV  281



>gb|AJC98493.1| AGAP000102 [Anopheles coluzzii]
Length=723

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
             LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V +
Sbjct  210  ALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVPL  269

Query  50   YMPVHWHIYSVV  15
             + +   I S+V
Sbjct  270  GLYLETRIRSLV  281



>gb|AJC98476.1| AGAP000102 [Anopheles coluzzii]
Length=723

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
             LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V +
Sbjct  210  ALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVPL  269

Query  50   YMPVHWHIYSVV  15
             + +   I S+V
Sbjct  270  GLYLETRIRSLV  281



>ref|XP_007889176.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Callorhinchus milii]
Length=305

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 12/65 (18%)
 Frame = -1

Query  281  SLLDFVVAVFI*SNAILYHA--------GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSS  126
            SL++  +++F      LYHA        GL++ VDSV W RLLWPE EV W+N+V+N+SS
Sbjct  5    SLVNHRISIF----KSLYHAVPAAFVWLGLSVCVDSVFWGRLLWPEGEVLWYNTVMNKSS  60

Query  125  EWGVS  111
            EWG S
Sbjct  61   EWGTS  65



>gb|AAI55513.1| asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase 
homolog [Xenopus (Silurana) tropicalis]
Length=489

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            G+T+VVDS  W+RLLWPE EV W+N++LN+SS+WG S
Sbjct  222  GITVVVDSYFWKRLLWPEGEVLWYNTILNKSSDWGTS  258



>ref|NP_001016120.1| ALG12, alpha-1,6-mannosyltransferase precursor [Xenopus (Silurana) 
tropicalis]
Length=489

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            G+T+VVDS  W+RLLWPE EV W+N++LN+SS+WG S
Sbjct  222  GITVVVDSYFWKRLLWPEGEVLWYNTILNKSSDWGTS  258



>ref|XP_008399364.1| PREDICTED: bromodomain-containing protein 1-like isoform X2 [Poecilia 
reticulata]
Length=1705

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -1

Query  239  AILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            A L+   LT+ VD+  WR+LLWPE +V W+N++LN+SS WG S
Sbjct  215  AGLFSLALTVAVDTFFWRKLLWPEGQVLWYNTILNKSSNWGTS  257



>ref|XP_009030087.1| hypothetical protein HELRODRAFT_70039 [Helobdella robusta]
 gb|ESN91704.1| hypothetical protein HELRODRAFT_70039 [Helobdella robusta]
Length=492

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 40/59 (68%), Gaps = 3/59 (5%)
 Frame = -1

Query  218  LTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
            LT++VDS  WRR LWPEFEVFWFN+ LN+S +WG S   W  +  +  C+   Y+LV +
Sbjct  215  LTVLVDSYFWRRWLWPEFEVFWFNTALNKSHQWGTSPFLWYFYSALPRCLGPFYILVPL  273



>ref|XP_007889175.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Callorhinchus milii]
Length=344

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 8/49 (16%)
 Frame = -1

Query  233  LYHA--------GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            LYHA        GL++ VDSV W RLLWPE EV W+N+V+N+SSEWG S
Sbjct  56   LYHAVPAAFVWLGLSVCVDSVFWGRLLWPEGEVLWYNTVMNKSSEWGTS  104



>ref|XP_002104066.1| GD18643 [Drosophila simulans]
 gb|EDX13569.1| GD18643 [Drosophila simulans]
Length=631

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 3/74 (4%)
 Frame = -1

Query  215  TIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDIYM  45
            T++VDS  WRRLLWPE EV W+N++LN+SS WG S   W  +  +   +  + VLV I +
Sbjct  212  TVLVDSFFWRRLLWPEGEVLWYNTILNKSSNWGTSPFLWYFYSALPRAMGASLVLVPIGV  271

Query  44   PVHWHIYSVVSFAF  3
             +   I S+V  A 
Sbjct  272  ALEPRIRSLVVSAL  285



>gb|ENN80093.1| hypothetical protein YQE_03452, partial [Dendroctonus ponderosae]
Length=735

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -1

Query  218  LTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            LTIVVDS+ W R LWPE EV W+N++LNRSS WG S
Sbjct  211  LTIVVDSIFWNRALWPEGEVLWYNTILNRSSNWGTS  246



>ref|NP_649939.1| CG8412 [Drosophila melanogaster]
 sp|Q9VH78.1|ALG12_DROME RecName: Full=Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase; 
AltName: Full=Asparagine-linked glycosylation 
protein 12 homolog; AltName: Full=Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase; 
AltName: Full=Mannosyltransferase ALG12 homolog [Drosophila 
melanogaster]
 gb|AAF54441.1| CG8412 [Drosophila melanogaster]
 gb|AAL48754.1| RE17513p [Drosophila melanogaster]
 gb|ACL86552.1| CG8412-PA, partial [synthetic construct]
Length=678

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 38/58 (66%), Gaps = 3/58 (5%)
 Frame = -1

Query  215  TIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
            T++VDS  WRRLLWPE EV W+N+VLN+SS WG S   W  +  +   +  + VLV I
Sbjct  212  TVLVDSFFWRRLLWPEGEVLWYNTVLNKSSNWGTSPFLWYFYSALPRAMGASLVLVPI  269



>ref|XP_011504718.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
[Ceratosolen solmsi marchali]
Length=857

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 40/59 (68%), Gaps = 3/59 (5%)
 Frame = -1

Query  218  LTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
            LT+ VDS  WRR LWPE EVF+FN++LN+S+EWG S   W  +  +   ++ +Y L+ +
Sbjct  211  LTVTVDSYFWRRTLWPEGEVFYFNTILNKSNEWGTSPFLWYFYSALPRGMAFSYFLIPL  269



>ref|XP_001994768.1| GH17417 [Drosophila grimshawi]
 gb|EDV91397.1| GH17417 [Drosophila grimshawi]
Length=672

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 3/58 (5%)
 Frame = -1

Query  215  TIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
            T++VDS  WRRLLWPE EV W+N++LN+SS WG S   W  +  +   + L+ V V I
Sbjct  212  TVLVDSFFWRRLLWPEGEVLWYNTILNKSSNWGTSPFLWYFYSALPRAMGLSLVFVPI  269



>ref|XP_002031835.1| GM23833 [Drosophila sechellia]
 gb|EDW42821.1| GM23833 [Drosophila sechellia]
Length=678

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 3/58 (5%)
 Frame = -1

Query  215  TIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
            T++VDS  WRRLLWPE EV W+N++LN+SS WG S   W  +  +   +  + VLV I
Sbjct  212  TVLVDSFFWRRLLWPEGEVLWYNTILNKSSNWGTSPFLWYFYSALPRAMGASLVLVPI  269



>ref|XP_002070263.1| GK11961 [Drosophila willistoni]
 gb|EDW81249.1| GK11961 [Drosophila willistoni]
Length=683

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 5/62 (8%)
 Frame = -1

Query  215  TIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACI--SLNYVLVDI  51
            T++VDS  WRRLLWPE EV W+N+VLN+SS WG S   W  +  +   +  SL +V + I
Sbjct  212  TVLVDSFFWRRLLWPEGEVLWYNTVLNKSSNWGTSPFLWYFYSALPRAMGASLAFVPIGI  271

Query  50   YM  45
            Y+
Sbjct  272  YL  273



>ref|XP_011303562.1| PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Fopius arisanus]
Length=1056

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 40/75 (53%), Gaps = 22/75 (29%)
 Frame = -1

Query  239  AILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRHHILICACISLNYVL  60
            A ++   LTI +DS+ W R+LWPE EVF+FN+VLN+SS+WG                   
Sbjct  204  AGIFFLSLTIGIDSIFWGRILWPEGEVFYFNTVLNKSSQWGT------------------  245

Query  59   VDIYMPVHWHIYSVV  15
                +P  W+ YS +
Sbjct  246  ----LPFFWYFYSAL  256



>ref|XP_006119662.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X5 [Pelodiscus sinensis]
Length=424

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  242  NAILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            N   +  GLTI VDSV WR+LLWPE +V W+N VLN+SS WG S
Sbjct  150  NMFAFPIGLTIAVDSVFWRQLLWPEGKVLWYNIVLNKSSNWGTS  193



>ref|XP_001117738.2| PREDICTED: dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase-like, 
partial [Macaca mulatta]
Length=113

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS  WR+L WPE +VFW+N+VLN+S+ WGVS
Sbjct  75   GLTVAVDSYFWRQLTWPEGKVFWYNTVLNKSANWGVS  111



>ref|XP_007054631.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Chelonia mydas]
Length=489

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDSV WR+LLWPE +V W+N+VLN+SS WG S
Sbjct  222  GLTVAVDSVFWRQLLWPEGKVLWYNTVLNKSSNWGTS  258



>gb|KFB34980.1| AGAP000102-PA-like protein [Anopheles sinensis]
Length=752

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 44/71 (62%), Gaps = 3/71 (4%)
 Frame = -1

Query  218  LTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDIY  48
            LT+ +DS  WRRLLWPE EVFWFN+V N+SS+WG S   W  +  +   + L+ V V + 
Sbjct  211  LTVAMDSFFWRRLLWPEAEVFWFNTVQNKSSDWGTSPFLWYLYSALPRAMGLSIVFVPLG  270

Query  47   MPVHWHIYSVV  15
            +     I S+V
Sbjct  271  LYFETRIRSLV  281



>ref|XP_001758628.1| predicted protein [Physcomitrella patens]
 gb|EDQ76606.1| predicted protein [Physcomitrella patens]
Length=471

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  224  AGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            A +T  +DSV+WR+ +WPEF+V WFNSVLNRS+EWGVS  H
Sbjct  194  AAVTCGLDSVVWRQWIWPEFQVLWFNSVLNRSTEWGVSPVH  234



>ref|XP_011210461.1| PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Bactrocera dorsalis]
Length=743

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 38/58 (66%), Gaps = 3/58 (5%)
 Frame = -1

Query  215  TIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
            TIV+DS  WRRLLWPE EV W+N++LN+SS+WG S   W  +      +  + VLV I
Sbjct  212  TIVLDSFFWRRLLWPEGEVLWYNTILNKSSDWGTSPFLWYFYSAFPRALGASVVLVPI  269



>gb|KFV12894.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Pterocles gutturalis]
Length=490

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE EV W+N+VLN+SS WG S
Sbjct  223  GLTVAVDSLFWRQLVWPEGEVLWYNTVLNKSSNWGTS  259



>ref|XP_006780630.1| PREDICTED: bromodomain-containing protein 1-like isoform X2 [Neolamprologus 
brichardi]
Length=1540

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/73 (37%), Positives = 36/73 (49%), Gaps = 22/73 (30%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRHHILICACISLNYVLVDIYMP  42
             LT+ VD+  WR+LLWPE +V W+N++LN+SS WG S                      P
Sbjct  109  ALTVAVDTFFWRKLLWPEGQVLWYNTILNKSSNWGTS----------------------P  146

Query  41   VHWHIYSVVSFAF  3
              W+ YS V  A 
Sbjct  147  FLWYFYSAVPRAL  159



>ref|XP_006780629.1| PREDICTED: bromodomain-containing protein 1-like isoform X1 [Neolamprologus 
brichardi]
Length=1596

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/73 (37%), Positives = 36/73 (49%), Gaps = 22/73 (30%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRHHILICACISLNYVLVDIYMP  42
             LT+ VD+  WR+LLWPE +V W+N++LN+SS WG S                      P
Sbjct  109  ALTVAVDTFFWRKLLWPEGQVLWYNTILNKSSNWGTS----------------------P  146

Query  41   VHWHIYSVVSFAF  3
              W+ YS V  A 
Sbjct  147  FLWYFYSAVPRAL  159



>ref|XP_001964465.1| GF23035 [Drosophila ananassae]
 gb|EDV30261.1| GF23035 [Drosophila ananassae]
Length=688

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  215  TIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            T++VDS  WRRLLWPE EV W+N++LN+SS WG S
Sbjct  212  TVLVDSFFWRRLLWPEGEVLWYNTILNKSSNWGTS  246



>gb|KFV77693.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Struthio camelus australis]
Length=490

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+LLWPE +V W+N+VLN+SS WG S
Sbjct  223  GLTVAVDSLFWRQLLWPEGKVLWYNTVLNKSSNWGTS  259



>ref|XP_010078902.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Pterocles gutturalis]
Length=510

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE EV W+N+VLN+SS WG S
Sbjct  243  GLTVAVDSLFWRQLVWPEGEVLWYNTVLNKSSNWGTS  279



>ref|XP_009666099.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Struthio camelus australis]
Length=575

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+LLWPE +V W+N+VLN+SS WG S
Sbjct  308  GLTVAVDSLFWRQLLWPEGKVLWYNTVLNKSSNWGTS  344



>ref|XP_002097006.1| GE25981 [Drosophila yakuba]
 gb|EDW96718.1| GE25981 [Drosophila yakuba]
Length=678

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 3/58 (5%)
 Frame = -1

Query  215  TIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
            T++VDS  WRRLLWPE EV W+N++LN+SS WG S   W  +  +   +  + VLV I
Sbjct  212  TVLVDSFFWRRLLWPEGEVLWYNTILNKSSNWGTSPFLWYFYSALPRAMGASLVLVPI  269



>ref|XP_001980759.1| GG17092 [Drosophila erecta]
 gb|EDV49717.1| GG17092 [Drosophila erecta]
Length=678

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 3/58 (5%)
 Frame = -1

Query  215  TIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
            T++VDS  WRRLLWPE EV W+N++LN+SS WG S   W  +  +   +  + VLV I
Sbjct  212  TVLVDSFFWRRLLWPEGEVLWYNTILNKSSNWGTSPFLWYFYSALPRAMGASLVLVPI  269



>ref|XP_002054547.1| GJ22748 [Drosophila virilis]
 gb|EDW68067.1| GJ22748 [Drosophila virilis]
Length=690

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 31/76 (41%), Positives = 45/76 (59%), Gaps = 5/76 (7%)
 Frame = -1

Query  215  TIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACI--SLNYVLVDI  51
            T++VDS  WRRLLWPE EV W+N++LN+SS WG S   W  +  +   +  SL +V + I
Sbjct  212  TVLVDSFFWRRLLWPEGEVLWYNTILNKSSNWGTSPFLWYFYSALPRAMGASLAFVPIGI  271

Query  50   YMPVHWHIYSVVSFAF  3
            Y        ++ + AF
Sbjct  272  YFERRLRPLALCAVAF  287



>ref|XP_010933575.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X3 [Elaeis guineensis]
Length=495

 Score = 56.2 bits (134),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  215  TIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            T ++  +MW+R++WPE EVFWFNS+LNRSSEWG 
Sbjct  225  TALLSILMWQRIVWPELEVFWFNSILNRSSEWGT  258


 Score = 26.2 bits (56),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -3

Query  393  LQTKSISLWKAVISCFGTALCCI  325
            L +KSISLW+A+  C  TAL  I
Sbjct  208  LLSKSISLWRAMKCCIATALLSI  230



>ref|XP_006119658.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Pelodiscus sinensis]
 ref|XP_006119659.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Pelodiscus sinensis]
 ref|XP_006119660.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X3 [Pelodiscus sinensis]
 ref|XP_006119661.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X4 [Pelodiscus sinensis]
Length=489

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLTI VDSV WR+LLWPE +V W+N VLN+SS WG S
Sbjct  222  GLTIAVDSVFWRQLLWPEGKVLWYNIVLNKSSNWGTS  258



>ref|XP_010304542.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like, 
partial [Balearica regulorum gibbericeps]
Length=298

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N++LN+SS+WG S
Sbjct  65   GLTVAVDSLFWRQLVWPEGKVLWYNTILNKSSDWGTS  101



>ref|XP_009927917.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Haliaeetus albicilla]
 ref|XP_010579150.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Haliaeetus leucocephalus]
 gb|KFP93072.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Haliaeetus albicilla]
Length=490

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N++LNRSS WG S
Sbjct  223  GLTVAVDSLFWRQLVWPEGKVLWYNTILNRSSNWGTS  259



>gb|KFO05594.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase, 
partial [Balearica regulorum gibbericeps]
Length=258

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N++LN+SS+WG S
Sbjct  66   GLTVAVDSLFWRQLVWPEGKVLWYNTILNKSSDWGTS  102



>ref|XP_004521212.1| PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X1 [Ceratitis capitata]
Length=734

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/58 (45%), Positives = 39/58 (67%), Gaps = 3/58 (5%)
 Frame = -1

Query  215  TIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDI  51
            TI++DS  WRR+LWPE EV W+N++LN+SS+WG S   W  +  +   +  + +LV I
Sbjct  212  TIILDSFFWRRILWPEGEVLWYNTILNKSSDWGTSPFLWYFYSALPRALGASIILVPI  269



>ref|XP_005519263.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Pseudopodoces humilis]
 ref|XP_005519264.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Pseudopodoces humilis]
Length=490

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLTI VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  223  GLTIAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  259



>ref|XP_003770822.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Sarcophilus harrisii]
Length=489

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR +LWPE +V W+N+VLN+SS+WGVS
Sbjct  222  GLTVAVDSMFWRHVLWPEGQVLWYNTVLNKSSDWGVS  258



>gb|AAX25758.2| SJCHGC04766 protein [Schistosoma japonicum]
Length=359

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 38/50 (76%), Gaps = 6/50 (12%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRHHILICACISL  72
            G +++VDS++W +L+WPEFEVF+FN++LN+S +WG       L+C C+ L
Sbjct  64   GSSVLVDSMLWGKLIWPEFEVFYFNTILNKSGQWGS------LLCTCMLL  107



>ref|XP_004458227.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Dasypus novemcinctus]
Length=479

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 2/44 (5%)
 Frame = -1

Query  236  ILYHA--GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            +L HA  GLT+ VDS  WR L+WPE +VFWFN+V+N+SS WG S
Sbjct  209  VLGHALPGLTVAVDSYFWRYLVWPEGQVFWFNTVMNKSSNWGTS  252



>ref|XP_008934732.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Merops nubicus]
 gb|KFQ16776.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Merops nubicus]
Length=490

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 46/72 (64%), Gaps = 12/72 (17%)
 Frame = -1

Query  302  LGILSRDSLLDFVVAVFI*SNAILYHA--------GLTIVVDSVMWRRLLWPEFEVFWFN  147
            LG++   +LL   +++F     +L HA        GLT+ VDS+ WR+L+WPE +V W+N
Sbjct  192  LGLMLIVTLLTKRISIF----KVLSHAVPAGFFCLGLTVAVDSLFWRQLVWPEGKVLWYN  247

Query  146  SVLNRSSEWGVS  111
            +VLN+SS WG S
Sbjct  248  TVLNKSSNWGTS  259



>gb|EOB00345.1| Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1, 6-mannosyltransferase, 
partial [Anas platyrhynchos]
Length=490

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  223  GLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  259



>ref|XP_010172344.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Caprimulgus carolinensis]
 gb|KFZ49680.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Caprimulgus carolinensis]
Length=490

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  223  GLTVTVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  259



>emb|CAX69859.1| alpha-1,6-mannosyltransferase [Schistosoma japonicum]
Length=401

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 40/58 (69%), Gaps = 8/58 (14%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH--------HILICACISL  72
            G +++VDS++W +L+WPEFEVF+FN++LN+S +WG+   H          L+C C+ L
Sbjct  99   GSSVLVDSMLWGKLIWPEFEVFYFNTILNKSGQWGIYPFHWYFTSALPKSLLCTCMLL  156



>ref|XP_001640825.1| predicted protein [Nematostella vectensis]
 gb|EDO48762.1| predicted protein [Nematostella vectensis]
Length=487

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ +DS+ W+R LWPE EVF+FN+VLN+SS+WG S
Sbjct  219  GLTVCIDSIFWQRWLWPEGEVFYFNAVLNKSSQWGTS  255



>ref|XP_005020901.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Anas platyrhynchos]
Length=555

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  288  GLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  324



>ref|XP_002013739.1| GL24301 [Drosophila persimilis]
 gb|EDW24725.1| GL24301 [Drosophila persimilis]
Length=685

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  215  TIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            +++VDS  WRRLLWPE EV W+N++LN+SS WG S
Sbjct  214  SVLVDSFFWRRLLWPEGEVLWYNTILNKSSNWGTS  248



>ref|XP_009941547.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Opisthocomus hoazin]
 gb|KFR17514.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Opisthocomus hoazin]
Length=490

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLTI VDS+ WR+L+WPE +V W+N++LN+SS WG S
Sbjct  223  GLTIAVDSLFWRQLVWPEGKVLWYNTILNKSSNWGTS  259



>ref|XP_007232458.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Astyanax mexicanus]
Length=490

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDSV W++LLWPE +V W+N++LN+SS WG S
Sbjct  221  GLTVCVDSVFWKKLLWPEGQVLWYNTILNKSSNWGTS  257



>ref|XP_001358592.2| GA21058 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL27733.2| GA21058 [Drosophila pseudoobscura pseudoobscura]
Length=685

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  215  TIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            +++VDS  WRRLLWPE EV W+N++LN+SS WG S
Sbjct  214  SVLVDSFFWRRLLWPEGEVLWYNTILNKSSNWGTS  248



>ref|NP_001092219.1| dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
precursor [Danio rerio]
 gb|AAI42933.1| Alg12 protein [Danio rerio]
Length=493

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 35/52 (67%), Gaps = 8/52 (15%)
 Frame = -1

Query  242  NAILYHA--------GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
              +LYHA        GLTI+ DS+ W +LLWPE +V W+N+VLN+SS WG S
Sbjct  206  GQLLYHAIPAGFVSLGLTIMFDSLFWNKLLWPEGQVLWYNTVLNKSSNWGTS  257



>gb|KFV76590.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Picoides pubescens]
Length=489

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  222  GLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  258



>gb|KFO86029.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Buceros rhinoceros silvestris]
Length=490

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  223  GLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSSWGTS  259



>ref|XP_009317042.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Pygoscelis adeliae]
 gb|KFW63493.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Pygoscelis adeliae]
Length=490

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  223  GLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  259



>ref|XP_010143942.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Buceros rhinoceros silvestris]
Length=514

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  247  GLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSSWGTS  283



>ref|XP_009701833.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Cariama cristata]
 gb|KFP66687.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Cariama cristata]
Length=490

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  223  GLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  259



>ref|XP_008924845.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Manacus vitellinus]
 gb|KFW83222.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Manacus vitellinus]
Length=490

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  223  GLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  259



>ref|XP_009289185.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Aptenodytes forsteri]
 gb|KFM02774.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Aptenodytes forsteri]
Length=490

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  223  GLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  259



>gb|KFP76651.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Acanthisitta chloris]
Length=482

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  215  GLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  251



>ref|XP_009069265.1| PREDICTED: LOW QUALITY PROTEIN: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol 
alpha-1,6-mannosyltransferase [Acanthisitta chloris]
Length=487

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  220  GLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  256



>ref|XP_009907509.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Picoides pubescens]
Length=506

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  239  GLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  275



>gb|KFP30903.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Colius striatus]
Length=490

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  223  GLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  259



>ref|XP_005150100.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Melopsittacus undulatus]
Length=490

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  223  GLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  259



>ref|XP_010284497.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase, 
partial [Phaethon lepturus]
Length=331

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  223  GLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  259



>ref|XP_010198175.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Colius striatus]
Length=512

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  245  GLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  281



>ref|XP_010010445.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Nestor notabilis]
 gb|KFQ47355.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Nestor notabilis]
Length=490

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  223  GLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  259



>ref|XP_009498471.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Phalacrocorax carbo]
 gb|KFW87932.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Phalacrocorax carbo]
Length=490

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  223  GLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  259



>gb|KFQ64312.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Phaethon lepturus]
Length=332

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  223  GLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  259



>ref|XP_009085055.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Serinus canaria]
Length=490

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  223  GLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  259



>ref|XP_008640763.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Corvus brachyrhynchos]
 ref|XP_010393865.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Corvus cornix cornix]
 gb|KFO65807.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Corvus brachyrhynchos]
Length=490

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  223  GLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  259



>gb|KGL77880.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase, 
partial [Tinamus guttatus]
Length=487

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N++LN+SS WG S
Sbjct  223  GLTVAVDSIFWRQLVWPEGKVLWYNTILNKSSNWGTS  259



>ref|XP_010213853.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Tinamus guttatus]
Length=490

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N++LN+SS WG S
Sbjct  223  GLTVAVDSIFWRQLVWPEGKVLWYNTILNKSSNWGTS  259



>ref|XP_005039300.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Ficedula albicollis]
 ref|XP_005039301.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Ficedula albicollis]
 ref|XP_005039302.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X3 [Ficedula albicollis]
Length=490

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  223  GLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  259



>ref|XP_002188335.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Taeniopygia guttata]
Length=490

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  223  GLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSSWGTS  259



>ref|XP_005481972.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Zonotrichia albicollis]
Length=490

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  223  GLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  259



>ref|XP_005428578.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Geospiza fortis]
Length=490

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  223  GLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  259



>gb|KFQ78426.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase, 
partial [Phoenicopterus ruber ruber]
Length=415

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  223  GLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  259



>ref|XP_001489274.3| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
[Equus caballus]
Length=336

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            GLT+ VDS  WR L+WPE +V W+N+VLN+SS WGVS+R
Sbjct  224  GLTVAVDSYFWRYLVWPEGKVLWYNTVLNKSSNWGVSFR  262



>ref|XP_003225017.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Anolis carolinensis]
Length=491

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            G+T+V+DSV W++LLWPE +V W+N+VLN+SS WG S
Sbjct  222  GITVVLDSVFWKQLLWPEGKVLWYNTVLNKSSNWGTS  258



>ref|XP_008115325.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Anolis carolinensis]
Length=413

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            G+T+V+DSV W++LLWPE +V W+N+VLN+SS WG S
Sbjct  222  GITVVLDSVFWKQLLWPEGKVLWYNTVLNKSSNWGTS  258



>ref|XP_004921841.1| PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
[Bombyx mori]
Length=760

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/76 (32%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV---SWRHHILICACISLNYVLVDI  51
             +T+++DS+ W RLLWPE EV W+N++LN+SS WG     W  +  +   +  +++L+ +
Sbjct  210  AITVIIDSIFWGRLLWPEAEVLWYNTILNKSSNWGTLPFLWYFYSALPRGLGPSFILIPV  269

Query  50   YMPVHWHIYSVVSFAF  3
             + +   +  V++ +F
Sbjct  270  GVYLDRRLVPVIALSF  285



>ref|XP_006267869.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Alligator mississippiensis]
Length=400

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLTI VDSV W +LLWPE +V W+N++LN+SS WG S
Sbjct  222  GLTIAVDSVFWGQLLWPEGKVLWYNTILNKSSSWGTS  258



>ref|XP_006633542.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
[Lepisosteus oculatus]
Length=488

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -1

Query  239  AILYHAGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            A L+   LTI +DSV W++LLWPE +V W+N+VLN+SS WG+S
Sbjct  215  AGLFCLALTIGIDSVFWKQLLWPEGQVLWYNTVLNKSSNWGIS  257



>gb|KFV93233.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Eurypyga helias]
Length=490

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N++LN+SS WG S
Sbjct  223  GLTVAVDSLFWRQLVWPEGKVLWYNTILNKSSNWGTS  259



>ref|XP_009997748.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Chaetura pelagica]
 gb|KFU91006.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Chaetura pelagica]
Length=490

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  221  GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            GLT+ VDS+ WR+L+WPE +V W+N++LN+SS WG S
Sbjct  223  GLTVAVDSLFWRQLVWPEGKVLWYNTILNKSSNWGTS  259



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660