BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP008H10 475 bp,:Filtered

Length=445
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006470496.1|  PREDICTED: uncharacterized protein LOC102617255  94.7    7e-20   
ref|XP_006476142.1|  PREDICTED: uncharacterized protein LOC102616098  92.8    4e-19   
ref|XP_002531759.1|  conserved hypothetical protein                   86.3    5e-18   Ricinus communis
ref|XP_002532007.1|  conserved hypothetical protein                   87.4    8e-18   
ref|XP_006467327.1|  PREDICTED: uncharacterized protein LOC102625297  86.7    4e-17   
ref|XP_003598202.1|  60S ribosomal protein L23                        86.7    9e-17   
ref|XP_002525921.1|  conserved hypothetical protein                   82.4    2e-16   
ref|XP_003607468.1|  hypothetical protein MTR_4g078340                80.1    1e-15   
ref|XP_006489961.1|  PREDICTED: uncharacterized protein LOC102608276  78.2    6e-15   Citrus sinensis [Valencia orange]
ref|XP_010670097.1|  PREDICTED: uncharacterized protein LOC104887199  77.4    1e-14   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_003629388.1|  Cytochrome P450                                  79.7    3e-14   
ref|XP_003593283.1|  hypothetical protein MTR_2g009730                76.6    4e-14   
ref|XP_003607028.1|  hypothetical protein MTR_4g071380                74.7    2e-13   
ref|XP_008229542.1|  PREDICTED: uncharacterized protein LOC103328904  74.3    2e-13   Prunus mume [ume]
gb|AES76948.2|  hypothetical protein MTR_6g089560                     73.9    3e-13   Medicago truncatula
ref|XP_003601858.1|  Estradiol 17-beta-dehydrogenase                  76.3    3e-13   
ref|XP_003621450.1|  hypothetical protein MTR_7g013520                73.2    3e-13   Medicago truncatula
ref|XP_006480463.1|  PREDICTED: putative ribonuclease H protein A...  75.9    4e-13   
ref|XP_003620730.1|  hypothetical protein MTR_6g089560                73.6    4e-13   
ref|XP_009623190.1|  PREDICTED: uncharacterized protein LOC104114439  75.1    4e-13   Nicotiana tomentosiformis
ref|XP_003597249.1|  hypothetical protein MTR_2g094480                72.4    5e-13   
ref|XP_007206484.1|  hypothetical protein PRUPE_ppa019056mg           73.2    9e-13   Prunus persica
ref|XP_003617149.1|  hypothetical protein MTR_5g088360                71.2    1e-12   
ref|XP_002531249.1|  hypothetical protein RCOM_0494170                72.8    2e-12   
ref|XP_009800085.1|  PREDICTED: uncharacterized protein LOC104246050  74.3    2e-12   Nicotiana sylvestris
ref|XP_003588770.1|  hypothetical protein MTR_1g012560                71.6    2e-12   
ref|XP_003605183.1|  Cytochrome P450                                  72.8    2e-12   
gb|ABD32189.2|  Polynucleotidyl transferase, Ribonuclease H fold      72.0    1e-11   Medicago truncatula
gb|ABD28710.1|  Polynucleotidyl transferase, Ribonuclease H fold      70.9    1e-11   Medicago truncatula
gb|KJB20572.1|  hypothetical protein B456_003G154500                  68.9    1e-11   Gossypium raimondii
ref|XP_002517530.1|  Disease resistance protein RPS5, putative        72.0    2e-11   
ref|XP_003624705.1|  hypothetical protein MTR_7g086560                68.9    2e-11   
gb|ABN06084.1|  Polynucleotidyl transferase, Ribonuclease H fold      71.2    2e-11   Medicago truncatula
ref|XP_002512628.1|  conserved hypothetical protein                   68.6    2e-11   
ref|XP_003612608.1|  Replication protein A 70 kDa DNA-binding sub...  71.6    2e-11   
ref|XP_007203452.1|  hypothetical protein PRUPE_ppa022115mg           71.6    2e-11   Prunus persica
ref|XP_002518871.1|  conserved hypothetical protein                   70.5    5e-11   
ref|XP_010690674.1|  PREDICTED: uncharacterized protein LOC104904177  68.2    5e-11   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_003613409.1|  hypothetical protein MTR_5g036320                67.0    5e-11   Medicago truncatula
ref|XP_010687523.1|  PREDICTED: uncharacterized protein LOC104901631  68.9    5e-11   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_006378610.1|  hypothetical protein POPTR_0010s18040g           66.2    7e-11   Populus trichocarpa [western balsam poplar]
ref|XP_007217321.1|  hypothetical protein PRUPE_ppa019733mg           70.1    7e-11   Prunus persica
gb|ABN08952.1|  Polynucleotidyl transferase, Ribonuclease H fold      67.0    8e-11   Medicago truncatula
ref|XP_008346598.1|  PREDICTED: uncharacterized protein LOC103409561  67.0    8e-11   
ref|XP_003594556.1|  hypothetical protein MTR_2g030550                66.2    8e-11   
gb|KDP24857.1|  hypothetical protein JCGZ_24451                       65.5    8e-11   Jatropha curcas
gb|EEE56566.1|  hypothetical protein OsJ_05904                        68.6    1e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003624042.1|  hypothetical protein MTR_7g078610                65.9    2e-10   
ref|XP_006483704.1|  PREDICTED: uncharacterized protein LOC102620092  67.4    2e-10   
ref|XP_003595869.1|  hypothetical protein MTR_2g062740                65.1    2e-10   
ref|XP_003607370.1|  LCR-like protein                                 64.7    2e-10   
ref|XP_008231652.1|  PREDICTED: uncharacterized protein LOC103330817  65.1    3e-10   Prunus mume [ume]
ref|XP_007225095.1|  hypothetical protein PRUPE_ppa016563mg           67.8    4e-10   Prunus persica
ref|XP_003614116.1|  hypothetical protein MTR_5g045010                64.3    4e-10   
ref|XP_002465515.1|  hypothetical protein SORBIDRAFT_01g040340        67.4    5e-10   Sorghum bicolor [broomcorn]
ref|XP_010667872.1|  PREDICTED: uncharacterized protein LOC104884867  64.3    5e-10   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_008226303.1|  PREDICTED: uncharacterized protein LOC103325890  65.1    5e-10   
ref|XP_003593785.1|  hypothetical protein MTR_2g017550                63.9    6e-10   
ref|XP_006464882.1|  PREDICTED: putative ribonuclease H protein A...  67.0    6e-10   
ref|XP_003599959.1|  hypothetical protein MTR_3g049770                63.5    7e-10   
ref|XP_003621136.1|  Pentatricopeptide repeat-containing protein      66.6    8e-10   
gb|AES64036.2|  hypothetical protein MTR_2g017550                     63.2    1e-09   Medicago truncatula
ref|XP_003594782.1|  hypothetical protein MTR_2g034570                62.8    1e-09   
ref|XP_003623678.1|  hypothetical protein MTR_7g074420                63.5    1e-09   
ref|XP_006493122.1|  PREDICTED: putative ribonuclease H protein A...  65.9    2e-09   
ref|XP_010696211.1|  PREDICTED: uncharacterized protein LOC104908759  64.7    2e-09   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_006493121.1|  PREDICTED: putative ribonuclease H protein A...  65.9    2e-09   
gb|KHN14619.1|  hypothetical protein glysoja_024714                   63.2    2e-09   Glycine soja [wild soybean]
gb|ABN08583.1|  Polynucleotidyl transferase, Ribonuclease H fold      62.8    2e-09   Medicago truncatula
gb|ABN09176.1|  Polynucleotidyl transferase, Ribonuclease H fold      63.5    2e-09   Medicago truncatula
gb|AAP54617.2|  retrotransposon protein, putative, unclassified       65.5    2e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003603808.1|  hypothetical protein MTR_3g114430                63.2    2e-09   
ref|XP_003598902.1|  hypothetical protein MTR_3g023170                63.2    2e-09   
ref|NP_194638.1|  ribonuclease H-like protein                         65.1    3e-09   Arabidopsis thaliana [mouse-ear cress]
gb|AAG13524.1|AC068924_29  putative non-LTR retroelement reverse ...  65.5    3e-09   Oryza sativa Japonica Group [Japonica rice]
gb|KHN38789.1|  hypothetical protein glysoja_047929                   62.0    3e-09   Glycine soja [wild soybean]
gb|EEE64789.1|  hypothetical protein OsJ_19645                        62.4    3e-09   Oryza sativa Japonica Group [Japonica rice]
gb|AAP44645.1|  putative reverse transcriptase                        64.3    3e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007203129.1|  hypothetical protein PRUPE_ppa024061mg           61.6    3e-09   Prunus persica
ref|XP_003605496.1|  hypothetical protein MTR_4g032310                63.2    3e-09   
ref|XP_007203380.1|  hypothetical protein PRUPE_ppa025995mg           62.0    3e-09   Prunus persica
ref|XP_002529689.1|  conserved hypothetical protein                   60.8    4e-09   
gb|KHN31589.1|  hypothetical protein glysoja_043032                   61.2    4e-09   Glycine soja [wild soybean]
ref|XP_009137097.1|  PREDICTED: uncharacterized protein LOC103861143  61.2    5e-09   Brassica rapa
ref|XP_003599929.1|  hypothetical protein MTR_3g049170                62.4    5e-09   
ref|XP_010236322.1|  PREDICTED: uncharacterized protein LOC104583970  62.8    5e-09   Brachypodium distachyon [annual false brome]
ref|XP_010689379.1|  PREDICTED: uncharacterized protein LOC104903088  62.4    5e-09   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_003590140.1|  hypothetical protein MTR_1g044900                60.8    5e-09   
ref|XP_008227720.1|  PREDICTED: putative ribonuclease H protein A...  63.2    6e-09   
emb|CAN77449.1|  hypothetical protein VITISV_016970                   63.9    6e-09   Vitis vinifera
ref|XP_002528833.1|  conserved hypothetical protein                   60.8    6e-09   
gb|EEC72753.1|  hypothetical protein OsI_06384                        63.9    6e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_011470556.1|  PREDICTED: uncharacterized protein LOC105353255  63.5    8e-09   Fragaria vesca subsp. vesca
ref|XP_002527468.1|  conserved hypothetical protein                   60.5    8e-09   
ref|XP_003614676.1|  hypothetical protein MTR_5g057370                61.6    8e-09   
ref|XP_006593242.1|  PREDICTED: uncharacterized protein LOC102666191  60.8    8e-09   
ref|XP_007198863.1|  hypothetical protein PRUPE_ppa018328mg           60.5    8e-09   Prunus persica
gb|KEH21242.1|  hypothetical protein MTR_8g099580                     62.4    8e-09   Medicago truncatula
emb|CDP14369.1|  unnamed protein product                              62.4    9e-09   Coffea canephora [robusta coffee]
ref|XP_008226963.1|  PREDICTED: uncharacterized protein LOC103326508  60.8    9e-09   
ref|XP_006577722.1|  PREDICTED: putative ribonuclease H protein A...  61.2    1e-08   
ref|XP_007214838.1|  hypothetical protein PRUPE_ppa018217mg           62.0    1e-08   Prunus persica
gb|KHN20416.1|  Putative ribonuclease H protein                       60.8    1e-08   Glycine soja [wild soybean]
ref|XP_010513219.1|  PREDICTED: uncharacterized protein LOC104789182  63.5    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_002522452.1|  nucleic acid binding protein, putative           62.4    1e-08   
ref|XP_003609588.1|  hypothetical protein MTR_4g118850                59.3    2e-08   
ref|XP_009121392.1|  PREDICTED: uncharacterized protein LOC103846249  60.8    2e-08   Brassica rapa
gb|AAU89136.1|  F-box domain containing protein                       62.8    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002453054.1|  hypothetical protein SORBIDRAFT_04g037485        59.7    2e-08   Sorghum bicolor [broomcorn]
ref|XP_010679712.1|  PREDICTED: uncharacterized protein LOC104895014  60.1    2e-08   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_002517043.1|  conserved hypothetical protein                   59.7    2e-08   
gb|EEC75888.1|  hypothetical protein OsI_12930                        62.8    2e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_008345353.1|  PREDICTED: putative ribonuclease H protein A...  62.8    2e-08   
ref|XP_008337941.1|  PREDICTED: uncharacterized protein LOC103401016  61.2    2e-08   
gb|ABA97040.1|  retrotransposon protein, putative, unclassified       62.8    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006471930.1|  PREDICTED: uncharacterized protein LOC102617744  61.2    2e-08   Citrus sinensis [Valencia orange]
gb|EAZ07210.1|  hypothetical protein OsI_29454                        59.7    2e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_006487438.1|  PREDICTED: putative ribonuclease H protein A...  61.2    2e-08   
ref|XP_010485231.1|  PREDICTED: uncharacterized protein LOC104763574  62.4    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006285982.1|  hypothetical protein CARUB_v10007509mg           59.3    2e-08   Capsella rubella
ref|XP_006427454.1|  hypothetical protein CICLE_v10027161mg           58.9    3e-08   Citrus clementina
ref|XP_010682232.1|  PREDICTED: uncharacterized protein LOC104897109  61.2    3e-08   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_004293042.2|  PREDICTED: uncharacterized protein LOC101293660  62.0    3e-08   Fragaria vesca subsp. vesca
gb|EEE59647.1|  hypothetical protein OsJ_12023                        62.0    3e-08   Oryza sativa Japonica Group [Japonica rice]
dbj|BAF36334.1|  hypothetical protein                                 58.5    4e-08   Ipomoea trifida
gb|ABD28554.2|  Polynucleotidyl transferase, Ribonuclease H fold      58.2    4e-08   Medicago truncatula
ref|XP_010666974.1|  PREDICTED: uncharacterized protein LOC104884077  58.5    4e-08   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010684542.1|  PREDICTED: uncharacterized protein LOC104899105  58.9    4e-08   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|EEE68803.1|  hypothetical protein OsJ_27549                        58.9    5e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003614550.1|  hypothetical protein MTR_5g055330                58.2    5e-08   
ref|XP_003629565.1|  hypothetical protein MTR_8g079540                57.8    5e-08   Medicago truncatula
ref|XP_006603254.1|  PREDICTED: uncharacterized protein LOC102660201  58.5    6e-08   Glycine max [soybeans]
ref|XP_003589048.1|  hypothetical protein MTR_1g017840                58.2    6e-08   Medicago truncatula
emb|CCA66036.1|  hypothetical protein                                 61.2    6e-08   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|EAY95391.1|  hypothetical protein OsI_17229                        58.2    6e-08   Oryza sativa Indica Group [Indian rice]
gb|KHN00089.1|  hypothetical protein glysoja_046125                   57.8    6e-08   Glycine soja [wild soybean]
gb|EMT25602.1|  F-box/WD-40 repeat-containing protein                 60.5    8e-08   Aegilops tauschii
ref|XP_006596580.1|  PREDICTED: uncharacterized protein LOC102666294  58.2    9e-08   Glycine max [soybeans]
ref|XP_002447811.1|  hypothetical protein SORBIDRAFT_06g016240        59.7    9e-08   Sorghum bicolor [broomcorn]
ref|XP_010689711.1|  PREDICTED: uncharacterized protein LOC104903385  60.8    9e-08   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_002515720.1|  conserved hypothetical protein                   57.4    1e-07   
ref|XP_010667851.1|  PREDICTED: uncharacterized protein LOC104884846  57.8    1e-07   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_003613452.1|  hypothetical protein MTR_5g036840                58.5    1e-07   
ref|XP_007213514.1|  hypothetical protein PRUPE_ppa020664mg           57.4    1e-07   Prunus persica
ref|XP_002468357.1|  hypothetical protein SORBIDRAFT_01g044485        57.8    1e-07   Sorghum bicolor [broomcorn]
gb|KEH18875.1|  hypothetical protein MTR_8g031080                     59.7    1e-07   Medicago truncatula
ref|XP_002526185.1|  conserved hypothetical protein                   57.4    1e-07   
ref|XP_010673165.1|  PREDICTED: uncharacterized protein LOC104889605  57.4    1e-07   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010681661.1|  PREDICTED: uncharacterized protein LOC104896591  57.4    1e-07   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010319942.1|  PREDICTED: uncharacterized protein LOC104647070  59.3    1e-07   Solanum lycopersicum
ref|XP_003619023.1|  hypothetical protein MTR_6g032980                56.6    1e-07   
ref|XP_002531371.1|  conserved hypothetical protein                   56.6    1e-07   
gb|KEH25827.1|  hypothetical protein MTR_6g034915                     57.0    1e-07   Medicago truncatula
ref|XP_003592602.1|  hypothetical protein MTR_1g109000                55.8    2e-07   Medicago truncatula
ref|XP_003625876.1|  hypothetical protein MTR_7g108270                56.6    2e-07   
ref|XP_003624433.1|  hypothetical protein MTR_7g083150                58.2    2e-07   
ref|XP_003594303.1|  hypothetical protein MTR_2g027020                57.0    2e-07   Medicago truncatula
ref|XP_008383144.1|  PREDICTED: uncharacterized protein LOC103445866  57.8    2e-07   
ref|XP_007217601.1|  hypothetical protein PRUPE_ppa018407mg           58.9    2e-07   Prunus persica
ref|XP_010680493.1|  PREDICTED: uncharacterized protein LOC104895631  57.0    2e-07   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010680467.1|  PREDICTED: uncharacterized protein LOC104895604  58.5    2e-07   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_008226959.1|  PREDICTED: putative ribonuclease H protein A...  58.9    2e-07   
ref|XP_004308694.1|  PREDICTED: uncharacterized protein LOC101313751  57.0    2e-07   Fragaria vesca subsp. vesca
ref|XP_006473914.1|  PREDICTED: uncharacterized protein LOC102629934  58.2    2e-07   
gb|ABA99010.1|  expressed protein                                     57.8    2e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003621044.1|  hypothetical protein MTR_7g006490                57.8    2e-07   
ref|XP_006485449.1|  PREDICTED: uncharacterized protein LOC102621413  59.7    2e-07   
ref|XP_008243683.1|  PREDICTED: uncharacterized protein LOC103341914  56.6    2e-07   
ref|XP_009378422.1|  PREDICTED: uncharacterized protein LOC103966921  58.5    2e-07   Pyrus x bretschneideri [bai li]
gb|ABN07957.1|  Polynucleotidyl transferase, Ribonuclease H fold      58.5    2e-07   Medicago truncatula
ref|XP_008358038.1|  PREDICTED: uncharacterized protein LOC103421772  57.4    2e-07   
ref|XP_010676258.1|  PREDICTED: uncharacterized protein LOC104892125  56.2    3e-07   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010269328.1|  PREDICTED: uncharacterized protein LOC104606020  56.2    3e-07   Nelumbo nucifera [Indian lotus]
gb|EEC72520.1|  hypothetical protein OsI_05906                        56.2    3e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_003610669.1|  hypothetical protein MTR_5g005740                57.4    3e-07   
ref|XP_010677668.1|  PREDICTED: uncharacterized protein LOC104893266  56.2    3e-07   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_002510892.1|  conserved hypothetical protein                   56.2    3e-07   
ref|XP_003627791.1|  hypothetical protein MTR_8g038340                57.0    3e-07   Medicago truncatula
ref|XP_010696574.1|  PREDICTED: uncharacterized protein LOC104909083  55.8    3e-07   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_003614263.1|  hypothetical protein MTR_5g047250                55.1    3e-07   Medicago truncatula
ref|XP_010686173.1|  PREDICTED: uncharacterized protein LOC104900455  56.6    4e-07   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_003609683.1|  hypothetical protein MTR_4g120000                55.5    4e-07   
gb|KHN02823.1|  hypothetical protein glysoja_043630                   55.5    4e-07   Glycine soja [wild soybean]
ref|XP_003596821.1|  hypothetical protein MTR_2g086490                55.5    4e-07   
ref|XP_010678934.1|  PREDICTED: uncharacterized protein LOC104894413  55.8    4e-07   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|KEH17742.1|  hypothetical protein MTR_0002s1220                    55.8    5e-07   Medicago truncatula
ref|XP_009344564.1|  PREDICTED: uncharacterized protein LOC103936456  56.2    5e-07   Pyrus x bretschneideri [bai li]
ref|XP_007227312.1|  hypothetical protein PRUPE_ppa016553mg           58.5    5e-07   Prunus persica
ref|XP_010688579.1|  PREDICTED: uncharacterized protein LOC104902491  58.5    5e-07   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|EAY96391.1|  hypothetical protein OsI_18290                        58.2    5e-07   Oryza sativa Indica Group [Indian rice]
gb|KDP36415.1|  hypothetical protein JCGZ_08684                       54.7    5e-07   Jatropha curcas
gb|EPS63384.1|  hypothetical protein M569_11402                       56.6    5e-07   Genlisea aurea
ref|XP_003615225.1|  hypothetical protein MTR_5g065390                57.4    5e-07   
gb|EEC75227.1|  hypothetical protein OsI_11496                        58.2    5e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_002893489.1|  hypothetical protein ARALYDRAFT_335919           55.5    5e-07   Arabidopsis lyrata subsp. lyrata
ref|XP_003636292.1|  hypothetical protein MTR_036s0078                55.1    5e-07   
ref|XP_006483194.1|  PREDICTED: putative ribonuclease H protein A...  58.2    5e-07   
ref|XP_009346162.1|  PREDICTED: uncharacterized protein LOC103937909  57.4    6e-07   Pyrus x bretschneideri [bai li]
ref|XP_002300604.2|  hypothetical protein POPTR_0002s00270g           55.5    6e-07   Populus trichocarpa [western balsam poplar]
gb|EEE55133.1|  hypothetical protein OsJ_02920                        58.2    6e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003627352.1|  hypothetical protein MTR_8g022030                57.0    6e-07   
ref|XP_008359305.1|  PREDICTED: uncharacterized protein LOC103423013  55.5    6e-07   
ref|XP_008367209.1|  PREDICTED: uncharacterized protein LOC103430850  55.5    6e-07   
gb|AES80260.2|  hypothetical protein MTR_7g078610                     54.3    6e-07   Medicago truncatula
ref|XP_010233514.1|  PREDICTED: uncharacterized protein LOC104583329  54.7    6e-07   
ref|XP_003616687.1|  hypothetical protein MTR_5g083200                55.8    6e-07   
ref|XP_003623409.1|  hypothetical protein MTR_7g070460                55.1    7e-07   
gb|EEE62189.1|  hypothetical protein OsJ_16976                        57.8    7e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007208881.1|  hypothetical protein PRUPE_ppa026460mg           55.1    7e-07   Prunus persica
ref|XP_003635882.1|  hypothetical protein MTR_014s0022                54.3    7e-07   
ref|XP_003616829.1|  hypothetical protein MTR_5g084710                54.3    8e-07   
ref|XP_009368150.1|  PREDICTED: uncharacterized protein LOC103957683  55.8    9e-07   Pyrus x bretschneideri [bai li]
ref|XP_010682926.1|  PREDICTED: uncharacterized protein LOC104897688  56.2    9e-07   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|AAX94970.1|  retrotransposon protein, putative, unclassified       57.4    9e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010682311.1|  PREDICTED: uncharacterized protein LOC104897185  56.6    1e-06   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009787297.1|  PREDICTED: uncharacterized protein LOC104235275  55.1    1e-06   Nicotiana sylvestris
gb|KEH42462.1|  hypothetical protein MTR_1g069475                     55.8    1e-06   Medicago truncatula
ref|XP_003593670.1|  hypothetical protein MTR_2g014850                53.9    1e-06   
gb|ABK28206.1|  unknown                                               56.2    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007207608.1|  hypothetical protein PRUPE_ppa018906mg           56.6    1e-06   Prunus persica
ref|NP_180979.1|  polynucleotidyl transferase, ribonuclease H-lik...  56.2    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010513785.1|  PREDICTED: uncharacterized protein LOC104789843  55.5    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_009145555.1|  PREDICTED: putative ribonuclease H protein A...  57.0    1e-06   Brassica rapa
gb|AAX95581.1|  hypothetical protein, partial                         56.2    1e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003619331.1|  hypothetical protein MTR_6g046670                54.7    1e-06   Medicago truncatula
ref|XP_003615058.1|  hypothetical protein MTR_5g063110                54.3    1e-06   
ref|XP_006491472.1|  PREDICTED: uncharacterized protein LOC102626455  57.0    1e-06   Citrus sinensis [Valencia orange]
gb|KJB22308.1|  hypothetical protein B456_004G040000                  54.3    1e-06   Gossypium raimondii
ref|XP_006576094.1|  PREDICTED: uncharacterized protein LOC102661466  55.1    1e-06   
gb|EAZ40370.1|  hypothetical protein OsJ_24816                        56.6    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010684219.1|  PREDICTED: putative ribonuclease H protein A...  55.8    2e-06   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_002524117.1|  conserved hypothetical protein                   52.8    2e-06   
ref|XP_003620402.1|  hypothetical protein MTR_6g082440                53.5    2e-06   
ref|XP_008646672.1|  PREDICTED: uncharacterized protein LOC103628202  54.3    2e-06   Zea mays [maize]
ref|XP_008393540.1|  PREDICTED: putative ribonuclease H protein A...  55.8    2e-06   
ref|XP_010683805.1|  PREDICTED: uncharacterized protein LOC104898417  55.5    2e-06   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|KHN23277.1|  hypothetical protein glysoja_040246                   53.5    2e-06   Glycine soja [wild soybean]
ref|XP_003623176.1|  hypothetical protein MTR_7g065310                54.3    2e-06   
gb|KEH31239.1|  hypothetical protein MTR_4g094272                     53.1    2e-06   Medicago truncatula
ref|XP_003603833.1|  hypothetical protein MTR_3g114720                55.5    2e-06   
gb|EEC71228.1|  hypothetical protein OsI_03168                        56.2    2e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_010314573.1|  PREDICTED: uncharacterized protein LOC104645185  55.5    2e-06   Solanum lycopersicum
ref|XP_002467917.1|  hypothetical protein SORBIDRAFT_01g036320        53.1    2e-06   Sorghum bicolor [broomcorn]
ref|XP_008351830.1|  PREDICTED: putative ribonuclease H protein A...  56.2    2e-06   
gb|KHN34964.1|  hypothetical protein glysoja_004730                   53.1    2e-06   Glycine soja [wild soybean]
ref|XP_008646671.1|  PREDICTED: uncharacterized protein LOC103628201  53.9    2e-06   Zea mays [maize]
ref|XP_008654095.1|  PREDICTED: uncharacterized protein LOC103634318  53.9    2e-06   Zea mays [maize]
gb|KHN35662.1|  hypothetical protein glysoja_047989                   52.4    2e-06   Glycine soja [wild soybean]
gb|KEH41802.1|  hypothetical protein MTR_1g054905                     53.5    2e-06   Medicago truncatula
ref|XP_003599939.1|  hypothetical protein MTR_3g049310                53.1    2e-06   
ref|XP_007226560.1|  hypothetical protein PRUPE_ppa024452mg           53.1    2e-06   Prunus persica
ref|XP_002523274.1|  conserved hypothetical protein                   52.8    3e-06   
gb|KHN09137.1|  hypothetical protein glysoja_025598                   52.4    3e-06   Glycine soja [wild soybean]
ref|XP_010675182.1|  PREDICTED: uncharacterized protein LOC104891220  53.9    3e-06   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_007212995.1|  hypothetical protein PRUPE_ppa022768mg           55.8    3e-06   Prunus persica
gb|EEC75445.1|  hypothetical protein OsI_11981                        53.9    3e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_008376986.1|  PREDICTED: putative ribonuclease H protein A...  55.1    3e-06   
gb|KEH25194.1|  hypothetical protein MTR_6g016265                     52.8    3e-06   Medicago truncatula
ref|XP_008646667.1|  PREDICTED: uncharacterized protein LOC103628197  53.9    3e-06   Zea mays [maize]
ref|XP_009378152.1|  PREDICTED: uncharacterized protein LOC103966680  53.9    3e-06   Pyrus x bretschneideri [bai li]
gb|EAY97610.1|  hypothetical protein OsI_19535                        54.3    3e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_003636511.1|  hypothetical protein MTR_043s0014                52.8    4e-06   
gb|KEH37989.1|  hypothetical protein MTR_2g055490                     52.4    4e-06   Medicago truncatula
ref|XP_003589347.1|  Eukaryotic translation initiation factor 3 s...  55.8    4e-06   
gb|KEH40134.1|  hypothetical protein MTR_1g022215                     52.0    4e-06   Medicago truncatula
ref|XP_006285450.1|  hypothetical protein CARUB_v10006875mg           55.1    4e-06   Capsella rubella
ref|XP_009102110.1|  PREDICTED: putative ribonuclease H protein A...  55.5    4e-06   Brassica rapa
tpg|DAA41979.1|  TPA: hypothetical protein ZEAMMB73_722280            53.1    4e-06   Zea mays [maize]
gb|KHN31016.1|  hypothetical protein glysoja_020314                   52.8    4e-06   Glycine soja [wild soybean]
ref|XP_010318134.1|  PREDICTED: uncharacterized protein LOC101246115  53.1    4e-06   Solanum lycopersicum
ref|XP_003609748.1|  hypothetical protein MTR_4g121800                52.4    4e-06   
ref|XP_006418776.1|  hypothetical protein EUTSA_v10003059mg           52.4    5e-06   Eutrema salsugineum
ref|XP_003603227.1|  hypothetical protein MTR_3g105270                52.8    5e-06   
ref|XP_003595161.1|  hypothetical protein MTR_2g039110                52.8    5e-06   
gb|ABF97084.1|  retrotransposon protein, putative, unclassified       55.5    5e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008245775.1|  PREDICTED: uncharacterized protein LOC103343917  54.3    5e-06   
ref|XP_010678553.1|  PREDICTED: uncharacterized protein LOC104894086  53.9    5e-06   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_004959141.1|  PREDICTED: putative ribonuclease H protein A...  55.1    5e-06   
gb|ABD28498.2|  Polynucleotidyl transferase, Ribonuclease H fold      54.7    6e-06   Medicago truncatula
ref|XP_009361347.1|  PREDICTED: uncharacterized protein LOC103951644  52.8    6e-06   
ref|NP_001066197.2|  Os12g0156200                                     55.1    6e-06   
gb|AAX95549.1|  hypothetical protein                                  54.7    6e-06   
gb|AAQ19327.1|  bZIP-like protein                                     55.1    6e-06   
ref|XP_003627706.1|  hypothetical protein MTR_8g036780                51.6    6e-06   
ref|XP_010689862.1|  PREDICTED: uncharacterized protein LOC104903518  52.4    6e-06   
ref|XP_006491602.1|  PREDICTED: uncharacterized protein LOC102623801  54.3    6e-06   
ref|XP_003595330.1|  Zinc finger MYM-type protein                     54.7    6e-06   
ref|XP_002451200.1|  hypothetical protein SORBIDRAFT_05g025720        53.1    6e-06   
ref|XP_011462054.1|  PREDICTED: uncharacterized protein LOC105350808  54.7    6e-06   
ref|XP_008222895.1|  PREDICTED: putative ribonuclease H protein A...  54.7    7e-06   
ref|XP_003593473.1|  Receptor-like kinase CR4                         54.3    7e-06   
emb|CCA65997.1|  hypothetical protein                                 55.1    7e-06   
ref|XP_003599520.1|  NBS-LRR resistance-like protein 1P               54.3    7e-06   
ref|XP_003598204.1|  hypothetical protein MTR_3g008440                52.8    7e-06   
ref|XP_008382173.1|  PREDICTED: uncharacterized protein LOC103444985  52.0    7e-06   
gb|EEC68887.1|  hypothetical protein OsI_37529                        55.1    7e-06   
ref|XP_002455221.1|  hypothetical protein SORBIDRAFT_03g006485        52.4    7e-06   
gb|ADK92871.1|  retrotransposon protein                               54.3    7e-06   
ref|XP_008340367.1|  PREDICTED: uncharacterized protein LOC103403304  52.4    7e-06   
emb|CCA66050.1|  hypothetical protein                                 54.7    8e-06   
ref|XP_003603708.1|  hypothetical protein MTR_3g111390                52.4    9e-06   
ref|XP_008348866.1|  PREDICTED: uncharacterized protein LOC103412039  51.6    9e-06   
ref|XP_010680492.1|  PREDICTED: uncharacterized protein LOC104895629  53.5    1e-05   
ref|XP_008352570.1|  PREDICTED: uncharacterized protein LOC103416078  53.1    1e-05   
ref|XP_002513235.1|  conserved hypothetical protein                   52.0    1e-05   
ref|XP_008345396.1|  PREDICTED: putative ribonuclease H protein A...  53.5    1e-05   
ref|XP_008340805.1|  PREDICTED: uncharacterized protein LOC103403753  53.5    1e-05   
gb|EEE59742.1|  hypothetical protein OsJ_12207                        53.9    1e-05   
ref|XP_002489257.1|  hypothetical protein SORBIDRAFT_0011s003210      53.9    1e-05   
ref|XP_003590531.1|  hypothetical protein MTR_1g070820                52.8    1e-05   
ref|NP_187562.1|  RNase H domain-containing protein                   53.9    1e-05   
gb|AAO19364.1|  hypothetical protein                                  53.9    1e-05   
ref|XP_009113118.1|  PREDICTED: uncharacterized protein LOC103838431  53.1    1e-05   
gb|AAD24831.1|  putative non-LTR retroelement reverse transcriptase   54.3    1e-05   
ref|XP_003599397.1|  hypothetical protein MTR_3g032730                52.8    1e-05   
ref|XP_003622120.1|  Pentatricopeptide repeat-containing protein      53.9    1e-05   
gb|AAK39575.1|AC025296_10  putative reverse transcriptase             53.9    1e-05   
ref|XP_009783270.1|  PREDICTED: uncharacterized protein LOC104231905  53.5    1e-05   
ref|XP_008388887.1|  PREDICTED: uncharacterized protein LOC103451234  53.1    1e-05   
gb|KEH43061.1|  hypothetical protein MTR_1g081930                     50.8    1e-05   
ref|XP_006480206.1|  PREDICTED: uncharacterized protein LOC102628543  51.6    1e-05   
gb|KHN23992.1|  hypothetical protein glysoja_049729                   50.8    1e-05   
gb|ABF98340.1|  expressed protein                                     53.9    1e-05   
ref|XP_009149305.1|  PREDICTED: putative ribonuclease H protein A...  53.9    1e-05   
gb|KJB30629.1|  hypothetical protein B456_005G152500                  50.8    1e-05   
gb|ABN06159.1|  Polynucleotidyl transferase, Ribonuclease H fold      52.8    1e-05   
ref|XP_010673863.1|  PREDICTED: uncharacterized protein LOC104890171  52.0    2e-05   
ref|XP_002530993.1|  conserved hypothetical protein                   50.4    2e-05   
ref|XP_007032521.1|  Uncharacterized protein TCM_018523               53.1    2e-05   
ref|XP_009121368.1|  PREDICTED: putative ribonuclease H protein A...  51.2    2e-05   
ref|XP_007216494.1|  hypothetical protein PRUPE_ppa025352mg           53.1    2e-05   
ref|XP_008359621.1|  PREDICTED: putative ribonuclease H protein A...  53.1    2e-05   
ref|XP_010688984.1|  PREDICTED: uncharacterized protein LOC104902780  52.4    2e-05   
ref|XP_002532287.1|  conserved hypothetical protein                   52.8    2e-05   
ref|XP_009139307.1|  PREDICTED: uncharacterized protein LOC103863297  49.7    2e-05   
gb|ABN07998.1|  Polynucleotidyl transferase, Ribonuclease H fold      51.2    2e-05   
dbj|BAI67988.1|  hypothetical protein                                 52.8    2e-05   
ref|XP_010462877.1|  PREDICTED: uncharacterized protein LOC104743503  52.8    2e-05   
ref|XP_003594668.1|  hypothetical protein MTR_2g033150                50.8    2e-05   
gb|EEE54600.1|  hypothetical protein OsJ_01823                        53.1    2e-05   
gb|EMT20455.1|  Putative cysteine-rich receptor-like protein kina...  53.1    2e-05   
gb|EEE63329.1|  hypothetical protein OsJ_18140                        52.8    2e-05   
gb|ABA99231.1|  hypothetical protein LOC_Os12g34030                   52.8    2e-05   
ref|XP_008228453.1|  PREDICTED: putative ribonuclease H protein A...  53.1    2e-05   
ref|XP_002446679.1|  hypothetical protein SORBIDRAFT_06g020406        52.8    2e-05   
ref|XP_007206269.1|  hypothetical protein PRUPE_ppa016210mg           51.2    2e-05   
ref|XP_010670096.1|  PREDICTED: uncharacterized protein LOC104887198  53.1    2e-05   
ref|XP_006285232.1|  hypothetical protein CARUB_v10006591mg           52.0    2e-05   
gb|KDP37578.1|  hypothetical protein JCGZ_08269                       49.7    2e-05   
ref|XP_006482369.1|  PREDICTED: putative ribonuclease H protein A...  52.8    2e-05   
gb|KEH26346.1|  hypothetical protein MTR_6g453270                     52.4    2e-05   
ref|XP_010480439.1|  PREDICTED: uncharacterized protein LOC104759181  51.2    2e-05   
ref|XP_002883137.1|  hypothetical protein ARALYDRAFT_898220           52.0    2e-05   
gb|EEE57524.1|  hypothetical protein OsJ_07834                        52.4    3e-05   
ref|XP_009796311.1|  PREDICTED: putative ribonuclease H protein A...  50.8    3e-05   
ref|XP_006487889.1|  PREDICTED: uncharacterized protein LOC102617714  53.1    3e-05   
ref|XP_003589740.1|  hypothetical protein MTR_1g038690                49.3    3e-05   
ref|NP_178523.1|  RNase H domain-containing protein                   51.6    3e-05   
ref|XP_003627584.1|  hypothetical protein MTR_8g031800                49.7    3e-05   
ref|XP_008391252.1|  PREDICTED: putative ribonuclease H protein A...  52.8    3e-05   
ref|XP_010445342.1|  PREDICTED: uncharacterized protein LOC104727993  51.6    3e-05   
ref|XP_010665576.1|  PREDICTED: uncharacterized protein LOC104882857  50.8    3e-05   
gb|EEE50824.1|  hypothetical protein OsJ_31232                        53.1    3e-05   
ref|XP_010266099.1|  PREDICTED: uncharacterized protein LOC104603705  50.1    3e-05   
ref|XP_002533065.1|  conserved hypothetical protein                   52.4    3e-05   
ref|XP_010686468.1|  PREDICTED: uncharacterized protein LOC104900675  52.0    3e-05   
gb|EAY97553.1|  hypothetical protein OsI_19481                        52.0    3e-05   
ref|XP_009130050.1|  PREDICTED: putative ribonuclease H protein A...  52.8    3e-05   
emb|CDP16895.1|  unnamed protein product                              51.2    3e-05   
gb|AES68631.2|  hypothetical protein MTR_3g010950                     50.1    3e-05   
ref|XP_004308516.1|  PREDICTED: uncharacterized protein LOC101296245  52.4    3e-05   
ref|XP_008338539.1|  PREDICTED: uncharacterized protein LOC103401606  52.4    3e-05   
ref|XP_003616537.1|  hypothetical protein MTR_5g081540                49.7    3e-05   
ref|XP_010686140.1|  PREDICTED: uncharacterized protein LOC104900422  52.0    3e-05   
ref|XP_002875657.1|  hypothetical protein ARALYDRAFT_347512           52.0    3e-05   
gb|EEC72931.1|  hypothetical protein OsI_06781                        52.0    3e-05   
gb|AAD20714.1|  putative non-LTR retroelement reverse transcriptase   52.8    3e-05   
gb|KEH16790.1|  hypothetical protein MTR_0093s0070                    50.8    4e-05   
ref|XP_009124883.1|  PREDICTED: uncharacterized protein LOC103849922  50.4    4e-05   
ref|XP_008351938.1|  PREDICTED: uncharacterized protein LOC103415381  51.2    4e-05   
ref|XP_006487091.1|  PREDICTED: uncharacterized protein LOC102612209  51.2    4e-05   
ref|XP_010256191.1|  PREDICTED: uncharacterized protein LOC104596624  52.4    4e-05   
ref|XP_003630976.1|  hypothetical protein MTR_8g105730                51.6    4e-05   
ref|XP_006395893.1|  hypothetical protein EUTSA_v10005379mg           49.7    4e-05   
gb|EEE63330.1|  hypothetical protein OsJ_18141                        50.8    4e-05   
ref|XP_010690745.1|  PREDICTED: uncharacterized protein LOC104904243  51.2    4e-05   
ref|XP_008378669.1|  PREDICTED: uncharacterized protein LOC103441749  49.7    4e-05   
ref|XP_003608647.1|  hypothetical protein MTR_4g098780                51.2    4e-05   
gb|AAV43820.1|  hypothetical protein                                  50.8    4e-05   
ref|XP_010693085.1|  PREDICTED: uncharacterized protein LOC104906074  50.4    4e-05   
ref|XP_009799002.1|  PREDICTED: uncharacterized protein LOC104245133  50.4    4e-05   
gb|KEH42714.1|  hypothetical protein MTR_1g074090                     49.7    5e-05   
ref|XP_008343113.1|  PREDICTED: putative ribonuclease H protein A...  51.6    5e-05   
gb|ABN08008.1|  Polynucleotidyl transferase, Ribonuclease H fold      49.7    5e-05   
ref|XP_010672795.1|  PREDICTED: uncharacterized protein LOC104889298  49.7    5e-05   
ref|XP_008657704.1|  PREDICTED: uncharacterized protein LOC103637249  50.4    5e-05   
ref|NP_179015.1|  RNase H domain-containing protein                   50.1    5e-05   
ref|XP_008646690.1|  PREDICTED: uncharacterized protein LOC103628227  50.8    5e-05   
gb|EEC81662.1|  hypothetical protein OsI_25211                        51.6    5e-05   
ref|XP_003598380.1|  hypothetical protein MTR_3g010950                50.1    6e-05   
ref|XP_009346855.1|  PREDICTED: uncharacterized protein LOC103938558  50.8    6e-05   
gb|EEE63328.1|  hypothetical protein OsJ_18139                        50.4    6e-05   
gb|AAO11668.1|  hypothetical protein                                  50.4    6e-05   
ref|XP_003612943.1|  hypothetical protein MTR_5g030850                48.5    6e-05   
ref|XP_008657713.1|  PREDICTED: uncharacterized protein LOC103637261  50.4    6e-05   
ref|XP_003599995.1|  hypothetical protein MTR_3g050230                50.8    6e-05   
ref|XP_003607874.1|  hypothetical protein MTR_4g083950                48.9    7e-05   
ref|XP_002523516.1|  conserved hypothetical protein                   48.9    7e-05   
ref|XP_004963954.1|  PREDICTED: uncharacterized protein LOC101785093  51.6    7e-05   
ref|XP_003623221.1|  hypothetical protein MTR_7g067370                48.9    7e-05   
ref|XP_003598775.1|  hypothetical protein MTR_3g020790                49.7    7e-05   
ref|XP_010675428.1|  PREDICTED: uncharacterized protein LOC104891430  50.8    7e-05   
gb|ABA98491.1|  retrotransposon protein, putative, unclassified       51.6    7e-05   
ref|XP_010676052.1|  PREDICTED: uncharacterized protein LOC104891961  49.7    8e-05   
ref|XP_003615350.1|  hypothetical protein MTR_5g066880                48.5    8e-05   
gb|AAS55787.1|  hypothetical protein                                  51.6    8e-05   
ref|XP_002529707.1|  conserved hypothetical protein                   47.8    8e-05   
ref|XP_008385541.1|  PREDICTED: uncharacterized protein LOC103448077  50.8    8e-05   
ref|XP_008352730.1|  PREDICTED: putative ribonuclease H protein A...  50.8    8e-05   
gb|AAP12989.1|  putative reverse transcriptase                        51.2    9e-05   
ref|XP_007206707.1|  hypothetical protein PRUPE_ppa024042mg           48.9    9e-05   
ref|XP_010687479.1|  PREDICTED: uncharacterized protein LOC104901585  50.8    9e-05   
gb|EAY83065.1|  hypothetical protein OsI_38284                        50.4    9e-05   
ref|XP_010431104.1|  PREDICTED: uncharacterized protein LOC104715396  50.4    9e-05   
ref|XP_008228072.1|  PREDICTED: uncharacterized protein LOC103327517  50.4    1e-04   
ref|XP_003601635.1|  hypothetical protein MTR_3g083790                49.3    1e-04   
ref|XP_003590162.1|  hypothetical protein MTR_1g045340                49.3    1e-04   
ref|XP_003596081.1|  hypothetical protein MTR_2g065980                48.5    1e-04   
gb|EMS52220.1|  Aspartic proteinase nepenthesin-2                     50.8    1e-04   
ref|XP_007226438.1|  hypothetical protein PRUPE_ppa024753mg           50.8    1e-04   
ref|XP_010241360.1|  PREDICTED: uncharacterized protein LOC104585986  50.1    1e-04   
ref|XP_010256193.1|  PREDICTED: uncharacterized protein LOC104596627  50.1    1e-04   
ref|XP_003603884.1|  hypothetical protein MTR_3g116210                49.3    1e-04   
ref|XP_009341350.1|  PREDICTED: uncharacterized protein LOC103933385  50.1    1e-04   
ref|XP_008381948.1|  PREDICTED: uncharacterized protein LOC103444783  49.7    1e-04   
ref|XP_010666759.1|  PREDICTED: uncharacterized protein LOC104883889  50.1    1e-04   
gb|EMS64578.1|  hypothetical protein TRIUR3_16998                     50.4    1e-04   
ref|XP_010101832.1|  hypothetical protein L484_023622                 50.8    1e-04   
ref|XP_009775947.1|  PREDICTED: uncharacterized protein LOC104225779  50.8    1e-04   
ref|XP_008338363.1|  PREDICTED: uncharacterized protein LOC103401427  50.8    1e-04   
ref|XP_006664529.1|  PREDICTED: uncharacterized protein LOC102712133  50.1    1e-04   
ref|XP_002466618.1|  hypothetical protein SORBIDRAFT_01g011130        50.4    1e-04   
gb|ABA94760.1|  Protein kinase domain containing protein, expressed   50.8    1e-04   
ref|XP_002441395.1|  hypothetical protein SORBIDRAFT_09g025860        49.3    1e-04   
ref|XP_003614633.1|  hypothetical protein MTR_5g056500                47.8    1e-04   
ref|XP_010513002.1|  PREDICTED: uncharacterized protein LOC104788940  50.8    1e-04   
ref|XP_003625485.1|  hypothetical protein MTR_7g099650                48.5    1e-04   
gb|EEC73134.1|  hypothetical protein OsI_07152                        50.4    1e-04   
ref|XP_007207182.1|  hypothetical protein PRUPE_ppa017175mg           47.8    2e-04   
ref|XP_003604221.1|  hypothetical protein MTR_4g006750                48.9    2e-04   
gb|EEC83100.1|  hypothetical protein OsI_28249                        50.4    2e-04   
gb|KHN07187.1|  hypothetical protein glysoja_038049                   47.4    2e-04   
gb|EEE54811.1|  hypothetical protein OsJ_02230                        50.4    2e-04   
ref|XP_002456315.1|  hypothetical protein SORBIDRAFT_03g033860        50.1    2e-04   
dbj|BAD72257.1|  hypothetical protein                                 49.7    2e-04   
ref|XP_003614776.1|  hypothetical protein MTR_5g059090                49.7    2e-04   
gb|KEH17434.1|  hypothetical protein MTR_0015s0120                    49.7    2e-04   
ref|XP_008392737.1|  PREDICTED: uncharacterized protein LOC103454919  49.7    2e-04   
ref|XP_010666374.1|  PREDICTED: uncharacterized protein LOC104883530  49.7    2e-04   
ref|XP_010689004.1|  PREDICTED: uncharacterized protein LOC104902799  48.5    2e-04   
gb|EEE63272.1|  hypothetical protein OsJ_18082                        49.7    2e-04   
emb|CCA66188.1|  hypothetical protein                                 50.4    2e-04   
ref|XP_007201492.1|  hypothetical protein PRUPE_ppa014760mg           50.1    2e-04   
ref|XP_002532243.1|  conserved hypothetical protein                   48.9    2e-04   
ref|XP_010669786.1|  PREDICTED: uncharacterized protein LOC104886930  49.7    2e-04   
ref|XP_002458726.1|  hypothetical protein SORBIDRAFT_03g039080        47.8    2e-04   
gb|EEC70889.1|  hypothetical protein OsI_02427                        50.4    2e-04   
ref|XP_009151515.1|  PREDICTED: putative ribonuclease H protein A...  49.7    2e-04   
ref|XP_003615215.1|  hypothetical protein MTR_5g065190                48.9    2e-04   
ref|XP_007013292.1|  Uncharacterized protein TCM_037955               47.8    2e-04   
ref|XP_010670879.1|  PREDICTED: uncharacterized protein LOC104887825  48.9    2e-04   
ref|XP_008343287.1|  PREDICTED: aspartic proteinase-like protein 2    49.7    2e-04   
ref|XP_008344497.1|  PREDICTED: uncharacterized protein LOC103407339  49.3    2e-04   
ref|XP_009768117.1|  PREDICTED: uncharacterized protein LOC104219182  49.7    2e-04   
ref|XP_010422447.1|  PREDICTED: uncharacterized protein LOC104707721  49.3    2e-04   
ref|XP_010666306.1|  PREDICTED: uncharacterized protein LOC104883473  50.1    2e-04   
ref|XP_002525961.1|  hypothetical protein RCOM_0596960                49.3    2e-04   
ref|XP_008366160.1|  PREDICTED: putative ribonuclease H protein A...  49.7    3e-04   
gb|KJB11245.1|  hypothetical protein B456_001G249300                  48.1    3e-04   
ref|XP_010507162.1|  PREDICTED: uncharacterized protein LOC104783743  49.3    3e-04   
ref|XP_002459655.1|  hypothetical protein SORBIDRAFT_02g008050        48.9    3e-04   
ref|XP_007224497.1|  hypothetical protein PRUPE_ppa023013mg           49.7    3e-04   
gb|EEC76169.1|  hypothetical protein OsI_13484                        50.1    3e-04   
gb|EEE53090.1|  hypothetical protein OsJ_35851                        49.7    3e-04   
ref|XP_002467831.1|  hypothetical protein SORBIDRAFT_01g034800        49.3    3e-04   
ref|XP_006292228.1|  hypothetical protein CARUB_v10018434mg           49.3    3e-04   
ref|XP_007214195.1|  hypothetical protein PRUPE_ppa020989mg           49.3    3e-04   
ref|XP_008367994.1|  PREDICTED: uncharacterized protein LOC103431605  49.7    3e-04   
ref|XP_002462405.1|  hypothetical protein SORBIDRAFT_02g025125        49.3    3e-04   
ref|XP_006415078.1|  hypothetical protein EUTSA_v10009492mg           46.6    3e-04   
gb|EEE59920.1|  hypothetical protein OsJ_12548                        49.7    3e-04   
gb|KDO37898.1|  hypothetical protein CISIN_1g042834mg                 46.6    3e-04   
ref|NP_001235218.1|  uncharacterized protein LOC100527633             47.8    3e-04   
ref|XP_010682933.1|  PREDICTED: uncharacterized protein LOC104897695  49.7    3e-04   
ref|XP_009129273.1|  PREDICTED: putative ribonuclease H protein A...  48.9    3e-04   
ref|XP_009601887.1|  PREDICTED: uncharacterized protein LOC104097078  48.5    3e-04   
ref|XP_008243898.1|  PREDICTED: putative ribonuclease H protein A...  48.9    4e-04   
ref|XP_003627271.1|  hypothetical protein MTR_8g020570                48.5    4e-04   
ref|XP_007200256.1|  hypothetical protein PRUPE_ppa015018mg           47.8    4e-04   
gb|AAU89228.1|  hypothetical protein                                  48.1    4e-04   



>ref|XP_006470496.1| PREDICTED: uncharacterized protein LOC102617255 [Citrus sinensis]
Length=440

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 72/132 (55%), Gaps = 15/132 (11%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            WE P  G LK NVD AL      +G G V+RD+   F+AA+   I G F  ++ EA+GVR
Sbjct  281  WEPPVAGRLKCNVDVALFAFRGYIGFGNVIRDSNCAFMAARCCSIPGRFSARDAEALGVR  340

Query  189  EALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFAK  323
            EAL WIK LQ   + +++                SSF LII D + L+    +++F F +
Sbjct  341  EALSWIKQLQLSNVTIEMDCLTVYNALVNNLSGPSSFSLIIEDCRALSNSIRDVSFSFVR  400

Query  324  RSANKVAHLLTR  359
            RSAN VAH + +
Sbjct  401  RSANSVAHYVAQ  412



>ref|XP_006476142.1| PREDICTED: uncharacterized protein LOC102616098 [Citrus sinensis]
Length=510

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 54/152 (36%), Positives = 82/152 (54%), Gaps = 15/152 (10%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W+RP + W K NVDA     +  +  G V++++EG FV A+   +   F  +E EAIGVR
Sbjct  354  WQRPCVWWFKCNVDATTFLSSGTIMYGAVIQNSEGEFVTARSNWLISSFGAREAEAIGVR  413

Query  189  EALKWIKDLQY-----DFIQLQLYSS----------FDLIINDVKELAKDFLNINFLFAK  323
            E L W+K L +     +   LQ++++          F L+I+D + LA+   ++ F F +
Sbjct  414  EILSWLKGLPFLHVIIEMDSLQVFTALTMDSFSPNGFGLLIDDCRALAQSLGDVTFSFVR  473

Query  324  RSANKVAHLLTRETLFKSDCSVYFFIPFPSIV  419
            RSAN  AH +TR   F S    +  IP PS+V
Sbjct  474  RSANSAAHSVTRVGGFLSGLGEWRLIPPPSLV  505



>ref|XP_002531759.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30615.1| conserved hypothetical protein [Ricinus communis]
Length=163

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 67/132 (51%), Gaps = 15/132 (11%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W  P LG +K+N+DA +      MG+G V++D  G FV A  +  +G + P+  E + ++
Sbjct  28   WNTPSLGSMKVNMDATIFSNPDSMGVGCVMKDHAGLFVCAMAVSFAGAYIPEIAEGLAIQ  87

Query  189  EALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFAK  323
            EAL W +D Q   +  +L                SS  LII D K L+    N +F F K
Sbjct  88   EALSWARDRQLLNVVFELDCLHIVEALLRKGTDRSSLGLIIKDCKLLSSSISNCSFAFVK  147

Query  324  RSANKVAHLLTR  359
            RS N+VAH L R
Sbjct  148  RSRNEVAHKLAR  159



>ref|XP_002532007.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30380.1| conserved hypothetical protein [Ricinus communis]
Length=273

 Score = 87.4 bits (215),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 75/144 (52%), Gaps = 15/144 (10%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W  P  GWLK N+D  +   N R+G GF+ ++  GTF AA    ISG   P+  EA+ +R
Sbjct  129  WTCPVEGWLKCNIDVVVFVANNRLGFGFIFQNDSGTFRAATNGLISGPLDPQVAEALSLR  188

Query  189  EALKWIKDLQYDFI--------------QLQLYSS-FDLIINDVKELAKDFLNINFLFAK  323
            E L W+K L  +++              ++ + SS F L+I D +   K+  + + +F K
Sbjct  189  EDLCWVKGLDLNYVVSESDCLTLVNAVNKVGVNSSLFGLLIGDCRSFLKEMNHAHIVFVK  248

Query  324  RSANKVAHLLTRETLFKSDCSVYF  395
            R  N+VAHLL R T  + D   +F
Sbjct  249  RFGNRVAHLLARVTDSEVDHGEWF  272



>ref|XP_006467327.1| PREDICTED: uncharacterized protein LOC102625297 [Citrus sinensis]
Length=412

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            WE+P  GW+K NVDAA+     ++G+G V+R+++G FVAA+ + ++G+F  +E EA+G+R
Sbjct  329  WEQPKFGWVKCNVDAAVFESQGKIGIGCVIRNSQGGFVAARCVSVAGIFGAREAEALGIR  388

Query  189  EALKWIKDLQYDFIQLQL  242
            EAL W+K+LQ   + +++
Sbjct  389  EALSWMKELQIPCVIIEM  406



>ref|XP_003598202.1| 60S ribosomal protein L23 [Medicago truncatula]
Length=547

 Score = 86.7 bits (213),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 69/137 (50%), Gaps = 15/137 (11%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W+ P  G+LK NVDAA+     R G G  +RD  G F+ A      G   P+E EA+G+R
Sbjct  57   WQPPAAGFLKCNVDAAIFSEQNRFGTGMCVRDQRGRFLKAATNWYEGCPPPQEAEAVGLR  116

Query  189  EALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFAK  323
            +A+ W+  L+   +QL+L                + F  II+D + L + F N    F +
Sbjct  117  DAILWLGQLELSNVQLELDCKLVVDSIYDKNNNQAEFGSIIDDCRSLLQQFTNFKISFVR  176

Query  324  RSANKVAHLLTRETLFK  374
            R AN VAH   R ++F+
Sbjct  177  RQANVVAHSFARVSIFQ  193



>ref|XP_002525921.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36441.1| conserved hypothetical protein [Ricinus communis]
Length=191

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 67/133 (50%), Gaps = 12/133 (9%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
             W +P   +LK+N DA +     R G G V+R+     VAA+ + I G+++    EA+ V
Sbjct  52   SWRKPHNEYLKINEDAGIFQAQNRTGYGMVVRNHAANLVAARALIIHGVYEANLAEAMAV  111

Query  186  REALKWIKDLQYDFIQLQLYS------------SFDLIINDVKELAKDFLNINFLFAKRS  329
            REAL WIK + +  + + + S            SF LII+  K +  +  +  F   +RS
Sbjct  112  REALSWIKHMNWSRVSIDMDSLGVCVALTSDNLSFGLIIDGCKHVVANIHDAAFTCIRRS  171

Query  330  ANKVAHLLTRETL  368
             N  AH+L R ++
Sbjct  172  TNHCAHMLARASV  184



>ref|XP_003607468.1| hypothetical protein MTR_4g078340 [Medicago truncatula]
Length=181

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 70/148 (47%), Gaps = 16/148 (11%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
             W+    G  K N+DAA         +G  +RDAEGTFV AK +           EA+G+
Sbjct  21   TWQPHVAGRYKCNIDAAFTSHVNCTCIGICVRDAEGTFVLAKTMTYPCTVSVDVGEALGM  80

Query  186  REALKWIKDLQYDFIQLQLYS-----SFDLIINDVKE-----------LAKDFLNINFLF  317
              AL+W+ D+Q+D +  +  S     +F   +ND+ E            +  F N    F
Sbjct  81   HSALQWLSDMQFDNVDFETDSKLTADAFLSTMNDLSEFGCIIFSCRSLFSTSFSNFRVEF  140

Query  318  AKRSANKVAHLLTRETLFKSDCSVYFFI  401
             ++ AN VAH LTRET   +  +VYF I
Sbjct  141  VRQQANVVAHALTRETTSLASPAVYFDI  168



>ref|XP_006489961.1| PREDICTED: uncharacterized protein LOC102608276 [Citrus sinensis]
Length=190

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 64/108 (59%), Gaps = 15/108 (14%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W+RP +GW+K NVDAA+      +GLG V+R++EG F+ AK     G F  +E EA GVR
Sbjct  83   WKRPHVGWVKCNVDAAVFSSQAMVGLGCVVRNSEGIFLTAKCDRFLGSFGAREAEAFGVR  142

Query  189  EALKWIKDLQY-------DFIQL-----QLYSS---FDLIINDVKELA  287
            EAL W+K LQ+       D +Q+     + +SS   F LII + + LA
Sbjct  143  EALSWLKKLQFPRVIIEIDCLQVFKALTENHSSPNGFGLIIEECRFLA  190



>ref|XP_010670097.1| PREDICTED: uncharacterized protein LOC104887199 [Beta vulgaris 
subsp. vulgaris]
Length=180

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 70/134 (52%), Gaps = 16/134 (12%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            ++W +P  G++K+NVDA    G    GLG V RD  G  +AA        ++P+  EA  
Sbjct  20   SEWSKPSSGFIKVNVDAGF-VGEMGCGLGVVFRDEYGEVLAAGTYQFHVAWEPRIAEAKA  78

Query  183  VREALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLF  317
            +   +K  K++ Y  I+++                 S F+LI++DV +LA+ F N+ + F
Sbjct  79   IFHGVKLAKEMSYSHIEVESDSLLAIQALRSGKGGSSEFNLILDDVLDLARSFDNVIWCF  138

Query  318  AKRSANKVAHLLTR  359
             KRS NKVAH+L  
Sbjct  139  VKRSGNKVAHMLAH  152



>ref|XP_003629388.1| Cytochrome P450 [Medicago truncatula]
Length=687

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 46/142 (32%), Positives = 70/142 (49%), Gaps = 16/142 (11%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            KW +P  G    NVDA+      R+G+G  +RD EG FV AK   ++ L   +  EA+G+
Sbjct  527  KWVKPSPGRFTCNVDASFSQARNRVGIGVCIRDEEGRFVLAKTEWMTPLLDVELGEALGL  586

Query  186  REALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKE-LAKDFLNINFLF  317
              A+ W++DLQ   +  +L                S+F  +IN+ +  LA D +  +  F
Sbjct  587  LSAMHWVRDLQLGIVDFELDSKSVVDSLYGSTSGVSNFSAVINECRRLLASDLVTSDVRF  646

Query  318  AKRSANKVAHLLTRETLFKSDC  383
             +R AN+VAH   R  L +  C
Sbjct  647  IRRQANEVAHSFARVALLEWLC  668



>ref|XP_003593283.1| hypothetical protein MTR_2g009730 [Medicago truncatula]
Length=268

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 68/147 (46%), Gaps = 16/147 (11%)
 Frame = +3

Query  12   ERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVRE  191
            E P  G  K N+DA      +R G+   +RD++ TFV AK +    +      EA+G+  
Sbjct  113  EAPYSGRYKCNIDATFSSRFKRTGIDICVRDSDSTFVLAKTVTYPCIVSVDVGEALGLHS  172

Query  192  ALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFL-NINFLFAK  323
            AL+W+ D+Q+D +  +                 S F  II+  + L   F  N    F +
Sbjct  173  ALQWLSDMQFDSVDFETDSKVTSDAFLSTRNDTSEFGSIISSCRLLFSSFFSNSKVEFVR  232

Query  324  RSANKVAHLLTRETLFKSDCSVYFFIP  404
            R  N V H L RET   ++ +VY+ IP
Sbjct  233  RQTNTVTHALARETTLLANPAVYYDIP  259



>ref|XP_003607028.1| hypothetical protein MTR_4g071380 [Medicago truncatula]
Length=218

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 68/148 (46%), Gaps = 23/148 (16%)
 Frame = +3

Query  21   PLGW-------LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAI  179
            P+GW        K NVD A    + R  +   +RDAEG FV A+ +   G++  +  EA+
Sbjct  61   PVGWHKSAPNRFKCNVDVAFSSFHNRTRIDICIRDAEGVFVLARMVSFPGVYLVEVGEAL  120

Query  180  GVREALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFL-NINF  311
            G+ EAL+W+ D+ ++ I  ++                S F  IIN  K L   F  N   
Sbjct  121  GLFEALQWLSDMSFNNIDFEIDYKITRDVFHSRRKDVSEFGHIINSCKSLFTAFFTNSRV  180

Query  312  LFAKRSANKVAHLLTRETLFKSDCSVYF  395
             F+KR AN  AH L  E  F +    YF
Sbjct  181  EFSKRQANVAAHALAGEATFLASPVTYF  208



>ref|XP_008229542.1| PREDICTED: uncharacterized protein LOC103328904 [Prunus mume]
Length=205

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 70/137 (51%), Gaps = 15/137 (11%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
              W  PP G LKLNVD A      + GLG V+R+  G  + A  +PI+G F  K  E + 
Sbjct  39   THWCPPPPGKLKLNVDGACSTFVWKCGLGAVVRNVHGDLLGAISVPITGCFSAKITELLA  98

Query  183  VREALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLF  317
            +R+ L++  +  YD + ++                + +   IIND+  L+++F +++F+F
Sbjct  99   IRKGLQFAWEANYDSLVVETDAKNAINDIISGTEAFEAAGGIINDIHMLSRNFESLSFVF  158

Query  318  AKRSANKVAHLLTRETL  368
            A +  N VA  L + TL
Sbjct  159  APKLRNTVADRLAKFTL  175



>gb|AES76948.2| hypothetical protein MTR_6g089560 [Medicago truncatula]
Length=232

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 69/138 (50%), Gaps = 16/138 (12%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            KW+ P  G LK NVDA     + R+G+G  LRD EGTFV AK +   G++  +  EA+G+
Sbjct  94   KWQPPASGRLKCNVDATFSIPHNRIGVGICLRDDEGTFVLAKIVNFEGVYSVEVGEALGL  153

Query  186  REALKWIKDLQYDFIQLQLYS-----SFDLIINDVKELAKDFLNINFLFAKRSANKVAHL  350
              A++W+ D+Q D I  ++ S     +F    +D+ E        + + A RS       
Sbjct  154  FHAIQWLSDMQMDNIDFEVDSKIRKDAFTARRDDISEFG------HIVEASRSM-----F  202

Query  351  LTRETLFKSDCSVYFFIP  404
             + E    +   VY+ IP
Sbjct  203  HSEEATLLASAVVYYAIP  220



>ref|XP_003601858.1| Estradiol 17-beta-dehydrogenase [Medicago truncatula]
Length=526

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 48/133 (36%), Positives = 67/133 (50%), Gaps = 16/133 (12%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W++P  G  K N+DA+      R+G+G  +RD  G FV AK    S L +    EA+G+ 
Sbjct  378  WKKPARGRYKCNIDASFSSSLNRVGIGICIRDDAGDFVLAKTDWFSPLCEVTIGEAVGLH  437

Query  189  EALKWIKDLQYDFIQLQLYSSFDL---------------IINDVKELAKD-FLNINFLFA  320
             AL+WI DLQ+D +   L S  D+               II   ++L +D F N +  F 
Sbjct  438  TALQWISDLQFDNVDFALDSKQDVDSFHTGVDDDNELGCIITACRQLFQDSFQNSHVEFN  497

Query  321  KRSANKVAHLLTR  359
            +R AN VAH L R
Sbjct  498  RRQANGVAHELAR  510



>ref|XP_003621450.1| hypothetical protein MTR_7g013520 [Medicago truncatula]
 gb|AES77668.1| glycosyltransferase family 28 protein [Medicago truncatula]
Length=183

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 63/132 (48%), Gaps = 9/132 (7%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W+ P +G  K N DA         G+G  +RDA+GTFV  K          +  EA+G+ 
Sbjct  49   WQPPGVGRYKCNNDATFSSHLNHTGIGICVRDADGTFVLGKAFAYPCSVPVEVGEALGLH  108

Query  189  EALKWIKDLQYDFIQLQLYSSFDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTRETL  368
             AL+W+ D+Q+D +  +          D K  A  FL+     ++  +N VAH L RE  
Sbjct  109  AALQWLSDMQFDNVDFE---------TDSKLTADAFLSSRNDLSEFGSNVVAHALAREAT  159

Query  369  FKSDCSVYFFIP  404
              +  +VYF IP
Sbjct  160  SLASPAVYFDIP  171



>ref|XP_006480463.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=459

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 43/132 (33%), Positives = 67/132 (51%), Gaps = 15/132 (11%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W  P +GWLK N+DA +     R+GLG V+RD  G FVAA    I G + P++ E + +R
Sbjct  305  WSPPRVGWLKCNIDATVFANEGRVGLGSVIRDESGKFVAALCCHIRGNYSPRDAEVLSIR  364

Query  189  EALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFAK  323
            EAL  +K ++   + ++                 +SF  ++ D K +A    +I F F  
Sbjct  365  EALSLLKSMKLSKVIVETDCLQAFNALVDRKCPLNSFGSLVLDCKCIADSIGDIAFSFVG  424

Query  324  RSANKVAHLLTR  359
            RSAN  +H + +
Sbjct  425  RSANSASHFVAK  436



>ref|XP_003620730.1| hypothetical protein MTR_6g089560 [Medicago truncatula]
Length=205

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 69/138 (50%), Gaps = 16/138 (12%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            KW+ P  G LK NVDA     + R+G+G  LRD EGTFV AK +   G++  +  EA+G+
Sbjct  67   KWQPPASGRLKCNVDATFSIPHNRIGVGICLRDDEGTFVLAKIVNFEGVYSVEVGEALGL  126

Query  186  REALKWIKDLQYDFIQLQLYS-----SFDLIINDVKELAKDFLNINFLFAKRSANKVAHL  350
              A++W+ D+Q D I  ++ S     +F    +D+ E        + + A RS       
Sbjct  127  FHAIQWLSDMQMDNIDFEVDSKIRKDAFTARRDDISEFG------HIVEASRSM-----F  175

Query  351  LTRETLFKSDCSVYFFIP  404
             + E    +   VY+ IP
Sbjct  176  HSEEATLLASAVVYYAIP  193



>ref|XP_009623190.1| PREDICTED: uncharacterized protein LOC104114439 [Nicotiana tomentosiformis]
Length=362

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 71/154 (46%), Gaps = 17/154 (11%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            KW  P  G LK N+DA+ D  + R   G ++R     FV     P+         E + V
Sbjct  199  KWFPPDPGTLKCNIDASYDVNSGRAWDGMLIRSTHENFVRGFTTPLEASHDAVIAEILTV  258

Query  186  REALKWIKDLQYDF-IQLQL---------------YSSFDLIINDVKELAKDFLNINFLF  317
            REAL W+K   +   I +++                S FD+I+ D K L  DF +I+  F
Sbjct  259  REALSWLKMQHHKSPITIEMDCLLAKQALERSDNGNSYFDIIVQDCKVLMCDFTSISLSF  318

Query  318  AKRSANKVAHLLTRETLFKSDCSVYFFIPFPSIV  419
             KRSAN+ AH+L R     SD   +   P PS++
Sbjct  319  VKRSANQCAHMLVRAASSMSDAMEWIVHP-PSLI  351



>ref|XP_003597249.1| hypothetical protein MTR_2g094480 [Medicago truncatula]
Length=165

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 71/154 (46%), Gaps = 18/154 (12%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
             WE+P  G  K N+DA+      R+G+   +RD  G FV A+    S L +    EA+G+
Sbjct  14   HWEKPMRGSYKCNIDASFSSSLNRVGIDICIRDDAGDFVLARTDWFSPLCEVTIGEAVGL  73

Query  186  REALKWIKDLQYDFIQL-----QLYSSFDLIINDVKELA-----------KDFLNINFLF  317
              A++WI DLQ+D +       Q+ +SF   ++D  EL              F N +  F
Sbjct  74   HTAMQWILDLQFDNVDFVLDSKQVVNSFHTEVDDDSELGCIITACRQLFQDSFQNSHVKF  133

Query  318  AKRSANKVAHLLTRETLFKSDCSVYFFIPFPSIV  419
              R AN V H L R  +  SD S   +   PS +
Sbjct  134  NMRQANGVTHELAR--VAPSDPSPTIYDDVPSCI  165



>ref|XP_007206484.1| hypothetical protein PRUPE_ppa019056mg, partial [Prunus persica]
 gb|EMJ07683.1| hypothetical protein PRUPE_ppa019056mg, partial [Prunus persica]
Length=298

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 67/148 (45%), Gaps = 15/148 (10%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W  PP G LK N D A D  + R  +G V RDA+G FVAA    +  +   +  E +  
Sbjct  121  RWAAPPSGRLKFNFDGAFDPTSGRGAVGVVARDADGGFVAAVAKSVGEVLSAEHAEILAA  180

Query  186  REALKWIKDL-------QYDFIQL--------QLYSSFDLIINDVKELAKDFLNINFLFA  320
            RE +     L       + D   +        Q YS+   I+ DVK L + F +  F F 
Sbjct  181  REGVALALSLGTASPIFEGDSAVVVSAIKRAGQDYSNIGTIVEDVKHLQQQFPSSLFQFT  240

Query  321  KRSANKVAHLLTRETLFKSDCSVYFFIP  404
             R AN VAH L R  L   D  ++F +P
Sbjct  241  PREANGVAHRLARFGLHNVDNFIWFEVP  268



>ref|XP_003617149.1| hypothetical protein MTR_5g088360 [Medicago truncatula]
Length=156

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 66/131 (50%), Gaps = 8/131 (6%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W +   G LK N+DAA      R+G+G  +R+A G F+ AK +  + +  P+  EA+G+
Sbjct  25   QWAKSHHGRLKYNIDAAFSEVLNRVGVGLCIRNAAGNFIKAKTLWTNPICAPEIGEALGL  84

Query  186  REALKWIKDLQYDFIQLQ-------LYSSFDLIINDVKELAKDFL-NINFLFAKRSANKV  341
               + WI +LQ   + L+       +   F  I+++ K     +  N    F++R  ++V
Sbjct  85   LPTIHWIHELQLSNVDLRWMQRKVLIIFEFGAIVDECKRCCNVYFENSKVEFSRRQVSEV  144

Query  342  AHLLTRETLFK  374
             H L RE LF 
Sbjct  145  PHTLVREALFS  155



>ref|XP_002531249.1| hypothetical protein RCOM_0494170 [Ricinus communis]
 gb|EEF31146.1| hypothetical protein RCOM_0494170 [Ricinus communis]
Length=329

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 73/144 (51%), Gaps = 15/144 (10%)
 Frame = +3

Query  18   PPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREAL  197
            P  G++K NVD A+   + R G G V+RD+ G+FV   +    GLF  K  EAIG+REA+
Sbjct  171  PQPGFVKCNVDGAVFTASGRSGFGMVIRDSAGSFVMGADGSSPGLFNVKLAEAIGLREAV  230

Query  198  KWIKDL-------QYD---FIQLQLYSSFDL-----IINDVKELAKDFLNINFLFAKRSA  332
            +W+  L       +YD    +   L  + DL     +I D + L +   N +  F ++ A
Sbjct  231  QWVLSLGRSNVIFEYDAKVVVDAVLSGAADLFEFGAVIADCRLLLQHGCNYSVQFIRKQA  290

Query  333  NKVAHLLTRETLFKSDCSVYFFIP  404
            N VAH L R +  +   +++   P
Sbjct  291  NLVAHSLARASHLQDGFNMFSVPP  314



>ref|XP_009800085.1| PREDICTED: uncharacterized protein LOC104246050 [Nicotiana sylvestris]
Length=690

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 72/159 (45%), Gaps = 16/159 (10%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            KW  P  G LK N+DA  +  + R   G ++RD  G FV      +         E + V
Sbjct  527  KWFPPDPGTLKCNIDAFYEVNSGRAWAGMLIRDTHGNFVRGFSTLLGASHDAVIAEILTV  586

Query  186  REALKWIKDLQYDF-IQLQL---------------YSSFDLIINDVKELAKDFLNINFLF  317
            REAL W+K   +   I +++                S FD+I+ D KEL +DF +I+  F
Sbjct  587  REALSWLKMQHHRSPITIEMDCLLAKQALERSDSGNSYFDIIVQDCKELMRDFTSISLYF  646

Query  318  AKRSANKVAHLLTRETLFKSDCSVYFFIPFPSIV*YISS  434
             KRSA + AH+L R     SD   +   P   I   I+S
Sbjct  647  VKRSAKQRAHMLARAASSMSDAMEWIVHPLSLIHDVITS  685



>ref|XP_003588770.1| hypothetical protein MTR_1g012560 [Medicago truncatula]
Length=214

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 64/149 (43%), Gaps = 16/149 (11%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W +P  G  K N+D +       +G+G   RD  G FV+AK      L      EA+G 
Sbjct  54   EWSKPAYGRYKCNIDTSFSSSMNMVGIGICFRDDRGEFVSAKIDCFPPLCDVAVGEAVGF  113

Query  186  REALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAK-DFLNINFLF  317
               LKW+ +L YD +   L                S F  I+ D K+L +  F N +  F
Sbjct  114  HTKLKWMAELHYDNVDFALDSKIVVDHFRSSLEDDSEFGCIMYDCKQLFEISFQNSHVEF  173

Query  318  AKRSANKVAHLLTRETLFKSDCSVYFFIP  404
             +R AN VAH L R     +   VY  +P
Sbjct  174  NRRQANGVAHELVRVAPSHASSHVYGNVP  202



>ref|XP_003605183.1| Cytochrome P450 [Medicago truncatula]
Length=348

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 65/133 (49%), Gaps = 16/133 (12%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            KW +P  G  K NVDA+      R+ +G  +RD EG +V AK   +S LF     EA+G+
Sbjct  204  KWIKPSPGRFKCNVDASFSQAQNRVDIGVCIRDEEGRYVLAKTEWMSPLFDVDLGEALGL  263

Query  186  REALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKE-LAKDFLNINFLF  317
              A+ W+++LQ   +  +L                S+F  +IND +  LA D +  +  F
Sbjct  264  LSAMYWVRNLQLGIVDFELDSKIVVDSLYGSKIGVSNFSAVINDCRRLLASDLVTSDVRF  323

Query  318  AKRSANKVAHLLT  356
             +R AN+V   L 
Sbjct  324  IRRQANEVGQWLC  336



>gb|ABD32189.2| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=612

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 59/123 (48%), Gaps = 5/123 (4%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            WERP  G  K NVDA       R+G+G  +RD +G +V AK I    +   +  EA+G+ 
Sbjct  453  WERPSRGRFKCNVDAGFSTSKNRIGIGICVRDDDGAYVLAKTISFDVVHPVRVGEALGLY  512

Query  189  EALKWIKDLQYDFIQLQL-----YSSFDLIINDVKELAKDFLNINFLFAKRSANKVAHLL  353
             AL+W+ D+Q+D +   +     Y +F+   +D+ E          LF+    N     +
Sbjct  513  HALEWLSDMQFDNMDFAMDSKITYDAFNSQKDDISEFGHIISARQSLFSTHFTNSRVEFI  572

Query  354  TRE  362
             R+
Sbjct  573  RRQ  575



>gb|ABD28710.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=393

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/154 (29%), Positives = 72/154 (47%), Gaps = 18/154 (12%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W +P  G LK NVDA+    + ++G+G  +RD+EG  V +K +  S L      EA+G+
Sbjct  233  RWRKPKSGRLKCNVDASFSTSSNKVGIGMCIRDSEGNHVRSKTMWFSPLCPVNIGEALGL  292

Query  186  REALKWIKDLQYDFIQLQLYS---------------SFDLIINDVKELAKDFL-NINFLF  317
              A +WI +LQ   +  ++ S                F  I+ +  +    FL N +  F
Sbjct  293  YHATRWINELQLTNVDFEVDSKTIADYFNKARGDNTEFGSIMENTIQFCNIFLTNSHVEF  352

Query  318  AKRSANKVAHLLTRETLFKSDCSVYFFIPFPSIV  419
             +R AN+VAH L +        S + F   P+ +
Sbjct  353  TRRQANEVAHELAKAATLGP--SFHIFDESPTCI  384



>gb|KJB20572.1| hypothetical protein B456_003G154500 [Gossypium raimondii]
Length=226

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 65/136 (48%), Gaps = 24/136 (18%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            KW  PP G+ K+NVDA L   N R  LGF++R+AEG F+    +  S +      EAI V
Sbjct  77   KWSPPPQGYFKINVDAGLSVANNRAVLGFIIRNAEG-FIMGHNLVHSMVIA----EAIAV  131

Query  186  REALKWIKDLQYDFIQLQLYSSFDLIIN-----------------DVKELAKDFLNINFL  314
             + L++  D+   F ++ L S   L++N                 DVK LA+ FL   F 
Sbjct  132  LDGLQFALDM--GFSKVILESDSRLVVNNIQKSSEDYSESRPFTWDVKNLARKFLCCRFQ  189

Query  315  FAKRSANKVAHLLTRE  362
            F  R  N  AH L  E
Sbjct  190  FVAREGNGAAHALVVE  205



>ref|XP_002517530.1| Disease resistance protein RPS5, putative [Ricinus communis]
 gb|EEF44694.1| Disease resistance protein RPS5, putative [Ricinus communis]
Length=1066

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/78 (40%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +3

Query  9     WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
             W +PP GWL +N DAA      R G G + RD  G F+AA+ + + G F+ ++ EA+GVR
Sbjct  941   WFKPPQGWLIVNADAATFGRENRTGWGMIARDGSGYFIAARALSLDGCFEVRDAEAMGVR  1000

Query  189   EALKWIKDLQYDFIQLQL  242
             EAL W   + ++ + L++
Sbjct  1001  EALSWANQMGWNAVVLEM  1018



>ref|XP_003624705.1| hypothetical protein MTR_7g086560 [Medicago truncatula]
Length=256

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 66/148 (45%), Gaps = 16/148 (11%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W+    G  + N+  A        GLG  +RD+EGTFV AK +    L+     EA+G+ 
Sbjct  97   WQHLLPGRYECNIHDAFFSHLNHTGLGICVRDSEGTFVLAKFVSYPCLYYVDVGEALGLH  156

Query  189  EALKWIKDLQYDFIQLQLYS---------------SFDLIINDVKELAKDFL-NINFLFA  320
              L+W+ D+Q+D +  +  S                F  I +  + L   F  N    F 
Sbjct  157  STLQWLSDMQFDNVDFETDSKLTCDAFHANRDDTYEFWCITSSCRSLFSSFFTNSRVEFV  216

Query  321  KRSANKVAHLLTRETLFKSDCSVYFFIP  404
            +R AN+V H+L  + +  +   VYF IP
Sbjct  217  RRQANRVVHVLAGDAMLLAGPVVYFHIP  244



>gb|ABN06084.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=519

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 59/123 (48%), Gaps = 5/123 (4%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            WERP  G  K NVDA       R+G+G  +RD +G +V AK I    +   +  EA+G+ 
Sbjct  360  WERPSRGRFKCNVDAGFSTSKNRIGIGICVRDDDGAYVLAKTISFDVVHPVRVGEALGLY  419

Query  189  EALKWIKDLQYDFIQLQL-----YSSFDLIINDVKELAKDFLNINFLFAKRSANKVAHLL  353
             AL+W+ D+Q+D +   +     Y +F+   +D+ E          LF+    N     +
Sbjct  420  HALEWLSDMQFDNMDFAMDSKITYDAFNSQKDDISEFGHIISARQSLFSTHFTNSRVEFI  479

Query  354  TRE  362
             R+
Sbjct  480  RRQ  482



>ref|XP_002512628.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50080.1| conserved hypothetical protein [Ricinus communis]
Length=223

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 63/125 (50%), Gaps = 15/125 (12%)
 Frame = +3

Query  75   RMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQL----  242
            ++G+  V+ D+ GTFVA     + GLF+P+  EA+ ++EA++W   +++  +  +     
Sbjct  84   KIGMAAVVSDSNGTFVACMAHAVLGLFEPRLAEAVALKEAIRWAIQMRFSLVVFESDSKI  143

Query  243  -----------YSSFDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTRETLFKSDCSV  389
                       +S F +II++ + L    LN    F KR AN VAH+L   +   +  + 
Sbjct  144  AVDAIRSLAADWSEFGIIIDECRSLLSLGLNFQVYFVKRQANMVAHVLAMSSYSYASLAT  203

Query  390  YFFIP  404
            +  IP
Sbjct  204  WNVIP  208



>ref|XP_003612608.1| Replication protein A 70 kDa DNA-binding subunit [Medicago truncatula]
Length=1723

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 49/153 (32%), Positives = 71/153 (46%), Gaps = 18/153 (12%)
 Frame = +3

Query  9     WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
             W +P  G  K NVDAA    + R+G+G  +RD  G  V A+    + L    E EAIG+ 
Sbjct  1564  WRKPDEGHFKCNVDAAFFKESNRVGIGICIRDDSGRLVKARTSWSTLLLDVPEGEAIGLL  1623

Query  189   EALKWIKDLQYDFIQLQLYS-----SFDLIINDVKEL-----------AKDFLNINFLFA  320
              A++W K+   + I  +L S     SF    NDV +L           +  F N    F 
Sbjct  1624  YAIRWAKEQNLNNITFELDSKRVVYSFHNTRNDVSDLGAIIRECRTTFSSFFTNSRVEFI  1683

Query  321   KRSANKVAHLLTRETLFKSDCSVYFFIPFPSIV  419
             +R AN+V H L R   F +  S+++F   P  +
Sbjct  1684  RRQANEVVHSLARAATFYA--SIHYFTVLPDCI  1714



>ref|XP_007203452.1| hypothetical protein PRUPE_ppa022115mg [Prunus persica]
 gb|EMJ04651.1| hypothetical protein PRUPE_ppa022115mg [Prunus persica]
Length=1755

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 50/153 (33%), Positives = 70/153 (46%), Gaps = 16/153 (10%)
 Frame = +3

Query  6     KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
             +W  PP G LK N D A D  + R  +G V RDA+G FVAA    +  +   +  E +  
Sbjct  1578  RWAAPPSGRLKFNFDGAFDPTSGRGAVGVVARDADGGFVAAVAKSVGEVLSAEHAEILAA  1637

Query  186   REALKWIKDL-------QYDFIQL--------QLYSSFDLIINDVKELAKDFLNINFLFA  320
             RE +     L       + D   +        Q YS+   I+ DVK L + F +  F F 
Sbjct  1638  REGVALALSLGTASPIFEGDSAVVVSAIKRAGQDYSNIGTIVEDVKHLQQQFPSSLFQFT  1697

Query  321   KRSANKVAHLLTRETLFKSDCSVYFFIPFPSIV  419
              R AN VAH L R  L   D  ++F +P P ++
Sbjct  1698  PREANGVAHRLARFGLHNVDNFIWFEVP-PDLI  1729



>ref|XP_002518871.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43404.1| conserved hypothetical protein [Ricinus communis]
Length=668

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            KW +P LGWLK+N D AL     R+GLG V+RD+ G  + A+     G F  +E EA+ +
Sbjct  587  KWTKPELGWLKINTDTALFLKQGRIGLGCVVRDSNGRMIMARSERRVGRFTAREAEALSM  646

Query  186  REALKWIKDLQYD  224
            +EAL ++KD Q D
Sbjct  647  KEALSYMKDYQMD  659



>ref|XP_010690674.1| PREDICTED: uncharacterized protein LOC104904177 [Beta vulgaris 
subsp. vulgaris]
Length=280

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 63/134 (47%), Gaps = 16/134 (12%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
              W +P   W+K+NVDA L  G+   G+G V  D  G  +AA        ++ +  EA  
Sbjct  120  TSWAKPAPHWMKVNVDAGL-VGSLGCGIGVVCWDYMGEVLAASTFQFHETWETRVAEAKA  178

Query  183  VREALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLF  317
            +   LK   +L Y  ++++                 S F LII+DV +L   F N+ + F
Sbjct  179  IFYGLKVALELGYAHVEVESDSLLAIQALRSGKGGSSDFHLIIDDVLDLVSSFSNVEWSF  238

Query  318  AKRSANKVAHLLTR  359
             KRS NKVAH+L  
Sbjct  239  VKRSGNKVAHMLAH  252



>ref|XP_003613409.1| hypothetical protein MTR_5g036320 [Medicago truncatula]
 gb|AES96367.1| transmembrane protein, putative [Medicago truncatula]
Length=145

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W++P  G  K NV AA      R+G+G  +RD +G+FV AK   IS + K  E EA+GV 
Sbjct  58   WKKPDRGRYKCNVGAAFSTATNRVGIGICIRDDQGSFVLAKTKWISPILKVDEGEALGVS  117

Query  189  EALKWIKDLQYDFIQLQLY  245
             A++W+KDL+ + +   L+
Sbjct  118  YAIRWLKDLRINNVIFVLH  136



>ref|XP_010687523.1| PREDICTED: uncharacterized protein LOC104901631 [Beta vulgaris 
subsp. vulgaris]
Length=333

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 63/130 (48%), Gaps = 16/130 (12%)
 Frame = +3

Query  15   RPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREA  194
            RP  G +KLNVDA    G    GLG V RD +G  +AA        ++P+  EA  +   
Sbjct  177  RPTAGHVKLNVDAG-KTGVGGCGLGAVFRDVDGVVLAAGSFQCHDTWEPRVAEAKAIYFG  235

Query  195  LKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFAKRS  329
            +K  K+L Y  ++++                 S F LII+D+      F N+++ F KRS
Sbjct  236  IKLAKELGYRLVEVESDSLLAIQALKNGRTGCSEFHLIIDDILAFVGCFDNVSWSFVKRS  295

Query  330  ANKVAHLLTR  359
             N+VAHLL  
Sbjct  296  GNRVAHLLAH  305



>ref|XP_006378610.1| hypothetical protein POPTR_0010s18040g, partial [Populus trichocarpa]
 gb|ERP56407.1| hypothetical protein POPTR_0010s18040g, partial [Populus trichocarpa]
Length=146

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 63/125 (50%), Gaps = 6/125 (5%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            KW++PP+G+LK N D  +      MG GFV+R+ EG  V      I G F P   EA+ +
Sbjct  8    KWDKPPVGFLKCNTDVGILDQGAAMGAGFVIRNNEGAVVYCGCWEIIGFFSPTLAEALCL  67

Query  186  REALKWI--KDLQYDFIQLQ----LYSSFDLIINDVKELAKDFLNINFLFAKRSANKVAH  347
            +  L+++  + L    I+L     + S   +I  D + L     + N    + SAN VAH
Sbjct  68   KNVLQFMISQGLSNFLIELDAKIVVDSGTGMIFEDCRGLINRGSSFNLCNVRISANVVAH  127

Query  348  LLTRE  362
             L+++
Sbjct  128  CLSKK  132



>ref|XP_007217321.1| hypothetical protein PRUPE_ppa019733mg [Prunus persica]
 gb|EMJ18520.1| hypothetical protein PRUPE_ppa019733mg [Prunus persica]
Length=1275

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 50/153 (33%), Positives = 70/153 (46%), Gaps = 16/153 (10%)
 Frame = +3

Query  6     KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
             +W  PP G LK N D A D  + R  +G V RDA+G FVAA    +  +   +  E +  
Sbjct  1098  RWAAPPSGRLKFNFDGAFDPTSGREAVGVVARDADGGFVAAVAKSVGEVLSAEHAEILVA  1157

Query  186   REALKWIKDL-------QYDFIQL--------QLYSSFDLIINDVKELAKDFLNINFLFA  320
             RE +     L       + D   +        Q YS+   I+ DVK L + F +  F F 
Sbjct  1158  REGVALALSLGTASPIFEGDSAVVVSAIKRAGQDYSNIGTIVEDVKHLQQQFPSSLFQFT  1217

Query  321   KRSANKVAHLLTRETLFKSDCSVYFFIPFPSIV  419
              R AN VAH L R  L   D  ++F +P P ++
Sbjct  1218  PREANGVAHRLARFGLHNVDNFIWFEVP-PDLI  1249



>gb|ABN08952.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=238

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 66/141 (47%), Gaps = 17/141 (12%)
 Frame = +3

Query  33   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKD  212
            LK N+DA+      R G+G   RD EG FV AK +  + +      EA+G+  AL+W+ D
Sbjct  88   LKCNIDASFSISQNRTGIGLC-RDGEGNFVLAKTMNFAVVHAADVREALGLYHALEWLWD  146

Query  213  LQYDFI---------QLQLY------SSFDLIINDVKE-LAKDFLNINFLFAKRSANKVA  344
            +Q D I         QL  Y      S F  +I   +  L+  F N    F +R A++VA
Sbjct  147  MQLDNIDFEVDSRTTQLAFYARKDDVSEFGNVITACRGILSTKFTNSRVEFIQRQADEVA  206

Query  345  HLLTRETLFKSDCSVYFFIPF  407
            H+   E       ++Y+ +P 
Sbjct  207  HVFVGEATLVVSPTIYYHVPL  227



>ref|XP_008346598.1| PREDICTED: uncharacterized protein LOC103409561 [Malus domestica]
Length=216

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 74/153 (48%), Gaps = 17/153 (11%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            KW  PP G LKLNVD A        G+G +  D+ GTFVAA       +F P   EA+ +
Sbjct  54   KWSCPPPGRLKLNVDGAWCKETNLGGVGLIFWDSNGTFVAATSRRFGDIFSPIHIEALAI  113

Query  186  REAL-----KWIKDLQYDFIQLQLYSSF---DLIINDVKELAKDFLNINFLFA-------  320
            RE L     + ++ +  +   LQ+ S+     L ++ ++ + +D +++  L         
Sbjct  114  REGLLMAIERGVQSISLESDSLQIISALKESSLNVSTIEPIIEDTISLLLLVTEATAYNV  173

Query  321  KRSANKVAHLLTRETLFKSDCSVYFFIPFPSIV  419
            +  AN VAH L R  L+   C+  +F   PS++
Sbjct  174  RHQANFVAHRLARFALYGXGCT--WFDETPSMI  204



>ref|XP_003594556.1| hypothetical protein MTR_2g030550 [Medicago truncatula]
Length=152

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 63/140 (45%), Gaps = 16/140 (11%)
 Frame = +3

Query  33   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKD  212
            LK N+DAA       +G G  +RD  G FVAAK +  S +      EA+G+  A++W+ +
Sbjct  5    LKCNLDAAFSSSLNVIGFGMCIRDEVGQFVAAKTLRSSPICDSSIGEALGLSYAIQWVHE  64

Query  213  LQYDFIQLQL---------------YSSFDLIINDVKELAKD-FLNINFLFAKRSANKVA  344
            LQ   +  ++                S F  II+D +      F N    F +R AN VA
Sbjct  65   LQLTNVDFEMDAKRAVDYYIKGSNDISEFGAIIDDCRRRCCSWFENSKIEFNRRQANIVA  124

Query  345  HLLTRETLFKSDCSVYFFIP  404
            H + RE +  +    +  +P
Sbjct  125  HTIAREAILLTSSQTFNVVP  144



>gb|KDP24857.1| hypothetical protein JCGZ_24451 [Jatropha curcas]
Length=104

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W+RPP GW+K+NVDA+L      +G+G V+RD+   F+AA+   I  L   K  EAI +R
Sbjct  29   WQRPPPGWIKINVDASLGGSGGFVGIGAVVRDSHAHFLAARTWGIPDLLDAKSAEAIAIR  88

Query  189  EALKWIKDLQY  221
            E L WIKD  Y
Sbjct  89   EVLSWIKDKVY  99



>gb|EEE56566.1| hypothetical protein OsJ_05904 [Oryza sativa Japonica Group]
Length=420

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/144 (28%), Positives = 66/144 (46%), Gaps = 16/144 (11%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
             W  PP G   +N DAA+    R+MG+G V+RD  G  + A      G+  P+  EA  +
Sbjct  261  SWVPPPAGVFLINTDAAVFQAERQMGVGVVIRDQHGNCLLAANTRFMGITDPETAEACAI  320

Query  186  REALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFA  320
            R AL   K+  +  + +                  S    ++ D+K+L  +F++++F+  
Sbjct  321  RHALWLAKEEGFHNVIVACDCLSVIQKLNSPGRDRSKIGCLVEDIKKLGVEFISVSFIHV  380

Query  321  KRSANKVAHLLTRETLFKSDCSVY  392
               +N  AH L R +   S C+VY
Sbjct  381  SHCSNVAAHTLARCSE-PSVCNVY  403



>ref|XP_003624042.1| hypothetical protein MTR_7g078610 [Medicago truncatula]
Length=187

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 65/141 (46%), Gaps = 16/141 (11%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W++P  G  K NVDAA      R G+G  LRD EG FV AK      L +      + V 
Sbjct  42   WQKPTSGQYKCNVDAAFSSNFNRTGIGICLRDEEGAFVLAKMTSFPCLHQ------VTVG  95

Query  189  EALKWIKDLQYDF-IQLQLY-------SSFDLIINDVKEL-AKDFLNINFLFAKRSANKV  341
            EA+  I D + D  I    +       S F  +I   K L +  F+N    F +R AN V
Sbjct  96   EAMNNI-DFELDSKITCDAFRSSRDDVSEFRHVIASCKALFSTFFINSRVEFTRRLANVV  154

Query  342  AHLLTRETLFKSDCSVYFFIP  404
            A+ L RE  F +   +Y+ IP
Sbjct  155  AYALVREATFLASPVIYYHIP  175



>ref|XP_006483704.1| PREDICTED: uncharacterized protein LOC102620092 [Citrus sinensis]
Length=340

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 69/141 (49%), Gaps = 16/141 (11%)
 Frame = +3

Query  30   WLKL-NVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  206
            WLK+ +VDAA+        LG V+R A+  F+AAK     G  + +E EAI VREAL W+
Sbjct  196  WLKVGSVDAAITSSRGMFSLGAVIRSAQCDFIAAKSDFFPGRVEAREAEAIEVREALSWL  255

Query  207  KDLQY-----DFIQLQLYSS----------FDLIINDVKELAKDFLNINFLFAKRSANKV  341
            K   +     D   LQ++++          F  II+D + L +    + F F + SAN  
Sbjct  256  KKFAFYSVILDMDSLQVFNALHDKTSYFNGFGSIIDDCRALVRSLGEVVFSFVRGSANSA  315

Query  342  AHLLTRETLFKSDCSVYFFIP  404
            A  + +     SD   + F+P
Sbjct  316  AFTVAQVGSSMSDSGEWRFVP  336



>ref|XP_003595869.1| hypothetical protein MTR_2g062740 [Medicago truncatula]
Length=155

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 65/139 (47%), Gaps = 16/139 (12%)
 Frame = +3

Query  33   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKD  212
            LK NVDAA     +R G+   LRD  GTFV AK +    ++     EA+G+  A++W++D
Sbjct  4    LKYNVDAAFSETFQRTGIRVCLRDNHGTFVLAKVLQFDQVYPVAVGEALGLYHAIQWMQD  63

Query  213  LQYDFIQLQLYS-----SFDLIINDVKELA-----------KDFLNINFLFAKRSANKVA  344
            +Q+D +  +L S     +F  +  DV E               F N    F +R  N  A
Sbjct  64   MQFDNVDFKLDSKIKRDAFHSLETDVTEFGNIIDECRVQFFSSFTNSRVEFIRRQMNVAA  123

Query  345  HLLTRETLFKSDCSVYFFI  401
            H L R+       ++Y+ I
Sbjct  124  HGLARKVTSLISPNIYYVI  142



>ref|XP_003607370.1| LCR-like protein [Medicago truncatula]
Length=141

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 63/133 (47%), Gaps = 19/133 (14%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W+ P   +LK NVDAA+    R  G+G  +RD+ G F+ A              +A+G+
Sbjct  16   RWQPPDADYLKCNVDAAIFEEQRSFGIGICIRDSRGNFIKA------------STKAMGL  63

Query  186  REALKWIKDLQYDFIQLQLYSSFDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTRET  365
            R+A+ W+  L    +Q++L           + L + F N    F +  AN VAH L RE+
Sbjct  64   RDAILWLGQLGLSKVQIELD-------RKCRSLLQQFSNFKINFVRIQANYVAHGLARES  116

Query  366  LFKSDCSVYFFIP  404
               +   V+  IP
Sbjct  117  KLYARHHVFDSIP  129



>ref|XP_008231652.1| PREDICTED: uncharacterized protein LOC103330817 [Prunus mume]
Length=205

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 64/133 (48%), Gaps = 15/133 (11%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
             W  P  G L+L VD A      + GLG V+R+  G  + A  +PI+G F  K  E + +
Sbjct  40   HWCPPLSGKLRLYVDGACSTSIWKRGLGAVVRNVHGDLMGAISVPITGCFSAKTTELLAI  99

Query  186  REALKWIKDLQYDFIQL---------------QLYSSFDLIINDVKELAKDFLNINFLFA  320
            RE L++  +  YD + +               + +     IIND+  L+++F +++F+FA
Sbjct  100  REGLQFAWEAGYDSLVVESDAKNAINDIVTGTEAFGVAGGIINDIHMLSRNFDSLSFVFA  159

Query  321  KRSANKVAHLLTR  359
                N VA  L +
Sbjct  160  SILCNTVADRLAK  172



>ref|XP_007225095.1| hypothetical protein PRUPE_ppa016563mg, partial [Prunus persica]
 gb|EMJ26294.1| hypothetical protein PRUPE_ppa016563mg, partial [Prunus persica]
Length=925

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 48/153 (31%), Positives = 69/153 (45%), Gaps = 16/153 (10%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W  P  G LK N D A D  + R  +G V RDA+G FVAA    +  +   +  E +  
Sbjct  729  RWAAPSSGRLKFNFDGAFDPTSGRGAVGVVARDADGGFVAAVAKSVGEVLSAEHAEILAA  788

Query  186  REALKWIKDL-------QYDFIQL--------QLYSSFDLIINDVKELAKDFLNINFLFA  320
            RE +     L       + D   +        Q YS+   I+ DVK L + F +  F F 
Sbjct  789  REGVALALSLGTASPIFEGDSAVVVSAVKRAGQDYSNIGTIVEDVKHLQQQFPSSLFQFT  848

Query  321  KRSANKVAHLLTRETLFKSDCSVYFFIPFPSIV  419
             R AN V H L R  L+  D  ++F +P P ++
Sbjct  849  PREANGVVHRLARFGLYNVDNFIWFEVP-PDLI  880



>ref|XP_003614116.1| hypothetical protein MTR_5g045010 [Medicago truncatula]
Length=147

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 58/122 (48%), Gaps = 16/122 (13%)
 Frame = +3

Query  75   RMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQL----  242
            R G+G  LR+++G+FV AK +    L      EA+G+R  L+W+ D+Q+D +  +     
Sbjct  10   REGIGICLRESDGSFVLAKTVTHPCLLPVDVGEALGLRLVLQWLSDMQFDNVDFETDFKL  69

Query  243  -----------YSSFDLIINDVKELAKD-FLNINFLFAKRSANKVAHLLTRETLFKSDCS  386
                        S F  II+  + L    F N    F +R AN VAH L RE    +  +
Sbjct  70   TSDAFLSDRNDTSEFGCIISSCRSLFTSLFSNSRVKFVRRQANGVAHALAREATLLASPA  129

Query  387  VY  392
            VY
Sbjct  130  VY  131



>ref|XP_002465515.1| hypothetical protein SORBIDRAFT_01g040340 [Sorghum bicolor]
 gb|EER92513.1| hypothetical protein SORBIDRAFT_01g040340 [Sorghum bicolor]
Length=778

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 75/161 (47%), Gaps = 22/161 (14%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            + W  P  G +K+NVDAAL   +RR+ +  + RD EG ++ A  +   G+ +P+  E + 
Sbjct  619  STWIPPAAGQVKINVDAALSKNSRRIAVAAIARDCEGKYLGASGLVFEGITEPEIAEILA  678

Query  183  VREALKWIKDLQYDFI--QLQLYSSFD---------------LIINDVKELAKDFLNINF  311
             RE L    DL  D +   L+L S  D                I+ ++ + A+ F  + F
Sbjct  679  CREGL----DLASDLLVTSLRLASDCDNAIRSLKGDGMGPYGQIVKEINDRARVFSAVEF  734

Query  312  LFAKRSANKVAHLLTRE-TLFKSDCSVYFFIPFPSIV*YIS  431
            +   R  N  AH + R   L ++D  V+F  P   +  Y++
Sbjct  735  VHENRQVNIDAHCIARSLVLAETDRHVWFVEPPCGVCNYVN  775



>ref|XP_010667872.1| PREDICTED: uncharacterized protein LOC104884867 [Beta vulgaris 
subsp. vulgaris]
Length=183

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 64/134 (48%), Gaps = 16/134 (12%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            AKW+ P  G  KLN DAAL  GN+ +G+G V+RD +G  V A      G       EA+ 
Sbjct  21   AKWKAPCAGIYKLNTDAALLPGNQ-VGIGGVVRDHDGEVVVALCCREQGGSDVAVAEALS  79

Query  183  VREALKWIK-----------DLQYDFIQLQ----LYSSFDLIINDVKELAKDFLNINFLF  317
             R+ ++              D Q  F  L+      S F  I+ND++ +A +   + F  
Sbjct  80   ARKGIQVAMQAGFSRLMVEVDCQQLFFHLKERRSTASPFGKIVNDIQVMASNCQQVVFSH  139

Query  318  AKRSANKVAHLLTR  359
             +RS NKVAH L +
Sbjct  140  VRRSGNKVAHCLAQ  153



>ref|XP_008226303.1| PREDICTED: uncharacterized protein LOC103325890 [Prunus mume]
Length=271

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 64/149 (43%), Gaps = 19/149 (13%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W +P  G LK+NVD +   GN   G+G V+RD+ G FVA + + +  +F   + EA+  R
Sbjct  111  WTKPCAGSLKINVDGSWTAGNTYGGVGIVVRDSNGKFVAGRALHVDNVFSALQVEAMAAR  170

Query  189  EALKWIKDLQYDFI-------QLQLYSSF----------DLIINDVKELAKDFLNINFLF  317
            E    I  ++ DF         LQ+ S+             ++ D K L        F  
Sbjct  171  EGA--ILAVEGDFNNAIFESDSLQIVSAIRSSSVDRSNVGPVVEDTKALLTQITGDGFTH  228

Query  318  AKRSANKVAHLLTRETLFKSDCSVYFFIP  404
             +R AN  AH L R        + +F  P
Sbjct  229  IRRVANGAAHRLARYASHTGTMTTWFEEP  257



>ref|XP_003593785.1| hypothetical protein MTR_2g017550 [Medicago truncatula]
Length=197

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W  P LG  K N+DAA     +   +G  LRD  GTFV AK +    L+     EA+G+
Sbjct  119  QWMPPSLGRYKCNIDAAFSNQFQWTSIGVCLRDDSGTFVLAKTLQFHHLYLVVVGEALGL  178

Query  186  REALKWIKDLQYDFIQLQ  239
              AL+W +D+ +D+IQ Q
Sbjct  179  FHALRWPQDIHFDYIQRQ  196



>ref|XP_006464882.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=769

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 70/143 (49%), Gaps = 15/143 (10%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W+ PP GW K+NVDAA+   N+R+GLG V+R++EG F+ A   P   L +    EA   R
Sbjct  610  WKCPPAGWFKVNVDAAIKLENQRVGLGIVIRNSEGKFITAAIKPSKWLDRVDYAEAEATR  669

Query  189  EALKWIKDLQ-------------YDFIQLQLYSSFDL--IINDVKELAKDFLNINFLFAK  323
              L+  +                 D +  +  +  ++  I+++V++  K   ++    + 
Sbjct  670  FGLEVAESAGCLPLIVETDSKEVTDLVSARKSTKAEIFWIVSEVQDTMKRLKHVKIQHSP  729

Query  324  RSANKVAHLLTRETLFKSDCSVY  392
            R+ N  AH L +  L  +DC ++
Sbjct  730  RTCNGFAHTLAKLVLDYTDCVIW  752



>ref|XP_003599959.1| hypothetical protein MTR_3g049770 [Medicago truncatula]
Length=136

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 59/125 (47%), Gaps = 9/125 (7%)
 Frame = +3

Query  36   KLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDL  215
            K N++AA      R  +G  + DAEGTFV AK             EA+G+   ++W+ D+
Sbjct  10   KCNIEAAFSSHANRTCIGICVWDAEGTFVIAKAFTYLCTVSVDVAEALGLHSVVQWLNDM  69

Query  216  QYDFIQLQLYS-----SFDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTRETLFKSD  380
            Q+D +  +  S     +F    N++ E      +   LF    +N VAH L RE  F + 
Sbjct  70   QFDNVDFETDSKLTADAFLFSRNNLSEFGCIIFSCRSLF----SNAVAHTLAREATFLAS  125

Query  381  CSVYF  395
             S+YF
Sbjct  126  PSIYF  130



>ref|XP_003621136.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
Length=821

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 66/141 (47%), Gaps = 17/141 (12%)
 Frame = +3

Query  33   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKD  212
            LK N+DA+      R G+G   RD EG FV AK +  + +      EA+G+  AL+W+ D
Sbjct  671  LKCNIDASFSISQNRTGIGLC-RDGEGNFVLAKTMNFAVVHAADVREALGLYHALEWLWD  729

Query  213  LQYDFI---------QLQLY------SSFDLIINDVKE-LAKDFLNINFLFAKRSANKVA  344
            +Q D I         QL  Y      S F  +I   +  L+  F N    F +R A++VA
Sbjct  730  MQLDNIDFEVDSRTTQLAFYARKDDVSEFGNVITACRGILSTKFTNSRVEFIQRQADEVA  789

Query  345  HLLTRETLFKSDCSVYFFIPF  407
            H+   E       ++Y+ +P 
Sbjct  790  HVFVGEATLVVSPTIYYHVPL  810



>gb|AES64036.2| hypothetical protein MTR_2g017550 [Medicago truncatula]
Length=164

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W  P LG  K N+DAA     +   +G  LRD  GTFV AK +    L+     EA+G+
Sbjct  86   QWMPPSLGRYKCNIDAAFSNQFQWTSIGVCLRDDSGTFVLAKTLQFHHLYLVVVGEALGL  145

Query  186  REALKWIKDLQYDFIQLQ  239
              AL+W +D+ +D+IQ Q
Sbjct  146  FHALRWPQDIHFDYIQRQ  163



>ref|XP_003594782.1| hypothetical protein MTR_2g034570 [Medicago truncatula]
Length=157

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 61/135 (45%), Gaps = 21/135 (16%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W++P L  LK NVDA+      R+G GF +RD                   K   A+GV
Sbjct  31   RWKKPGLERLKCNVDASFSDALNRVGFGFCIRD------------------EKVGGALGV  72

Query  186  REALKWIKDLQYDFIQLQLYSSFDLIINDVKE-LAKDFLNINFLFAKRSANKVAHLLTRE  362
              A++W+++LQ   +  +L   F  I+ + +      F N    F++R A +VAH L R 
Sbjct  73   SHAIRWVRELQLTNVDFEL--DFGAIVEECRRNCVTYFENSKVEFSQRQATEVAHTLARN  130

Query  363  TLFKSDCSVYFFIPF  407
              F +   ++   P 
Sbjct  131  VTFLTSPQIFNVAPL  145



>ref|XP_003623678.1| hypothetical protein MTR_7g074420 [Medicago truncatula]
Length=245

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 59/145 (41%), Gaps = 20/145 (14%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W+ P LG  K N+D A  Y + R G+       EG FV AK +    +      EA  V 
Sbjct  91   WQCPLLGRYKCNIDDAFSYSHNRTGIDIY----EGIFVLAKAVSFPCVSPVDVGEAFEVH  146

Query  189  EALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKD-FLNINFLFA  320
              L+W+ D+Q+D I  ++                S F  II   + L    F N    FA
Sbjct  147  NTLQWLSDMQFDNIDFEVDSNITLDAFHSTCDNISEFRCIIASCRSLFNSYFTNSRVEFA  206

Query  321  KRSANKVAHLLTRETLFKSDCSVYF  395
             R AN   H L  E  F    +VYF
Sbjct  207  MRQANVATHTLVGEATFLVFPTVYF  231



>ref|XP_006493122.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X2 [Citrus sinensis]
Length=765

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 70/143 (49%), Gaps = 15/143 (10%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W+ PP GW K+NVDAA+   N+R+GLG V+R++EG F+ A   P   + +    EA   R
Sbjct  610  WKCPPAGWFKVNVDAAIKLENQRVGLGIVIRNSEGKFITAAIKPSKWIDRVDYAEAEATR  669

Query  189  EALKWIKDLQ-------------YDFIQLQLYSSFDL--IINDVKELAKDFLNINFLFAK  323
              L+  +                 D +  +  +  ++  I+++V++  K   ++    + 
Sbjct  670  FGLEVAESAGCLPLIVETDSKEVTDLVSARKSTKAEIFWIVSEVQDTMKRLKHVKLQHSP  729

Query  324  RSANKVAHLLTRETLFKSDCSVY  392
            R+ N  AH L +  L  +DC ++
Sbjct  730  RACNGFAHTLAKLALDYTDCVIW  752



>ref|XP_010696211.1| PREDICTED: uncharacterized protein LOC104908759 [Beta vulgaris 
subsp. vulgaris]
Length=338

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 72/154 (47%), Gaps = 16/154 (10%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            ++W  PP    KLN DAA+ + N R+GLG V+RD  G  + A  + + G+      EA+ 
Sbjct  177  SRWCAPPSALYKLNTDAAM-FKNNRIGLGGVVRDQAGDMLMATCVVVDGVEDVDVAEALS  235

Query  183  VREALKWIKD-------LQYDFIQLQLY--------SSFDLIINDVKELAKDFLNINFLF  317
             R  ++   D       ++ D ++L  Y        S F  I+ D+   A    NI F  
Sbjct  236  ARHGIQTAVDAGLRQLIMEVDCLKLFNYLRDGRRESSPFGFIVQDILCAAGLCSNIRFAH  295

Query  318  AKRSANKVAHLLTRETLFKSDCSVYFFIPFPSIV  419
             +RS NKVAH L + +    DC V+     P IV
Sbjct  296  VRRSGNKVAHNLAKLSFSIVDCRVWLEEVPPEIV  329



>ref|XP_006493121.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X1 [Citrus sinensis]
Length=968

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 70/143 (49%), Gaps = 15/143 (10%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W+ PP GW K+NVDAA+   N+R+GLG V+R++EG F+ A   P   + +    EA   R
Sbjct  813  WKCPPAGWFKVNVDAAIKLENQRVGLGIVIRNSEGKFITAAIKPSKWIDRVDYAEAEATR  872

Query  189  EALKWIKDLQ-------------YDFIQLQLYSSFDL--IINDVKELAKDFLNINFLFAK  323
              L+  +                 D +  +  +  ++  I+++V++  K   ++    + 
Sbjct  873  FGLEVAESAGCLPLIVETDSKEVTDLVSARKSTKAEIFWIVSEVQDTMKRLKHVKLQHSP  932

Query  324  RSANKVAHLLTRETLFKSDCSVY  392
            R+ N  AH L +  L  +DC ++
Sbjct  933  RACNGFAHTLAKLALDYTDCVIW  955



>gb|KHN14619.1| hypothetical protein glysoja_024714 [Glycine soja]
Length=239

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 69/152 (45%), Gaps = 20/152 (13%)
 Frame = +3

Query  18   PPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREAL  197
            P  G +K N+DAA   G RRMG+G  LRD  G  V A       L   KEDEA+ +   L
Sbjct  3    PSKGRMKCNIDAAFREGGRRMGIGACLRDDRGHCVHAFTTLKPYLPTMKEDEALAILHTL  62

Query  198  KWIKD------------------LQYDFIQLQLYSSFDLIINDVKELAKDFLNINFLFAK  323
            +++K+                    +    + +++    +IN  +    D LN++  F +
Sbjct  63   EYLKNNGFHDTLIWWKLPVRWWLETFSVGTMTIWNLAASLINKCRRFLLDILNVSIGFIR  122

Query  324  RSANKVAHLLTRETLFKSDC--SVYFFIPFPS  413
            R AN VAH L ++  ++ +    ++F I  P 
Sbjct  123  RQANSVAHSLAKDDFYELNLWYDIWFKISAPC  154



>gb|ABN08583.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=207

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 53/99 (54%), Gaps = 5/99 (5%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W  P  G  K N+DA      +R G+   LRD  GTFV AK +P   ++     EA+G+
Sbjct  91   QWFPPSRGRFKCNIDADFSEQFQRTGIRMCLRDDSGTFVLAKVMPFDQVYLVAVGEALGL  150

Query  186  REALKWIKDLQYDFIQLQLYS-----SFDLIINDVKELA  287
              A++W++D+Q+D I  +L S     +F  I+ D+ +  
Sbjct  151  YHAIQWMQDMQFDNIDFELDSKITRDAFHSIMTDITKFG  189



>gb|ABN09176.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=260

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 67/149 (45%), Gaps = 15/149 (10%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            A WE+PPL  +K NV+ AL   N  MG G   RD+ G F+            P E EA G
Sbjct  100  ALWEKPPLTVVKCNVECALFNNNSIMGYGLCFRDSMGHFLPGMSNYEFLRVTPSEAEATG  159

Query  183  VREALKW--IKDLQ-----------YDFIQLQLYSSFDL--IINDVKELAKDFLNINFLF  317
            + EA+K    + +Q            D +   +    +L  II   K+L     N +  F
Sbjct  160  LLEAVKLAIARGMQSVIFKSDCKIVVDAVNSSVNPHNELGDIIFYCKQLLSLHANFSVRF  219

Query  318  AKRSANKVAHLLTRETLFKSDCSVYFFIP  404
             +R ANKVAH + R +L      ++F +P
Sbjct  220  VRRQANKVAHNIARASLSHPSPHIFFDVP  248



>gb|AAP54617.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|EAZ16681.1| hypothetical protein OsJ_32156 [Oryza sativa Japonica Group]
Length=1339

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 68/144 (47%), Gaps = 16/144 (11%)
 Frame = +3

Query  6     KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
             +W+ PP     +N DAA+   +R MG+G ++RD  G  + A    IS +  P+  EA+ +
Sbjct  1180  RWQPPPASVWMINSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAI  1239

Query  186   REALKWIKDLQYDFIQL---------------QLYSSFDLIINDVKELAKDFLNINFLFA  320
             R AL   K+   + I +               +  S    +I D+K+LA  F+  +F+  
Sbjct  1240  RRALGLAKEEGLEHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHV  1299

Query  321   KRSANKVAHLLTRETLFKSDCSVY  392
              R +N  AH L R     S C+VY
Sbjct  1300  NRLSNLAAHSLARNAEL-STCTVY  1322



>ref|XP_003603808.1| hypothetical protein MTR_3g114430 [Medicago truncatula]
Length=256

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 57/130 (44%), Gaps = 14/130 (11%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W+   LG  K N+DAA      R G+G  ++DAEGTFV AK             EA+G+ 
Sbjct  112  WQPLVLGRYKCNIDAAFSSHINRTGIGICVQDAEGTFVLAKAFIYPCTVSVNVGEALGLH  171

Query  189  EALKWIKDLQYDFIQLQLYSSFDLIINDVKELAKDFL-NINFLFAKRSANKVAHLLTRET  365
             A+    DL          S F  II+  + L   F  N    F +R  N +AH L RE 
Sbjct  172  SAM---NDL----------SEFGCIISSCRSLFSTFFSNSRVEFVRRQVNAIAHALAREA  218

Query  366  LFKSDCSVYF  395
               +   VYF
Sbjct  219  TSLASRVVYF  228



>ref|XP_003598902.1| hypothetical protein MTR_3g023170 [Medicago truncatula]
Length=274

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 62/135 (46%), Gaps = 2/135 (1%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            WE+P  G  K NVDA+      ++G G  +RDAEG FV A+    + L      E   V 
Sbjct  129  WEKPSPGRFKCNVDASFSTTLNKVGFGACIRDAEGNFVIARTAWTTLLLDVNMGELNMVH  188

Query  189  EALKWIKDLQYDFI-QLQLYSSFDLIINDVKE-LAKDFLNINFLFAKRSANKVAHLLTRE  362
               +    +  D I   +  S F  IIND +  L+ + +N +  F +R  N VAH L +E
Sbjct  189  MDFETNSKVVADRIYGKEGVSDFMAIINDCRHLLSTNLVNSDVKFIRRQVNGVAHSLAKE  248

Query  363  TLFKSDCSVYFFIPF  407
             L  +   +   IP 
Sbjct  249  ALHHASLHIRLNIPH  263



>ref|NP_194638.1| ribonuclease H-like protein [Arabidopsis thaliana]
 emb|CAB43923.1| putative protein [Arabidopsis thaliana]
 emb|CAB79667.1| putative protein [Arabidopsis thaliana]
 gb|AAY78807.1| putative reverse transcriptase/RNA-dependent DNA polymerase [Arabidopsis 
thaliana]
 gb|AEE85585.1| ribonuclease H-like protein [Arabidopsis thaliana]
Length=575

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 70/152 (46%), Gaps = 20/152 (13%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEG--TFVAAKEIPISGLFKPKEDEA  176
             +W  PP  W+K N DA  +  N R G+G+VLR+ +G   ++ A+ +P   L    E E 
Sbjct  418  GRWRPPPHQWVKCNTDATWNRDNERCGIGWVLRNEKGEVKWMGARALP--KLKSVLEAEL  475

Query  177  IGVREALKWIKDLQYDFIQL--------------QLYSSFDLIINDVKELAKDFLNINFL  314
              +R A+  +   QY+++                +++ S    I D++ L   F  + F+
Sbjct  476  EAMRWAVLSLSRFQYNYVIFESDSQVLIEILNNDEIWPSLKPTIQDLQRLLSQFTEVKFV  535

Query  315  FAKRSANKVAHLLTRETL--FKSDCSVYFFIP  404
            F  R  N +A  + RE+L     D  +Y  +P
Sbjct  536  FIPREGNTLAERVARESLSFLNYDPKLYSIVP  567



>gb|AAG13524.1|AC068924_29 putative non-LTR retroelement reverse transcriptase [Oryza sativa 
Japonica Group]
Length=1382

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 68/144 (47%), Gaps = 16/144 (11%)
 Frame = +3

Query  6     KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
             +W+ PP     +N DAA+   +R MG+G ++RD  G  + A    IS +  P+  EA+ +
Sbjct  1223  RWQPPPASVWMINSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAI  1282

Query  186   REALKWIKDLQYDFIQL---------------QLYSSFDLIINDVKELAKDFLNINFLFA  320
             R AL   K+   + I +               +  S    +I D+K+LA  F+  +F+  
Sbjct  1283  RRALGLAKEEGLEHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHV  1342

Query  321   KRSANKVAHLLTRETLFKSDCSVY  392
              R +N  AH L R     S C+VY
Sbjct  1343  NRLSNLAAHSLARNAEL-STCTVY  1365



>gb|KHN38789.1| hypothetical protein glysoja_047929, partial [Glycine soja]
Length=187

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W  PPLG LK NVDA++       G+G  L D  GTFV A+      + KP E EA  ++
Sbjct  82   WSPPPLGSLKCNVDASIFKEEPSFGIGMCLHDDNGTFVKARTASSMSIPKPDEAEAFALK  141

Query  189  EALKWIKDLQ  218
            ++L+WI+ L 
Sbjct  142  KSLEWIQSLH  151



>gb|EEE64789.1| hypothetical protein OsJ_19645 [Oryza sativa Japonica Group]
Length=205

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 66/145 (46%), Gaps = 15/145 (10%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            +KW+ PP GW K+NVD A D G+ R G+G V+RD  G  + +    +    + +E E + 
Sbjct  41   SKWQPPPEGWAKINVDGAFDQGDGRCGIGVVIRDCLGRVLLSSWRYLRRCSQAEEAELLA  100

Query  183  VRE----ALKWIK---DLQYDFIQLQLY--------SSFDLIINDVKELAKDFLNINFLF  317
              E    A +WI     L+ D +             S +  ++ ++K   +    ++   
Sbjct  101  CSEGINLAAEWIHLPVILESDCLMATTSIAGKDMERSRWTFLLREIKAAVRRLQEVSVHH  160

Query  318  AKRSANKVAHLLTRETLFKSDCSVY  392
              R  N+VAH L +     + C+V+
Sbjct  161  VNRECNRVAHELAQLAKRTAHCAVW  185



>gb|AAP44645.1| putative reverse transcriptase [Oryza sativa Japonica Group]
Length=404

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 71/144 (49%), Gaps = 16/144 (11%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W+  P G   +N DAA+   +R MG+G ++RD  G  + A    IS +  P+  EA+ +
Sbjct  245  RWQPLPAGVWMINSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAI  304

Query  186  REALKWIKD--LQYDFI---------QLQLY----SSFDLIINDVKELAKDFLNINFLFA  320
            R AL   K+  LQ+  +         ++Q      S    +I D+K+LA  F+  +F+  
Sbjct  305  RRALGLAKEEGLQHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHV  364

Query  321  KRSANKVAHLLTRETLFKSDCSVY  392
             R +N  AH L R     S C+VY
Sbjct  365  NRLSNLAAHSLARNAEL-STCTVY  387



>ref|XP_007203129.1| hypothetical protein PRUPE_ppa024061mg, partial [Prunus persica]
 gb|EMJ04328.1| hypothetical protein PRUPE_ppa024061mg, partial [Prunus persica]
Length=140

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 67/128 (52%), Gaps = 10/128 (8%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAA--LDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEA  176
             KW   P+G  KLNVD A  L+ G  R+G+  V+R+ +G  +AA  +P++     K  E 
Sbjct  3    TKWSPLPVGKYKLNVDVAFILETGAGRIGV--VVRNDKGEVMAAMALPLASATSSKHAEI  60

Query  177  IGVREALKWIKDLQYDFIQLQLYSSFDLIINDV----KELAKDFLNINFLFAKRSANKVA  344
            +     +K+ +D  +  I ++  S    +INDV    KE  + F ++   F+ R +N+VA
Sbjct  61   MAFLFGMKFTRDAGFSSILIE--SDSQGVINDVKKDEKESLQQFEDVIISFSPRGSNQVA  118

Query  345  HLLTRETL  368
            H L R  L
Sbjct  119  HFLARHAL  126



>ref|XP_003605496.1| hypothetical protein MTR_4g032310 [Medicago truncatula]
Length=283

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/149 (28%), Positives = 68/149 (46%), Gaps = 16/149 (11%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W++P    LK NVD +       +G GF +R+  G  + AK +  + +F     EA+G+ 
Sbjct  124  WQKPAHCRLKCNVDVSFSEALNCVGFGFCIRNEFGNLIKAKTMWSNPVFASDVGEALGLS  183

Query  189  EALKWIKDLQYDFIQLQLYSS-----FDLIINDVKELAKD-----------FLNINFLFA  320
             A++W+ +LQ   I  +L +      F+   ND+ E               F N    F+
Sbjct  184  NAIRWVHELQLLNINFELDAKKVVDYFNNGSNDISEFGSIVEECRRSHNFYFANSKVEFS  243

Query  321  KRSANKVAHLLTRETLFKSDCSVYFFIPF  407
            +R AN+VAH L +E    +    +  +PF
Sbjct  244  RRQANEVAHTLAQEATSLASPHNFNDVPF  272



>ref|XP_007203380.1| hypothetical protein PRUPE_ppa025995mg [Prunus persica]
 gb|EMJ04579.1| hypothetical protein PRUPE_ppa025995mg [Prunus persica]
Length=209

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 68/146 (47%), Gaps = 15/146 (10%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
              W  PP G LKLNVD A      +  LG V+R+  G  + A  +PI+  F  K  E + 
Sbjct  43   THWCPPPPGKLKLNVDGACSTSVWKRELGAVVRNVHGDLMGAISVPITRCFSAKIIELLA  102

Query  183  VREALKWIKDLQYDFIQLQLYSSFDL---------------IINDVKELAKDFLNINFLF  317
            +RE L++  +  Y+ + ++L +   +               IIN++  L+++F  ++F+F
Sbjct  103  IREGLQFAWEDGYNSLVVELDAKNAINDIVSGTEAFRVAGGIINNIHMLSRNFDFLSFVF  162

Query  318  AKRSANKVAHLLTRETLFKSDCSVYF  395
            A R  N V   L +  L      V+ 
Sbjct  163  APRLCNTVVERLAKFALGSVSIDVWL  188



>ref|XP_002529689.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32700.1| conserved hypothetical protein [Ricinus communis]
Length=119

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 50/95 (53%), Gaps = 14/95 (15%)
 Frame = +3

Query  117  FVAAKEIPISGLFKPKEDEAIGVREALKWIKD-------LQYDFIQL-------QLYSSF  254
             V A+   I G + P+E EAI +REAL W+K        ++ D +Q+          S F
Sbjct  1    MVMARADRIPGNYTPREAEAISIREALSWLKQQIFEECIIESDALQVIEALKAPSSQSCF  60

Query  255  DLIINDVKELAKDFLNINFLFAKRSANKVAHLLTR  359
             LII+D K L + F  ++F F +RSAN  A ++ R
Sbjct  61   HLIIDDCKHLVQHFRQVHFQFVRRSANTAAQIVAR  95



>gb|KHN31589.1| hypothetical protein glysoja_043032, partial [Glycine soja]
Length=155

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 63/136 (46%), Gaps = 20/136 (15%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
              WE+    ++K NVDAAL   + + G    +R++EG F++A      G+ KP+E E+  
Sbjct  12   TSWEKTSSNFMKCNVDAALFQEDNKFGFAACIRNSEGVFISAISW-FQGIPKPQEAESYA  70

Query  183  VREALKWIKDLQYDFIQLQLYSSFDLIINDVKE--------------LAKDFLNIN---F  311
            V   L+WI DLQ   + ++  +    I + +                 AK   N++    
Sbjct  71   VLSTLQWISDLQLTNVIIE--TDCKAIPHAIHSKRFHELEAGRILCICAKKICNLHNCRI  128

Query  312  LFAKRSANKVAHLLTR  359
             F  R AN+V H LTR
Sbjct  129  QFVSREANQVTHNLTR  144



>ref|XP_009137097.1| PREDICTED: uncharacterized protein LOC103861143 [Brassica rapa]
Length=154

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 68/145 (47%), Gaps = 15/145 (10%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            + W +PPLGW+K NVD +     +    G+V+RD+ GT+  A +   + +    E E   
Sbjct  3    SGWRKPPLGWVKCNVDGSFSAQQQTSTAGWVIRDSNGTYKGAGQANGNHVNNALESEIQA  62

Query  183  V----------REALKWIKDLQYDFIQLQLYSSFDLIINDVKELAKDFLNINFLFAKRSA  332
            +          R   K IK L  + +    Y+     I +V    + F +I+F++  R  
Sbjct  63   LIVAMQNCWSKRYCSKMIKILNNEVLHFTGYN----WIREVNWWKQKFEDISFMWIGRDG  118

Query  333  NKVAHLLTRETLFKSDCSVYFFIPF  407
            N+VA  L +  +  ++ S YFFI F
Sbjct  119  NQVADGLAKNEI-PNNVSFYFFILF  142



>ref|XP_003599929.1| hypothetical protein MTR_3g049170 [Medicago truncatula]
 ref|XP_003599934.1| hypothetical protein MTR_3g049260 [Medicago truncatula]
Length=266

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 62/132 (47%), Gaps = 12/132 (9%)
 Frame = +3

Query  18   PPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREAL  197
            P LG  K N+DAA     +  G+G  +RD+EGTFV AK      L+     E +G+   L
Sbjct  132  PMLGRYKCNIDAACSSHFKWTGIGICVRDSEGTFVLAKVASYPCLYSVDVGEMLGLHSTL  191

Query  198  KWIKDLQYDFIQLQLYSSFDLIINDVKELAKDFLN--INFLFAKRSA-----NKVAHLLT  356
            +W+ D+Q+D +  +  S    + +D   L    LN  + FL   R +     N     + 
Sbjct  192  QWLSDMQFDNVDFETDSK---MTSDAMLLRTTILNFVVLFLHVVRYSDFSLPNSRVKFVR  248

Query  357  RETLFKSDCSVY  392
            R+   K DCS Y
Sbjct  249  RQA--KRDCSCY  258



>ref|XP_010236322.1| PREDICTED: uncharacterized protein LOC104583970 [Brachypodium 
distachyon]
Length=284

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/148 (26%), Positives = 66/148 (45%), Gaps = 13/148 (9%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W  PP+   K+NVDAA+        +  V RD +G F+ A    I+G+  P   E +  
Sbjct  126  RWLPPPVDHAKINVDAAVAKQVCAGAITAVCRDMDGRFLGASAQVIAGINDPGTLETLAC  185

Query  186  REALKWIKDLQYDFIQLQL-------------YSSFDLIINDVKELAKDFLNINFLFAKR  326
            REAL   +DLQ   +++                  F L++ ++K     F ++ F+   R
Sbjct  186  REALSLAEDLQLAHLRVASDCLEVIMALMGDNLGRFALVLQEIKRCYPRFASVEFVHEGR  245

Query  327  SANKVAHLLTRETLFKSDCSVYFFIPFP  410
            ++N  AH L R +  + +    + +  P
Sbjct  246  ASNMEAHTLARASTSRQEGRYIWLVESP  273



>ref|XP_010689379.1| PREDICTED: uncharacterized protein LOC104903088 [Beta vulgaris 
subsp. vulgaris]
Length=259

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 67/133 (50%), Gaps = 16/133 (12%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W+ P  G  K+N DAA+   + ++GLG V+RD  G  +AA    + G  +  E EA+  
Sbjct  96   RWKPPGFGLYKINSDAAVSE-DGKVGLGGVMRDDVGDVIAAVCEEVRGRVEVSEAEAMAA  154

Query  186  REALKWIKD-------LQYDFIQL--QL------YSSFDLIINDVKELAKDFLNINFLFA  320
            R A     D       L+ D ++L  QL       +SF  I  D++ELAK + NI+F F 
Sbjct  155  RLAFSTAIDVGLRDIILESDCLKLITQLKNGTEDQTSFGFITRDIQELAKLYRNISFEFV  214

Query  321  KRSANKVAHLLTR  359
             R  NKVA  L  
Sbjct  215  SREGNKVAQKLAH  227



>ref|XP_003590140.1| hypothetical protein MTR_1g044900 [Medicago truncatula]
Length=155

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 61/119 (51%), Gaps = 3/119 (3%)
 Frame = +3

Query  54   ALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFI-  230
            +L+YGN+ +G G  +RDAEG FV A+    + L      EA+G    ++    +  D I 
Sbjct  26   SLEYGNK-VGFGACIRDAEGNFVIARTAWTTPLLDVDMGEAMGFFSCIEVDSKVVADSIY  84

Query  231  QLQLYSSFDLIINDVKE-LAKDFLNINFLFAKRSANKVAHLLTRETLFKSDCSVYFFIP  404
              +  S F  IIND +  L+ D +N +  F +R  N VAH L +E L  +   ++  IP
Sbjct  85   GKEGVSDFMAIINDCRHLLSTDLVNSDVKFIRRQVNGVAHSLAKEALHHASLHIHLNIP  143



>ref|XP_008227720.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=342

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 66/136 (49%), Gaps = 15/136 (11%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W +PP+ + K+NVD A +   +  G+G V+RD+ G F+  +      +F   + EA+  
Sbjct  181  RWTKPPMSFFKINVDGAWNADTKSGGVGVVVRDSTGAFIVGRARKFDNVFSALQSEALAA  240

Query  186  REAL-----KWIKDLQYDFIQLQL-----YSSFDL-----IINDVKELAKDFLNINFLFA  320
            RE +     + + ++ ++   LQ+     YSS D      I+ D K L        F   
Sbjct  241  REGVVLEAERGLTNICFESDSLQIVTALGYSSLDRSFIGPILEDSKFLLLQITGEGFNHV  300

Query  321  KRSANKVAHLLTRETL  368
            +R+AN+ AH + R  L
Sbjct  301  RRTANEAAHHIARFAL  316



>emb|CAN77449.1| hypothetical protein VITISV_016970 [Vitis vinifera]
Length=517

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 61/121 (50%), Gaps = 18/121 (15%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
             KW +P  G LK NVDA +   ++ +GLG +LR+  G+        ++G+  PK  EA+G
Sbjct  354  VKWSKPSPGMLKCNVDAXIFSKHQTIGLGVILRNEFGSVXGCYSKVVNGVSSPKXAEALG  413

Query  183  VREALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLF  317
            +REA +W+ +L+   + ++L                S F ++I D + L   FL+ NF  
Sbjct  414  LREAARWLLELRVSNVIVELDAKGVYDSFYSKALDRSEFGMLIQDCRSL---FLDQNFTL  470

Query  318  A  320
             
Sbjct  471  C  471



>ref|XP_002528833.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33567.1| conserved hypothetical protein [Ricinus communis]
Length=141

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +3

Query  18   PPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREAL  197
            P + WLKLNVD AL     R+GLG ++R+A G F+AAK + + G  + K  +A+GV EAL
Sbjct  63   PTIEWLKLNVDVALFRSLSRIGLGMIVRNATGNFMAAKIVILDGCLEVKVAKAVGVCEAL  122

Query  198  KWIKD  212
              +K+
Sbjct  123  SLVKE  127



>gb|EEC72753.1| hypothetical protein OsI_06384 [Oryza sativa Indica Group]
Length=556

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 40/143 (28%), Positives = 66/143 (46%), Gaps = 16/143 (11%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W  PP G   +N DAA+    R+MG+G V+RD  G  + A      G+  P+  EA  +R
Sbjct  398  WVPPPAGVFLINTDAAVFQAERQMGVGVVIRDQHGNCLLAANTRFMGITDPETAEACAIR  457

Query  189  EALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFAK  323
             AL   K+  +  + +                  S    ++ D+K+L  +F++++F+   
Sbjct  458  HALWLAKEEGFHNVIVACDCLSVIQKLNSPGRDRSKIGCLVEDIKKLGVEFISVSFIHVS  517

Query  324  RSANKVAHLLTRETLFKSDCSVY  392
              +N  AH L R +   S C+VY
Sbjct  518  HCSNVAAHTLARCSE-PSVCNVY  539



>ref|XP_011470556.1| PREDICTED: uncharacterized protein LOC105353255 [Fragaria vesca 
subsp. vesca]
Length=623

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 45/147 (31%), Positives = 63/147 (43%), Gaps = 15/147 (10%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            KWE+P  GW K + D A      R G G V+RD  G F A     +  +  P   E I +
Sbjct  462  KWEKPRHGWYKCSCDGAFVTDIHRGGSGVVIRDEHGQFRAGAGKVLVQVTSPFHAELIAL  521

Query  186  REALKWIKDL-------QYDFIQLQL--------YSSFDLIINDVKELAKDFLNINFLFA  320
             E LK  + L       + D + LQ          S+   II +VKE    + +   L  
Sbjct  522  LEGLKLAETLHISKIVFETDCLLLQQAVSQPDTDLSTLGTIIAEVKEFLHRYADFRVLHV  581

Query  321  KRSANKVAHLLTRETLFKSDCSVYFFI  401
             R AN+VAH+L    L  S+   +F +
Sbjct  582  PREANRVAHILANHALNYSESQSWFVV  608



>ref|XP_002527468.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34866.1| conserved hypothetical protein [Ricinus communis]
Length=158

 Score = 60.5 bits (145),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 61/119 (51%), Gaps = 24/119 (20%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W++P LG+LK NVDAA   G  R G GFVLRD  G     +++      +P   EA+G+R
Sbjct  56   WQKPQLGYLKYNVDAATFNG--RTGFGFVLRDHAGLLF--QQLMDLRRLRP-HTEAMGLR  110

Query  189  EALKWIKDLQYDFIQLQLYSSFDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTRET  365
            E L W+K   +                +V EL    +N++  F  RS N+VAH+L R +
Sbjct  111  ETLSWLKANSHC---------------NVLEL----VNVSVPFVARSVNRVAHVLPRAS  150



>ref|XP_003614676.1| hypothetical protein MTR_5g057370 [Medicago truncatula]
Length=247

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 41/77 (53%), Gaps = 0/77 (0%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W+ P LG  K N+D A      R G+G  + D+EG FV AK +    ++     EA G+ 
Sbjct  115  WQHPLLGRYKCNIDVAFLSSLNRTGIGICVHDSEGKFVLAKVVSFPCIYSVDVGEAWGLH  174

Query  189  EALKWIKDLQYDFIQLQ  239
             A++W  D+Q+D +  +
Sbjct  175  SAMQWSSDMQFDNVDFE  191



>ref|XP_006593242.1| PREDICTED: uncharacterized protein LOC102666191 [Glycine max]
Length=192

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 63/136 (46%), Gaps = 20/136 (15%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
              WE+    ++K NVDAAL   + + G    +R++EG F++A      G+ KP+E E+  
Sbjct  33   TSWEKTSSNFMKCNVDAALFQEDNKFGFAACIRNSEGVFISAISW-FQGIPKPQEAESYA  91

Query  183  VREALKWIKDLQYDFIQLQLYSSFDLIINDVKE--------------LAKDFLNIN---F  311
            V   L+WI DLQ   + ++  +    I + +                 AK   N++    
Sbjct  92   VLSTLQWISDLQLTNVIIE--TDCKAIPHAIHSKRFHELEAGRILCICAKKICNLHNCRI  149

Query  312  LFAKRSANKVAHLLTR  359
             F  R AN+V H LTR
Sbjct  150  QFVSREANQVTHNLTR  165



>ref|XP_007198863.1| hypothetical protein PRUPE_ppa018328mg [Prunus persica]
 gb|EMJ00062.1| hypothetical protein PRUPE_ppa018328mg [Prunus persica]
Length=161

 Score = 60.5 bits (145),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 61/132 (46%), Gaps = 15/132 (11%)
 Frame = +3

Query  18   PPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREAL  197
            P   + K+NVD AL   +   GLG V+RD     +AA   P+ G+F P   E   +R  L
Sbjct  2    PLTQFFKINVDGALKTNDSMRGLGVVIRDDCEELIAATTKPVCGMFTPNITELFAIRFGL  61

Query  198  KWIKD--LQYDF--------IQLQLYSSFDL-----IINDVKELAKDFLNINFLFAKRSA  332
            +   D  LQ+ +        IQ+      DL     ++N+++ LA  F +    F  R+ 
Sbjct  62   QLAMDLGLQHIYLESDAQAAIQMAFQCDADLSYDGILVNEIQVLANSFHSCFGKFRPRTC  121

Query  333  NKVAHLLTRETL  368
            N VAH L   TL
Sbjct  122  NHVAHSLACFTL  133



>gb|KEH21242.1| hypothetical protein MTR_8g099580 [Medicago truncatula]
Length=309

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W+ P  G +K N+DA     + +  +G  +RD  G FV AK I   G++     EA+G+
Sbjct  184  RWQPPAQGQMKCNIDAVFSNHHNKTDIGICIRDEGGVFVLAKTISFVGVYFVDIGEALGL  243

Query  186  REALKWIKDLQYDFIQLQLYS  248
              AL+W+ D+Q D I  ++ S
Sbjct  244  YHALQWVSDMQLDNIDFEVDS  264



>emb|CDP14369.1| unnamed protein product [Coffea canephora]
Length=347

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 60/134 (45%), Gaps = 14/134 (10%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W  P +GW+K+N DAA+     R G G + RD  G  + A  +P +     K++EA+ +R
Sbjct  182  WREPEVGWVKINSDAAVQQKAERAGWGMIARDCLGNALGAWAVPDTCCSSAKQEEALALR  241

Query  189  EALKWIKDLQYDFIQL-----QLYSSFD---------LIINDVKELAKDFLNINFLFAKR  326
             A+   K   +  +       QL  S +          I+ D+  L  +F    F F +R
Sbjct  242  SAMLMAKQQGWRRVVFESDCKQLIDSINSGDGDSDIATILLDIVSLKSNFYKCCFSFTRR  301

Query  327  SANKVAHLLTRETL  368
              N V+H L +  L
Sbjct  302  MNNSVSHSLAKLAL  315



>ref|XP_008226963.1| PREDICTED: uncharacterized protein LOC103326508 [Prunus mume]
Length=224

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/137 (28%), Positives = 65/137 (47%), Gaps = 16/137 (12%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            KW  PP+G  KLNVDAA        G+G V+R+ +G  +AA  +P++     K  E + +
Sbjct  60   KWSPPPVGKYKLNVDAAFIPETGVGGIGAVVRNDKGEVMAAMALPLASATSSKHAEIMAL  119

Query  186  REALKWIKDLQYDFIQL----------------QLYSSFDLIINDVKELAKDFLNINFLF  317
               +K+ +D  +  I +                + ++S   +I+D+K   + F ++   F
Sbjct  120  LFGMKFAQDAGFSSILIESDSQGVINDVRKDEEESWASDGHLIDDIKRSLQHFEDVIISF  179

Query  318  AKRSANKVAHLLTRETL  368
            + R  N+VAH   R  L
Sbjct  180  SPRGGNQVAHFPARHAL  196



>ref|XP_006577722.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=249

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            +W +PPL + K N+DAA+    RR GLG  LRD+ G F+ AK + + G+ +P E EA+G
Sbjct  175  QWVKPPLVFAKCNLDAAVFGNQRRFGLGMCLRDSLGRFIIAKSVLVEGMLQPVEAEALG  233



>ref|XP_007214838.1| hypothetical protein PRUPE_ppa018217mg, partial [Prunus persica]
 gb|EMJ16037.1| hypothetical protein PRUPE_ppa018217mg, partial [Prunus persica]
Length=320

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 63/149 (42%), Gaps = 19/149 (13%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W +P  G LK+N+D +   GN   G+G V+RD+ G FVA + + +  +F   + EA   R
Sbjct  146  WTKPCAGGLKINLDGSWTAGNTYGGVGIVVRDSNGRFVAGRALRVDNVFSALQVEASAAR  205

Query  189  EALKWIKDLQYDFI-------QLQLYSSF----------DLIINDVKELAKDFLNINFLF  317
            E    I  ++ DF         LQ+ S+             ++ D K L        F  
Sbjct  206  EGA--ILAVERDFNNVIFESDSLQILSAIRSSSVDRSNVGQVVEDTKALLTQITGDGFTH  263

Query  318  AKRSANKVAHLLTRETLFKSDCSVYFFIP  404
             +R AN  AH L R        + +F  P
Sbjct  264  IRRVANGAAHRLARYASHLGTTTTWFEEP  292



>gb|KHN20416.1| Putative ribonuclease H protein [Glycine soja]
Length=249

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            +W +PPL + K N+DAA+    RR GLG  LRD+ G F+ AK + + G+ +P E EA+G
Sbjct  175  QWVKPPLVFAKCNLDAAVFGNQRRFGLGMCLRDSLGRFIIAKSVLVEGMLQPVEAEALG  233



>ref|XP_010513219.1| PREDICTED: uncharacterized protein LOC104789182 [Camelina sativa]
Length=1754

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 39/135 (29%), Positives = 64/135 (47%), Gaps = 14/135 (10%)
 Frame = +3

Query  6     KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
             KW  PP+GW+K NVD A    + + G+G+VLRD +   +      +  + KP + E  G+
Sbjct  1594  KWIPPPMGWVKCNVDGAWRSDSEQCGIGWVLRDEQKKVIWLGARALPRVNKPLDVEVEGL  1653

Query  186   REALKWIKDLQYDFIQLQLYSSFDL--------------IINDVKELAKDFLNINFLFAK  323
             R A+  +  +QY  +  +  S   L              II D+ +L++ F  +  +F  
Sbjct  1654  RWAMLSLARIQYPKVIFETDSQLVLSLIKGNTESNHYAPIIQDINQLSQRFEKVKMVFTY  1713

Query  324   RSANKVAHLLTRETL  368
             R  N VA  + +E L
Sbjct  1714  REGNGVADRVAKEAL  1728



>ref|XP_002522452.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF39944.1| nucleic acid binding protein, putative [Ricinus communis]
Length=483

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 65/145 (45%), Gaps = 20/145 (14%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W++P  G  KLNVDA+      + G  FVLRD  G ++    I    +  P   EA  ++
Sbjct  343  WQKPATGKYKLNVDASSSAERGKSGASFVLRDNAGIWITGVLIIRPYIANPDVAEAWALK  402

Query  189  EALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFAK  323
            EAL WI     + +Q++                 S    ++ D ++L +     N +F  
Sbjct  403  EALSWIHAKGMEEVQIETDCLRNIELLEEELHPNSYLLCLLKDCQDLLRVLNRCNLVFVY  462

Query  324  RSANKVAHLLTRETLFKSDCSVYFF  398
             SAN VAH++++ T     CS + F
Sbjct  463  GSANTVAHMISKAT-----CSAHMF  482



>ref|XP_003609588.1| hypothetical protein MTR_4g118850 [Medicago truncatula]
Length=137

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 59/113 (52%), Gaps = 16/113 (14%)
 Frame = +3

Query  54   ALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDL---QYD  224
            +L+YGN+ +G G  +RDAEG FV A+    + L      EA+G   ALKW+++L     D
Sbjct  26   SLEYGNK-VGFGACIRDAEGNFVIARTAWTTPLLDVDMGEAMGFLAALKWVEELNMVHMD  84

Query  225  F------IQLQLY-----SSFDLIINDVKE-LAKDFLNINFLFAKRSANKVAH  347
            F      +   +Y     S F  IIND +  L+ D +N +  F +R  N VAH
Sbjct  85   FETDSKVVADSIYGKEGVSDFMAIINDCRHLLSTDLVNSDVKFIRRQVNGVAH  137



>ref|XP_009121392.1| PREDICTED: uncharacterized protein LOC103846249 [Brassica rapa]
Length=253

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 66/146 (45%), Gaps = 18/146 (12%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W+ PP  WLK NVDA+          G+++RD  G +  A ++  + +  P E E   +
Sbjct  89   RWKAPPNQWLKCNVDASFIDTREPSSAGWIIRDEHGIYKGAVQVQGNMICSPLESELQAI  148

Query  186  REALK--WIKDLQYDFIQLQLYSSFDLIIND-------------VKELAKDFLNINFLFA  320
              A++  W K      I+     + D I+ND             ++  A+   NI+F + 
Sbjct  149  LMAVQFCWTKGYNKIIIESDCRKAID-ILNDLVLHFDSFNWKREIRWWAEKIQNISFQWV  207

Query  321  KRSANKVAHLLTRETLFKSDCSVYFF  398
            KR ANKVA  L R  L   D S Y F
Sbjct  208  KREANKVADSLARTPLH--DMSSYCF  231



>gb|AAU89136.1| F-box domain containing protein [Oryza sativa Japonica Group]
Length=855

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 71/144 (49%), Gaps = 16/144 (11%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W+  P G   +N DAA+   +R MG+G ++RD  G  + A    IS +  P+  EA+ +
Sbjct  696  RWQPLPAGVWMINSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAI  755

Query  186  REALKWIKD--LQYDFI---------QLQLY----SSFDLIINDVKELAKDFLNINFLFA  320
            R AL   K+  LQ+  +         ++Q      S    +I D+K+LA  F+  +F+  
Sbjct  756  RRALGLAKEEGLQHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHV  815

Query  321  KRSANKVAHLLTRETLFKSDCSVY  392
             R +N  AH L R     S C+VY
Sbjct  816  NRLSNLAAHSLARNAEL-STCTVY  838



>ref|XP_002453054.1| hypothetical protein SORBIDRAFT_04g037485 [Sorghum bicolor]
 gb|EES06030.1| hypothetical protein SORBIDRAFT_04g037485 [Sorghum bicolor]
Length=172

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 55/118 (47%), Gaps = 5/118 (4%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            KW  PP  ++K NVDAA+     +  +  V RD  G +VAA  + I GL  P   EA+  
Sbjct  32   KWIPPPEAFVKFNVDAAVARAEDKRTVSVVCRDNVGNYVAASAMVIDGLTDPSSLEALAC  91

Query  186  REALKWIKDLQYDFIQLQLYSSFDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTR  359
             EA+    D     I  Q   ++  ++ ++K  +  F  + F    R +N  AH L +
Sbjct  92   NEAISLAMD-----IWKQSLCAYSSVLKEIKARSTLFQEVVFKHEGRESNCEAHALAK  144



>ref|XP_010679712.1| PREDICTED: uncharacterized protein LOC104895014 [Beta vulgaris 
subsp. vulgaris]
Length=197

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 66/134 (49%), Gaps = 16/134 (12%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W+ P  G  K+N DAA+ Y +  +GLG V+RDA G  + A  + +    +  E EA   R
Sbjct  35   WKPPVEGHYKVNSDAAI-YKDCTVGLGGVMRDANGDIMGATSMHLKLDMEVHEAEACAAR  93

Query  189  EALKWIKD-------LQYDFIQLQLY--------SSFDLIINDVKELAKDFLNINFLFAK  323
             ALK   +       L+ D ++L  +        +SF  I+ D+  L     +I+F   +
Sbjct  94   HALKIAMEAGFRNIVLESDCLKLISHLKRKKRDDTSFGNIVEDILWLGNCCSSISFSHVR  153

Query  324  RSANKVAHLLTRET  365
            R  N+VAH+L + +
Sbjct  154  REGNRVAHILAQRS  167



>ref|XP_002517043.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45206.1| conserved hypothetical protein [Ricinus communis]
Length=160

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 49/109 (45%), Gaps = 8/109 (7%)
 Frame = +3

Query  78   MGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQLYSSFD  257
            +G+G V+RD  G FV A    I G F   E EA  + EAL W+K  Q+D   ++      
Sbjct  50   IGVGCVVRDERGRFVMACSCSIHGNFTIIEAEAHSMGEALSWLKCRQFDNCVIE------  103

Query  258  LIINDVKELAKDFLNINFLFAKRSANKVAHLLTRETLFKSDCSVYFFIP  404
               N    LA     + F F +RSAN   H+  R     +   V+F  P
Sbjct  104  --SNAWTHLASALRRVQFSFVRRSANMATHIAARAGCSLTGRVVWFLKP  150



>gb|EEC75888.1| hypothetical protein OsI_12930 [Oryza sativa Indica Group]
Length=834

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 71/144 (49%), Gaps = 16/144 (11%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W+  P G   +N DAA+   +R MG+G ++RD  G  + A    IS +  P+  EA+ +
Sbjct  675  RWQPLPAGVWMINSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAI  734

Query  186  REALKWIKD--LQYDFI---------QLQLY----SSFDLIINDVKELAKDFLNINFLFA  320
            R AL   K+  LQ+  +         ++Q      S    +I D+K+LA  F+  +F+  
Sbjct  735  RRALGLAKEEGLQHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHV  794

Query  321  KRSANKVAHLLTRETLFKSDCSVY  392
             R +N  AH L R     S C+VY
Sbjct  795  NRLSNLAAHSLARNAEL-STCTVY  817



>ref|XP_008345353.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=953

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 63/137 (46%), Gaps = 19/137 (14%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W+RP  G +K+N DAA    +RR G+G+V RD  G   AA              E I +R
Sbjct  789  WQRPXFGTIKINTDAAWXKDSRRAGVGWVGRDFAGVLQAAGGSGTILCQSAAAAEVIAIR  848

Query  189  EALKWIKDLQYDFIQLQLYS-----------------SFDLIINDVKELAKDFLNINFLF  317
             AL     +++ F  + + S                 + D I+ D+K LA+ F ++ F F
Sbjct  849  TALS--ACIKHGFNHVIVESDAQKIIHMIRKEVSEDFNLDCILGDIKILARMFTSVTFAF  906

Query  318  AKRSANKVAHLLTRETL  368
              R +N+ AHL+ +  L
Sbjct  907  VPRESNQAAHLVAKYVL  923



>ref|XP_008337941.1| PREDICTED: uncharacterized protein LOC103401016 [Malus domestica]
Length=298

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 60/133 (45%), Gaps = 15/133 (11%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W   P G +K+N+D + + G    G G ++RD++G FVA +      +  P   EA+ +
Sbjct  162  RWSVLPHGRIKMNIDGSWNVGRLIAGFGAIIRDSDGCFVATRTGSFKDICSPLLSEAMAM  221

Query  186  REALKWIKDLQYDFI-----QLQLYSSF-DLIIN---------DVKELAKDFLNINFLFA  320
            +  L W  D  Y F+      LQ+  +  DL +N         D K L       N  + 
Sbjct  222  KVGLLWAIDRGYQFLIIETDSLQIVEALRDLTLNLSIIGQVVEDYKALLNTITEANITYI  281

Query  321  KRSANKVAHLLTR  359
             R+AN  AH L +
Sbjct  282  HRNANAAAHYLAK  294



>gb|ABA97040.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1913

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 57/104 (55%), Gaps = 2/104 (2%)
 Frame = +3

Query  3     AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
             A+WE+P +GW+KLNVD + D  + + G+G VLRD+ GT + +    +     P E E + 
Sbjct  1793  ARWEKPQMGWMKLNVDGSYDSNSSKGGIGVVLRDSVGTVIFSACGFLERCSSPLESELLA  1852

Query  183   VREALKWIKDLQYDFIQLQLYSSFDLIINDVKELAKDFLNINFL  314
              +E +     LQ+  + + L S   + +N ++ + K+   + +L
Sbjct  1853  CKEGINLA--LQWTLLPIILESDCLIAVNMIQSVKKEMSQLAYL  1894



>ref|XP_006471930.1| PREDICTED: uncharacterized protein LOC102617744 [Citrus sinensis]
Length=294

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 69/153 (45%), Gaps = 27/153 (18%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKP--KEDEAI  179
            +W  PP   LKLNVDAA +  ++++GLG VLRD+ G  VAA      G+ +   ++D + 
Sbjct  135  RWSPPPTNVLKLNVDAATNSKDQKVGLGAVLRDSNGRVVAA------GIKQASFRKDVSF  188

Query  180  GVREALKWIKDLQYDFIQLQLYSSFDL-------------------IINDVKELAKDFLN  302
               EA++W   +        L    D                    II++++   ++F  
Sbjct  189  AEAEAIQWGLQIAKKAAAASLIVETDCKDVAELVNNTKGSRSEIFWIISEIQTQKREFQR  248

Query  303  INFLFAKRSANKVAHLLTRETLFKSDCSVYFFI  401
            I+F F  R  N  AH L +  L K   +V+  I
Sbjct  249  IHFNFVPRFCNAHAHSLAKHALRKDTTAVWLDI  281



>gb|EAZ07210.1| hypothetical protein OsI_29454 [Oryza sativa Indica Group]
Length=201

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 64/135 (47%), Gaps = 15/135 (11%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +WERPP GW+K NVD + D    + G+G V+RD EG  + A    +     P E E + +
Sbjct  45   RWERPPEGWMKANVDGSFDSQLLKGGIGVVIRDWEGAIIFASCKSVCRCSSPLEAELLAL  104

Query  186  REA----LKWIKD---LQYD-FIQLQLYSSFDLIINDVKELA---KDFLNINFLFA----  320
            RE     L W      L+ D  + LQ+  S +   +++  L    +D LN +  F     
Sbjct  105  REGIYLFLIWTLRSVILETDCLVALQMIQSKERATSELAYLVREIRDLLNGSREFVLWKI  164

Query  321  KRSANKVAHLLTRET  365
            +R  N V+H L  + 
Sbjct  165  RREQNMVSHFLANKC  179



>ref|XP_006487438.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=335

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 68/144 (47%), Gaps = 15/144 (10%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEG-TFVAA-KEIPISGLFKPKEDEAI  179
            KW  PP  W+K+NVDAA+D  ++  GLG V++D  G  FVAA K +   G     E EA 
Sbjct  176  KWAPPPPRWVKINVDAAIDAKSKCSGLGAVIKDPSGKCFVAAVKSVTSKGDVLLAEAEAD  235

Query  180  GVREALKWIKDLQYDFIQLQLYSSFDL-------------IINDVKELAKDFLNINFLFA  320
                 L   + +Q   ++    ++ DL             II+D++ L   F +    F 
Sbjct  236  EWGTYLAKEEGMQAVILETDSKATVDLINNNGNYMTEVHWIISDIQSLMSQFSHFVAKFI  295

Query  321  KRSANKVAHLLTRETLFKSDCSVY  392
             RS N  AH L +  L K+D  V+
Sbjct  296  PRSCNTCAHKLAKIALGKTDSFVW  319



>ref|XP_010485231.1| PREDICTED: uncharacterized protein LOC104763574 [Camelina sativa]
Length=1808

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 47/163 (29%), Positives = 75/163 (46%), Gaps = 20/163 (12%)
 Frame = +3

Query  6     KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGT--FVAAKEIPISGLFKPKEDEAI  179
             +W  PPL W+K N+D A      R G+G+VLRD +G+  ++ A+ +P +      E EA+
Sbjct  1642  RWRPPPLEWVKCNMDGAWPREGDRSGVGWVLRDHQGSVLWMGARALPRTRSVLEVETEAL  1701

Query  180   GVREALKWIKDLQYDFIQLQLYSSFDLI---------------INDVKELAKDFLNINFL  314
               R A+  +   QY  +  +   S DLI               + D+K L + F  + F 
Sbjct  1702  --RWAMVSVARFQYKKVIFE-SDSQDLISAINGDERRPPIATLLEDIKCLCRQFEEVTFK  1758

Query  315   FAKRSANKVAHLLTRETLFKSDCSVYFFIPFPSIV*YISSSFL  443
             F KR  N VA  + +ET       + F+   P  + Y+  + L
Sbjct  1759  FTKRGGNAVADRIAQETTSFQRNEIRFYSNAPRWLEYLVETEL  1801



>ref|XP_006285982.1| hypothetical protein CARUB_v10007509mg, partial [Capsella rubella]
 gb|EOA18880.1| hypothetical protein CARUB_v10007509mg, partial [Capsella rubella]
Length=172

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 65/138 (47%), Gaps = 13/138 (9%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            AKW++   GW+K N DA+   GNR  GLG+++R++ G F+        G   P E E   
Sbjct  12   AKWKKLEGGWVKCNYDASHHEGNRDSGLGWIIRNSTGIFLHGGMGRFQGRATPAEAECTA  71

Query  183  VREALK--WIK-----DLQYDFIQL-QLYSSFDLI-----INDVKELAKDFLNINFLFAK  323
            +  A++  W       D + D + + QL  S +       +N +++    F +I F F  
Sbjct  72   LLWAIQATWANGYRRIDFEGDNLTITQLLQSREATPRLHYLNTIQQWRSMFTDIRFSFRH  131

Query  324  RSANKVAHLLTRETLFKS  377
            R  N  A +L ++ L  S
Sbjct  132  REQNSCADILAKQALNNS  149



>ref|XP_006427454.1| hypothetical protein CICLE_v10027161mg, partial [Citrus clementina]
 gb|ESR40694.1| hypothetical protein CICLE_v10027161mg, partial [Citrus clementina]
Length=164

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 68/139 (49%), Gaps = 16/139 (12%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W+ PP  W K+NVDAA+     R G+G ++ ++ G  +AA    +      +  EA+ V 
Sbjct  3    WQSPPPSWYKVNVDAAVSSTEDRAGIGVLVCNSTGEVMAASICTVIFSRDIEFVEAVAVH  62

Query  189  EALKWIKDLQ-------------YDFIQLQLYSSFDL--IINDVKE-LAKDFLNINFLFA  320
              L+ + D+               + I  +++S  ++  +I+DV+E L+    +    FA
Sbjct  63   NGLQLVMDIGLAPAIIESDSFNVVNLINNKIHSRCEVGWLISDVQEVLSSSESSFQVKFA  122

Query  321  KRSANKVAHLLTRETLFKS  377
             RS N+VAH L++  L  S
Sbjct  123  PRSCNEVAHHLSKLALCNS  141



>ref|XP_010682232.1| PREDICTED: uncharacterized protein LOC104897109 [Beta vulgaris 
subsp. vulgaris]
Length=332

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/132 (29%), Positives = 66/132 (50%), Gaps = 16/132 (12%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W+ PP  ++K+NVDA + +GN  + +G ++RD  G+  AA    I+  + P+  EA   R
Sbjct  174  WQPPPQSYVKVNVDAHVMHGN-GVSMGMIIRDEHGSIKAAGVKRIASNWAPELAEAGAAR  232

Query  189  EALKWIKDLQYDFIQLQLYSS---------------FDLIINDVKELAKDFLNINFLFAK  323
              L   + L +D + L+  +S                 L  +D+ E++  FL+ + +  K
Sbjct  233  FGLDVARRLGFDRVVLECDASNVVRCIRERRQGAAPIFLFYDDILEISSSFLSFDCVHVK  292

Query  324  RSANKVAHLLTR  359
            R+ N VAH + R
Sbjct  293  RAGNTVAHSVAR  304



>ref|XP_004293042.2| PREDICTED: uncharacterized protein LOC101293660 [Fragaria vesca 
subsp. vesca]
Length=816

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 40/152 (26%), Positives = 73/152 (48%), Gaps = 20/152 (13%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            A W+ PP G +K+NVD +   G      GFV+RD  G+F+A        +   +  E + 
Sbjct  653  ASWKPPPHGIVKINVDGSFISGTHSGSTGFVIRDNSGSFLACGGQAHKAVVSAEHVEVLA  712

Query  183  VREALKWI-----------KDLQYDFIQLQLYSSFDL-----IINDVKELAKDFLNINFL  314
             ++A+ +             D Q  ++QL  +   +L     + +D+  + +D+ ++  +
Sbjct  713  CKQAIVFAIANNFQPAIIESDAQVVYLQLINHHQANLSVLGRLYDDIGNMIQDYGSVRIM  772

Query  315  FAKRSANKVAHLLT--RETLFKSDCSVYFFIP  404
              KRS N+VAHL+    +TL +   + YF +P
Sbjct  773  HTKRSVNRVAHLMAGHSKTLVRE--TFYFSVP  802



>gb|EEE59647.1| hypothetical protein OsJ_12023 [Oryza sativa Japonica Group]
Length=1145

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 71/144 (49%), Gaps = 16/144 (11%)
 Frame = +3

Query  6     KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
             +W+  P G   +N DAA+   +R MG+G ++RD  G  + A    IS +  P+  EA+ +
Sbjct  986   RWQPLPAGVWMINSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAI  1045

Query  186   REALKWIKD--LQYDFI---------QLQLY----SSFDLIINDVKELAKDFLNINFLFA  320
             R AL   K+  LQ+  +         ++Q      S    +I D+K+LA  F+  +F+  
Sbjct  1046  RRALGLAKEEGLQHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHV  1105

Query  321   KRSANKVAHLLTRETLFKSDCSVY  392
              R +N  AH L R     S C+VY
Sbjct  1106  NRLSNLAAHSLARNAEL-STCTVY  1128



>dbj|BAF36334.1| hypothetical protein [Ipomoea trifida]
Length=162

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEI  137
            KW + P  W+KL VD ALD+ N +MG GFVLR++ GTF+AAK++
Sbjct  111  KWSKHPERWIKLTVDVALDFYNSKMGFGFVLRNSNGTFMAAKKV  154



>gb|ABD28554.2| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=118

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 41/76 (54%), Gaps = 0/76 (0%)
 Frame = +3

Query  12   ERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVRE  191
            E P  G  K N+DA      +R G+   +RD++ TFV AK +    +      EA+G+  
Sbjct  33   EAPYSGRYKCNIDATFSSRFKRTGIDICVRDSDSTFVLAKTVTYPCIVSVDVGEALGLHS  92

Query  192  ALKWIKDLQYDFIQLQ  239
            AL+W+ D+Q+D +  +
Sbjct  93   ALQWLSDMQFDSVDFE  108



>ref|XP_010666974.1| PREDICTED: uncharacterized protein LOC104884077 [Beta vulgaris 
subsp. vulgaris]
Length=172

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 64/138 (46%), Gaps = 16/138 (12%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            A W  PP G++K+NVDA+L      +GLG V RD  G  + A        + P+  EA  
Sbjct  10   AVWHPPPAGFIKVNVDASLKE-EGWVGLGVVARDHTGQVLFAATRRTRAYWTPEVSEAKA  68

Query  183  VREALKWIK-----------DLQYDFIQLQ----LYSSFDLIINDVKELAKDFLNINFLF  317
            +  AL+  +           D Q   I+L       S  DL+++D+  L+  F +I +  
Sbjct  69   MAMALRLSRARNIPHVIFESDCQSLVIKLSKGNVFLSDLDLVMSDIMCLSTSFTSIAWSH  128

Query  318  AKRSANKVAHLLTRETLF  371
             KR  N VAH L + T F
Sbjct  129  VKRGGNFVAHHLAQFTPF  146



>ref|XP_010684542.1| PREDICTED: uncharacterized protein LOC104899105 [Beta vulgaris 
subsp. vulgaris]
Length=189

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 67/133 (50%), Gaps = 16/133 (12%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            KW++PP G  K+N DAA  + +  +G G ++RDAEG  + A    I G F  +E EA+  
Sbjct  27   KWQKPPAGHYKVNSDAAC-FKDGAVGFGGIMRDAEGDVMVATCHQIGGGFTAEEAEALAA  85

Query  186  REALKWIKD-------LQYDFIQLQLY--------SSFDLIINDVKELAKDFLNINFLFA  320
            R AL    +       L+ D ++L  +        SSF  I+ D+ E+ +   ++NF   
Sbjct  86   RHALVIALEAGLRMIVLESDCLKLISHLKEGKRDNSSFGNIVLDIMEIGESCTSLNFSHV  145

Query  321  KRSANKVAHLLTR  359
             +  N VAH L +
Sbjct  146  SKIGNVVAHKLAQ  158



>gb|EEE68803.1| hypothetical protein OsJ_27549 [Oryza sativa Japonica Group]
Length=201

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 63/131 (48%), Gaps = 15/131 (11%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +WERPP GW+K NVD + D    + G+G V+RD EG  + A    +     P E E + +
Sbjct  45   RWERPPEGWMKANVDGSFDSQLLKGGIGVVIRDWEGAIIFASCKSMCRCSSPLEAELLAL  104

Query  186  REA----LKWIKD---LQYD-FIQLQLYSSFDLIINDVKELA---KDFLNINFLFA----  320
            RE     L W      L+ D  + LQ+  S +   +++  L    +D LN +  F     
Sbjct  105  REGIYLFLIWTLRPVILETDCLVALQMIQSKERATSELAYLVREIRDLLNGSREFVLWKI  164

Query  321  KRSANKVAHLL  353
            +R  N V+H L
Sbjct  165  RREQNMVSHFL  175



>ref|XP_003614550.1| hypothetical protein MTR_5g055330 [Medicago truncatula]
Length=138

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 50/97 (52%), Gaps = 2/97 (2%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
             W+RP  G  K N+DAA       + LG  + D  G F  AK IP+  +      EA+G+
Sbjct  18   SWQRPSRGRFKCNIDAAFLNKQNVICLGMCICDEGGVFGLAKVIPLPVMHNVIVGEAMGL  77

Query  186  REALKWIKDLQYDFIQLQL--YSSFDLIINDVKELAK  290
              AL+W+ D+++D +   L   S+ D  IN   ++++
Sbjct  78   YHALEWLSDMRFDNVDFALDSKSTMDAFINPRPDISE  114



>ref|XP_003629565.1| hypothetical protein MTR_8g079540 [Medicago truncatula]
 gb|AET04041.1| hypothetical protein MTR_8g079540 [Medicago truncatula]
Length=121

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W++PP  ++K NVDA+      R+G+G  LRD    FV AK I +  +      EA+G+
Sbjct  26   RWQQPPNSFVKCNVDASFSEHYNRVGIGMCLRDEFCMFVGAKMIWLQPIMLVDTGEALGL  85

Query  186  REALKWIKDLQYDFIQLQLYS  248
              AL+W ++L++  I   L S
Sbjct  86   LAALEWARELEFKKIIFCLNS  106



>ref|XP_006603254.1| PREDICTED: uncharacterized protein LOC102660201 [Glycine max]
Length=214

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/135 (26%), Positives = 64/135 (47%), Gaps = 15/135 (11%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W+ P  G++K N+D A     +  G G  ++D +G FV A      G+ +  E EA+ +
Sbjct  69   EWKPPGPGFVKCNIDVAYFQEQQWWGKGMCIQDDKGWFVRATMNIRHGMPEVHEGEALVL  128

Query  186  REALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFA  320
             + L W+K++ Y +++++                 S F +I+N  K +   F N      
Sbjct  129  LQTLTWLKNMDYQYVEVESDCKRLTDSLDRNIMDDSEFGMILNKCKRILMSFPNHKVSLI  188

Query  321  KRSANKVAHLLTRET  365
            ++ AN +AH L R +
Sbjct  189  RKQANCIAHSLARAS  203



>ref|XP_003589048.1| hypothetical protein MTR_1g017840 [Medicago truncatula]
 gb|AES59299.1| hypothetical protein MTR_1g017840 [Medicago truncatula]
Length=162

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 43/81 (53%), Gaps = 0/81 (0%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
              + P  G LK N+DA       R  +G  +RD + TFV AK I ++ +      EA+G+
Sbjct  56   HCQCPSRGRLKCNMDAGFSVATNRTDIGICVRDDDCTFVLAKTISLNVVHSVDVGEAMGL  115

Query  186  REALKWIKDLQYDFIQLQLYS  248
              AL+W+ ++Q+D +   + S
Sbjct  116  YHALEWLSNMQFDNVDFAMDS  136



>emb|CCA66036.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1369

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 46/132 (35%), Positives = 67/132 (51%), Gaps = 16/132 (12%)
 Frame = +3

Query  9     WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
             W  PP+G +KLNVDAA+ + +  +G+G V+RDAEG  + A       +  P   EA  +R
Sbjct  1210  WSVPPVGMVKLNVDAAV-FKHVGIGMGGVVRDAEGDVLLATCCGGWAMEDPAMAEACSLR  1268

Query  189   EALKWI-----------KDLQYDFIQLQLYSS----FDLIINDVKELAKDFLNINFLFAK  323
               LK              D +  F+QL+  +S    F  +++D+  LA    N+ F   K
Sbjct  1269  YGLKVAYEAGFRNLVVEMDCKKLFLQLRGKASDVTPFGRVVDDILYLASKCSNVVFEHVK  1328

Query  324   RSANKVAHLLTR  359
             R  NKVAHLL +
Sbjct  1329  RHCNKVAHLLAQ  1340



>gb|EAY95391.1| hypothetical protein OsI_17229 [Oryza sativa Indica Group]
Length=172

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 69/140 (49%), Gaps = 16/140 (11%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAI-  179
            AKWE+PP GW+KLNVD +    N   G+G +LR++ G  + A    +       E E + 
Sbjct  11   AKWEKPPSGWMKLNVDGSYQE-NNTGGIGAILRNSTGDVIFAVYGFVEQCQSALEAEILA  69

Query  180  ---GVREALKW------IKDLQYDFIQL-----QLYSSFDLIINDVKELAKDFLNINFLF  317
               G+R AL+W      I+    + IQL     +L S+   ++ +++ + K    +    
Sbjct  70   CKEGIRLALQWTLLPIIIESDCAEAIQLILSEGKLRSAHTFLVREIQGMVKGAREMKLKK  129

Query  318  AKRSANKVAHLLTRETLFKS  377
              R+ N+++H+L  +   +S
Sbjct  130  VNRNCNRISHVLANKGRCES  149



>gb|KHN00089.1| hypothetical protein glysoja_046125, partial [Glycine soja]
Length=147

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 64/147 (44%), Gaps = 15/147 (10%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            WE PPLG LK N+  A         L   +RD  G FV A            E +A+ + 
Sbjct  1    WEPPPLGTLKCNIGVAFVKEENSFKLVVFIRDDRGQFVMALSHTSPFKLLIHERKALAML  60

Query  189  EALKWIKDLQYDFIQL---------QLY------SSFDLIINDVKELAKDFLNINFLFAK  323
             AL+W+KDL+ D I +         ++Y      S + +I+++ + + +D  N    F  
Sbjct  61   VALQWLKDLEIDDIIIESDCLQVENEVYNCRSDKSKYGVILSNCRIMLRDLQNFWVCFVG  120

Query  324  RSANKVAHLLTRETLFKSDCSVYFFIP  404
            R AN V H L R    + D   +  +P
Sbjct  121  RQANSVTHSLDRALNSQVDPHYFRHVP  147



>gb|EMT25602.1| F-box/WD-40 repeat-containing protein [Aegilops tauschii]
Length=779

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 40/133 (30%), Positives = 61/133 (46%), Gaps = 15/133 (11%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W  PP+G +K+NVDAA+  G     +G + RD + TF+ A  +  S L  P   E + +R
Sbjct  44   WIAPPVGLVKINVDAAV--GRAHGAVGAMCRDRDRTFLGASAVVFSNLSDPGTLETLAIR  101

Query  189  EALKWIKDLQYDFIQL-------------QLYSSFDLIINDVKELAKDFLNINFLFAKRS  329
            EA+    DL    IQ+             Q   S+  I++++ +    F   N     RS
Sbjct  102  EAMALANDLYVGRIQIASDCKVAVDDIHQQFKGSYSAIVHEIIQYKSTFDICNIGHEFRS  161

Query  330  ANKVAHLLTRETL  368
            +N  AH L +  L
Sbjct  162  SNTEAHKLAKHAL  174



>ref|XP_006596580.1| PREDICTED: uncharacterized protein LOC102666294 [Glycine max]
Length=216

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 54/98 (55%), Gaps = 3/98 (3%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
             +W++P  G+LK NVDA +   +++ G G  +RD  G F+ AK     G+  P   EA G
Sbjct  103  CEWKKPSFGYLKCNVDATIFNQDQQFGNGMCIRDHNGQFIQAK-TWFQGVSDPTIAEACG  161

Query  183  VREALKWIKDLQYDFIQLQLYSSFDLIINDVKELAKDF  296
            + +A++W+K+   + I  +L + F  +++D     KD 
Sbjct  162  LYQAMEWLKESYNNNIISELDNKF--VVDDFNHNNKDL  197



>ref|XP_002447811.1| hypothetical protein SORBIDRAFT_06g016240 [Sorghum bicolor]
 gb|EES12139.1| hypothetical protein SORBIDRAFT_06g016240 [Sorghum bicolor]
Length=342

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 40/135 (30%), Positives = 64/135 (47%), Gaps = 13/135 (10%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            A W  PP G +K+NVDAA+   + +     V RD+ G FV A  +   G+  P+  EA+ 
Sbjct  181  APWIPPPAGVMKINVDAAISKNSSKASASAVARDSSGMFVGASVVVTEGISDPEIMEAVA  240

Query  183  VREALKWIKDLQYDFIQLQL-------------YSSFDLIINDVKELAKDFLNINFLFAK  323
             RE+L    DL    I++               + S+  +I ++K     F ++ F++  
Sbjct  241  CRESLALASDLLLQKIRVACDNITVVRNIRGKGFGSYGHVIQEIKARGDSFTSVEFVYEG  300

Query  324  RSANKVAHLLTRETL  368
            R +N  AH L R +L
Sbjct  301  RMSNGDAHRLARGSL  315



>ref|XP_010689711.1| PREDICTED: uncharacterized protein LOC104903385 [Beta vulgaris 
subsp. vulgaris]
Length=1533

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 43/138 (31%), Positives = 65/138 (47%), Gaps = 16/138 (12%)
 Frame = +3

Query  3     AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
             ++W  PP G++KLN DA++   +  +GLG V RD++G  + +        + P+  E   
Sbjct  1371  SRWTTPPDGFVKLNSDASIG-DDGWIGLGVVARDSQGKILFSAVRRTKAYWPPEVAECKA  1429

Query  183   VREALKWIKD--LQYDFIQLQ-------------LYSSFDLIINDVKELAKDFLNINFLF  317
             V  A++  K   LQ   I+                YS  D I+ DV  L + F ++NF+ 
Sbjct  1430  VHFAIRLAKSHGLQSVVIESDSQIVTTRLSRAALFYSDLDSILGDVLALCRSFNSVNFMH  1489

Query  318   AKRSANKVAHLLTRETLF  371
              KR  N VAH L R   F
Sbjct  1490  VKRDGNTVAHNLARVVPF  1507



>ref|XP_002515720.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46667.1| conserved hypothetical protein [Ricinus communis]
Length=156

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +3

Query  12   ERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVRE  191
            ++P  GW+K ++DAA     R +G+G +  D EG FV  K   ++G    KE EA+G++E
Sbjct  37   QKPARGWVKCDMDAATFENGRVIGIGLMSMDEEGRFVKGKSFCMNGRIAIKEAEAMGLKE  96

Query  192  ALKWI  206
            AL W 
Sbjct  97   ALSWC  101



>ref|XP_010667851.1| PREDICTED: uncharacterized protein LOC104884846 [Beta vulgaris 
subsp. vulgaris]
Length=179

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 65/134 (49%), Gaps = 18/134 (13%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W  P     KLN DA++   ++ +G+G V RD+EG  + A    + G+   +  EA+  
Sbjct  18   RWSAPIGDVYKLNTDASM-VKDKGIGMGGVDRDSEGDVMMATCCGMMGIANVELAEALSA  76

Query  186  REALKW--------------IKDLQYDFIQLQLY--SSFDLIINDVKELAKDFLNINFLF  317
            R  L+                K L ++++Q ++Y  S F  I+ D+ E A     I+F  
Sbjct  77   RHGLQLSVEAGLRSLIMEVDCKKL-FNYMQARIYEMSPFGKIVADILEYASQCTFISFAH  135

Query  318  AKRSANKVAHLLTR  359
             KR  NKVAHLL +
Sbjct  136  VKRQGNKVAHLLAQ  149



>ref|XP_003613452.1| hypothetical protein MTR_5g036840 [Medicago truncatula]
Length=261

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/108 (29%), Positives = 51/108 (47%), Gaps = 5/108 (5%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W+ P     K N+DAA    +    +G  +RD+EG+FV +K I    +      EA+G+ 
Sbjct  70   WQPPTSDRYKCNIDAAFSSHHNHTSIGICIRDSEGSFVLSKTITSLCIVLVDVGEALGLH  129

Query  189  EALKWIKDLQYDFIQLQLYSSFDLII-----NDVKELAKDFLNINFLF  317
             AL+W+ D+Q D +  +  S   + +     ND+ E      +   LF
Sbjct  130  SALQWLSDMQLDNVDFETDSKVTVDVFLSTRNDLSEFGSIISSCRSLF  177



>ref|XP_007213514.1| hypothetical protein PRUPE_ppa020664mg, partial [Prunus persica]
 gb|EMJ14713.1| hypothetical protein PRUPE_ppa020664mg, partial [Prunus persica]
Length=171

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 62/137 (45%), Gaps = 16/137 (12%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            KW  PP G  KLNVDAA        G+G V+R+ +G  +AA  +P++     K  E +  
Sbjct  34   KWSPPPAGKYKLNVDAAFIPETGVGGIGAVVRNDKGEVMAAMALPLASATSSKHAEIMAF  93

Query  186  REALKWIKDLQYDFI----------------QLQLYSSFDLIINDVKELAKDFLNINFLF  317
               +K+ +D     I                + + ++S   +I D+K   + F ++   +
Sbjct  94   LFGMKFARDAGCSSILIESDSQGVVNDVKKDEEESWASDGHLIGDIKRSLQHFEDVIISY  153

Query  318  AKRSANKVAHLLTRETL  368
            + R  N+VAH L +  L
Sbjct  154  SPRGVNQVAHFLAKHAL  170



>ref|XP_002468357.1| hypothetical protein SORBIDRAFT_01g044485 [Sorghum bicolor]
 gb|EER95355.1| hypothetical protein SORBIDRAFT_01g044485 [Sorghum bicolor]
Length=212

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 56/118 (47%), Gaps = 4/118 (3%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            KW  PP  ++K NVDAA+     +  +  V RD  G +VAA  + I GL  P   EA+  
Sbjct  71   KWIPPPEAFVKFNVDAAVARAEDKGTVTVVCRDNVGNYVAASAMVIDGLTDPSSLEALAC  130

Query  186  REALKWIKDLQYDFIQLQLYSSFDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTR  359
             EA+    D+    +Q +    F L + ++K  +  F  + F    R +N  AH L +
Sbjct  131  NEAISLAMDIG---VQAKFVCLF-LSVEEIKARSTLFQEVVFKHEGRESNCEAHALAK  184



>gb|KEH18875.1| hypothetical protein MTR_8g031080 [Medicago truncatula]
Length=398

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 66/134 (49%), Gaps = 12/134 (9%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W++P  G LK NVDA+      ++G+G  +RD EG FV AK +    L      EA+G 
Sbjct  267  RWKKPRCGRLKCNVDASFSSSTNKVGVGMCIRDEEGHFVRAKTMWHKPLCSVDIGEALG-  325

Query  186  REALKWIKDLQYDFIQLQLYSSFDLIINDVKELAKDFLNINFL-FAKRSANKVAHLLTRE  362
                     L +D     + + F + ++  +     FL  + + F++R AN+VAH L + 
Sbjct  326  ---------LHHDIGNGDI-TEFGINMDSNRHYCSLFLPKSHVEFSRRQANRVAHELAKA  375

Query  363  TLFKSDCSVYFFIP  404
             L++    ++  +P
Sbjct  376  ALYEPSFRIFDDVP  389



>ref|XP_002526185.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36189.1| conserved hypothetical protein [Ricinus communis]
Length=180

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 49/90 (54%), Gaps = 8/90 (9%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            KW++  +G++K N+DA++      +  G V RDA+G F+ A+   I+ +  P   EA+  
Sbjct  92   KWQKSGIGYVKCNMDASIYLTKGNIAFGMVTRDADGRFLEARNGLINAIMDPLLAEALSC  151

Query  186  REALKWIKD-------LQYDFIQLQLYSSF  254
            REAL W+K        ++YD  Q   + SF
Sbjct  152  REALSWLKTAGKEKVLVEYD-CQCVKWCSF  180



>ref|XP_010673165.1| PREDICTED: uncharacterized protein LOC104889605 [Beta vulgaris 
subsp. vulgaris]
Length=188

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 60/139 (43%), Gaps = 18/139 (13%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAAL-DYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAI  179
            ++W  PP G +KLN DA+L D G   +GLG V RD+EG    A    +   + P+  E  
Sbjct  27   SRWYAPPAGAIKLNTDASLADEG--WVGLGVVARDSEGKVCFAAARRVRAFWPPEVAECK  84

Query  180  GVREALKWIKDLQYDFIQLQ---------------LYSSFDLIINDVKELAKDFLNINFL  314
             +  A +  K   Y  +  +                 S  D I+ D+  +   F +++F 
Sbjct  85   AIYMATRLAKAHGYRDVIFESDSLVATKRLTKAAIFLSDLDAILGDILSMCNAFSSVSFS  144

Query  315  FAKRSANKVAHLLTRETLF  371
              +R  N VAH L R   F
Sbjct  145  HVRRDGNSVAHNLARVVPF  163



>ref|XP_010681661.1| PREDICTED: uncharacterized protein LOC104896591 [Beta vulgaris 
subsp. vulgaris]
Length=197

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 63/134 (47%), Gaps = 16/134 (12%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W+ P  G  K+N DAA+ + +R +GLG V+RDA G  + A  + +       E EA   R
Sbjct  35   WKPPVEGSYKINADAAI-FKDRTVGLGGVMRDAAGEVMGATCMHLEVELGVDEAEACAAR  93

Query  189  EALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFAK  323
             AL+   ++    I L+                 SSF  ++ D+  L   F +I+F   +
Sbjct  94   HALQTAVEMGLRHIVLESDSLKVISHLLTKKGDESSFGNVVEDILWLGGFFSSISFNHVR  153

Query  324  RSANKVAHLLTRET  365
            R  N+VAH + + +
Sbjct  154  REGNRVAHTIAQRS  167



>ref|XP_010319942.1| PREDICTED: uncharacterized protein LOC104647070 [Solanum lycopersicum]
Length=440

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 68/139 (49%), Gaps = 16/139 (12%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            AKWERP L  +K NVDA+ D       +G +L D  G  +A K + +  +  P   + IG
Sbjct  300  AKWERPLLYTIKCNVDASYDINTGLTVIGMLLCDLLGQSIAGKTLFLDRVASPLLTKIIG  359

Query  183  VREALKWIKD--------LQYDFIQLQL--------YSSFDLIINDVKELAKDFLNINFL  314
            V EAL W+K         +  D ++++         YS F+ ++   + L K+   +   
Sbjct  360  VCEALSWLKKWFSRKWLVVVTDNLRVKQALEENLVNYSYFNSLVFKCETLIKELFFLFLS  419

Query  315  FAKRSANKVAHLLTRETLF  371
             +K+SAN+V + L R + F
Sbjct  420  VSKKSANEVVYCLARASNF  438



>ref|XP_003619023.1| hypothetical protein MTR_6g032980 [Medicago truncatula]
Length=131

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 59/129 (46%), Gaps = 7/129 (5%)
 Frame = +3

Query  21   PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  200
             LG  K NVDA+      ++G+G  +RD EG FV AK    +  F P  D  +G    L 
Sbjct  2    TLGRYKCNVDASFSNSLNKVGIGVCIRDEEGLFVLAK----TEWFAPIVDVDLGEAMGLL  57

Query  201  WIKDLQYDFIQLQLYSSFDLIINDVKE-LAKDFLNINFLFAKRSANKVAHLLTRETLFKS  377
             I D  Y        S+  +IIND +  LA D  N +  F +R AN   H L ++  F  
Sbjct  58   TIVDNVYG--GSNGVSNNMVIINDCRHMLATDLANSDLKFIRRQANDATHSLVKKAPFNH  115

Query  378  DCSVYFFIP  404
               +Y+ I 
Sbjct  116  SFHIYYNIS  124



>ref|XP_002531371.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31019.1| conserved hypothetical protein [Ricinus communis]
Length=143

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +3

Query  18   PPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREAL  197
            P  GWLK+N DA     + + G G V R  +G+FV A  I  SGLF  +  E +GVREAL
Sbjct  83   PSFGWLKVNADAVSFLASAKTGFGMVARRDDGSFVVAHTISTSGLFSSRMMEIMGVREAL  142

Query  198  K  200
             
Sbjct  143  S  143



>gb|KEH25827.1| hypothetical protein MTR_6g034915 [Medicago truncatula]
Length=176

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 59/117 (50%), Gaps = 11/117 (9%)
 Frame = +3

Query  72   RRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQLYSS  251
            R++ +G  +RDA G F  AK +  + + KP+  E +G+  A++W+ +LQ   +  ++ + 
Sbjct  55   RKIYVGLCIRDAAGNFRKAKMMWSNPICKPEIGEVLGLLYAIQWVHELQLTNVDFEMDAK  114

Query  252  -----FDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTRETLFKSDCSVYFFIPF  407
                 F    N+V E      N    F+ R AN+VAH L RE LF     V+  +P 
Sbjct  115  LVVDYFTKGNNNVSE------NFKMEFSWRQANEVAHTLAREALFLPSSQVFNDVPL  165



>ref|XP_003592602.1| hypothetical protein MTR_1g109000 [Medicago truncatula]
 gb|AES62853.1| hypothetical protein MTR_1g109000 [Medicago truncatula]
Length=87

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W +P   ++K N+DA+  + +  +G+G ++RD  G FV AK I ++ L + +E +A G+ 
Sbjct  5    WIKPRANFMKCNIDASFCHTHNMVGIGILIRDDRGHFVQAKTIQVTPLLQVQEGKAKGLL  64

Query  189  EALKWIKDL  215
             A+ W+ +L
Sbjct  65   HAMNWVIEL  73



>ref|XP_003625876.1| hypothetical protein MTR_7g108270 [Medicago truncatula]
Length=151

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W+RP  G LK N+DA+      +  +   + D E TFV AK + IS +      E +G+
Sbjct  29   RWKRPQRGRLKCNIDASFSDPLNKPCIDVCICDDECTFVPAKTVSISLMCFVAVGEVLGL  88

Query  186  REALKWIKDLQYD  224
              AL+W+ DLQ+D
Sbjct  89   FHALQWLSDLQFD  101



>ref|XP_003624433.1| hypothetical protein MTR_7g083150 [Medicago truncatula]
Length=272

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 70/154 (45%), Gaps = 27/154 (18%)
 Frame = +3

Query  30   WLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKED-----EAIGVREA  194
            W K N+DA+      ++GLG  +R+  G F+ AK    +  F P  D     E IG+  A
Sbjct  119  WYKCNIDASFSPSLNKVGLGMCIRNDAGEFMLAK----TDWFAPLCDALMWGEVIGLYTA  174

Query  195  LKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKD-FLNINFLFAKR  326
            L+W+ DLQ+D +   L                S +  II+  + L ++ F N +  F +R
Sbjct  175  LQWVLDLQFDNVDFVLDSKTVVDHVNFDVDDNSEYGCIISICRRLLQNSFQNYHVEFNRR  234

Query  327  SANKVAHLLTRETLFKSDCSVYFFIPFPSIV*YI  428
              N +AH LT   +   + S Y     PS + +I
Sbjct  235  QVNGIAHKLTE--IVPLNHSSYIIDDAPSCIWHI  266



>ref|XP_003594303.1| hypothetical protein MTR_2g027020 [Medicago truncatula]
 gb|AES64554.1| hypothetical protein MTR_2g027020 [Medicago truncatula]
Length=188

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 63/132 (48%), Gaps = 12/132 (9%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W++   G LK ++D        ++G+   +RD EG FV AK +  + L      EA+G+
Sbjct  6    RWKKLIYGRLKCSIDLCFSASTNKLGICTCIRDEEGCFVLAKSMWFTLLCSIDVGEALGL  65

Query  186  REALKWIKDLQYDFI-QLQLYSSFDLIINDVKELAKDF-LNINFL----------FAKRS  329
              A+KWI DL+   +   ++   F+   +D+ E      +NI +           F +R 
Sbjct  66   YHAIKWIHDLRLPNVDSKRVVDYFNRSNDDITEYGIIMDINIYYCSLYLTNSRVGFTRRQ  125

Query  330  ANKVAHLLTRET  365
            AN+V H LT  +
Sbjct  126  ANEVVHELTNAS  137



>ref|XP_008383144.1| PREDICTED: uncharacterized protein LOC103445866 [Malus domestica]
Length=256

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 58/130 (45%), Gaps = 16/130 (12%)
 Frame = +3

Query  18   PPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREAL  197
            P   W++ N DAA D      G+G V+R+ +G F+    + + G+  P   E +  REAL
Sbjct  110  PENEWIQSNFDAAWDAQLEIGGVGVVIRNNKGEFMVIVAMRVEGVGSPLLVEIMAAREAL  169

Query  198  KWIKDLQYDFIQ----------------LQLYSSFDLIINDVKELAKDFLNINFLFAKRS  329
             + +  Q   ++                L   S F  II +++++  DF      F +RS
Sbjct  170  IFSQHQQTTHVEVEGDALMVSTTLQHEGLNDSSPFGHIITNIRQILNDFSQCKVTFGRRS  229

Query  330  ANKVAHLLTR  359
             NKV H L R
Sbjct  230  TNKVVHRLAR  239



>ref|XP_007217601.1| hypothetical protein PRUPE_ppa018407mg [Prunus persica]
 gb|EMJ18800.1| hypothetical protein PRUPE_ppa018407mg [Prunus persica]
Length=356

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/150 (27%), Positives = 67/150 (45%), Gaps = 19/150 (13%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
             KW  PP G  KLNVDAA        G+  V+R+ +G  +AA  +P++     K  E + 
Sbjct  202  TKWSPPPAGKYKLNVDAAFIPETGVGGIDVVVRNDKGEVMAAMALPLASATSSKHAEIMA  261

Query  183  VREALKWIKDLQYDFIQLQL----------------YSSFDLIINDVKELAKDFLNINFL  314
                +K+  D  +  I ++                 ++S   +I+D+K   + F ++   
Sbjct  262  FLFEMKFAWDAGFSSILIESDSQGVVNDVKKDEEESWASDGHLIDDIKRSLQHFEDVIIS  321

Query  315  FAKRSANKVAHLLTRETLFKSDCSVYFFIP  404
            F+ R  N+VAH L +  L   +C+    IP
Sbjct  322  FSPRGGNQVAHFLAKHAL---NCNTMLMIP  348



>ref|XP_010680493.1| PREDICTED: uncharacterized protein LOC104895631 [Beta vulgaris 
subsp. vulgaris]
Length=192

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 65/133 (49%), Gaps = 16/133 (12%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W  P  G  KLN DA++   ++ +G+G V+RD+EG  + A    + G+   +  EA+  
Sbjct  31   RWRAPREGVYKLNTDASM-IKDKGIGMGGVVRDSEGDVMLATYCGMVGISNVEVAEALSA  89

Query  186  REALKWI-----KDLQYDFIQLQLY----------SSFDLIINDVKELAKDFLNINFLFA  320
            R  L+ +     ++L  +    +LY          S F  I+ D+ + A     I+F   
Sbjct  90   RHGLQVVVEAGLRNLIVEVDCKKLYNHLHARISEVSLFGKIVADILDYASHCSYISFSHV  149

Query  321  KRSANKVAHLLTR  359
            KR  NKVAHLL +
Sbjct  150  KRQGNKVAHLLAQ  162



>ref|XP_010680467.1| PREDICTED: uncharacterized protein LOC104895604 [Beta vulgaris 
subsp. vulgaris]
Length=349

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 60/138 (43%), Gaps = 18/138 (13%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAAL-DYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            +W  PP G +KLN DA+L D G   +GLG V RD+EG    A    +   + P+  E   
Sbjct  173  RWYAPPAGVIKLNTDASLADEG--WVGLGVVARDSEGKVCFAATKRVRAFWPPEVAECKA  230

Query  183  VREALKWIKDLQYDFIQLQ---------------LYSSFDLIINDVKELAKDFLNINFLF  317
            +  A +  K   Y  +  +                +S  D I+ D+  +   F +++F  
Sbjct  231  IYMATRLAKAHGYGDVIFESDSLVATKRLTKAAIFFSDLDAILGDILSMCNAFSSVSFSH  290

Query  318  AKRSANKVAHLLTRETLF  371
             +R  N VAH L R   F
Sbjct  291  VRRDGNSVAHNLARVVPF  308



>ref|XP_008226959.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=370

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 68/139 (49%), Gaps = 27/139 (19%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKE----IPISGLFKPKED  170
            + W  PP G++KLN D   +   R++G+G+VLRD  G F+ A      + +S L      
Sbjct  227  SAWSCPPSGFVKLNCDGEWEAQTRKLGVGWVLRDGIGCFINAGGYGDMLCVSALMA----  282

Query  171  EAIGVREALKWIKDLQYDFIQLQLYS-----------------SFDLIINDVKELAKDFL  299
            EA  V EAL   + L++ F+++ + S                   + I+ D++ L +   
Sbjct  283  EAEAVPEAL--TRCLEFGFVKVAVESDSLSLIKMLNKKGVVDLEIEGILFDIQCLTQHAD  340

Query  300  NINFLFAKRSANKVAHLLT  356
             ++FL+A R  N+ AH +T
Sbjct  341  QVDFLYAPRICNQAAHKVT  359



>ref|XP_004308694.1| PREDICTED: uncharacterized protein LOC101313751 [Fragaria vesca 
subsp. vesca]
Length=193

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 62/146 (42%), Gaps = 17/146 (12%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W+RPP GWL + +D A D      G+G V+RD  G F +     I+ +  P   EAI   
Sbjct  6    WKRPPPGWLSVCLDGAFDPNTMSGGVGIVVRDWHGNFHSGTACSIAHVSSPAHIEAIAGL  65

Query  189  EALKWIKD-------LQYDFIQLQLYSSFDLIINDVKELAKDFLNINFLFAK--------  323
             A +++ D        + + +QL    S     +D  +L + + ++  LF +        
Sbjct  66   IACRFVLDHGLSPVKFETESVQLVQAVSSPSRSSDHLQLGQSYEDVADLFMQLPGCSFTR  125

Query  324  --RSANKVAHLLTRETLFKSDCSVYF  395
              R  N+ A  L         C++YF
Sbjct  126  IFREGNEAAQKLALWASASQPCNIYF  151



>ref|XP_006473914.1| PREDICTED: uncharacterized protein LOC102629934 [Citrus sinensis]
Length=304

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 62/131 (47%), Gaps = 15/131 (11%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            KW  PP GW K+NVDAA+    +R GLG V+R++EG  +AA   P   L K    EA   
Sbjct  144  KWSYPPEGWFKVNVDAAVKMEQQRTGLGIVIRNSEGKVMAAAMKPSKFLSKVDAAEAEAA  203

Query  186  REALKWIKDLQY-------------DFIQLQLYSSFDL--IINDVKELAKDFLNINFLFA  320
            +  L+  +++               + I L+  +  ++  +I+++++  K    +     
Sbjct  204  KFGLEIAENVGCFPLIIESDSKEVVELISLKKSTRTEIFWVISEIQDRMKRLKKVKIQHT  263

Query  321  KRSANKVAHLL  353
             R  N +AH L
Sbjct  264  PRGCNSLAHSL  274



>gb|ABA99010.1| expressed protein [Oryza sativa Japonica Group]
 gb|EAZ20576.1| hypothetical protein OsJ_36185 [Oryza sativa Japonica Group]
Length=268

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 58/134 (43%), Gaps = 19/134 (14%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            A+W +P  GW+K+N D + D  N   G+G V+RD+ G  V A    I       E E + 
Sbjct  107  AQWVKPQGGWMKINTDGSCDSKNGNGGVGAVVRDSSGRVVLALSRHIDRCGSALEAELLA  166

Query  183  VREALKWIKDLQYDFIQL-----------------QLYSSFDLIINDVKELAKDFLNINF  311
             +E L     LQY  + L                 ++ S    II +   L +    I F
Sbjct  167  CKEGLSLA--LQYTLLPLVLETDCLEALKLLKSKEKVMSPEVFIIREANSLLQGNREIKF  224

Query  312  LFAKRSANKVAHLL  353
               +RS N+V+HLL
Sbjct  225  SKGQRSQNRVSHLL  238



>ref|XP_003621044.1| hypothetical protein MTR_7g006490 [Medicago truncatula]
Length=263

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 58/134 (43%), Gaps = 16/134 (12%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W+ P L   K  +DA+      ++G+G    D  G FV AK+   S L      E +G+
Sbjct  112  QWKNPTLSRYKCFIDASFSSAMNKVGIGMCFHDDAGDFVLAKKSWFSPLCDVNIGEVVGL  171

Query  186  REALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKD-FLNINFLF  317
               LKW   LQ+D + L L                S F  II + ++L +  F N +  F
Sbjct  172  HTILKWTSHLQFDNVDLALDSKKVVDAFRRCVGDSSEFGCIIVECRQLFQSRFQNSHVEF  231

Query  318  AKRSANKVAHLLTR  359
             +R AN + + L  
Sbjct  232  NRRQANGITYELAH  245



>ref|XP_006485449.1| PREDICTED: uncharacterized protein LOC102621413 [Citrus sinensis]
Length=2303

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 40/151 (26%), Positives = 73/151 (48%), Gaps = 27/151 (18%)
 Frame = +3

Query  6     KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAA--KEIPISGLFKPKEDEAI  179
             KWE PP  +LK+NVDAA++  ++  GLG V++D  G  VAA  K++P+      +E  + 
Sbjct  1175  KWEPPPGNFLKVNVDAAINNRDQVAGLGAVIKDPSGKIVAAGTKQVPL------REGVSF  1228

Query  180   GVREALKW----IKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLN  302
                EA++W     ++L    + ++                 +    +I+D++E  +DF  
Sbjct  1229  AEAEAMEWGLQIARELSLSALIMETDCKEVVDLLNNTKGSRTGISWVISDIQEQRRDFKE  1288

Query  303   INFLFAKRSANKVAHLLTRETLFKSDCSVYF  395
             + F    R+ N  AH L +  +  +  +V+ 
Sbjct  1289  VKFRHIPRTCNTCAHSLAKLAVGANTSAVWL  1319



>ref|XP_008243683.1| PREDICTED: uncharacterized protein LOC103341914 [Prunus mume]
Length=196

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            KW  PP G  KLNVDAA        G+G V+R+ +G  +AA  +P+  +  PK  E + +
Sbjct  60   KWSPPPAGKYKLNVDAAYIPETCVGGIGGVVRNDKGEVMAAMALPLVTVTSPKYAEIMAL  119

Query  186  REALKWIKDLQYDFIQLQLYSSFDLIINDVKE-----------LAKDFLNINFLFAKRSA  332
            +  +K+ +D  +  I ++  S    +++D+K+           + +   ++   F+    
Sbjct  120  QFGMKFARDAGFSSILIE--SDSQGVVSDLKKDEEESWASVRGVCEQLDDVTVSFSPMGC  177

Query  333  NKVAHLLTRETL  368
            N+VA+ L R  L
Sbjct  178  NQVAYRLARHAL  189



>ref|XP_009378422.1| PREDICTED: uncharacterized protein LOC103966921 [Pyrus x bretschneideri]
Length=377

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 71/154 (46%), Gaps = 17/154 (11%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W++   GW+K N+D   D      G+G V+R++EG F+AA  +  +G+      EA+  
Sbjct  214  EWQKLDFGWIKCNLDVVWDEIGLHGGIGIVVRNSEGEFIAAMVVWENGIRSVLHAEAVVA  273

Query  186  REALKWIKDLQYDFIQ-----LQLYSS-----------FDLIINDVKELAKDFLNINFLF  317
            R    + +    + +Q     L + S+           +  +  D +++ + F   N  F
Sbjct  274  RATAVFTRQWSTEQVQGEGDALMVISAIQNEGTAHQGPYGHLFADTRQILQSFKQWNVSF  333

Query  318  AKRSANKVAHLLTRETLFKSDCSVYFFIPFPSIV  419
             +R  NKVAH L R +L     + +F  P P ++
Sbjct  334  GRRDTNKVAHHLARFSLALDHPASWFEEP-PDVI  366



>gb|ABN07957.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=380

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/91 (31%), Positives = 49/91 (54%), Gaps = 2/91 (2%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            +KW +P +G  K NVDAA      R+G G  +RDA G  V ++    + L   +  EAIG
Sbjct  286  SKWSKPSVGRFKCNVDAAFSASLHRVGFGACIRDANGNHVISRTECFTPLLDVEMGEAIG  345

Query  183  VREALKWIKDLQYDFIQLQLYSSFDLIINDV  275
            +  A++W KDL  + + +   +   +++ ++
Sbjct  346  LLHAMRWAKDL--NLVNMDFETDSKVVVENI  374



>ref|XP_008358038.1| PREDICTED: uncharacterized protein LOC103421772 [Malus domestica]
Length=244

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 70/152 (46%), Gaps = 16/152 (11%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            KW +P  G +KLN D A D  +   G   ++ D++G F+A        +  P   EAI V
Sbjct  85   KWTKPRQGQVKLNXDGAWDATHLVGGXRAIIXDSDGNFLAGLSKSSLYISSPFFXEAIAV  144

Query  186  RE--ALKWIKDLQ--------YDFIQLQLYSSFD-----LIINDVKELAKDFLNINFLFA  320
            RE  AL + +  Q           +Q   YSS D     LI  D + +A     ++F   
Sbjct  145  REGLALAYSRGFQNIIVESDSXQIVQALCYSSPDLSXVGLIXEDSRAIAXAITGVSFTHI  204

Query  321  KRSANKVAHLLTRETLFKSDCSVYFFIPFPSI  416
            +R AN+VAH   R +   +  +++F  P P+I
Sbjct  205  RRQANEVAHRXARYSFSSTIPALWFEEP-PNI  235



>ref|XP_010676258.1| PREDICTED: uncharacterized protein LOC104892125 [Beta vulgaris 
subsp. vulgaris]
Length=175

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 65/139 (47%), Gaps = 18/139 (13%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRR-MGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAI  179
            +KW  PP G +K+N DA +  GN   +GLG V RD++G    +        + P+  E  
Sbjct  13   SKWRAPPPGVIKVNTDACV--GNDGWIGLGVVARDSDGRVCFSAVRRCRAWWPPEIAECK  70

Query  180  GVREALKWIKD-------LQYD--FIQLQL------YSSFDLIINDVKELAKDFLNINFL  314
             +   ++  KD       ++ D   +  +L      YS  D I+ DV  L+  F +++F+
Sbjct  71   AIHLGVRLAKDHGLRDVLVESDSQVVTTRLTKAVLYYSDLDFILGDVLALSYVFNSVSFV  130

Query  315  FAKRSANKVAHLLTRETLF  371
              KR  N VAH L R   F
Sbjct  131  HVKRDGNAVAHNLARVVPF  149



>ref|XP_010269328.1| PREDICTED: uncharacterized protein LOC104606020 [Nelumbo nucifera]
Length=167

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 63/133 (47%), Gaps = 19/133 (14%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W +PP G+LK+N D       ++ G+GFV+RD  G+F+ A+ IPI+ L  P   EA  + 
Sbjct  14   WAKPPNGFLKINFDGT--NSTQKSGVGFVVRDHTGSFIFARAIPIN-LSPPVVSEATALL  70

Query  189  EALKWIKDLQY----------DFIQLQLYS------SFDLIINDVKELAKDFLNINFLFA  320
            E++K+   + +            I+L L        S   +++  + L       +  F 
Sbjct  71   ESIKFTISMGFSHTIFEGDNESIIKLLLEENSNPPWSILTLLSSCRSLLNHLDGFSVTFT  130

Query  321  KRSANKVAHLLTR  359
             RS  +VAH + +
Sbjct  131  LRSGKQVAHHIAK  143



>gb|EEC72520.1| hypothetical protein OsI_05906 [Oryza sativa Indica Group]
Length=175

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 62/134 (46%), Gaps = 18/134 (13%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKE--IPISGLFKPKEDEAIG  182
            W++PP G L +NVDAA D  +   G G VLRD  G  V A +  +P   L  P   EA  
Sbjct  25   WKKPPEGMLMINVDAAFDIDSGSGGTGVVLRDHLGACVTASQAFLPYV-LDAPTMAEAFA  83

Query  183  VREALKWIKDL-------QYDFIQL---QLYSSFDL-----IINDVKELAKDFLNINFLF  317
            +R+ L   + +       Q D +Q+    +   F       + +D K +   F  I+   
Sbjct  84   LRDGLALAQHIGAKNVIVQTDCMQVVSTMMDGGFSATAAMSVFDDCKLMWDGFGTISIEH  143

Query  318  AKRSANKVAHLLTR  359
              R++N+VAH L R
Sbjct  144  CNRNSNQVAHELAR  157



>ref|XP_003610669.1| hypothetical protein MTR_5g005740 [Medicago truncatula]
Length=261

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 55/117 (47%), Gaps = 16/117 (14%)
 Frame = +3

Query  78   MGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQL-----  242
            +G+G  +RD  GTFV AK++  S + +    EA+G+  AL W+ +L    +  +L     
Sbjct  2    VGIGMCIRDENGTFVLAKQVRFSPICEVHIGEALGLLAALDWVHNLSLGPVDFELDAKRV  61

Query  243  ----------YSSFDLIINDVKELAKDF-LNINFLFAKRSANKVAHLLTRETLFKSD  380
                       + F  II   K L  +F +N    F +R AN+VAH L +  L  + 
Sbjct  62   VDDFNSLNCDVTEFGNIIEHCKSLCSNFYVNSRVEFVRRQANEVAHNLAKAALLSAS  118



>ref|XP_010677668.1| PREDICTED: uncharacterized protein LOC104893266 [Beta vulgaris 
subsp. vulgaris]
Length=190

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 59/138 (43%), Gaps = 16/138 (12%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            ++W  PP G +KLN DA+L      +G+G + R++EG    A    +   + P+  E   
Sbjct  27   SRWHAPPAGAIKLNTDASLAE-EGWVGIGVIARNSEGKVCFAATRRVRAYWPPEVAECKA  85

Query  183  VREALKWIKDLQYDFIQLQ---------------LYSSFDLIINDVKELAKDFLNINFLF  317
            +  A +  K   Y  +  +                +S  D I+ D+  +   F +++F  
Sbjct  86   IYMATRLAKAHGYGDVIFESDSLVATRRLTKAAIFFSDLDAILGDILAMCNAFSSVSFSH  145

Query  318  AKRSANKVAHLLTRETLF  371
             KR  N VAH L R   F
Sbjct  146  VKRDGNTVAHNLARVVSF  163



>ref|XP_002510892.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51494.1| conserved hypothetical protein [Ricinus communis]
Length=192

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 58/111 (52%), Gaps = 17/111 (15%)
 Frame = +3

Query  21   PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFV-AAKEIPISGLFKPKEDEAIGVREAL  197
            PLG  K+  DAA+   + ++GLG ++RD  G F+ AAK   +     P   EA+  RE L
Sbjct  45   PLGPCKMRCDAAVFVESNKLGLGCIIRDDSGRFIAAAKHNSMRVRLIPSIAEALSCREGL  104

Query  198  KWIKDL--QYDFI-----QLQLY---------SSFDLIINDVKELAKDFLN  302
             W+K L  Q++ I     Q+ ++         S F L+++D   +AKD ++
Sbjct  105  SWLKSLLGQHNVIVDSDSQVLIHAINNSRSDLSEFGLVVDDCISIAKDIVS  155



>ref|XP_003627791.1| hypothetical protein MTR_8g038340 [Medicago truncatula]
 gb|AET02267.1| hypothetical protein MTR_8g038340 [Medicago truncatula]
Length=248

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W +P     K NVDA+  +   ++GL   +RD EG FV  K   ++ L     +EA+G+
Sbjct  167  QWHKPSPSRYKCNVDASFSHSFNQVGLRLCIRDDEGRFVLVKTEWLTPLLYVDSEEALGL  226

Query  186  REALKWIKDLQYDFIQLQL  242
               L W++D+++  +  +L
Sbjct  227  LSTLHWVRDMRFSIVDFEL  245



>ref|XP_010696574.1| PREDICTED: uncharacterized protein LOC104909083 [Beta vulgaris 
subsp. vulgaris]
Length=172

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 64/136 (47%), Gaps = 16/136 (12%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +WE P   + K+N DAA  + + R GLG ++RD  G  + A    ++G    +  EA+  
Sbjct  13   RWEPPLRDYCKINSDAAC-FEDGRYGLGGIMRDEVGDIMVATCTVVNGNKNAEIAEALAA  71

Query  186  REALKWIKD-------LQYDFIQLQLY--------SSFDLIINDVKELAKDFLNINFLFA  320
            R AL    +       L+ D +++  +        S F  I+ND++ LA+   +I F   
Sbjct  72   RHALTTAIEAGLSRVILEVDNMKVYAHLKNGTKEQSCFGFIMNDIRALARQCSDIKFSHV  131

Query  321  KRSANKVAHLLTRETL  368
             R+ N  AH L + + 
Sbjct  132  GRNGNVAAHELAKMSC  147



>ref|XP_003614263.1| hypothetical protein MTR_5g047250 [Medicago truncatula]
 gb|AES97221.1| hypothetical protein MTR_5g047250 [Medicago truncatula]
Length=108

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 52/105 (50%), Gaps = 11/105 (10%)
 Frame = +3

Query  93   VLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQLYSSFDLIIND  272
             LRD +GTFVAA  I         E EA  + + ++WI  L Y  +  +L         D
Sbjct  4    CLRDEKGTFVAALTIYCEAAMIIVEGEAWDLYQDIQWISSLGYHDVIFEL---------D  54

Query  273  VKELAKDFLNINFLFAKRSANKVAHLLTRETLFKSDCSVYFFIPF  407
             K +A D  NI  +F +R AN  AH+L++E L  +  S +  IPF
Sbjct  55   CKMVADDVHNI--VFTRRQANGSAHVLSQEALSHASRSTFDVIPF  97



>ref|XP_010686173.1| PREDICTED: uncharacterized protein LOC104900455 [Beta vulgaris 
subsp. vulgaris]
Length=225

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 59/132 (45%), Gaps = 16/132 (12%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W +P   ++K+N DA    G+   G+G V RD  G  +A          +P+  EA  + 
Sbjct  67   WSKPKASYVKVNTDAG-QIGSLGCGIGVVCRDEFGEVLATGTFEHQVESEPRVAEAKAIF  125

Query  189  EALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFAK  323
              +K   +L Y  ++++                 S F+LII+DV  L   F N+   F K
Sbjct  126  YGMKLALELGYSCVEVESDSLMAIQALRSDKGGSSEFNLIIDDVLALVSSFNNVIRSFVK  185

Query  324  RSANKVAHLLTR  359
            R  NKV H+LT 
Sbjct  186  RLRNKVTHMLTH  197



>ref|XP_003609683.1| hypothetical protein MTR_4g120000 [Medicago truncatula]
Length=134

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 60/144 (42%), Gaps = 32/144 (22%)
 Frame = +3

Query  33   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKD  212
            +K N+D           +   LR   GTFV A+     G+      EA+G+   L+W+ D
Sbjct  1    MKCNIDVVFSTQRNHTDISICLRGEGGTFVLARATSFGGVHPIDIGEALGLHLDLQWVSD  60

Query  213  LQYDFI---------QLQLYSSFDLIINDVKE-----------LAKDFLNINFLFAKRSA  332
            LQ D I         Q  +YSS++    D+ E           L+  F+N    F +R A
Sbjct  61   LQLDNIDFEVDSKNTQEAIYSSWE----DISEFGNIITTFWVLLSSKFVNFRTEFVRRQA  116

Query  333  NKVAHLLTRETLFKSDCSVYFFIP  404
            N VA+L           ++YF IP
Sbjct  117  NAVAYLACP--------TIYFHIP  132



>gb|KHN02823.1| hypothetical protein glysoja_043630 [Glycine soja]
Length=148

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 39/76 (51%), Gaps = 0/76 (0%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
             +W  PP  +LK N+DAA+   N   G+G  LRD  G F  A  +  +G    KE EA  
Sbjct  26   TQWTPPPHNFLKCNLDAAIFNDNNLFGVGICLRDNNGCFFKAITLTANGKPTLKEVEAWA  85

Query  183  VREALKWIKDLQYDFI  230
            + +A+KW + L    I
Sbjct  86   LHKAIKWTQQLNIHNI  101



>ref|XP_003596821.1| hypothetical protein MTR_2g086490 [Medicago truncatula]
Length=138

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 55/125 (44%), Gaps = 16/125 (13%)
 Frame = +3

Query  78   MGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQL-----  242
            +G+G  + D +G F  AK    S L   +  EA+G+   L+W+ DL YD +   L     
Sbjct  2    VGIGICIHDDQGEFFMAKTDCFSPLCVVEVSEAVGLHMTLQWVADLHYDNVDFVLDSKSV  61

Query  243  ----------YSSFDLIINDVKEL-AKDFLNINFLFAKRSANKVAHLLTRETLFKSDCSV  389
                       S    II+  ++L    F N +  F +R AN+VAH L R     +   V
Sbjct  62   VERFNSNLGDSSELGCIIHTCRQLFDCHFQNSHVEFNRRQANEVAHELARVAPSHASSHV  121

Query  390  YFFIP  404
            Y  +P
Sbjct  122  YGDVP  126



>ref|XP_010678934.1| PREDICTED: uncharacterized protein LOC104894413 [Beta vulgaris 
subsp. vulgaris]
Length=192

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/155 (30%), Positives = 66/155 (43%), Gaps = 25/155 (16%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            A W +PP G LK N DA L   N  +GLG V RD+ G  VA     +   +     EA+ 
Sbjct  32   ASWCKPPAGVLKANFDAHLSP-NGEVGLGAVFRDSVGQVVAMGVKRVEAKWDATTAEAMA  90

Query  183  VREALKWIKDLQYDFIQLQLYSSFDL---------------IINDVKELAKDFLNINFLF  317
               A+   +   Y+ +  +  +   +               I +D+  L  +F++ +F  
Sbjct  91   ALYAVDLGQRFGYERVMFEGDALLVVNAVKNKCVGGAPLFHIFSDINRLCLNFVSFSFSH  150

Query  318  AKRSANKVAHLLTRETLFKSDCS----VYFFIPFP  410
             KR  N VAHLL R      DCS    V +F  FP
Sbjct  151  VKRGGNTVAHLLARW-----DCSRQSEVVWFGSFP  180



>gb|KEH17742.1| hypothetical protein MTR_0002s1220 [Medicago truncatula]
 gb|AES99645.2| hypothetical protein MTR_5g083200 [Medicago truncatula]
Length=197

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 53/99 (54%), Gaps = 5/99 (5%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W++P  G LK NVDA        +G+   +RD  G FVAAK +  S + +    EA+G+
Sbjct  76   RWQKPGTGRLKCNVDAEFTRSLNVIGVDMFIRDEAGQFVAAKTLRSSPICESGIGEALGL  135

Query  186  REALKWIKDLQYDFIQLQLYSS-----FDLIINDVKELA  287
              A++W+ +L+   +  ++ +      ++ + ND+ E +
Sbjct  136  SYAIQWVHELKLTNVDFEMDAKRVVDYYNKVSNDISEFS  174



>ref|XP_009344564.1| PREDICTED: uncharacterized protein LOC103936456 [Pyrus x bretschneideri]
 ref|XP_009344566.1| PREDICTED: uncharacterized protein LOC103936458 [Pyrus x bretschneideri]
Length=210

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/150 (27%), Positives = 62/150 (41%), Gaps = 17/150 (11%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            KW +P + W+K N + A   G+ R G G +LRD    F+      I G       E I  
Sbjct  48   KWRKPGVRWIKCNFNGAWSKGSSRGGYGVMLRDHTCVFLGTMAGSIEGYASALYSELIAA  107

Query  186  REALKWIKDLQYDFIQLQLY-----------------SSFDLIINDVKELAKDFLNINFL  314
            R A++ +K L    ++++L                  S +  IIND++   K+   +   
Sbjct  108  RHAVRLVKRLYPPDVKVKLEGDSSVVMAAMKGKGDDDSIWGSIINDLRFFLKELPYMECG  167

Query  315  FAKRSANKVAHLLTRETLFKSDCSVYFFIP  404
              +R  N +AH L R  L      V+F  P
Sbjct  168  HVQREGNSIAHRLARMDLSCFQEVVWFEEP  197



>ref|XP_007227312.1| hypothetical protein PRUPE_ppa016553mg [Prunus persica]
 gb|EMJ28511.1| hypothetical protein PRUPE_ppa016553mg [Prunus persica]
Length=992

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 67/152 (44%), Gaps = 16/152 (11%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W+ P    LK+NVD A   G    G+G V+RD+ G FVA     ++ +F   + EA+  R
Sbjct  832  WQPPHENSLKINVDGAWKPGTTEGGVGVVVRDSTGKFVAGCATKLTNVFSAPQVEALAAR  891

Query  189  EAL-----KWIKDLQYDFIQLQLYSSF----------DLIINDVKELAKDFLNINFLFAK  323
                    +  +++ ++   LQ+ ++             ++ D K L        F   +
Sbjct  892  TNTILAMERGYQNVVFESDALQIVTALRNHSIDRSVIGPVVEDTKSLLTQITGEGFTHIR  951

Query  324  RSANKVAHLLTRETLFKSDCSVYFFIPFPSIV  419
            R+AN VAH L R  L     S+Y+F   P  +
Sbjct  952  RTANGVAHRLARFALHIGG-SLYWFEEPPDFI  982



>ref|XP_010688579.1| PREDICTED: uncharacterized protein LOC104902491 [Beta vulgaris 
subsp. vulgaris]
Length=1325

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 40/132 (30%), Positives = 62/132 (47%), Gaps = 16/132 (12%)
 Frame = +3

Query  9     WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
             W  P  GWLK+N DA ++ GN  +GLG V+RD+ G    A    +   +     EA+  +
Sbjct  1167  WSFPAEGWLKVNFDAHVN-GNGEIGLGAVMRDSAGVVKFAATKRVEARWDATLAEAMAAK  1225

Query  189   EALKWIKDLQYDFI-----QLQLYSSFD----------LIINDVKELAKDFLNINFLFAK  323
              A++    L YD +      L++  +             +  D++ L   F+  +FL  K
Sbjct  1226  FAVEVTLRLGYDNVLFEGDALEVVQAVKNNSEGVAPLFRVFYDIRRLVSSFVAFSFLHVK  1285

Query  324   RSANKVAHLLTR  359
             R+ N VAHLL R
Sbjct  1286  RTGNVVAHLLAR  1297



>gb|EAY96391.1| hypothetical protein OsI_18290 [Oryza sativa Indica Group]
Length=653

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/143 (26%), Positives = 63/143 (44%), Gaps = 15/143 (10%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            WE PP GW K+NVD A    +   G+G + RD+EG  + +    +      ++ E +   
Sbjct  491  WEPPPEGWAKINVDGAFSMTDNTGGIGVIARDSEGKALLSSWEYLHRCADAEQVEILACY  550

Query  189  EALK----WIKD---LQYDFIQL--------QLYSSFDLIINDVKELAKDFLNINFLFAK  323
            E +K    WI+    L+ D I +        +  S +  +I   K + +    +     K
Sbjct  551  EGMKLAAEWIRKPIILESDCITVIGRMTAEDEERSRWTFLIRSAKAVMRSLQEVRIQHRK  610

Query  324  RSANKVAHLLTRETLFKSDCSVY  392
            R  N+VAH L +     + C+V+
Sbjct  611  RECNRVAHELAQLAKRTAHCAVW  633



>gb|KDP36415.1| hypothetical protein JCGZ_08684 [Jatropha curcas]
Length=115

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 37/67 (55%), Gaps = 0/67 (0%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W  P  G LKLNVDAA D    R G G++LRD  G  +  K + +  +      EA+ +R
Sbjct  19   WHPPLQGTLKLNVDAAFDLNTHRAGGGWILRDHLGFCLGGKLMDLGVVASSLMAEALSIR  78

Query  189  EALKWIK  209
            EAL W+K
Sbjct  79   EALSWVK  85



>gb|EPS63384.1| hypothetical protein M569_11402 [Genlisea aurea]
Length=254

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 63/136 (46%), Gaps = 17/136 (13%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            A+WE P +G LK+NVD+    GN     G + RD  G  +      IS +  P+  E + 
Sbjct  96   ARWEPPAMGSLKINVDSG-KIGNHTTWAGLI-RDGRGRCIGWYSKSISPILDPEHGEYLA  153

Query  183  VREALKWIKDLQYDFIQLQ---------------LYSSFDLIINDVKELAKDFLNINFLF  317
             +  L + + L    I L+               L  +   ++ D++ L ++F +   +F
Sbjct  154  TKWGLIFARFLGISTITLEADCLALVSAITDDTMLNGTLQNLLTDIRVLLQEFDSCQVIF  213

Query  318  AKRSANKVAHLLTRET  365
             +R+ANK AHLL + +
Sbjct  214  IRRNANKAAHLLAKSS  229



>ref|XP_003615225.1| hypothetical protein MTR_5g065390 [Medicago truncatula]
Length=365

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 43/80 (54%), Gaps = 0/80 (0%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W+ P    LK N+D      + R  +G  LRD EG FV AK +  +G++  +  E +G+ 
Sbjct  245  WQSPASSRLKCNIDTTFSTPHNRTSVGICLRDDEGIFVLAKIVSFAGVYSAEVGETLGLF  304

Query  189  EALKWIKDLQYDFIQLQLYS  248
              ++W+ D++ + I  ++ S
Sbjct  305  HTIQWLSDMKMNNIDFEVDS  324



>gb|EEC75227.1| hypothetical protein OsI_11496 [Oryza sativa Indica Group]
Length=1059

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 66/144 (46%), Gaps = 22/144 (15%)
 Frame = +3

Query  6     KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAI--  179
             +W+ PP+GW+K+NVD A  + +   G G V+RD  G+ +      +S   +  E  A   
Sbjct  917   RWKAPPVGWVKINVDGAFVHQSGEAGAGVVIRDHLGSVL------LSSWKEEAEATACME  970

Query  180   GVREALKWIK---DLQYDFIQLQL--------YSSFDLIINDVKELAKDFLNINFLFAKR  326
             G+R A +W+K    L+ D+  + L         SS   I+ DVK        +     KR
Sbjct  971   GIRLAAEWVKLPAILETDYANIGLALETMATDRSSLWHIMRDVKSAFALLPGVQISRVKR  1030

Query  327   SANKVAHLLTRET---LFKSDCSV  389
              AN VAH L  E    L   DC+ 
Sbjct  1031  GANGVAHSLAPECVSELIALDCTC  1054



>ref|XP_002893489.1| hypothetical protein ARALYDRAFT_335919 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69748.1| hypothetical protein ARALYDRAFT_335919 [Arabidopsis lyrata subsp. 
lyrata]
Length=177

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 57/128 (45%), Gaps = 14/128 (11%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
             +W +P   W+K N DAA   GN   GLG+++RD+ GTF+        G   P+E E   
Sbjct  40   GRWTKPERRWIKCNYDAAHREGNDISGLGWIIRDSHGTFLHCGWGKFQGRVSPEEAECSA  99

Query  183  VREALKWIKDLQYDFI-----QLQLYSSFD---------LIINDVKELAKDFLNINFLFA  320
            +  A++    L Y  +      L L ++ +           I ++++ +K F   +F F 
Sbjct  100  LIWAIQATWALGYRTVVFEGDNLNLNNTINKDKVDLRLQHYIREIQQWSKCFTATSFTFK  159

Query  321  KRSANKVA  344
             R  N  A
Sbjct  160  HREQNVCA  167



>ref|XP_003636292.1| hypothetical protein MTR_036s0078 [Medicago truncatula]
 ref|XP_003636850.1| hypothetical protein MTR_062s1027 [Medicago truncatula]
Length=158

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 65/155 (42%), Gaps = 22/155 (14%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPK----ED  170
             +W+R   G LK NVD           +G  + D E TFV AK + +S    P       
Sbjct  4    VRWQRQQRGRLKCNVDDLFSNKLNTTCIGIYIHDDECTFVLAKTLSLS--LSPMCFVVMG  61

Query  171  EAIGVREALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKEL-AKDFLN  302
            E  G+  ALKW  D+Q++ +   L                + + L+I+  + L    F N
Sbjct  62   ETTGLFHALKWPSDMQFENVDFALDSKITTDAFHHHRVDVTKYGLVISACRILFNTHFSN  121

Query  303  INFLFAKRSANKVAHLLTRETLFKSDCSVYFFIPF  407
              + F +R  N++AH +       +  ++Y+ + F
Sbjct  122  SKYEFNRRQTNEIAHTIVEVATLSASPNIYYIVFF  156



>ref|XP_006483194.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=765

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 46/159 (29%), Positives = 70/159 (44%), Gaps = 28/159 (18%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKP--KEDEAI  179
            KW+ P    LKLNVDAA+    +++GLG ++RDAEG  +A       G+ +   +E  ++
Sbjct  605  KWKPPSQNVLKLNVDAAVSTKXQKVGLGAIVRDAEGKILAV------GIKQAQFRERVSL  658

Query  180  GVREALKWIKDLQYDFIQLQLYSSFDL-------------------IINDVKELAKDFLN  302
               EA+ W   +        L    D                    I++DV+  +KDF  
Sbjct  659  AEAEAIHWGLQVANQISSSSLIVESDCKEVVELLNNTKGSRTEIHWILSDVRRESKDFKQ  718

Query  303  INFLFAKRSANKVAHLLTRETLFKSDCSVYFFIPFPSIV  419
            + F F  R+ N  AH L +  L  S   V+    FP+ V
Sbjct  719  VQFSFIPRTCNTYAHALAKFALRNSSTDVWVGT-FPAEV  756



>ref|XP_009346162.1| PREDICTED: uncharacterized protein LOC103937909 [Pyrus x bretschneideri]
Length=415

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 63/132 (48%), Gaps = 19/132 (14%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            A+W  PP G LK+NVD A D  N   G+G ++R+ +G FV A    I  +F P + EA+ 
Sbjct  249  ARWSCPPSGKLKINVDGAWDKENCVRGVGIIIRNDKGAFVGAATRIIIDVFSPIQVEALA  308

Query  183  VREALKWIKD-------LQYDFIQLQLYSSFDLIINDVKELAKDFLNINFLFA-------  320
            +R  L+ + +       ++ D +Q+ L +    +  +V  +      I FL A       
Sbjct  309  MRVCLELVVERGLSKINIESDALQIILIAKKSSV--NVSPMGPIIEGIKFLLAVVAEALV  366

Query  321  ---KRSANKVAH  347
                R AN +AH
Sbjct  367  THVHRQANSIAH  378



>ref|XP_002300604.2| hypothetical protein POPTR_0002s00270g [Populus trichocarpa]
 gb|EEE79877.2| hypothetical protein POPTR_0002s00270g [Populus trichocarpa]
Length=166

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDA-ALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            KW++PP+G+LK N+DA  LD G   MG GFV+R+ EG  V      I G F P   EA+ 
Sbjct  50   KWDKPPVGFLKCNIDADILDQG-VAMGAGFVMRNNEGAVVYCGCWKIRGSFSPTLAEALC  108

Query  183  VREALKWI  206
            ++  L+++
Sbjct  109  LKNVLQFM  116



>gb|EEE55133.1| hypothetical protein OsJ_02920 [Oryza sativa Japonica Group]
Length=1049

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 36/118 (31%), Positives = 59/118 (50%), Gaps = 15/118 (13%)
 Frame = +3

Query  6     KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
             KW+ PP G + +N DAAL   + + GL FV+RD   T + A    I+GL  P+  EA+ +
Sbjct  931   KWKPPPPGMVLINSDAALFQASNQTGLAFVIRDHSATCLLAANKRITGLLSPELAEALAI  990

Query  186   REALKWIKDLQYDFIQL---------------QLYSSFDLIINDVKELAKDFLNINFL  314
             R AL+  K   +  + +               +  S   +I+ D+K+L  +FL  +F+
Sbjct  991   RFALEHAKAEGFQNVLMASDCLSVIKRIQSGARDLSVVGVIVRDIKKLETEFLECSFI  1048



>ref|XP_003627352.1| hypothetical protein MTR_8g022030 [Medicago truncatula]
Length=334

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 62/139 (45%), Gaps = 14/139 (10%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W+RP     K  VD +    + ++G+G  +R ++G FV A+    S L      EAI +
Sbjct  193  RWKRPTPSRYKCKVDDSFSSDHNKVGIGMCIRYSDGGFVLARTTWFSPLCSVDLGEAICL  252

Query  186  REALKWIKDLQYDFIQLQLYSSFDLIINDVKELA-KDFLNINFLFAKRSANKVAHLLTRE  362
             + L+W+  +            F  II   ++++ K F N    F +R  N VAH LT  
Sbjct  253  SQVLQWVSSIM-----------FGSIIQYCRQISHKSFYNSVVEFNRRQKNMVAHELTHA  301

Query  363  TLFKSDCSVYFFIPFPSIV  419
            T   +  S   FI  P  +
Sbjct  302  TPLNT--SFELFIGAPMCI  318



>ref|XP_008359305.1| PREDICTED: uncharacterized protein LOC103423013 [Malus domestica]
Length=187

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 60/139 (43%), Gaps = 14/139 (10%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            A W +P  G++K+N +AA      RMG+G+V  D  G   A               EA  
Sbjct  22   APWTKPEFGFIKVNTNAAWCKNTLRMGVGWVCHDFAGMIQAVGGSGTGLCHSAAAGEAYA  81

Query  183  VREALKWIKDLQYDFIQLQLYS--------------SFDLIINDVKELAKDFLNINFLFA  320
            +REA+    +L ++ I ++  +              S D I+ D++ LA    +++F   
Sbjct  82   IREAILACTNLGFNKIIIEFDTKSIIKMLRKELPDFSLDCILGDIEVLACRLTSVSFASM  141

Query  321  KRSANKVAHLLTRETLFKS  377
             + +N  AH + +    +S
Sbjct  142  SKESNSAAHSVAKYVFKQS  160



>ref|XP_008367209.1| PREDICTED: uncharacterized protein LOC103430850 [Malus domestica]
Length=174

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 63/147 (43%), Gaps = 17/147 (12%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            KW+      +K N D A D      G G V+R++EG F+AAK I   G+      EA   
Sbjct  24   KWQFSDSERIKCNFDGAWDEKGSVGGFGIVVRNSEGGFMAAKAIKEEGVRSTLHAEAADA  83

Query  186  REALKWIKDLQYDFIQL----------------QLYSSFDLIINDVKELAKDFLNINFLF  317
            R  + +++    + +Q+                 L   +  +  D ++L + F      F
Sbjct  84   RAVMLFLRKWGTERVQVAGDALLVTSAIQNAGAALSGHYGQLFEDTRQLLQGFKQWKVTF  143

Query  318  AKRSANKVAHLLTRETLFKSDCSVYFF  398
             +R  NKV H L R +L   D SV++F
Sbjct  144  GRRETNKVVHRLARFSL-TIDHSVFWF  169



>gb|AES80260.2| hypothetical protein MTR_7g078610 [Medicago truncatula]
Length=93

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 34/64 (53%), Gaps = 0/64 (0%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W++P  G  K NVDAA      R G+G  LRD EG FV AK      L +    EA+ + 
Sbjct  30   WQKPTSGQYKCNVDAAFSSNFNRTGIGICLRDEEGAFVLAKMTSFPCLHQVTVGEAMSLF  89

Query  189  EALK  200
            EAL+
Sbjct  90   EALQ  93



>ref|XP_010233514.1| PREDICTED: uncharacterized protein LOC104583329 [Brachypodium 
distachyon]
Length=137

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 41/91 (45%), Gaps = 2/91 (2%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W   P+G  K+NVD  L           + RD  G F+ A  I + GL  P   EAI  
Sbjct  43   RWIALPVGLCKINVDTGLVASGNPGACAAIFRDETGKFLGASSISLKGLSDPTAAEAIAC  102

Query  186  REALKWIKDLQYDFIQLQLYSSFDLIINDVK  278
             E L   +DLQ    +  L S    +IND+K
Sbjct  103  NEGLSLAQDLQ--LARFVLASDCSNVINDLK  131



>ref|XP_003616687.1| hypothetical protein MTR_5g083200 [Medicago truncatula]
Length=227

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 53/99 (54%), Gaps = 5/99 (5%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W++P  G LK NVDA        +G+   +RD  G FVAAK +  S + +    EA+G+
Sbjct  106  RWQKPGTGRLKCNVDAEFTRSLNVIGVDMFIRDEAGQFVAAKTLRSSPICESGIGEALGL  165

Query  186  REALKWIKDLQYDFIQLQLYSS-----FDLIINDVKELA  287
              A++W+ +L+   +  ++ +      ++ + ND+ E +
Sbjct  166  SYAIQWVHELKLTNVDFEMDAKRVVDYYNKVSNDISEFS  204



>ref|XP_003623409.1| hypothetical protein MTR_7g070460 [Medicago truncatula]
Length=163

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 54/122 (44%), Gaps = 16/122 (13%)
 Frame = +3

Query  87   GFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQL--------  242
            G   ++  GTFV AK      +      EA+G+  +L+W+ D+Q+D +   +        
Sbjct  30   GVTKKEGIGTFVLAKAFSYLCIVPVDVGEALGLHSSLQWLSDMQFDNVDFDINSKVTADA  89

Query  243  -------YSSFDLIINDVKELAKD-FLNINFLFAKRSANKVAHLLTRETLFKSDCSVYFF  398
                    S F  II+  + L  + F N    F +R  N V H LTRET   +  + YF 
Sbjct  90   LLASRNDLSKFGCIISSCRSLFSNLFSNSRVEFVRRQVNAVTHALTRETTSLTSPAGYFD  149

Query  399  IP  404
            IP
Sbjct  150  IP  151



>gb|EEE62189.1| hypothetical protein OsJ_16976 [Oryza sativa Japonica Group]
Length=653

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 63/143 (44%), Gaps = 15/143 (10%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            WE PP GW K+NVD A    +   G+G + RD+EG  + +    +      ++ E +   
Sbjct  491  WEPPPEGWAKINVDGAFSMTDNTGGIGVIARDSEGKALLSSWKYLHRCADAEQVEILACY  550

Query  189  EALK----WIKD---LQYDFIQL--------QLYSSFDLIINDVKELAKDFLNINFLFAK  323
            E +K    WI+    L+ D + +        +  S +  +I   K + +    +     K
Sbjct  551  EGMKLAAEWIRKPIILESDCVTVIGRMTAEDEERSRWTFLIRSAKAVMRSLQEVRIQHRK  610

Query  324  RSANKVAHLLTRETLFKSDCSVY  392
            R  N+VAH L +     + C+V+
Sbjct  611  RECNRVAHELAQLAKRTAHCAVW  633



>ref|XP_007208881.1| hypothetical protein PRUPE_ppa026460mg [Prunus persica]
 gb|EMJ10080.1| hypothetical protein PRUPE_ppa026460mg [Prunus persica]
Length=157

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 51/118 (43%), Gaps = 4/118 (3%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            A W  P LG++K+N+D A        G G +LRD+ G F      P S        EA  
Sbjct  5    ASWCPPRLGFIKVNIDGAWADAASSAGFGVILRDSTGAFCGGTAGPNS-CESALMSEAEA  63

Query  183  VREALKWIKDLQYDFIQLQLYS---SFDLIINDVKELAKDFLNINFLFAKRSANKVAH  347
                LK      +  I   L     +   II D+++LA  F++  + +A RS N  AH
Sbjct  64   ALSGLKLAAQFGHHRISWHLIPKAWTILPIIKDIRKLAASFVSSEWCWAPRSQNMAAH  121



>ref|XP_003635882.1| hypothetical protein MTR_014s0022 [Medicago truncatula]
 ref|XP_003636134.1| hypothetical protein MTR_029s0026 [Medicago truncatula]
 gb|KEH27933.1| hypothetical protein MTR_5g049680 [Medicago truncatula]
Length=107

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            + W++P  G  K N+DA+      ++G+G  LRD   TF+ AK   IS L +    EA+G
Sbjct  8    SNWKKPAEGRYKCNIDASFSRHLNKVGIGICLRDDTRTFILAKANWISPLREVHIGEALG  67

Query  183  VREALKWIKDLQYDFIQLQL  242
            +  AL+W+ DL    I  ++
Sbjct  68   LLSALEWVHDLNLGPIDFEM  87



>ref|XP_003616829.1| hypothetical protein MTR_5g084710 [Medicago truncatula]
Length=123

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (49%), Gaps = 4/121 (3%)
 Frame = +3

Query  33   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKD  212
            +K N+DA+  +     G+   + D +G FV AK + +S L      EA+G+    +W+ D
Sbjct  1    MKCNIDASFSHVWNCTGISVCVYD-DGAFVLAKIMSLSTLCPVSMGEALGLFYGPEWLSD  59

Query  213  LQYDFIQLQLYSSFDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTRETLFKSDCSVY  392
            +  D ++ Q     ++++   +     F N    F KR AN+VAH L  E    +  ++Y
Sbjct  60   MHMDNVERQ---RSNILLECKRLFNSKFTNSRVKFNKRQANEVAHALAGEPALSASRTIY  116

Query  393  F  395
            F
Sbjct  117  F  117



>ref|XP_009368150.1| PREDICTED: uncharacterized protein LOC103957683 [Pyrus x bretschneideri]
Length=241

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 58/144 (40%), Gaps = 20/144 (14%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            KW +P  GW+K N D A     +R G G V+R+  G F+ A   P   +      E +  
Sbjct  79   KWSKPDEGWVKCNFDGAWIPSQKRGGFGVVIRNQVGDFLGAAAGPFERITSALHAEFMAA  138

Query  186  REALKWIKDLQYDFIQLQL-----------------YSSFDLIINDVKELAKDFLNINFL  314
            R+AL  +  L    + +Q                   S F  IIND++   + + +    
Sbjct  139  RQALLLVNMLYSTDVHVQFEGDAVIAVSAMKDQGVDSSVFGPIINDLRCFLRKWSSSKLS  198

Query  315  FAKRSANKVAHLLTRETLFKSDCS  386
              +R  N VAH L R   F   C+
Sbjct  199  NVQREGNSVAHRLAR---FGVTCA  219



>ref|XP_010682926.1| PREDICTED: uncharacterized protein LOC104897688 [Beta vulgaris 
subsp. vulgaris]
Length=265

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 65/136 (48%), Gaps = 20/136 (15%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            A+W  P  G  KLN DAA+ +G  ++GLG V+ D EG  + A    ++G+      EA+ 
Sbjct  103  ARWTAPMEGVYKLNSDAAM-FGGNQIGLGSVVCDFEGDVMMAMCDRMNGITDVALAEALS  161

Query  183  VREALKWIKDLQYDFIQL-------QLY----------SSFDLIINDVKELAKDFLNINF  311
             R  +K    L+  F+ L       +LY          S F  II D+++ A    +I+F
Sbjct  162  ARNGIK--LALEAGFVNLVLEVDNWRLYKSLKDGTAEPSQFGSIIRDIRQYAVKCSHISF  219

Query  312  LFAKRSANKVAHLLTR  359
               +R  N VAH L +
Sbjct  220  SHVRRLGNSVAHCLAK  235



>gb|AAX94970.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|ABA93330.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=816

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 63/143 (44%), Gaps = 15/143 (10%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            WE PP GW K+NVD A    +   G+G + RD+EG  + +    +      ++ E +   
Sbjct  491  WEPPPEGWAKINVDGAFSMTDNTGGIGVIARDSEGKALLSSWKYLHRCADAEQVEILACY  550

Query  189  EALK----WIKD---LQYDFIQL--------QLYSSFDLIINDVKELAKDFLNINFLFAK  323
            E +K    WI+    L+ D + +        +  S +  +I   K + +    +     K
Sbjct  551  EGMKLAAEWIRKPIILESDCVTVIGRMTAEDEERSRWTFLIRSAKAVMRSLQEVRIQHRK  610

Query  324  RSANKVAHLLTRETLFKSDCSVY  392
            R  N+VAH L +     + C+V+
Sbjct  611  RECNRVAHELAQLAKRTAHCAVW  633



>ref|XP_010682311.1| PREDICTED: uncharacterized protein LOC104897185 [Beta vulgaris 
subsp. vulgaris]
Length=345

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 64/134 (48%), Gaps = 20/134 (15%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAAL--DYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            W  P  GW+K NVDA +  D+G   +G+G V RD  G  +    +     ++ +  EA  
Sbjct  187  WSLPQGGWVKCNVDAGMVADFG---VGVGAVCRDEVGEVLGCAVLQQHVGWEMRVAEARA  243

Query  183  VREALKWIKDL-------QYDFIQL--------QLYSSFDLIINDVKELAKDFLNINFLF  317
            V E ++  K+L       + D +Q+           S F LII D+ E  K F  + + F
Sbjct  244  VFEGVRLAKNLGVRKLIVESDCLQVISALKSKSTGASDFYLIIEDIPEFVKFFNVVVWSF  303

Query  318  AKRSANKVAHLLTR  359
             KR+ NKVAH++  
Sbjct  304  VKRTGNKVAHMMAH  317



>ref|XP_009787297.1| PREDICTED: uncharacterized protein LOC104235275 [Nicotiana sylvestris]
Length=201

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 59/119 (50%), Gaps = 18/119 (15%)
 Frame = +3

Query  6    KWERPPLGW-LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            KW +PP G  LK N+DA+ +        G V+RD    F+  +   I   F     EA+ 
Sbjct  71   KW-KPPDGLALKCNIDASFNLATGEARAGMVVRDRHSEFLRGRSTYIGATFSSMMAEALA  129

Query  183  VREALKWIKDLQYDFIQLQLYSSFDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTR  359
            V+EAL W+K L YD  +++L            E+   F+ ++++   RSAN+VA  L R
Sbjct  130  VKEALSWLK-LHYDDTKIEL------------EMDSLFVKLHWI---RSANQVAQALAR  172



>gb|KEH42462.1| hypothetical protein MTR_1g069475 [Medicago truncatula]
Length=250

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 51/100 (51%), Gaps = 5/100 (5%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            A+W++P    LK NVDA        +G GF +RD  G F+ AK +  + +      EA+G
Sbjct  141  ARWQKPVHVRLKCNVDALFSDALNCVGFGFCIRDEAGNFIRAKTMWSNPVCSTDVGEALG  200

Query  183  VREALKWIKDLQ-----YDFIQLQLYSSFDLIINDVKELA  287
            +  A++W+ +LQ     ++F   ++   F+   ND+ E  
Sbjct  201  LSHAIRWVHELQLTNVDFEFDAKKVVDYFNRGSNDITEFG  240



>ref|XP_003593670.1| hypothetical protein MTR_2g014850 [Medicago truncatula]
Length=114

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 51/105 (49%), Gaps = 3/105 (3%)
 Frame = +3

Query  90   FVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQLYSSFDLIIN  269
              +RD    F+ A      G   P+E EA+G+R+A+  +  + YD    Q  + F  II+
Sbjct  1    MCIRDQRSRFIKAATTWYEGCPPPQEAEAVGLRDAILCVDSI-YDKNNNQ--AEFGSIID  57

Query  270  DVKELAKDFLNINFLFAKRSANKVAHLLTRETLFKSDCSVYFFIP  404
            D + L + F N    F +R  N VAH   R ++ ++   V+  IP
Sbjct  58   DCRSLLQKFTNFKISFVRRQVNVVAHSFARVSILQARHQVFDLIP  102



>gb|ABK28206.1| unknown [Arabidopsis thaliana]
Length=293

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/152 (26%), Positives = 66/152 (43%), Gaps = 18/152 (12%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGT--FVAAKEIPISGLFKPKEDEAI  179
            +W+ PP  W+K N DA     N R G+G++LR+  G   ++ A+ +P +      E EA+
Sbjct  136  QWKAPPYQWVKCNTDATWQLENPRCGIGWILRNESGGVLWMGARALPRTKNVLEAELEAL  195

Query  180  GVREALKWIKDLQYDFIQLQ--------------LYSSFDLIINDVKELAKDFLNINFLF  317
              R A+  +    Y  I  +               + +    + D+++L   F  + F F
Sbjct  196  --RWAVLTMSRFNYKRIIFESDAQALVNLLNSDDFWPTLQPALEDIQQLLHHFEEVKFEF  253

Query  318  AKRSANKVAHLLTRETLFKSDCSVYFFIPFPS  413
              R  NKVA  + RE++  S+     F   P 
Sbjct  254  TPRGGNKVADRIARESISFSNYDPKLFSIVPQ  285



>ref|XP_007207608.1| hypothetical protein PRUPE_ppa018906mg [Prunus persica]
 gb|EMJ08807.1| hypothetical protein PRUPE_ppa018906mg [Prunus persica]
Length=339

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/145 (29%), Positives = 69/145 (48%), Gaps = 17/145 (12%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDE-----  173
            W  P   ++K+NVD A++      GLG V+RD+ G  + A    + G+F PK  +     
Sbjct  169  WSPPNGNFVKINVDGAVNLLIGFRGLGIVIRDSMGDLLLAAYKGLHGMFSPKATKLYAAI  228

Query  174  -------AIGVREALKWIKDLQYDFIQLQLYSSFDLI----INDVKELAKDFLNINFLFA  320
                    +G R  +  + D +   + LQ Y    L+    +++V+ L   F +I+  FA
Sbjct  229  MRLQIASQMGHRSVILEM-DAKEIIMNLQTYEQSWLVEGALVDEVRGLFNRFDHISCHFA  287

Query  321  KRSANKVAHLLTRETLFKSDCSVYF  395
             R  N+VAHLL ++ L   D  V+ 
Sbjct  288  PRERNQVAHLLAKQALLPQDFQVWL  312



>ref|NP_180979.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 gb|AAC27408.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
 gb|ABE65469.1| hypothetical protein At2g34320 [Arabidopsis thaliana]
 gb|AEC08958.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
Length=292

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/152 (26%), Positives = 66/152 (43%), Gaps = 18/152 (12%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGT--FVAAKEIPISGLFKPKEDEAI  179
            +W+ PP  W+K N DA     N R G+G++LR+  G   ++ A+ +P +      E EA+
Sbjct  136  QWKAPPYQWVKCNTDATWQLENPRCGIGWILRNESGGVLWMGARALPRTKNVLEAELEAL  195

Query  180  GVREALKWIKDLQYDFIQLQ--------------LYSSFDLIINDVKELAKDFLNINFLF  317
              R A+  +    Y  I  +               + +    + D+++L   F  + F F
Sbjct  196  --RWAVLTMSRFNYKRIIFESDAQALVNLLNSDDFWPTLQPALEDIQQLLHHFEEVKFEF  253

Query  318  AKRSANKVAHLLTRETLFKSDCSVYFFIPFPS  413
              R  NKVA  + RE++  S+     F   P 
Sbjct  254  TPRGGNKVADRIARESISFSNYDPKLFSIVPQ  285



>ref|XP_010513785.1| PREDICTED: uncharacterized protein LOC104789843 [Camelina sativa]
Length=231

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 72/151 (48%), Gaps = 17/151 (11%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            + W RPP GW+K N D + + G R+   G++LR+  G F+ A +        P E E   
Sbjct  72   SNWRRPPSGWIKCNYDGSFNNGIRQARSGWLLRNENGFFINAGQAIGQVTASPLESELQA  131

Query  183  VREALK--WIKD-----LQYDFIQLQ--------LYSSFDLIINDVKELAKDFLNINFLF  317
            +  A++  W K+      + D  Q++         + SF+ I N +      F N+ F +
Sbjct  132  LLIAMQHCWSKEHRQVIFEGDCKQVKDILDGRVLNFQSFNWIRN-INYWKTRFDNVLFEW  190

Query  318  AKRSANKVAHLLTRETLFKSDC-SVYFFIPF  407
              R+ N+ A LL++ ++  + C +V   +P+
Sbjct  191  TPRNNNQAADLLSKTSIPNNSCYNVSSHVPY  221



>ref|XP_009145555.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=900

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 67/146 (46%), Gaps = 14/146 (10%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W++P +GW+K N D A +    +   G+V+RD  G +  + +          E E   + 
Sbjct  740  WKKPMIGWIKCNTDGAYNSTQHQTSAGWVIRDENGIYKGSAQARGRTRNDALECELQAIL  799

Query  189  EALKWIKDLQYDFIQLQ--LYSSFDLI------------INDVKELAKDFLNINFLFAKR  326
             AL+    L Y  I ++     + D+I              +++  A  F +I+F + +R
Sbjct  800  MALQHCWSLGYRKIIMESDCQKAIDIINKKRLHFAYYNWKREIQWWANKFQDISFQWTRR  859

Query  327  SANKVAHLLTRETLFKSDCSVYFFIP  404
            SANKVA LL +      D S ++++P
Sbjct  860  SANKVADLLAKRLEDGVDFSFHYYVP  885



>gb|AAX95581.1| hypothetical protein, partial, partial [Oryza sativa Japonica 
Group]
Length=364

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 48/96 (50%), Gaps = 2/96 (2%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            WERP  GW+KLNVD + D  + + GLG +LR++ G  +     P+     P E E     
Sbjct  203  WERPKDGWMKLNVDGSFDASSGKGGLGMILRNSAGDIIFTSCKPLERCNNPLESELRACV  262

Query  189  EALKWIKDLQYDFIQLQLYSSFDLIINDVKELAKDF  296
            E LK    + +  + +Q+ +    ++  ++   +DF
Sbjct  263  EGLKLA--IHWTLLPIQVETDCASVVQLLQGTGRDF  296



>ref|XP_003619331.1| hypothetical protein MTR_6g046670 [Medicago truncatula]
 gb|AES75549.1| hypothetical protein MTR_6g046670 [Medicago truncatula]
Length=194

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 40/78 (51%), Gaps = 0/78 (0%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W+ P LG  K N+DAA        G G  +RD+EGTFV AK I           EA+ +
Sbjct  101  RWQPPMLGRHKCNIDAAFSSYLNCTGNGICVRDSEGTFVLAKTITYPCTVSVDVGEALVL  160

Query  186  REALKWIKDLQYDFIQLQ  239
              AL+W+ D+ +  +  +
Sbjct  161  HSALQWLSDMHFGNVDCR  178



>ref|XP_003615058.1| hypothetical protein MTR_5g063110 [Medicago truncatula]
Length=171

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/135 (29%), Positives = 61/135 (45%), Gaps = 21/135 (16%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDY---GNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEA  176
            +W+RP  G +K NV A   Y      R+G+   +R  EGTFV  K + +S ++     E 
Sbjct  5    RWKRPQHGHVKCNVGAFFFYQLMNTTRIGM--CVRYKEGTFVLEKTLYVSPMYSVYAGEV  62

Query  177  IGVREALKWIKDLQY---DFI---QLQLYSSF----------DLIINDVKELAKDFLNIN  308
            +G+   L+W+ D+Q+   DF+    L  Y+             +I  D       F N  
Sbjct  63   LGLFYGLQWLSDMQFDKGDFVLDSNLTTYTLHYHGFHVTEYRQVISADRSLFTTYFTNSL  122

Query  309  FLFAKRSANKVAHLL  353
              F +R  N+V+H L
Sbjct  123  VEFNRRQTNEVSHTL  137



>ref|XP_006491472.1| PREDICTED: uncharacterized protein LOC102626455 [Citrus sinensis]
Length=1452

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 71/159 (45%), Gaps = 28/159 (18%)
 Frame = +3

Query  6     KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKP--KEDEAI  179
             KW+ P    LKLNVDAA+   ++++GLG ++RDAEG  +A       G+ +   +E  ++
Sbjct  1292  KWKPPSQNVLKLNVDAAVSTKDQKVGLGAIVRDAEGKILAV------GIKQAQFRERVSL  1345

Query  180   GVREALKWIKDLQYDFIQLQLYSSFDL-------------------IINDVKELAKDFLN  302
                EA+ W   +        L    D                    I++DV+  +K+F  
Sbjct  1346  AEAEAIHWGLQVANQISSSSLIVESDCKEVVELLNNTKGSRTEIHWILSDVRRESKEFKQ  1405

Query  303   INFLFAKRSANKVAHLLTRETLFKSDCSVYFFIPFPSIV  419
             + F F  R+ N  AH L +  L  S   V+    FP+ V
Sbjct  1406  VQFSFIPRTCNTYAHALAKFALRNSSTDVWVGT-FPAEV  1443



>gb|KJB22308.1| hypothetical protein B456_004G040000 [Gossypium raimondii]
Length=175

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/135 (27%), Positives = 60/135 (44%), Gaps = 15/135 (11%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W     G+ K+N DAA D    R+  G ++ + +G  +A+K +    +      EAI   
Sbjct  35   WRHSKQGFFKINFDAAFDNSKNRLCSGIIVMNFKGDVLASKTMVHDNIPSKFAVEAIACL  94

Query  189  EALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFAK  323
            +A+   +DL   +++++                 S+    I+D+KE    F    F  A+
Sbjct  95   QAVTMGRDLGMKYVEIEGGSLIVIKKVKNPNKDKSAIGSYIHDIKEQNVTFYECKFQHAR  154

Query  324  RSANKVAHLLTRETL  368
            R+ANK AH L  E L
Sbjct  155  RAANKSAHNLASERL  169



>ref|XP_006576094.1| PREDICTED: uncharacterized protein LOC102661466 [Glycine max]
Length=227

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/135 (30%), Positives = 58/135 (43%), Gaps = 21/135 (16%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIP-ISGLFKPKEDEAIG  182
            +W+ PP G  K NVDA+        G+G  +RD  G  VA K     +     +E EA+ 
Sbjct  16   RWKPPPHGAFKCNVDASFHKEENVTGMGMCIRDETGRVVALKTYQRRTSCMAVQEGEALA  75

Query  183  VREALKWIKDLQYDFIQLQLYSSFDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTRE  362
            +  A+++   L ++ I +   S                   +F+FAKR  N VAH L R 
Sbjct  76   LAVAMEFTLSLGFNNIDITFES-------------------DFVFAKRQINGVAHELVRA  116

Query  363  T-LFKSDCSVYFFIP  404
               F S  + Y  IP
Sbjct  117  APFFPSLYTSYQVIP  131



>gb|EAZ40370.1| hypothetical protein OsJ_24816 [Oryza sativa Japonica Group]
Length=613

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 61/156 (39%), Gaps = 17/156 (11%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            + W  PP   LKLN+D A    N   G GF+LRD EG  V A+   I  +      EA+ 
Sbjct  445  STWCPPPQCVLKLNIDGAFQAANLSGGWGFILRDHEGNGVLARAGRIELVHDALSAEAVA  504

Query  183  VREALKWIKDLQYDFIQLQ-----LYSSFDLIINDVKELAKDFLNINFL-----------  314
               AL+ + +  + +  ++     L S+ D    D       F  I  L           
Sbjct  505  CLHALRAVLNHGFSYFSVETDSSILVSALDSACYDQSTAGVTFKQIRTLLRMDLGMIKVS  564

Query  315  FAKRSANKVAHLLTRETLFKSDCSVYFFI-PFPSIV  419
            FA  S N  AH L R+      C +  +  P P  V
Sbjct  565  FANHSCNSCAHELARKGASWDPCHMSIWADPLPDFV  600



>ref|XP_010684219.1| PREDICTED: putative ribonuclease H protein At1g65750 [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 61/134 (46%), Gaps = 22/134 (16%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            KW RP  G LKLN DAA+  G   +G G V+RD+ G    A    + G F P   EA+ +
Sbjct  235  KWHRPREGSLKLNTDAAVLAGG-MIGFGGVVRDSMGEVRLACCGRMDGRFAPDIAEAMAI  293

Query  186  RE------------------ALKWIKDLQYDFIQLQLYSSFDLIINDVKELAKDFLNINF  311
            RE                   LK I  L+   ++    SSF  I+ D+ +  + F  ++F
Sbjct  294  REVLAIAGAAGFREIILENDCLKLISQLKKHVLE---NSSFGNIVKDILDYVQAFNVVSF  350

Query  312  LFAKRSANKVAHLL  353
                RS N VAH L
Sbjct  351  NHICRSGNTVAHNL  364



>ref|XP_002524117.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38327.1| conserved hypothetical protein [Ricinus communis]
Length=91

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 40/86 (47%), Gaps = 14/86 (16%)
 Frame = +3

Query  15   RPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREA  194
            +PP    K+NVDAA              RD+ G FV AK   ISG   P   EA  VREA
Sbjct  2    KPPSDMYKMNVDAA--------------RDSFGLFVMAKHGCISGPLNPTLAEASSVREA  47

Query  195  LKWIKDLQYDFIQLQLYSSFDLIIND  272
            L WIK      IQ++L S    + + 
Sbjct  48   LSWIKQAGLSHIQVELDSQMGALCSS  73



>ref|XP_003620402.1| hypothetical protein MTR_6g082440 [Medicago truncatula]
Length=127

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 46/101 (46%), Gaps = 13/101 (13%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            A W RP LG  K NVDAA     +R G+G  LRD  GTFV  + +     F       I 
Sbjct  19   AAWLRPSLGIYKCNVDAAFSDQFQRTGIGVCLRDDTGTFVLPRMLQFDHYFP------IA  72

Query  183  VREALKWIKDLQY-DFIQLQLYS------SFDLIINDVKEL  284
            V EAL     LQY D I+   +S       F  II   +E+
Sbjct  73   VGEALSLFHALQYMDVIRDAFHSRHTDITEFGSIITACREM  113



>ref|XP_008646672.1| PREDICTED: uncharacterized protein LOC103628202 [Zea mays]
Length=206

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 59/141 (42%), Gaps = 29/141 (21%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDY-GNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            +W  PP GW KLN D ++ + G+ R  +G  +RD+ G  V A         +P E   +G
Sbjct  38   QWSPPPRGWCKLNFDGSVYHDGSARASIGGAIRDSAGRVVLA-------FAEPTEHSTVG  90

Query  183  VREALKWIKDLQY--------------DFIQLQLYSSFDL-------IINDVKELAKDFL  299
            + EA   I+ L+               D + +QL    D        +  ++  L + F 
Sbjct  91   IVEARAMIRGLRLALGLNLQRLVVEGDDLVLVQLLRGEDTQTRIPVALQEEIHGLLRRFQ  150

Query  300  NINFLFAKRSANKVAHLLTRE  362
              +     R  N+VAH L R+
Sbjct  151  GCDVRHVYREGNQVAHTLCRQ  171



>ref|XP_008393540.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=424

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/132 (27%), Positives = 59/132 (45%), Gaps = 15/132 (11%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            WE+P  G  KLN DA+    + R G G+V+RD  G   AA     S        EA  +R
Sbjct  260  WEKPQFGTFKLNTDASWCSASFRAGAGWVIRDFAGILHAAGGSGTSTFHCXAAAEAHAIR  319

Query  189  EALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFAK  323
              L++  +  ++ + ++                  SF+ I+ D++ LA+   ++ F F  
Sbjct  320  TGLQYCTEYXFENVFVEADAKTVILMINKGTAPNCSFECILGDIEVLARRLTSVTFGFVP  379

Query  324  RSANKVAHLLTR  359
            R  N+ AH + +
Sbjct  380  RERNRAAHSVAK  391



>ref|XP_010683805.1| PREDICTED: uncharacterized protein LOC104898417 [Beta vulgaris 
subsp. vulgaris]
Length=293

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/134 (28%), Positives = 60/134 (45%), Gaps = 16/134 (12%)
 Frame = +3

Query  3    AKWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            + W  PP  ++KLNVDA +  G   +  G V+RD  G+ +A     +   + P   EA  
Sbjct  133  SSWCPPPTSFVKLNVDAHVSQGGG-VSFGMVVRDEWGSLLAVGVRRMGVNWTPDVAEAGA  191

Query  183  VREALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLF  317
             R  L+ ++ L Y  + L+                 +   L+ +D+ E++  F N   + 
Sbjct  192  ARFGLEVVRSLGYTKVVLECDAIGVVRAIVNRKTGAAPIFLLFDDILEISSSFSNFKCVH  251

Query  318  AKRSANKVAHLLTR  359
             KRS N VAH + R
Sbjct  252  VKRSGNTVAHSVAR  265



>gb|KHN23277.1| hypothetical protein glysoja_040246, partial [Glycine soja]
Length=147

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/124 (26%), Positives = 53/124 (43%), Gaps = 15/124 (12%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W  P    ++ NVDAA+    ++ G G  LRD +G F+ A     +G+  P+E EA  + 
Sbjct  24   WSPPSRNQVECNVDAAIFEDVKQFGAGLCLRDEKGNFLKAFTATTTGVPTPREAEAWALH  83

Query  189  EALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFAK  323
            +A+ W   L    +  +L                + F  I++  + +  +  N    F K
Sbjct  84   QAINWTHHLGMQNVIFELDCKLVVDNMVNNKKGSTEFHAILHRCRAILSNSPNSRMSFEK  143

Query  324  RSAN  335
            R AN
Sbjct  144  RQAN  147



>ref|XP_003623176.1| hypothetical protein MTR_7g065310 [Medicago truncatula]
Length=227

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 53/124 (43%), Gaps = 16/124 (13%)
 Frame = +3

Query  81   GLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQLYS----  248
            G+G  + D  G FV AK    S L      E +G+  AL+W+ DL YD +   L S    
Sbjct  92   GIGICICDVHGEFVMAKIDCFSPLCDVDVGEVVGLHMALQWVADLHYDHVNFVLDSKSVV  151

Query  249  -SFDLIINDVKELA-----------KDFLNINFLFAKRSANKVAHLLTRETLFKSDCSVY  392
              F+  + D  EL             +F N +  F +R AN VAH L R     +   +Y
Sbjct  152  VHFNSNLGDSSELGCIIQVCRQLFDCNFQNSHIEFNRRQANGVAHELDRVDPSHASSHIY  211

Query  393  FFIP  404
              +P
Sbjct  212  DDVP  215



>gb|KEH31239.1| hypothetical protein MTR_4g094272 [Medicago truncatula]
Length=140

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W++P    +K NVDA+      R G+G   RD EG FV AK +  + +    E +A+G+
Sbjct  72   RWQKPRRRRMKCNVDASFSASRNRFGIG-CTRDDEGQFVLAKTMWFALMCSVDEGDALGL  130

Query  186  REALKWIKDL  215
              A++WI DL
Sbjct  131  YHAMRWISDL  140



>ref|XP_003603833.1| hypothetical protein MTR_3g114720 [Medicago truncatula]
Length=320

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 53/99 (54%), Gaps = 5/99 (5%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            +W++P  G LK NVDA        +G+   +RD  G FVAAK +  S + +    EA+G+
Sbjct  199  RWQKPGTGRLKCNVDAEFTRSLNVIGVDMFIRDEAGQFVAAKTLRSSPICESGIGEALGL  258

Query  186  REALKWIKDLQYDFIQLQLYSS-----FDLIINDVKELA  287
              A++W+ +L+   +  ++ +      ++ + ND+ E +
Sbjct  259  SYAIQWVHELKLTNVDFEMDAKRVVDYYNKVSNDISEFS  297



>gb|EEC71228.1| hypothetical protein OsI_03168 [Oryza sativa Indica Group]
Length=995

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 36/118 (31%), Positives = 58/118 (49%), Gaps = 15/118 (13%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            KW  PP G + +N DAAL   + + GL FV+RD   T + A    I+GL  P+  EA+ +
Sbjct  877  KWTPPPPGMVLINSDAALFQASNQTGLAFVIRDHSATCMLAANKRITGLLSPELAEALVI  936

Query  186  REALKWIKDLQYDFIQL---------------QLYSSFDLIINDVKELAKDFLNINFL  314
            R AL+  K   +  + +               +  S   +I+ D+K+L  +FL  +F+
Sbjct  937  RFALEHAKAEGFQNVLMASDCLSVIKRIQSGARDLSVVGVIVRDIKKLETEFLECSFI  994



>ref|XP_010314573.1| PREDICTED: uncharacterized protein LOC104645185 [Solanum lycopersicum]
Length=308

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/146 (27%), Positives = 66/146 (45%), Gaps = 20/146 (14%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W+RPP  W+KLN D +      ++G G +L++ EG  V A  + + G     + E    +
Sbjct  131  WKRPPEHWIKLNTDGSAVINTGKIGAGGILKNREGKMVMAYSVFL-GEGSNNQAETKAAQ  189

Query  189  EALKWIKDLQYDFIQLQLYSSFDL------------IINDVKELAK-----DFLNINFLF  317
              L W  +L Y  IQ++L S   +            + N V+E+ +      + + + +F
Sbjct  190  LGLSWALELGYKNIQMELDSQLVVQWITKKTAPQWTVANQVEEIQQLISQTQYFSCSHIF  249

Query  318  AKRSANKVAHLLTRETLFKSDCSVYF  395
              R AN VA  L + +   +   VYF
Sbjct  250  --REANSVADSLAKHSNNTTTPQVYF  273



>ref|XP_002467917.1| hypothetical protein SORBIDRAFT_01g036320 [Sorghum bicolor]
 ref|XP_002451890.1| hypothetical protein SORBIDRAFT_04g009300 [Sorghum bicolor]
 ref|XP_002440296.1| hypothetical protein SORBIDRAFT_09g029290 [Sorghum bicolor]
 ref|XP_002440548.1| hypothetical protein SORBIDRAFT_09g002920 [Sorghum bicolor]
 gb|EER94915.1| hypothetical protein SORBIDRAFT_01g036320 [Sorghum bicolor]
 gb|EES04866.1| hypothetical protein SORBIDRAFT_04g009300 [Sorghum bicolor]
 gb|EES18726.1| hypothetical protein SORBIDRAFT_09g029290 [Sorghum bicolor]
 gb|EES18978.1| hypothetical protein SORBIDRAFT_09g002920 [Sorghum bicolor]
Length=133

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 41/81 (51%), Gaps = 2/81 (2%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
            KW  PP  ++K NVDAA+     +  +  V RD  G +VAA  + I GL  P   EA+  
Sbjct  48   KWIPPPEAFVKFNVDAAVARAEDKGTVSVVCRDNVGNYVAASAMVIDGLTDPSSLEALAC  107

Query  186  REALKWIKDL--QYDFIQLQL  242
             EA+    D+  Q  F+ L L
Sbjct  108  NEAISLAMDIGVQAKFVCLFL  128



>ref|XP_008351830.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=1106

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/135 (27%), Positives = 62/135 (46%), Gaps = 15/135 (11%)
 Frame = +3

Query  9     WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
             W+RP  G +K+N DAA      R G+G+V RD  G   AA  +           EAI +R
Sbjct  942   WQRPRYGTIKINTDAAWCKATLRAGVGWVGRDLAGVLHAAGGLGTVRCLSAAAAEAIAIR  1001

Query  189   EALKWIKDLQYDFI---------------QLQLYSSFDLIINDVKELAKDFLNINFLFAK  323
              ALK     +++ +               ++ +  + D ++ D++ LA+  +++ F F  
Sbjct  1002  NALKACITHRFNHVVIESDAKLIIQMIRKEVSVDCNLDCVLGDIEILAQRLMSVTFDFVP  1061

Query  324   RSANKVAHLLTRETL  368
             R +N  AHL+ +   
Sbjct  1062  RESNHAAHLVAKHVF  1076



>gb|KHN34964.1| hypothetical protein glysoja_004730, partial [Glycine soja]
Length=131

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 50/122 (41%), Gaps = 15/122 (12%)
 Frame = +3

Query  81   GLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDL-------------QY  221
            G+G  LRD    +V A    +SG   P E EA  +   + WIK L               
Sbjct  6    GVGMGLRDCNRNYVKAMTSIVSGTPTPNEVEACALHSTIIWIKRLGLSNVVIETDCKTPV  65

Query  222  DFIQLQLYSSFD--LIINDVKELAKDFLNINFLFAKRSANKVAHLLTRETLFKSDCSVYF  395
            D  Q    +S D  +I N  ++L     N    F KR  N V H LTR + F  +  V+ 
Sbjct  66   DCFQADTKNSIDFHVIFNSCRDLLSPISNFRVSFVKRHVNHVTHNLTRTSRFYVNFHVFD  125

Query  396  FI  401
            +I
Sbjct  126  YI  127



>ref|XP_008646671.1| PREDICTED: uncharacterized protein LOC103628201 [Zea mays]
Length=206

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 59/141 (42%), Gaps = 29/141 (21%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDY-GNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            +W  PP GW KLN D ++ + G+ R  +G  +RD+ G  V A         +P E   +G
Sbjct  38   QWSPPPRGWCKLNFDGSVYHDGSARASIGGAIRDSAGRVVLA-------FAEPTEHSTVG  90

Query  183  VREALKWIKDLQY--------------DFIQLQLYSSFDL-------IINDVKELAKDFL  299
            + EA   I+ L+               D + +QL    D        +  ++  L + F 
Sbjct  91   IVEARAMIRGLRLALGLNLQRLVVEGDDLVLVQLLRGEDTQTRIPVALQEEIHGLLRRFQ  150

Query  300  NINFLFAKRSANKVAHLLTRE  362
              +     R  N+VAH L R+
Sbjct  151  ECDVRHVYREGNQVAHTLCRQ  171



>ref|XP_008654095.1| PREDICTED: uncharacterized protein LOC103634318 [Zea mays]
Length=207

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/141 (27%), Positives = 60/141 (43%), Gaps = 29/141 (21%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDY-GNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  182
            KW  PP GW KLN D ++ + G+ R  +G V+RD+ G  V A         +P E   +G
Sbjct  37   KWSPPPRGWFKLNFDGSVYHDGSARASVGGVIRDSAGRVVLA-------FAEPTEHSTVG  89

Query  183  VREALKWIKDLQY--------------DFIQLQLYSSFDL-------IINDVKELAKDFL  299
            + EA   I+ L+               D + +QL    +        +  ++  L + F 
Sbjct  90   IVEARAMIRGLRLALGLCLQRLVVEGDDLVLVQLLRGEETQTRIPAALHEEILYLLRCFS  149

Query  300  NINFLFAKRSANKVAHLLTRE  362
              +     R  N+VAH L R+
Sbjct  150  GCDVRHVYREGNQVAHTLCRQ  170



>gb|KHN35662.1| hypothetical protein glysoja_047989, partial [Glycine soja]
Length=81

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 0/74 (0%)
 Frame = +3

Query  9    WERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVR  188
            W  PP G++K N+DAA+    +  G+G  L      F+ A     SG+ KP   E+  + 
Sbjct  6    WSPPPNGYIKCNLDAAIFKDTQSFGIGIYLHGMHNNFLKAASSFFSGILKPAVAESWAML  65

Query  189  EALKWIKDLQYDFI  230
             A++W   L+Y  I
Sbjct  66   NAIQWTSQLRYQNI  79



>gb|KEH41802.1| hypothetical protein MTR_1g054905 [Medicago truncatula]
Length=160

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 35/66 (53%), Gaps = 0/66 (0%)
 Frame = +3

Query  6    KWERPPLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGV  185
             W+ P  G  K N+DAA      R  +G+ +RD++GTFV AK +    +      EA+ +
Sbjct  79   TWQHPTPGRYKCNIDAAFSSQFNRTCIGYCVRDSDGTFVLAKTVTYPCMVSVDVGEALNL  138

Query  186  REALKW  203
              AL+W
Sbjct  139  HSALQW  144



>ref|XP_003599939.1| hypothetical protein MTR_3g049310 [Medicago truncatula]
Length=155

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 57/141 (40%), Gaps = 15/141 (11%)
 Frame = +3

Query  27   GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  206
            G  K N+DAA     +   +G  +RD +GTFV AK      L+     E +G+   L+W+
Sbjct  3    GRYKCNIDAACSSHFKWTDIGICVRDFQGTFVLAKVASYHCLYSVDVGEVLGLHSTLEWL  62

Query  207  KDLQYDFIQLQLYSSFD---------------LIINDVKELAKDFLNINFLFAKRSANKV  341
             D+Q+D +  +  S                  L I+ V         + +       N +
Sbjct  63   SDMQFDNVDFETDSKMTSDDMLLRTTILYFVVLFIHVVPYSNLSLPTLGWSLLGDKPNGI  122

Query  342  AHLLTRETLFKSDCSVYFFIP  404
            AH L  E    ++  VYF IP
Sbjct  123  AHALAGEATLLANSVVYFDIP  143



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557830460880