BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP008H09 424 bp,:Filtered

Length=424
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006470496.1|  PREDICTED: uncharacterized protein LOC102617255  86.7    5e-17   
ref|XP_006476142.1|  PREDICTED: uncharacterized protein LOC102616098  85.5    2e-16   
ref|XP_002532007.1|  conserved hypothetical protein                   83.2    2e-16   
ref|XP_002531759.1|  conserved hypothetical protein                   79.0    2e-15   Ricinus communis
ref|XP_003598202.1|  60S ribosomal protein L23                        80.5    9e-15   
ref|XP_003607468.1|  hypothetical protein MTR_4g078340                77.4    1e-14   
ref|XP_002525921.1|  conserved hypothetical protein                   77.0    1e-14   
ref|XP_006467327.1|  PREDICTED: uncharacterized protein LOC102625297  77.8    5e-14   
ref|XP_003607028.1|  hypothetical protein MTR_4g071380                74.3    2e-13   
ref|XP_003593283.1|  hypothetical protein MTR_2g009730                73.6    4e-13   
ref|XP_003629388.1|  Cytochrome P450                                  73.2    5e-12   
ref|XP_010670097.1|  PREDICTED: uncharacterized protein LOC104887199  69.7    7e-12   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_002531249.1|  hypothetical protein RCOM_0494170                70.9    8e-12   
ref|XP_006489961.1|  PREDICTED: uncharacterized protein LOC102608276  69.3    1e-11   Citrus sinensis [Valencia orange]
ref|XP_006480463.1|  PREDICTED: putative ribonuclease H protein A...  71.6    1e-11   
ref|XP_009623190.1|  PREDICTED: uncharacterized protein LOC104114439  70.5    1e-11   Nicotiana tomentosiformis
ref|XP_002512628.1|  conserved hypothetical protein                   68.9    1e-11   
ref|XP_003617149.1|  hypothetical protein MTR_5g088360                67.8    2e-11   
ref|XP_008229542.1|  PREDICTED: uncharacterized protein LOC103328904  68.2    2e-11   Prunus mume [ume]
ref|XP_003621450.1|  hypothetical protein MTR_7g013520                66.6    6e-11   Medicago truncatula
ref|XP_003624705.1|  hypothetical protein MTR_7g086560                67.4    7e-11   
gb|ABN08952.1|  Polynucleotidyl transferase, Ribonuclease H fold      67.0    7e-11   Medicago truncatula
ref|XP_003594556.1|  hypothetical protein MTR_2g030550                66.2    7e-11   
ref|XP_003601858.1|  Estradiol 17-beta-dehydrogenase                  68.6    1e-10   
ref|XP_006483704.1|  PREDICTED: uncharacterized protein LOC102620092  67.4    1e-10   
ref|XP_003595869.1|  hypothetical protein MTR_2g062740                65.5    2e-10   
ref|XP_009800085.1|  PREDICTED: uncharacterized protein LOC104246050  68.6    2e-10   Nicotiana sylvestris
gb|AES76948.2|  hypothetical protein MTR_6g089560                     65.5    2e-10   Medicago truncatula
ref|XP_003614116.1|  hypothetical protein MTR_5g045010                64.7    2e-10   
ref|XP_003620730.1|  hypothetical protein MTR_6g089560                65.1    3e-10   
ref|XP_003597249.1|  hypothetical protein MTR_2g094480                64.3    4e-10   
ref|XP_007206484.1|  hypothetical protein PRUPE_ppa019056mg           65.5    4e-10   Prunus persica
ref|XP_003605183.1|  Cytochrome P450                                  66.2    5e-10   
ref|XP_003599959.1|  hypothetical protein MTR_3g049770                63.5    5e-10   
ref|XP_003621136.1|  Pentatricopeptide repeat-containing protein      66.6    8e-10   
ref|XP_003588770.1|  hypothetical protein MTR_1g012560                63.5    9e-10   
ref|XP_002517530.1|  Disease resistance protein RPS5, putative        65.5    2e-09   
ref|XP_003612608.1|  Replication protein A 70 kDa DNA-binding sub...  65.1    3e-09   
ref|XP_002529689.1|  conserved hypothetical protein                   61.2    3e-09   
ref|XP_007203452.1|  hypothetical protein PRUPE_ppa022115mg           65.1    3e-09   Prunus persica
ref|XP_010687523.1|  PREDICTED: uncharacterized protein LOC104901631  63.5    4e-09   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|ABD28710.1|  Polynucleotidyl transferase, Ribonuclease H fold      63.5    4e-09   Medicago truncatula
ref|XP_003590140.1|  hypothetical protein MTR_1g044900                61.2    5e-09   
ref|XP_010690674.1|  PREDICTED: uncharacterized protein LOC104904177  62.4    5e-09   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_008231652.1|  PREDICTED: uncharacterized protein LOC103330817  61.2    6e-09   Prunus mume [ume]
gb|KHN14619.1|  hypothetical protein glysoja_024714                   61.2    8e-09   Glycine soja [wild soybean]
ref|XP_007217321.1|  hypothetical protein PRUPE_ppa019733mg           63.5    9e-09   Prunus persica
ref|XP_003613409.1|  hypothetical protein MTR_5g036320                60.1    9e-09   Medicago truncatula
gb|EEE56566.1|  hypothetical protein OsJ_05904                        62.4    1e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002517043.1|  conserved hypothetical protein                   60.1    1e-08   
ref|XP_003609588.1|  hypothetical protein MTR_4g118850                59.3    1e-08   
ref|XP_003603808.1|  hypothetical protein MTR_3g114430                60.5    2e-08   
ref|XP_007225095.1|  hypothetical protein PRUPE_ppa016563mg           62.8    2e-08   Prunus persica
gb|KJB20572.1|  hypothetical protein B456_003G154500                  60.1    2e-08   Gossypium raimondii
ref|XP_007198863.1|  hypothetical protein PRUPE_ppa018328mg           59.3    2e-08   Prunus persica
ref|XP_002518871.1|  conserved hypothetical protein                   62.0    2e-08   
ref|XP_003599929.1|  hypothetical protein MTR_3g049170                60.1    3e-08   
ref|XP_003607370.1|  LCR-like protein                                 58.5    3e-08   
gb|ABN06084.1|  Polynucleotidyl transferase, Ribonuclease H fold      61.2    4e-08   Medicago truncatula
ref|XP_008346598.1|  PREDICTED: uncharacterized protein LOC103409561  58.9    4e-08   
gb|ABD32189.2|  Polynucleotidyl transferase, Ribonuclease H fold      61.2    4e-08   Medicago truncatula
ref|XP_006464882.1|  PREDICTED: putative ribonuclease H protein A...  60.8    7e-08   
gb|ABN08583.1|  Polynucleotidyl transferase, Ribonuclease H fold      58.2    8e-08   Medicago truncatula
gb|AAP44645.1|  putative reverse transcriptase                        60.1    8e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002528833.1|  conserved hypothetical protein                   57.4    8e-08   
ref|XP_003593785.1|  hypothetical protein MTR_2g017550                57.8    8e-08   
gb|KEH25827.1|  hypothetical protein MTR_6g034915                     57.8    9e-08   Medicago truncatula
ref|XP_007203129.1|  hypothetical protein PRUPE_ppa024061mg           57.4    9e-08   Prunus persica
ref|XP_003624042.1|  hypothetical protein MTR_7g078610                57.8    9e-08   
ref|XP_008226303.1|  PREDICTED: uncharacterized protein LOC103325890  58.5    1e-07   
gb|AES64036.2|  hypothetical protein MTR_2g017550                     57.0    1e-07   Medicago truncatula
ref|XP_002465515.1|  hypothetical protein SORBIDRAFT_01g040340        60.1    1e-07   Sorghum bicolor [broomcorn]
ref|XP_003619023.1|  hypothetical protein MTR_6g032980                56.6    1e-07   
ref|XP_006493122.1|  PREDICTED: putative ribonuclease H protein A...  59.7    1e-07   
gb|KDP24857.1|  hypothetical protein JCGZ_24451                       56.2    1e-07   Jatropha curcas
ref|XP_006493121.1|  PREDICTED: putative ribonuclease H protein A...  59.7    2e-07   
ref|XP_008337941.1|  PREDICTED: uncharacterized protein LOC103401016  58.2    2e-07   
ref|XP_003624433.1|  hypothetical protein MTR_7g083150                57.8    2e-07   
ref|XP_003614263.1|  hypothetical protein MTR_5g047250                55.5    3e-07   Medicago truncatula
ref|XP_003609683.1|  hypothetical protein MTR_4g120000                55.8    3e-07   
ref|XP_003610669.1|  hypothetical protein MTR_5g005740                57.4    3e-07   
ref|XP_008383144.1|  PREDICTED: uncharacterized protein LOC103445866  57.0    3e-07   
ref|XP_003623678.1|  hypothetical protein MTR_7g074420                57.0    3e-07   
ref|XP_003596821.1|  hypothetical protein MTR_2g086490                55.5    3e-07   
gb|AAU89136.1|  F-box domain containing protein                       58.5    4e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EEC72753.1|  hypothetical protein OsI_06384                        58.2    4e-07   Oryza sativa Indica Group [Indian rice]
gb|KHN31589.1|  hypothetical protein glysoja_043032                   55.5    4e-07   Glycine soja [wild soybean]
gb|EEC75888.1|  hypothetical protein OsI_12930                        58.5    4e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_007203380.1|  hypothetical protein PRUPE_ppa025995mg           56.2    4e-07   Prunus persica
ref|XP_002510892.1|  conserved hypothetical protein                   55.8    4e-07   
ref|XP_010696211.1|  PREDICTED: uncharacterized protein LOC104908759  57.4    4e-07   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|KHN38789.1|  hypothetical protein glysoja_047929                   55.8    4e-07   Glycine soja [wild soybean]
ref|XP_006378610.1|  hypothetical protein POPTR_0010s18040g           55.5    4e-07   Populus trichocarpa [western balsam poplar]
gb|ABD28554.2|  Polynucleotidyl transferase, Ribonuclease H fold      54.7    5e-07   Medicago truncatula
ref|XP_010236322.1|  PREDICTED: uncharacterized protein LOC104583970  56.6    6e-07   Brachypodium distachyon [annual false brome]
ref|XP_003623409.1|  hypothetical protein MTR_7g070460                55.1    6e-07   
gb|EEE59647.1|  hypothetical protein OsJ_12023                        58.2    6e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003616829.1|  hypothetical protein MTR_5g084710                54.7    6e-07   
ref|XP_003605496.1|  hypothetical protein MTR_4g032310                56.6    6e-07   
ref|XP_003593670.1|  hypothetical protein MTR_2g014850                54.3    7e-07   
ref|XP_006593242.1|  PREDICTED: uncharacterized protein LOC102666191  55.1    7e-07   
ref|XP_003589048.1|  hypothetical protein MTR_1g017840                54.7    8e-07   Medicago truncatula
ref|XP_003594782.1|  hypothetical protein MTR_2g034570                54.7    9e-07   
ref|NP_194638.1|  ribonuclease H-like protein                         57.0    9e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010679712.1|  PREDICTED: uncharacterized protein LOC104895014  55.1    9e-07   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_006285982.1|  hypothetical protein CARUB_v10007509mg           54.7    9e-07   Capsella rubella
gb|AAG13524.1|AC068924_29  putative non-LTR retroelement reverse ...  57.4    1e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010513219.1|  PREDICTED: uncharacterized protein LOC104789182  57.4    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_008367209.1|  PREDICTED: uncharacterized protein LOC103430850  54.7    1e-06   
gb|AAP54617.2|  retrotransposon protein, putative, unclassified       57.4    1e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010667872.1|  PREDICTED: uncharacterized protein LOC104884867  54.3    1e-06   Beta vulgaris subsp. vulgaris [Swiss chard]
emb|CDP14369.1|  unnamed protein product                              56.2    1e-06   Coffea canephora [robusta coffee]
ref|XP_010667851.1|  PREDICTED: uncharacterized protein LOC104884846  54.3    1e-06   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_002531371.1|  conserved hypothetical protein                   53.9    1e-06   
ref|XP_010689379.1|  PREDICTED: uncharacterized protein LOC104903088  55.1    1e-06   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_003599939.1|  hypothetical protein MTR_3g049310                53.9    2e-06   
gb|KHN34964.1|  hypothetical protein glysoja_004730                   53.5    2e-06   Glycine soja [wild soybean]
ref|XP_009137097.1|  PREDICTED: uncharacterized protein LOC103861143  53.5    2e-06   Brassica rapa
ref|XP_002515720.1|  conserved hypothetical protein                   53.5    2e-06   
dbj|BAF36334.1|  hypothetical protein                                 53.5    2e-06   Ipomoea trifida
ref|XP_007214838.1|  hypothetical protein PRUPE_ppa018217mg           55.1    2e-06   Prunus persica
ref|XP_006603254.1|  PREDICTED: uncharacterized protein LOC102660201  53.9    2e-06   Glycine max [soybeans]
ref|XP_003636511.1|  hypothetical protein MTR_043s0014                52.8    3e-06   
emb|CCA66036.1|  hypothetical protein                                 56.2    3e-06   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010233514.1|  PREDICTED: uncharacterized protein LOC104583329  52.8    3e-06   
gb|EEE64789.1|  hypothetical protein OsJ_19645                        53.5    3e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003623176.1|  hypothetical protein MTR_7g065310                53.9    3e-06   
ref|XP_003613452.1|  hypothetical protein MTR_5g036840                54.3    3e-06   
ref|XP_010485231.1|  PREDICTED: uncharacterized protein LOC104763574  55.8    3e-06   Camelina sativa [gold-of-pleasure]
gb|KEH21242.1|  hypothetical protein MTR_8g099580                     54.7    3e-06   Medicago truncatula
ref|XP_009378422.1|  PREDICTED: uncharacterized protein LOC103966921  55.1    3e-06   Pyrus x bretschneideri [bai li]
gb|KEH40134.1|  hypothetical protein MTR_1g022215                     52.0    4e-06   Medicago truncatula
gb|KEH37989.1|  hypothetical protein MTR_2g055490                     52.4    4e-06   Medicago truncatula
ref|XP_002527468.1|  conserved hypothetical protein                   52.8    4e-06   
ref|XP_009121392.1|  PREDICTED: uncharacterized protein LOC103846249  53.9    4e-06   Brassica rapa
ref|XP_003594303.1|  hypothetical protein MTR_2g027020                53.1    4e-06   Medicago truncatula
ref|XP_003614676.1|  hypothetical protein MTR_5g057370                53.9    4e-06   
ref|XP_002453054.1|  hypothetical protein SORBIDRAFT_04g037485        52.8    4e-06   Sorghum bicolor [broomcorn]
ref|XP_003595161.1|  hypothetical protein MTR_2g039110                52.8    4e-06   
emb|CAN77449.1|  hypothetical protein VITISV_016970                   55.1    4e-06   Vitis vinifera
ref|XP_006577722.1|  PREDICTED: putative ribonuclease H protein A...  53.9    4e-06   
gb|KHN20416.1|  Putative ribonuclease H protein                       53.9    4e-06   Glycine soja [wild soybean]
ref|XP_002522452.1|  nucleic acid binding protein, putative           54.7    5e-06   
gb|EMT25602.1|  F-box/WD-40 repeat-containing protein                 55.1    5e-06   Aegilops tauschii
ref|XP_006471930.1|  PREDICTED: uncharacterized protein LOC102617744  53.9    5e-06   Citrus sinensis [Valencia orange]
ref|XP_008227720.1|  PREDICTED: putative ribonuclease H protein A...  54.3    5e-06   
ref|XP_007227312.1|  hypothetical protein PRUPE_ppa016553mg           54.7    6e-06   Prunus persica
ref|XP_010688579.1|  PREDICTED: uncharacterized protein LOC104902491  55.1    6e-06   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_003598902.1|  hypothetical protein MTR_3g023170                53.5    7e-06   
ref|XP_010681661.1|  PREDICTED: uncharacterized protein LOC104896591  52.4    8e-06   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010682232.1|  PREDICTED: uncharacterized protein LOC104897109  53.5    8e-06   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_008226963.1|  PREDICTED: uncharacterized protein LOC103326508  52.8    9e-06   
ref|XP_002532287.1|  conserved hypothetical protein                   53.5    1e-05   
ref|XP_006487438.1|  PREDICTED: putative ribonuclease H protein A...  53.5    1e-05   
ref|XP_009787297.1|  PREDICTED: uncharacterized protein LOC104235275  52.0    1e-05   Nicotiana sylvestris
ref|XP_003622120.1|  Pentatricopeptide repeat-containing protein      53.9    1e-05   
ref|XP_003592602.1|  hypothetical protein MTR_1g109000                50.4    1e-05   Medicago truncatula
ref|XP_004293042.2|  PREDICTED: uncharacterized protein LOC101293660  53.9    1e-05   Fragaria vesca subsp. vesca
gb|ABN09176.1|  Polynucleotidyl transferase, Ribonuclease H fold      52.8    1e-05   Medicago truncatula
ref|XP_002530993.1|  conserved hypothetical protein                   50.4    1e-05   
ref|XP_010689711.1|  PREDICTED: uncharacterized protein LOC104903385  53.9    1e-05   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_011470556.1|  PREDICTED: uncharacterized protein LOC105353255  53.5    1e-05   Fragaria vesca subsp. vesca
ref|XP_010666974.1|  PREDICTED: uncharacterized protein LOC104884077  51.2    1e-05   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_002447811.1|  hypothetical protein SORBIDRAFT_06g016240        52.8    2e-05   Sorghum bicolor [broomcorn]
ref|XP_007207608.1|  hypothetical protein PRUPE_ppa018906mg           52.4    2e-05   Prunus persica
ref|XP_006427454.1|  hypothetical protein CICLE_v10027161mg           50.8    2e-05   Citrus clementina
ref|XP_008226959.1|  PREDICTED: putative ribonuclease H protein A...  52.8    2e-05   
gb|KDP36415.1|  hypothetical protein JCGZ_08684                       50.1    2e-05   Jatropha curcas
gb|KDP37578.1|  hypothetical protein JCGZ_08269                       49.7    2e-05   Jatropha curcas
gb|KJB22308.1|  hypothetical protein B456_004G040000                  50.8    2e-05   Gossypium raimondii
ref|XP_003616537.1|  hypothetical protein MTR_5g081540                50.1    2e-05   
ref|XP_003615225.1|  hypothetical protein MTR_5g065390                52.4    2e-05   
ref|XP_008345353.1|  PREDICTED: putative ribonuclease H protein A...  52.8    3e-05   
ref|XP_006483194.1|  PREDICTED: putative ribonuclease H protein A...  52.8    3e-05   
ref|XP_010680467.1|  PREDICTED: uncharacterized protein LOC104895604  52.0    3e-05   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010682311.1|  PREDICTED: uncharacterized protein LOC104897185  52.0    3e-05   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_003630976.1|  hypothetical protein MTR_8g105730                51.6    3e-05   
ref|XP_010686173.1|  PREDICTED: uncharacterized protein LOC104900455  51.2    3e-05   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009799002.1|  PREDICTED: uncharacterized protein LOC104245133  50.4    3e-05   Nicotiana sylvestris
ref|XP_002524117.1|  conserved hypothetical protein                   48.9    4e-05   
ref|XP_002526185.1|  conserved hypothetical protein                   50.4    4e-05   
ref|XP_010680493.1|  PREDICTED: uncharacterized protein LOC104895631  50.4    4e-05   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010673165.1|  PREDICTED: uncharacterized protein LOC104889605  50.4    4e-05   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_003627791.1|  hypothetical protein MTR_8g038340                51.2    4e-05   Medicago truncatula
gb|KEH18875.1|  hypothetical protein MTR_8g031080                     51.6    4e-05   Medicago truncatula
gb|KEH16790.1|  hypothetical protein MTR_0093s0070                    50.4    5e-05   Medicago truncatula
ref|XP_002468357.1|  hypothetical protein SORBIDRAFT_01g044485        50.4    5e-05   Sorghum bicolor [broomcorn]
gb|KHN31016.1|  hypothetical protein glysoja_020314                   49.3    5e-05   Glycine soja [wild soybean]
ref|XP_003607874.1|  hypothetical protein MTR_4g083950                49.3    5e-05   
ref|XP_003614550.1|  hypothetical protein MTR_5g055330                49.3    5e-05   
gb|KHN23277.1|  hypothetical protein glysoja_040246                   49.3    6e-05   Glycine soja [wild soybean]
gb|KHN00089.1|  hypothetical protein glysoja_046125                   49.3    6e-05   Glycine soja [wild soybean]
ref|XP_003623221.1|  hypothetical protein MTR_7g067370                48.9    6e-05   
ref|XP_003615350.1|  hypothetical protein MTR_5g066880                48.5    6e-05   
ref|XP_002529707.1|  conserved hypothetical protein                   48.1    6e-05   
ref|XP_003612943.1|  hypothetical protein MTR_5g030850                48.1    6e-05   
ref|XP_006491472.1|  PREDICTED: uncharacterized protein LOC102626455  51.6    7e-05   Citrus sinensis [Valencia orange]
ref|XP_003601635.1|  hypothetical protein MTR_3g083790                49.3    7e-05   
ref|XP_003596081.1|  hypothetical protein MTR_2g065980                48.5    7e-05   
gb|EAZ40370.1|  hypothetical protein OsJ_24816                        51.2    8e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004963954.1|  PREDICTED: uncharacterized protein LOC101785093  51.6    8e-05   
gb|ABA99010.1|  expressed protein                                     50.4    8e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EEC75227.1|  hypothetical protein OsI_11496                        51.2    9e-05   Oryza sativa Indica Group [Indian rice]
gb|KHN09137.1|  hypothetical protein glysoja_025598                   47.8    9e-05   Glycine soja [wild soybean]
ref|XP_003621044.1|  hypothetical protein MTR_7g006490                50.1    9e-05   
ref|XP_003629565.1|  hypothetical protein MTR_8g079540                48.1    9e-05   Medicago truncatula
ref|XP_008358038.1|  PREDICTED: uncharacterized protein LOC103421772  50.1    1e-04   
ref|XP_006473914.1|  PREDICTED: uncharacterized protein LOC102629934  50.4    1e-04   
ref|XP_007213514.1|  hypothetical protein PRUPE_ppa020664mg           48.9    1e-04   Prunus persica
ref|XP_007217601.1|  hypothetical protein PRUPE_ppa018407mg           50.4    1e-04   Prunus persica
gb|ABK28206.1|  unknown                                               50.1    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003604221.1|  hypothetical protein MTR_4g006750                49.3    1e-04   
ref|NP_180979.1|  polynucleotidyl transferase, ribonuclease H-lik...  50.1    1e-04   Arabidopsis thaliana [mouse-ear cress]
gb|KHN02823.1|  hypothetical protein glysoja_043630                   48.1    1e-04   Glycine soja [wild soybean]
ref|XP_009145555.1|  PREDICTED: putative ribonuclease H protein A...  50.8    1e-04   Brassica rapa
gb|KHN07187.1|  hypothetical protein glysoja_038049                   47.8    1e-04   Glycine soja [wild soybean]
gb|EMS64578.1|  hypothetical protein TRIUR3_16998                     50.1    1e-04   Triticum urartu
ref|XP_003627352.1|  hypothetical protein MTR_8g022030                49.7    2e-04   
ref|XP_003627584.1|  hypothetical protein MTR_8g031800                47.4    2e-04   Medicago truncatula
ref|XP_003636292.1|  hypothetical protein MTR_036s0078                48.1    2e-04   
ref|XP_006596580.1|  PREDICTED: uncharacterized protein LOC102666294  48.9    2e-04   Glycine max [soybeans]
gb|KEH17434.1|  hypothetical protein MTR_0015s0120                    49.7    2e-04   Medicago truncatula
ref|XP_003614633.1|  hypothetical protein MTR_5g056500                47.0    2e-04   Medicago truncatula
ref|XP_006415078.1|  hypothetical protein EUTSA_v10009492mg           47.0    2e-04   Eutrema salsugineum
gb|EEE55133.1|  hypothetical protein OsJ_02920                        50.1    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008222895.1|  PREDICTED: putative ribonuclease H protein A...  49.7    2e-04   
ref|XP_003635882.1|  hypothetical protein MTR_014s0022                47.0    2e-04   
gb|KEH42462.1|  hypothetical protein MTR_1g069475                     48.9    2e-04   Medicago truncatula
gb|KEH31239.1|  hypothetical protein MTR_4g094272                     47.4    2e-04   Medicago truncatula
ref|XP_006485449.1|  PREDICTED: uncharacterized protein LOC102621413  49.7    3e-04   
ref|XP_010269328.1|  PREDICTED: uncharacterized protein LOC104606020  47.8    3e-04   Nelumbo nucifera [Indian lotus]
ref|XP_009361347.1|  PREDICTED: uncharacterized protein LOC103951644  48.1    3e-04   Pyrus x bretschneideri [bai li]
ref|XP_010677668.1|  PREDICTED: uncharacterized protein LOC104893266  48.1    3e-04   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_003615215.1|  hypothetical protein MTR_5g065190                48.5    3e-04   
emb|CCA65997.1|  hypothetical protein                                 49.7    3e-04   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010683805.1|  PREDICTED: uncharacterized protein LOC104898417  48.9    3e-04   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_008341962.1|  PREDICTED: uncharacterized protein LOC103404776  48.9    4e-04   
ref|XP_003600985.1|  hypothetical protein MTR_3g071710                46.2    4e-04   
gb|EEE66057.1|  hypothetical protein OsJ_22054                        49.3    4e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002459655.1|  hypothetical protein SORBIDRAFT_02g008050        48.1    4e-04   Sorghum bicolor [broomcorn]
ref|XP_007032521.1|  Uncharacterized protein TCM_018523               48.5    4e-04   Theobroma cacao [chocolate]
ref|XP_008243683.1|  PREDICTED: uncharacterized protein LOC103341914  47.8    4e-04   
ref|XP_007206269.1|  hypothetical protein PRUPE_ppa016210mg           47.8    4e-04   Prunus persica
gb|ABN07957.1|  Polynucleotidyl transferase, Ribonuclease H fold      48.5    4e-04   Medicago truncatula
gb|KJB30629.1|  hypothetical protein B456_005G152500                  46.6    4e-04   Gossypium raimondii
ref|XP_003627271.1|  hypothetical protein MTR_8g020570                48.1    5e-04   
ref|XP_009346162.1|  PREDICTED: uncharacterized protein LOC103937909  48.5    5e-04   Pyrus x bretschneideri [bai li]
ref|XP_008376986.1|  PREDICTED: putative ribonuclease H protein A...  48.5    5e-04   
ref|XP_003613245.1|  hypothetical protein MTR_5g034450                46.2    5e-04   Medicago truncatula
ref|XP_003615631.1|  hypothetical protein MTR_5g070290                48.1    5e-04   
ref|XP_009102110.1|  PREDICTED: putative ribonuclease H protein A...  48.5    5e-04   Brassica rapa
ref|XP_003624213.1|  hypothetical protein MTR_7g080470                46.2    5e-04   
gb|KHN35662.1|  hypothetical protein glysoja_047989                   45.4    6e-04   Glycine soja [wild soybean]
ref|XP_002509697.1|  conserved hypothetical protein                   45.4    6e-04   
gb|EEC71228.1|  hypothetical protein OsI_03168                        48.5    6e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_003589347.1|  Eukaryotic translation initiation factor 3 s...  48.5    6e-04   
ref|XP_010684542.1|  PREDICTED: uncharacterized protein LOC104899105  47.0    6e-04   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_003594465.1|  hypothetical protein MTR_2g028970                45.1    6e-04   Medicago truncatula
gb|ABA97040.1|  retrotransposon protein, putative, unclassified       48.5    7e-04   Oryza sativa Japonica Group [Japonica rice]
gb|ABD28498.2|  Polynucleotidyl transferase, Ribonuclease H fold      48.1    7e-04   Medicago truncatula
ref|XP_008343287.1|  PREDICTED: aspartic proteinase-like protein 2    48.1    7e-04   Malus domestica [apple tree]
ref|XP_003619331.1|  hypothetical protein MTR_6g046670                47.0    8e-04   Medicago truncatula
ref|XP_003622056.1|  hypothetical protein MTR_7g026730                45.8    8e-04   
gb|KEH25194.1|  hypothetical protein MTR_6g016265                     45.8    8e-04   Medicago truncatula
ref|XP_007212995.1|  hypothetical protein PRUPE_ppa022768mg           48.1    9e-04   Prunus persica
ref|XP_006491602.1|  PREDICTED: uncharacterized protein LOC102623801  47.8    0.001   
emb|CCA66050.1|  hypothetical protein                                 48.1    0.001   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_008377029.1|  PREDICTED: putative ribonuclease H protein A...  47.8    0.001   
ref|XP_002510284.1|  conserved hypothetical protein                   45.1    0.001   



>ref|XP_006470496.1| PREDICTED: uncharacterized protein LOC102617255 [Citrus sinensis]
Length=440

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 49/126 (39%), Positives = 69/126 (55%), Gaps = 15/126 (12%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G LK NVD AL      +G G V+RD+   F+AA+   I G F  ++ EA+GVREAL WI
Sbjct  287  GRLKCNVDVALFAFRGYIGFGNVIRDSNCAFMAARCCSIPGRFSARDAEALGVREALSWI  346

Query  187  KDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFAKRSANKV  321
            K LQ   + +++                SSF LII D + L+    +++F F +RSAN V
Sbjct  347  KQLQLSNVTIEMDCLTVYNALVNNLSGPSSFSLIIEDCRALSNSIRDVSFSFVRRSANSV  406

Query  322  AHLLTR  339
            AH + +
Sbjct  407  AHYVAQ  412



>ref|XP_006476142.1| PREDICTED: uncharacterized protein LOC102616098 [Citrus sinensis]
Length=510

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 51/145 (35%), Positives = 77/145 (53%), Gaps = 15/145 (10%)
 Frame = +1

Query  10   WLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIK  189
            W K NVDA     +  +  G V++++EG FV A+   +   F  +E EAIGVRE L W+K
Sbjct  361  WFKCNVDATTFLSSGTIMYGAVIQNSEGEFVTARSNWLISSFGAREAEAIGVREILSWLK  420

Query  190  DLQY-----DFIQLQLYSS----------FDLIINDVKELAKDFLNINFLFAKRSANKVA  324
             L +     +   LQ++++          F L+I+D + LA+   ++ F F +RSAN  A
Sbjct  421  GLPFLHVIIEMDSLQVFTALTMDSFSPNGFGLLIDDCRALAQSLGDVTFSFVRRSANSAA  480

Query  325  HLLTRETLFKSDCSVYFFIPFPSIV  399
            H +TR   F S    +  IP PS+V
Sbjct  481  HSVTRVGGFLSGLGEWRLIPPPSLV  505



>ref|XP_002532007.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30380.1| conserved hypothetical protein [Ricinus communis]
Length=273

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 73/138 (53%), Gaps = 15/138 (11%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            GWLK N+D  +   N R+G GF+ ++  GTF AA    ISG   P+  EA+ +RE L W+
Sbjct  135  GWLKCNIDVVVFVANNRLGFGFIFQNDSGTFRAATNGLISGPLDPQVAEALSLREDLCWV  194

Query  187  KDLQYDFI--------------QLQLYSS-FDLIINDVKELAKDFLNINFLFAKRSANKV  321
            K L  +++              ++ + SS F L+I D +   K+  + + +F KR  N+V
Sbjct  195  KGLDLNYVVSESDCLTLVNAVNKVGVNSSLFGLLIGDCRSFLKEMNHAHIVFVKRFGNRV  254

Query  322  AHLLTRETLFKSDCSVYF  375
            AHLL R T  + D   +F
Sbjct  255  AHLLARVTDSEVDHGEWF  272



>ref|XP_002531759.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30615.1| conserved hypothetical protein [Ricinus communis]
Length=163

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 65/128 (51%), Gaps = 15/128 (12%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
             LG +K+N+DA +      MG+G V++D  G FV A  +  +G + P+  E + ++EAL 
Sbjct  32   SLGSMKVNMDATIFSNPDSMGVGCVMKDHAGLFVCAMAVSFAGAYIPEIAEGLAIQEALS  91

Query  181  WIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFAKRSAN  315
            W +D Q   +  +L                SS  LII D K L+    N +F F KRS N
Sbjct  92   WARDRQLLNVVFELDCLHIVEALLRKGTDRSSLGLIIKDCKLLSSSISNCSFAFVKRSRN  151

Query  316  KVAHLLTR  339
            +VAH L R
Sbjct  152  EVAHKLAR  159



>ref|XP_003598202.1| 60S ribosomal protein L23 [Medicago truncatula]
Length=547

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 66/131 (50%), Gaps = 15/131 (11%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G+LK NVDAA+     R G G  +RD  G F+ A      G   P+E EA+G+R+A+ W+
Sbjct  63   GFLKCNVDAAIFSEQNRFGTGMCVRDQRGRFLKAATNWYEGCPPPQEAEAVGLRDAILWL  122

Query  187  KDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFAKRSANKV  321
              L+   +QL+L                + F  II+D + L + F N    F +R AN V
Sbjct  123  GQLELSNVQLELDCKLVVDSIYDKNNNQAEFGSIIDDCRSLLQQFTNFKISFVRRQANVV  182

Query  322  AHLLTRETLFK  354
            AH   R ++F+
Sbjct  183  AHSFARVSIFQ  193



>ref|XP_003607468.1| hypothetical protein MTR_4g078340 [Medicago truncatula]
Length=181

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 68/141 (48%), Gaps = 16/141 (11%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G  K N+DAA         +G  +RDAEGTFV AK +           EA+G+  AL+W+
Sbjct  28   GRYKCNIDAAFTSHVNCTCIGICVRDAEGTFVLAKTMTYPCTVSVDVGEALGMHSALQWL  87

Query  187  KDLQYDFIQLQLYS-----SFDLIINDVKE-----------LAKDFLNINFLFAKRSANK  318
             D+Q+D +  +  S     +F   +ND+ E            +  F N    F ++ AN 
Sbjct  88   SDMQFDNVDFETDSKLTADAFLSTMNDLSEFGCIIFSCRSLFSTSFSNFRVEFVRQQANV  147

Query  319  VAHLLTRETLFKSDCSVYFFI  381
            VAH LTRET   +  +VYF I
Sbjct  148  VAHALTRETTSLASPAVYFDI  168



>ref|XP_002525921.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36441.1| conserved hypothetical protein [Ricinus communis]
Length=191

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 64/125 (51%), Gaps = 12/125 (10%)
 Frame = +1

Query  10   WLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIK  189
            +LK+N DA +     R G G V+R+     VAA+ + I G+++    EA+ VREAL WIK
Sbjct  60   YLKINEDAGIFQAQNRTGYGMVVRNHAANLVAARALIIHGVYEANLAEAMAVREALSWIK  119

Query  190  DLQYDFIQLQLYS------------SFDLIINDVKELAKDFLNINFLFAKRSANKVAHLL  333
             + +  + + + S            SF LII+  K +  +  +  F   +RS N  AH+L
Sbjct  120  HMNWSRVSIDMDSLGVCVALTSDNLSFGLIIDGCKHVVANIHDAAFTCIRRSTNHCAHML  179

Query  334  TRETL  348
             R ++
Sbjct  180  ARASV  184



>ref|XP_006467327.1| PREDICTED: uncharacterized protein LOC102625297 [Citrus sinensis]
Length=412

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            GW+K NVDAA+     ++G+G V+R+++G FVAA+ + ++G+F  +E EA+G+REAL W+
Sbjct  335  GWVKCNVDAAVFESQGKIGIGCVIRNSQGGFVAARCVSVAGIFGAREAEALGIREALSWM  394

Query  187  KDLQYDFIQLQL  222
            K+LQ   + +++
Sbjct  395  KELQIPCVIIEM  406



>ref|XP_003607028.1| hypothetical protein MTR_4g071380 [Medicago truncatula]
Length=218

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 68/148 (46%), Gaps = 23/148 (16%)
 Frame = +1

Query  1    PLGW-------LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAI  159
            P+GW        K NVD A    + R  +   +RDAEG FV A+ +   G++  +  EA+
Sbjct  61   PVGWHKSAPNRFKCNVDVAFSSFHNRTRIDICIRDAEGVFVLARMVSFPGVYLVEVGEAL  120

Query  160  GVREALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFL-NINF  291
            G+ EAL+W+ D+ ++ I  ++                S F  IIN  K L   F  N   
Sbjct  121  GLFEALQWLSDMSFNNIDFEIDYKITRDVFHSRRKDVSEFGHIINSCKSLFTAFFTNSRV  180

Query  292  LFAKRSANKVAHLLTRETLFKSDCSVYF  375
             F+KR AN  AH L  E  F +    YF
Sbjct  181  EFSKRQANVAAHALAGEATFLASPVTYF  208



>ref|XP_003593283.1| hypothetical protein MTR_2g009730 [Medicago truncatula]
Length=268

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 66/142 (46%), Gaps = 16/142 (11%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G  K N+DA      +R G+   +RD++ TFV AK +    +      EA+G+  AL+W+
Sbjct  118  GRYKCNIDATFSSRFKRTGIDICVRDSDSTFVLAKTVTYPCIVSVDVGEALGLHSALQWL  177

Query  187  KDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFL-NINFLFAKRSANK  318
             D+Q+D +  +                 S F  II+  + L   F  N    F +R  N 
Sbjct  178  SDMQFDSVDFETDSKVTSDAFLSTRNDTSEFGSIISSCRLLFSSFFSNSKVEFVRRQTNT  237

Query  319  VAHLLTRETLFKSDCSVYFFIP  384
            V H L RET   ++ +VY+ IP
Sbjct  238  VTHALARETTLLANPAVYYDIP  259



>ref|XP_003629388.1| Cytochrome P450 [Medicago truncatula]
Length=687

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 43/135 (32%), Positives = 66/135 (49%), Gaps = 16/135 (12%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G    NVDA+      R+G+G  +RD EG FV AK   ++ L   +  EA+G+  A+ W+
Sbjct  534  GRFTCNVDASFSQARNRVGIGVCIRDEEGRFVLAKTEWMTPLLDVELGEALGLLSAMHWV  593

Query  187  KDLQYDFIQLQL---------------YSSFDLIINDVKE-LAKDFLNINFLFAKRSANK  318
            +DLQ   +  +L                S+F  +IN+ +  LA D +  +  F +R AN+
Sbjct  594  RDLQLGIVDFELDSKSVVDSLYGSTSGVSNFSAVINECRRLLASDLVTSDVRFIRRQANE  653

Query  319  VAHLLTRETLFKSDC  363
            VAH   R  L +  C
Sbjct  654  VAHSFARVALLEWLC  668



>ref|XP_010670097.1| PREDICTED: uncharacterized protein LOC104887199 [Beta vulgaris 
subsp. vulgaris]
Length=180

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 65/126 (52%), Gaps = 16/126 (13%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G++K+NVDA    G    GLG V RD  G  +AA        ++P+  EA  +   +K  
Sbjct  28   GFIKVNVDAGF-VGEMGCGLGVVFRDEYGEVLAAGTYQFHVAWEPRIAEAKAIFHGVKLA  86

Query  187  KDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFAKRSANKV  321
            K++ Y  I+++                 S F+LI++DV +LA+ F N+ + F KRS NKV
Sbjct  87   KEMSYSHIEVESDSLLAIQALRSGKGGSSEFNLILDDVLDLARSFDNVIWCFVKRSGNKV  146

Query  322  AHLLTR  339
            AH+L  
Sbjct  147  AHMLAH  152



>ref|XP_002531249.1| hypothetical protein RCOM_0494170 [Ricinus communis]
 gb|EEF31146.1| hypothetical protein RCOM_0494170 [Ricinus communis]
Length=329

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 72/141 (51%), Gaps = 15/141 (11%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G++K NVD A+   + R G G V+RD+ G+FV   +    GLF  K  EAIG+REA++W+
Sbjct  174  GFVKCNVDGAVFTASGRSGFGMVIRDSAGSFVMGADGSSPGLFNVKLAEAIGLREAVQWV  233

Query  187  KDL-------QYD---FIQLQLYSSFDL-----IINDVKELAKDFLNINFLFAKRSANKV  321
              L       +YD    +   L  + DL     +I D + L +   N +  F ++ AN V
Sbjct  234  LSLGRSNVIFEYDAKVVVDAVLSGAADLFEFGAVIADCRLLLQHGCNYSVQFIRKQANLV  293

Query  322  AHLLTRETLFKSDCSVYFFIP  384
            AH L R +  +   +++   P
Sbjct  294  AHSLARASHLQDGFNMFSVPP  314



>ref|XP_006489961.1| PREDICTED: uncharacterized protein LOC102608276 [Citrus sinensis]
Length=190

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 59/103 (57%), Gaps = 15/103 (15%)
 Frame = +1

Query  4    LGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKW  183
            +GW+K NVDAA+      +GLG V+R++EG F+ AK     G F  +E EA GVREAL W
Sbjct  88   VGWVKCNVDAAVFSSQAMVGLGCVVRNSEGIFLTAKCDRFLGSFGAREAEAFGVREALSW  147

Query  184  IKDLQYDFIQLQL------------YSS---FDLIINDVKELA  267
            +K LQ+  + +++            +SS   F LII + + LA
Sbjct  148  LKKLQFPRVIIEIDCLQVFKALTENHSSPNGFGLIIEECRFLA  190



>ref|XP_006480463.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=459

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 43/127 (34%), Positives = 66/127 (52%), Gaps = 15/127 (12%)
 Frame = +1

Query  4    LGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKW  183
            +GWLK N+DA +     R+GLG V+RD  G FVAA    I G + P++ E + +REAL  
Sbjct  310  VGWLKCNIDATVFANEGRVGLGSVIRDESGKFVAALCCHIRGNYSPRDAEVLSIREALSL  369

Query  184  IKDLQYDFIQ-----LQLY----------SSFDLIINDVKELAKDFLNINFLFAKRSANK  318
            +K ++   +      LQ +          +SF  ++ D K +A    +I F F  RSAN 
Sbjct  370  LKSMKLSKVIVETDCLQAFNALVDRKCPLNSFGSLVLDCKCIADSIGDIAFSFVGRSANS  429

Query  319  VAHLLTR  339
             +H + +
Sbjct  430  ASHFVAK  436



>ref|XP_009623190.1| PREDICTED: uncharacterized protein LOC104114439 [Nicotiana tomentosiformis]
Length=362

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 68/147 (46%), Gaps = 17/147 (12%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G LK N+DA+ D  + R   G ++R     FV     P+         E + VREAL W+
Sbjct  206  GTLKCNIDASYDVNSGRAWDGMLIRSTHENFVRGFTTPLEASHDAVIAEILTVREALSWL  265

Query  187  KDLQYDF-IQLQL---------------YSSFDLIINDVKELAKDFLNINFLFAKRSANK  318
            K   +   I +++                S FD+I+ D K L  DF +I+  F KRSAN+
Sbjct  266  KMQHHKSPITIEMDCLLAKQALERSDNGNSYFDIIVQDCKVLMCDFTSISLSFVKRSANQ  325

Query  319  VAHLLTRETLFKSDCSVYFFIPFPSIV  399
             AH+L R     SD   +   P PS++
Sbjct  326  CAHMLVRAASSMSDAMEWIVHP-PSLI  351



>ref|XP_002512628.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50080.1| conserved hypothetical protein [Ricinus communis]
Length=223

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 63/125 (50%), Gaps = 15/125 (12%)
 Frame = +1

Query  55   RMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQL----  222
            ++G+  V+ D+ GTFVA     + GLF+P+  EA+ ++EA++W   +++  +  +     
Sbjct  84   KIGMAAVVSDSNGTFVACMAHAVLGLFEPRLAEAVALKEAIRWAIQMRFSLVVFESDSKI  143

Query  223  -----------YSSFDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTRETLFKSDCSV  369
                       +S F +II++ + L    LN    F KR AN VAH+L   +   +  + 
Sbjct  144  AVDAIRSLAADWSEFGIIIDECRSLLSLGLNFQVYFVKRQANMVAHVLAMSSYSYASLAT  203

Query  370  YFFIP  384
            +  IP
Sbjct  204  WNVIP  208



>ref|XP_003617149.1| hypothetical protein MTR_5g088360 [Medicago truncatula]
Length=156

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 62/124 (50%), Gaps = 8/124 (6%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G LK N+DAA      R+G+G  +R+A G F+ AK +  + +  P+  EA+G+   + WI
Sbjct  32   GRLKYNIDAAFSEVLNRVGVGLCIRNAAGNFIKAKTLWTNPICAPEIGEALGLLPTIHWI  91

Query  187  KDLQYDFIQLQLYS-------SFDLIINDVKELAKDFL-NINFLFAKRSANKVAHLLTRE  342
             +LQ   + L+           F  I+++ K     +  N    F++R  ++V H L RE
Sbjct  92   HELQLSNVDLRWMQRKVLIIFEFGAIVDECKRCCNVYFENSKVEFSRRQVSEVPHTLVRE  151

Query  343  TLFK  354
             LF 
Sbjct  152  ALFS  155



>ref|XP_008229542.1| PREDICTED: uncharacterized protein LOC103328904 [Prunus mume]
Length=205

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 68/131 (52%), Gaps = 15/131 (11%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P G LKLNVD A      + GLG V+R+  G  + A  +PI+G F  K  E + +R+ L+
Sbjct  45   PPGKLKLNVDGACSTFVWKCGLGAVVRNVHGDLLGAISVPITGCFSAKITELLAIRKGLQ  104

Query  181  WIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFAKRSAN  315
            +  +  YD + ++                + +   IIND+  L+++F +++F+FA +  N
Sbjct  105  FAWEANYDSLVVETDAKNAINDIISGTEAFEAAGGIINDIHMLSRNFESLSFVFAPKLRN  164

Query  316  KVAHLLTRETL  348
             VA  L + TL
Sbjct  165  TVADRLAKFTL  175



>ref|XP_003621450.1| hypothetical protein MTR_7g013520 [Medicago truncatula]
 gb|AES77668.1| glycosyltransferase family 28 protein [Medicago truncatula]
Length=183

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 60/127 (47%), Gaps = 9/127 (7%)
 Frame = +1

Query  4    LGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKW  183
            +G  K N DA         G+G  +RDA+GTFV  K          +  EA+G+  AL+W
Sbjct  54   VGRYKCNNDATFSSHLNHTGIGICVRDADGTFVLGKAFAYPCSVPVEVGEALGLHAALQW  113

Query  184  IKDLQYDFIQLQLYSSFDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTRETLFKSDC  363
            + D+Q+D +  +          D K  A  FL+     ++  +N VAH L RE    +  
Sbjct  114  LSDMQFDNVDFE---------TDSKLTADAFLSSRNDLSEFGSNVVAHALAREATSLASP  164

Query  364  SVYFFIP  384
            +VYF IP
Sbjct  165  AVYFDIP  171



>ref|XP_003624705.1| hypothetical protein MTR_7g086560 [Medicago truncatula]
Length=256

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/142 (30%), Positives = 64/142 (45%), Gaps = 16/142 (11%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G  + N+  A        GLG  +RD+EGTFV AK +    L+     EA+G+   L+W+
Sbjct  103  GRYECNIHDAFFSHLNHTGLGICVRDSEGTFVLAKFVSYPCLYYVDVGEALGLHSTLQWL  162

Query  187  KDLQYDFIQLQLYS---------------SFDLIINDVKELAKDFL-NINFLFAKRSANK  318
             D+Q+D +  +  S                F  I +  + L   F  N    F +R AN+
Sbjct  163  SDMQFDNVDFETDSKLTCDAFHANRDDTYEFWCITSSCRSLFSSFFTNSRVEFVRRQANR  222

Query  319  VAHLLTRETLFKSDCSVYFFIP  384
            V H+L  + +  +   VYF IP
Sbjct  223  VVHVLAGDAMLLAGPVVYFHIP  244



>gb|ABN08952.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=238

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 66/141 (47%), Gaps = 17/141 (12%)
 Frame = +1

Query  13   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKD  192
            LK N+DA+      R G+G   RD EG FV AK +  + +      EA+G+  AL+W+ D
Sbjct  88   LKCNIDASFSISQNRTGIGLC-RDGEGNFVLAKTMNFAVVHAADVREALGLYHALEWLWD  146

Query  193  LQYDFI---------QLQLY------SSFDLIINDVKE-LAKDFLNINFLFAKRSANKVA  324
            +Q D I         QL  Y      S F  +I   +  L+  F N    F +R A++VA
Sbjct  147  MQLDNIDFEVDSRTTQLAFYARKDDVSEFGNVITACRGILSTKFTNSRVEFIQRQADEVA  206

Query  325  HLLTRETLFKSDCSVYFFIPF  387
            H+   E       ++Y+ +P 
Sbjct  207  HVFVGEATLVVSPTIYYHVPL  227



>ref|XP_003594556.1| hypothetical protein MTR_2g030550 [Medicago truncatula]
Length=152

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 63/140 (45%), Gaps = 16/140 (11%)
 Frame = +1

Query  13   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKD  192
            LK N+DAA       +G G  +RD  G FVAAK +  S +      EA+G+  A++W+ +
Sbjct  5    LKCNLDAAFSSSLNVIGFGMCIRDEVGQFVAAKTLRSSPICDSSIGEALGLSYAIQWVHE  64

Query  193  LQYDFIQLQL---------------YSSFDLIINDVKELAKD-FLNINFLFAKRSANKVA  324
            LQ   +  ++                S F  II+D +      F N    F +R AN VA
Sbjct  65   LQLTNVDFEMDAKRAVDYYIKGSNDISEFGAIIDDCRRRCCSWFENSKIEFNRRQANIVA  124

Query  325  HLLTRETLFKSDCSVYFFIP  384
            H + RE +  +    +  +P
Sbjct  125  HTIAREAILLTSSQTFNVVP  144



>ref|XP_003601858.1| Estradiol 17-beta-dehydrogenase [Medicago truncatula]
Length=526

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 46/127 (36%), Positives = 63/127 (50%), Gaps = 16/127 (13%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G  K N+DA+      R+G+G  +RD  G FV AK    S L +    EA+G+  AL+WI
Sbjct  384  GRYKCNIDASFSSSLNRVGIGICIRDDAGDFVLAKTDWFSPLCEVTIGEAVGLHTALQWI  443

Query  187  KDLQYDFIQLQLYSSFDL---------------IINDVKELAKD-FLNINFLFAKRSANK  318
             DLQ+D +   L S  D+               II   ++L +D F N +  F +R AN 
Sbjct  444  SDLQFDNVDFALDSKQDVDSFHTGVDDDNELGCIITACRQLFQDSFQNSHVEFNRRQANG  503

Query  319  VAHLLTR  339
            VAH L R
Sbjct  504  VAHELAR  510



>ref|XP_006483704.1| PREDICTED: uncharacterized protein LOC102620092 [Citrus sinensis]
Length=340

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 69/141 (49%), Gaps = 16/141 (11%)
 Frame = +1

Query  10   WLKL-NVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            WLK+ +VDAA+        LG V+R A+  F+AAK     G  + +E EAI VREAL W+
Sbjct  196  WLKVGSVDAAITSSRGMFSLGAVIRSAQCDFIAAKSDFFPGRVEAREAEAIEVREALSWL  255

Query  187  KDLQY-----DFIQLQLYSS----------FDLIINDVKELAKDFLNINFLFAKRSANKV  321
            K   +     D   LQ++++          F  II+D + L +    + F F + SAN  
Sbjct  256  KKFAFYSVILDMDSLQVFNALHDKTSYFNGFGSIIDDCRALVRSLGEVVFSFVRGSANSA  315

Query  322  AHLLTRETLFKSDCSVYFFIP  384
            A  + +     SD   + F+P
Sbjct  316  AFTVAQVGSSMSDSGEWRFVP  336



>ref|XP_003595869.1| hypothetical protein MTR_2g062740 [Medicago truncatula]
Length=155

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 65/139 (47%), Gaps = 16/139 (12%)
 Frame = +1

Query  13   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKD  192
            LK NVDAA     +R G+   LRD  GTFV AK +    ++     EA+G+  A++W++D
Sbjct  4    LKYNVDAAFSETFQRTGIRVCLRDNHGTFVLAKVLQFDQVYPVAVGEALGLYHAIQWMQD  63

Query  193  LQYDFIQLQLYS-----SFDLIINDVKELA-----------KDFLNINFLFAKRSANKVA  324
            +Q+D +  +L S     +F  +  DV E               F N    F +R  N  A
Sbjct  64   MQFDNVDFKLDSKIKRDAFHSLETDVTEFGNIIDECRVQFFSSFTNSRVEFIRRQMNVAA  123

Query  325  HLLTRETLFKSDCSVYFFI  381
            H L R+       ++Y+ I
Sbjct  124  HGLARKVTSLISPNIYYVI  142



>ref|XP_009800085.1| PREDICTED: uncharacterized protein LOC104246050 [Nicotiana sylvestris]
Length=690

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 48/152 (32%), Positives = 69/152 (45%), Gaps = 16/152 (11%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G LK N+DA  +  + R   G ++RD  G FV      +         E + VREAL W+
Sbjct  534  GTLKCNIDAFYEVNSGRAWAGMLIRDTHGNFVRGFSTLLGASHDAVIAEILTVREALSWL  593

Query  187  K--------DLQYDFIQLQLY--------SSFDLIINDVKELAKDFLNINFLFAKRSANK  318
            K         ++ D +  +          S FD+I+ D KEL +DF +I+  F KRSA +
Sbjct  594  KMQHHRSPITIEMDCLLAKQALERSDSGNSYFDIIVQDCKELMRDFTSISLYFVKRSAKQ  653

Query  319  VAHLLTRETLFKSDCSVYFFIPFPSIV*YISS  414
             AH+L R     SD   +   P   I   I+S
Sbjct  654  RAHMLARAASSMSDAMEWIVHPLSLIHDVITS  685



>gb|AES76948.2| hypothetical protein MTR_6g089560 [Medicago truncatula]
Length=232

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 65/131 (50%), Gaps = 16/131 (12%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G LK NVDA     + R+G+G  LRD EGTFV AK +   G++  +  EA+G+  A++W+
Sbjct  101  GRLKCNVDATFSIPHNRIGVGICLRDDEGTFVLAKIVNFEGVYSVEVGEALGLFHAIQWL  160

Query  187  KDLQYDFIQLQLYS-----SFDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTRETLF  351
             D+Q D I  ++ S     +F    +D+ E        + + A RS        + E   
Sbjct  161  SDMQMDNIDFEVDSKIRKDAFTARRDDISEFG------HIVEASRSM-----FHSEEATL  209

Query  352  KSDCSVYFFIP  384
             +   VY+ IP
Sbjct  210  LASAVVYYAIP  220



>ref|XP_003614116.1| hypothetical protein MTR_5g045010 [Medicago truncatula]
Length=147

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 59/125 (47%), Gaps = 16/125 (13%)
 Frame = +1

Query  55   RMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQL----  222
            R G+G  LR+++G+FV AK +    L      EA+G+R  L+W+ D+Q+D +  +     
Sbjct  10   REGIGICLRESDGSFVLAKTVTHPCLLPVDVGEALGLRLVLQWLSDMQFDNVDFETDFKL  69

Query  223  -----------YSSFDLIINDVKELAKD-FLNINFLFAKRSANKVAHLLTRETLFKSDCS  366
                        S F  II+  + L    F N    F +R AN VAH L RE    +  +
Sbjct  70   TSDAFLSDRNDTSEFGCIISSCRSLFTSLFSNSRVKFVRRQANGVAHALAREATLLASPA  129

Query  367  VYFFI  381
            VY  I
Sbjct  130  VYHEI  134



>ref|XP_003620730.1| hypothetical protein MTR_6g089560 [Medicago truncatula]
Length=205

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 65/131 (50%), Gaps = 16/131 (12%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G LK NVDA     + R+G+G  LRD EGTFV AK +   G++  +  EA+G+  A++W+
Sbjct  74   GRLKCNVDATFSIPHNRIGVGICLRDDEGTFVLAKIVNFEGVYSVEVGEALGLFHAIQWL  133

Query  187  KDLQYDFIQLQLYS-----SFDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTRETLF  351
             D+Q D I  ++ S     +F    +D+ E        + + A RS        + E   
Sbjct  134  SDMQMDNIDFEVDSKIRKDAFTARRDDISEFG------HIVEASRSM-----FHSEEATL  182

Query  352  KSDCSVYFFIP  384
             +   VY+ IP
Sbjct  183  LASAVVYYAIP  193



>ref|XP_003597249.1| hypothetical protein MTR_2g094480 [Medicago truncatula]
Length=165

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 67/147 (46%), Gaps = 18/147 (12%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G  K N+DA+      R+G+   +RD  G FV A+    S L +    EA+G+  A++WI
Sbjct  21   GSYKCNIDASFSSSLNRVGIDICIRDDAGDFVLARTDWFSPLCEVTIGEAVGLHTAMQWI  80

Query  187  KDLQYDFIQL-----QLYSSFDLIINDVKELA-----------KDFLNINFLFAKRSANK  318
             DLQ+D +       Q+ +SF   ++D  EL              F N +  F  R AN 
Sbjct  81   LDLQFDNVDFVLDSKQVVNSFHTEVDDDSELGCIITACRQLFQDSFQNSHVKFNMRQANG  140

Query  319  VAHLLTRETLFKSDCSVYFFIPFPSIV  399
            V H L R  +  SD S   +   PS +
Sbjct  141  VTHELAR--VAPSDPSPTIYDDVPSCI  165



>ref|XP_007206484.1| hypothetical protein PRUPE_ppa019056mg, partial [Prunus persica]
 gb|EMJ07683.1| hypothetical protein PRUPE_ppa019056mg, partial [Prunus persica]
Length=298

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 64/143 (45%), Gaps = 15/143 (10%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P G LK N D A D  + R  +G V RDA+G FVAA    +  +   +  E +  RE + 
Sbjct  126  PSGRLKFNFDGAFDPTSGRGAVGVVARDADGGFVAAVAKSVGEVLSAEHAEILAAREGVA  185

Query  181  WIKDL-------QYDFIQL--------QLYSSFDLIINDVKELAKDFLNINFLFAKRSAN  315
                L       + D   +        Q YS+   I+ DVK L + F +  F F  R AN
Sbjct  186  LALSLGTASPIFEGDSAVVVSAIKRAGQDYSNIGTIVEDVKHLQQQFPSSLFQFTPREAN  245

Query  316  KVAHLLTRETLFKSDCSVYFFIP  384
             VAH L R  L   D  ++F +P
Sbjct  246  GVAHRLARFGLHNVDNFIWFEVP  268



>ref|XP_003605183.1| Cytochrome P450 [Medicago truncatula]
Length=348

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 61/126 (48%), Gaps = 16/126 (13%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G  K NVDA+      R+ +G  +RD EG +V AK   +S LF     EA+G+  A+ W+
Sbjct  211  GRFKCNVDASFSQAQNRVDIGVCIRDEEGRYVLAKTEWMSPLFDVDLGEALGLLSAMYWV  270

Query  187  KDLQYDFIQLQL---------------YSSFDLIINDVKE-LAKDFLNINFLFAKRSANK  318
            ++LQ   +  +L                S+F  +IND +  LA D +  +  F +R AN+
Sbjct  271  RNLQLGIVDFELDSKIVVDSLYGSKIGVSNFSAVINDCRRLLASDLVTSDVRFIRRQANE  330

Query  319  VAHLLT  336
            V   L 
Sbjct  331  VGQWLC  336



>ref|XP_003599959.1| hypothetical protein MTR_3g049770 [Medicago truncatula]
Length=136

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 59/125 (47%), Gaps = 9/125 (7%)
 Frame = +1

Query  16   KLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDL  195
            K N++AA      R  +G  + DAEGTFV AK             EA+G+   ++W+ D+
Sbjct  10   KCNIEAAFSSHANRTCIGICVWDAEGTFVIAKAFTYLCTVSVDVAEALGLHSVVQWLNDM  69

Query  196  QYDFIQLQLYS-----SFDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTRETLFKSD  360
            Q+D +  +  S     +F    N++ E      +   LF    +N VAH L RE  F + 
Sbjct  70   QFDNVDFETDSKLTADAFLFSRNNLSEFGCIIFSCRSLF----SNAVAHTLAREATFLAS  125

Query  361  CSVYF  375
             S+YF
Sbjct  126  PSIYF  130



>ref|XP_003621136.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
Length=821

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 66/141 (47%), Gaps = 17/141 (12%)
 Frame = +1

Query  13   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKD  192
            LK N+DA+      R G+G   RD EG FV AK +  + +      EA+G+  AL+W+ D
Sbjct  671  LKCNIDASFSISQNRTGIGLC-RDGEGNFVLAKTMNFAVVHAADVREALGLYHALEWLWD  729

Query  193  LQYDFI---------QLQLY------SSFDLIINDVKE-LAKDFLNINFLFAKRSANKVA  324
            +Q D I         QL  Y      S F  +I   +  L+  F N    F +R A++VA
Sbjct  730  MQLDNIDFEVDSRTTQLAFYARKDDVSEFGNVITACRGILSTKFTNSRVEFIQRQADEVA  789

Query  325  HLLTRETLFKSDCSVYFFIPF  387
            H+   E       ++Y+ +P 
Sbjct  790  HVFVGEATLVVSPTIYYHVPL  810



>ref|XP_003588770.1| hypothetical protein MTR_1g012560 [Medicago truncatula]
Length=214

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/142 (31%), Positives = 61/142 (43%), Gaps = 16/142 (11%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G  K N+D +       +G+G   RD  G FV+AK      L      EA+G    LKW+
Sbjct  61   GRYKCNIDTSFSSSMNMVGIGICFRDDRGEFVSAKIDCFPPLCDVAVGEAVGFHTKLKWM  120

Query  187  KDLQYDFI---------------QLQLYSSFDLIINDVKELAK-DFLNINFLFAKRSANK  318
             +L YD +                L+  S F  I+ D K+L +  F N +  F +R AN 
Sbjct  121  AELHYDNVDFALDSKIVVDHFRSSLEDDSEFGCIMYDCKQLFEISFQNSHVEFNRRQANG  180

Query  319  VAHLLTRETLFKSDCSVYFFIP  384
            VAH L R     +   VY  +P
Sbjct  181  VAHELVRVAPSHASSHVYGNVP  202



>ref|XP_002517530.1| Disease resistance protein RPS5, putative [Ricinus communis]
 gb|EEF44694.1| Disease resistance protein RPS5, putative [Ricinus communis]
Length=1066

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = +1

Query  1     PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
             P GWL +N DAA      R G G + RD  G F+AA+ + + G F+ ++ EA+GVREAL 
Sbjct  945   PQGWLIVNADAATFGRENRTGWGMIARDGSGYFIAARALSLDGCFEVRDAEAMGVREALS  1004

Query  181   WIKDLQYDFIQLQL  222
             W   + ++ + L++
Sbjct  1005  WANQMGWNAVVLEM  1018



>ref|XP_003612608.1| Replication protein A 70 kDa DNA-binding subunit [Medicago truncatula]
Length=1723

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 47/147 (32%), Positives = 68/147 (46%), Gaps = 18/147 (12%)
 Frame = +1

Query  7     GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
             G  K NVDAA    + R+G+G  +RD  G  V A+    + L    E EAIG+  A++W 
Sbjct  1570  GHFKCNVDAAFFKESNRVGIGICIRDDSGRLVKARTSWSTLLLDVPEGEAIGLLYAIRWA  1629

Query  187   KDLQYDFIQLQLYS-----SFDLIINDVKEL-----------AKDFLNINFLFAKRSANK  318
             K+   + I  +L S     SF    NDV +L           +  F N    F +R AN+
Sbjct  1630  KEQNLNNITFELDSKRVVYSFHNTRNDVSDLGAIIRECRTTFSSFFTNSRVEFIRRQANE  1689

Query  319   VAHLLTRETLFKSDCSVYFFIPFPSIV  399
             V H L R   F +  S+++F   P  +
Sbjct  1690  VVHSLARAATFYA--SIHYFTVLPDCI  1714



>ref|XP_002529689.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32700.1| conserved hypothetical protein [Ricinus communis]
Length=119

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 50/95 (53%), Gaps = 14/95 (15%)
 Frame = +1

Query  97   FVAAKEIPISGLFKPKEDEAIGVREALKWIKD-------LQYDFIQL-------QLYSSF  234
             V A+   I G + P+E EAI +REAL W+K        ++ D +Q+          S F
Sbjct  1    MVMARADRIPGNYTPREAEAISIREALSWLKQQIFEECIIESDALQVIEALKAPSSQSCF  60

Query  235  DLIINDVKELAKDFLNINFLFAKRSANKVAHLLTR  339
             LII+D K L + F  ++F F +RSAN  A ++ R
Sbjct  61   HLIIDDCKHLVQHFRQVHFQFVRRSANTAAQIVAR  95



>ref|XP_007203452.1| hypothetical protein PRUPE_ppa022115mg [Prunus persica]
 gb|EMJ04651.1| hypothetical protein PRUPE_ppa022115mg [Prunus persica]
Length=1755

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 48/148 (32%), Positives = 67/148 (45%), Gaps = 16/148 (11%)
 Frame = +1

Query  1     PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
             P G LK N D A D  + R  +G V RDA+G FVAA    +  +   +  E +  RE + 
Sbjct  1583  PSGRLKFNFDGAFDPTSGRGAVGVVARDADGGFVAAVAKSVGEVLSAEHAEILAAREGVA  1642

Query  181   WIKDL-------QYDFIQL--------QLYSSFDLIINDVKELAKDFLNINFLFAKRSAN  315
                 L       + D   +        Q YS+   I+ DVK L + F +  F F  R AN
Sbjct  1643  LALSLGTASPIFEGDSAVVVSAIKRAGQDYSNIGTIVEDVKHLQQQFPSSLFQFTPREAN  1702

Query  316   KVAHLLTRETLFKSDCSVYFFIPFPSIV  399
              VAH L R  L   D  ++F +P P ++
Sbjct  1703  GVAHRLARFGLHNVDNFIWFEVP-PDLI  1729



>ref|XP_010687523.1| PREDICTED: uncharacterized protein LOC104901631 [Beta vulgaris 
subsp. vulgaris]
Length=333

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 61/126 (48%), Gaps = 16/126 (13%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G +KLNVDA    G    GLG V RD +G  +AA        ++P+  EA  +   +K  
Sbjct  181  GHVKLNVDAG-KTGVGGCGLGAVFRDVDGVVLAAGSFQCHDTWEPRVAEAKAIYFGIKLA  239

Query  187  KDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFAKRSANKV  321
            K+L Y  ++++                 S F LII+D+      F N+++ F KRS N+V
Sbjct  240  KELGYRLVEVESDSLLAIQALKNGRTGCSEFHLIIDDILAFVGCFDNVSWSFVKRSGNRV  299

Query  322  AHLLTR  339
            AHLL  
Sbjct  300  AHLLAH  305



>gb|ABD28710.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=393

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 68/147 (46%), Gaps = 18/147 (12%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G LK NVDA+    + ++G+G  +RD+EG  V +K +  S L      EA+G+  A +WI
Sbjct  240  GRLKCNVDASFSTSSNKVGIGMCIRDSEGNHVRSKTMWFSPLCPVNIGEALGLYHATRWI  299

Query  187  KDLQYDFIQLQLYS---------------SFDLIINDVKELAKDFL-NINFLFAKRSANK  318
             +LQ   +  ++ S                F  I+ +  +    FL N +  F +R AN+
Sbjct  300  NELQLTNVDFEVDSKTIADYFNKARGDNTEFGSIMENTIQFCNIFLTNSHVEFTRRQANE  359

Query  319  VAHLLTRETLFKSDCSVYFFIPFPSIV  399
            VAH L +        S + F   P+ +
Sbjct  360  VAHELAKAATLGP--SFHIFDESPTCI  384



>ref|XP_003590140.1| hypothetical protein MTR_1g044900 [Medicago truncatula]
Length=155

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 61/119 (51%), Gaps = 3/119 (3%)
 Frame = +1

Query  34   ALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFI-  210
            +L+YGN+ +G G  +RDAEG FV A+    + L      EA+G    ++    +  D I 
Sbjct  26   SLEYGNK-VGFGACIRDAEGNFVIARTAWTTPLLDVDMGEAMGFFSCIEVDSKVVADSIY  84

Query  211  QLQLYSSFDLIINDVKE-LAKDFLNINFLFAKRSANKVAHLLTRETLFKSDCSVYFFIP  384
              +  S F  IIND +  L+ D +N +  F +R  N VAH L +E L  +   ++  IP
Sbjct  85   GKEGVSDFMAIINDCRHLLSTDLVNSDVKFIRRQVNGVAHSLAKEALHHASLHIHLNIP  143



>ref|XP_010690674.1| PREDICTED: uncharacterized protein LOC104904177 [Beta vulgaris 
subsp. vulgaris]
Length=280

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 60/125 (48%), Gaps = 16/125 (13%)
 Frame = +1

Query  10   WLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIK  189
            W+K+NVDA L  G+   G+G V  D  G  +AA        ++ +  EA  +   LK   
Sbjct  129  WMKVNVDAGL-VGSLGCGIGVVCWDYMGEVLAASTFQFHETWETRVAEAKAIFYGLKVAL  187

Query  190  DLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFAKRSANKVA  324
            +L Y  ++++                 S F LII+DV +L   F N+ + F KRS NKVA
Sbjct  188  ELGYAHVEVESDSLLAIQALRSGKGGSSDFHLIIDDVLDLVSSFSNVEWSFVKRSGNKVA  247

Query  325  HLLTR  339
            H+L  
Sbjct  248  HMLAH  252



>ref|XP_008231652.1| PREDICTED: uncharacterized protein LOC103330817 [Prunus mume]
Length=205

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 64/129 (50%), Gaps = 16/129 (12%)
 Frame = +1

Query  1    PL-GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREAL  177
            PL G L+L VD A      + GLG V+R+  G  + A  +PI+G F  K  E + +RE L
Sbjct  44   PLSGKLRLYVDGACSTSIWKRGLGAVVRNVHGDLMGAISVPITGCFSAKTTELLAIREGL  103

Query  178  KWIKDLQYDFIQL---------------QLYSSFDLIINDVKELAKDFLNINFLFAKRSA  312
            ++  +  YD + +               + +     IIND+  L+++F +++F+FA    
Sbjct  104  QFAWEAGYDSLVVESDAKNAINDIVTGTEAFGVAGGIINDIHMLSRNFDSLSFVFASILC  163

Query  313  NKVAHLLTR  339
            N VA  L +
Sbjct  164  NTVADRLAK  172



>gb|KHN14619.1| hypothetical protein glysoja_024714 [Glycine soja]
Length=239

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 62/134 (46%), Gaps = 18/134 (13%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G +K N+DAA   G RRMG+G  LRD  G  V A       L   KEDEA+ +   L+++
Sbjct  6    GRMKCNIDAAFREGGRRMGIGACLRDDRGHCVHAFTTLKPYLPTMKEDEALAILHTLEYL  65

Query  187  KD------------------LQYDFIQLQLYSSFDLIINDVKELAKDFLNINFLFAKRSA  312
            K+                    +    + +++    +IN  +    D LN++  F +R A
Sbjct  66   KNNGFHDTLIWWKLPVRWWLETFSVGTMTIWNLAASLINKCRRFLLDILNVSIGFIRRQA  125

Query  313  NKVAHLLTRETLFK  354
            N VAH L ++  ++
Sbjct  126  NSVAHSLAKDDFYE  139



>ref|XP_007217321.1| hypothetical protein PRUPE_ppa019733mg [Prunus persica]
 gb|EMJ18520.1| hypothetical protein PRUPE_ppa019733mg [Prunus persica]
Length=1275

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 48/148 (32%), Positives = 67/148 (45%), Gaps = 16/148 (11%)
 Frame = +1

Query  1     PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
             P G LK N D A D  + R  +G V RDA+G FVAA    +  +   +  E +  RE + 
Sbjct  1103  PSGRLKFNFDGAFDPTSGREAVGVVARDADGGFVAAVAKSVGEVLSAEHAEILVAREGVA  1162

Query  181   WIKDL-------QYDFIQL--------QLYSSFDLIINDVKELAKDFLNINFLFAKRSAN  315
                 L       + D   +        Q YS+   I+ DVK L + F +  F F  R AN
Sbjct  1163  LALSLGTASPIFEGDSAVVVSAIKRAGQDYSNIGTIVEDVKHLQQQFPSSLFQFTPREAN  1222

Query  316   KVAHLLTRETLFKSDCSVYFFIPFPSIV  399
              VAH L R  L   D  ++F +P P ++
Sbjct  1223  GVAHRLARFGLHNVDNFIWFEVP-PDLI  1249



>ref|XP_003613409.1| hypothetical protein MTR_5g036320 [Medicago truncatula]
 gb|AES96367.1| transmembrane protein, putative [Medicago truncatula]
Length=145

 Score = 60.1 bits (144),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G  K NV AA      R+G+G  +RD +G+FV AK   IS + K  E EA+GV  A++W+
Sbjct  64   GRYKCNVGAAFSTATNRVGIGICIRDDQGSFVLAKTKWISPILKVDEGEALGVSYAIRWL  123

Query  187  KDLQYDFIQLQLY  225
            KDL+ + +   L+
Sbjct  124  KDLRINNVIFVLH  136



>gb|EEE56566.1| hypothetical protein OsJ_05904 [Oryza sativa Japonica Group]
Length=420

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 64/139 (46%), Gaps = 16/139 (12%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P G   +N DAA+    R+MG+G V+RD  G  + A      G+  P+  EA  +R AL 
Sbjct  266  PAGVFLINTDAAVFQAERQMGVGVVIRDQHGNCLLAANTRFMGITDPETAEACAIRHALW  325

Query  181  WIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFAKRSAN  315
              K+  +  + +                  S    ++ D+K+L  +F++++F+     +N
Sbjct  326  LAKEEGFHNVIVACDCLSVIQKLNSPGRDRSKIGCLVEDIKKLGVEFISVSFIHVSHCSN  385

Query  316  KVAHLLTRETLFKSDCSVY  372
              AH L R +   S C+VY
Sbjct  386  VAAHTLARCSE-PSVCNVY  403



>ref|XP_002517043.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45206.1| conserved hypothetical protein [Ricinus communis]
Length=160

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 49/109 (45%), Gaps = 8/109 (7%)
 Frame = +1

Query  58   MGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQLYSSFD  237
            +G+G V+RD  G FV A    I G F   E EA  + EAL W+K  Q+D   ++      
Sbjct  50   IGVGCVVRDERGRFVMACSCSIHGNFTIIEAEAHSMGEALSWLKCRQFDNCVIE------  103

Query  238  LIINDVKELAKDFLNINFLFAKRSANKVAHLLTRETLFKSDCSVYFFIP  384
               N    LA     + F F +RSAN   H+  R     +   V+F  P
Sbjct  104  --SNAWTHLASALRRVQFSFVRRSANMATHIAARAGCSLTGRVVWFLKP  150



>ref|XP_003609588.1| hypothetical protein MTR_4g118850 [Medicago truncatula]
Length=137

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 59/113 (52%), Gaps = 16/113 (14%)
 Frame = +1

Query  34   ALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDL---QYD  204
            +L+YGN+ +G G  +RDAEG FV A+    + L      EA+G   ALKW+++L     D
Sbjct  26   SLEYGNK-VGFGACIRDAEGNFVIARTAWTTPLLDVDMGEAMGFLAALKWVEELNMVHMD  84

Query  205  F------IQLQLY-----SSFDLIINDVKE-LAKDFLNINFLFAKRSANKVAH  327
            F      +   +Y     S F  IIND +  L+ D +N +  F +R  N VAH
Sbjct  85   FETDSKVVADSIYGKEGVSDFMAIINDCRHLLSTDLVNSDVKFIRRQVNGVAH  137



>ref|XP_003603808.1| hypothetical protein MTR_3g114430 [Medicago truncatula]
Length=256

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 55/125 (44%), Gaps = 14/125 (11%)
 Frame = +1

Query  4    LGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKW  183
            LG  K N+DAA      R G+G  ++DAEGTFV AK             EA+G+  A+  
Sbjct  117  LGRYKCNIDAAFSSHINRTGIGICVQDAEGTFVLAKAFIYPCTVSVNVGEALGLHSAM--  174

Query  184  IKDLQYDFIQLQLYSSFDLIINDVKELAKDFL-NINFLFAKRSANKVAHLLTRETLFKSD  360
              DL          S F  II+  + L   F  N    F +R  N +AH L RE    + 
Sbjct  175  -NDL----------SEFGCIISSCRSLFSTFFSNSRVEFVRRQVNAIAHALAREATSLAS  223

Query  361  CSVYF  375
              VYF
Sbjct  224  RVVYF  228



>ref|XP_007225095.1| hypothetical protein PRUPE_ppa016563mg, partial [Prunus persica]
 gb|EMJ26294.1| hypothetical protein PRUPE_ppa016563mg, partial [Prunus persica]
Length=925

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 46/146 (32%), Positives = 66/146 (45%), Gaps = 16/146 (11%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G LK N D A D  + R  +G V RDA+G FVAA    +  +   +  E +  RE +   
Sbjct  736  GRLKFNFDGAFDPTSGRGAVGVVARDADGGFVAAVAKSVGEVLSAEHAEILAAREGVALA  795

Query  187  KDL-------QYDFIQL--------QLYSSFDLIINDVKELAKDFLNINFLFAKRSANKV  321
              L       + D   +        Q YS+   I+ DVK L + F +  F F  R AN V
Sbjct  796  LSLGTASPIFEGDSAVVVSAVKRAGQDYSNIGTIVEDVKHLQQQFPSSLFQFTPREANGV  855

Query  322  AHLLTRETLFKSDCSVYFFIPFPSIV  399
             H L R  L+  D  ++F +P P ++
Sbjct  856  VHRLARFGLYNVDNFIWFEVP-PDLI  880



>gb|KJB20572.1| hypothetical protein B456_003G154500 [Gossypium raimondii]
Length=226

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 62/131 (47%), Gaps = 24/131 (18%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P G+ K+NVDA L   N R  LGF++R+AEG F+    +  S +      EAI V + L+
Sbjct  82   PQGYFKINVDAGLSVANNRAVLGFIIRNAEG-FIMGHNLVHSMVIA----EAIAVLDGLQ  136

Query  181  WIKDLQYDFIQLQLYSSFDLIIN-----------------DVKELAKDFLNINFLFAKRS  309
            +  D+   F ++ L S   L++N                 DVK LA+ FL   F F  R 
Sbjct  137  FALDM--GFSKVILESDSRLVVNNIQKSSEDYSESRPFTWDVKNLARKFLCCRFQFVARE  194

Query  310  ANKVAHLLTRE  342
             N  AH L  E
Sbjct  195  GNGAAHALVVE  205



>ref|XP_007198863.1| hypothetical protein PRUPE_ppa018328mg [Prunus persica]
 gb|EMJ00062.1| hypothetical protein PRUPE_ppa018328mg [Prunus persica]
Length=161

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 60/128 (47%), Gaps = 15/128 (12%)
 Frame = +1

Query  10   WLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIK  189
            + K+NVD AL   +   GLG V+RD     +AA   P+ G+F P   E   +R  L+   
Sbjct  6    FFKINVDGALKTNDSMRGLGVVIRDDCEELIAATTKPVCGMFTPNITELFAIRFGLQLAM  65

Query  190  D--LQYDF--------IQLQLYSSFDL-----IINDVKELAKDFLNINFLFAKRSANKVA  324
            D  LQ+ +        IQ+      DL     ++N+++ LA  F +    F  R+ N VA
Sbjct  66   DLGLQHIYLESDAQAAIQMAFQCDADLSYDGILVNEIQVLANSFHSCFGKFRPRTCNHVA  125

Query  325  HLLTRETL  348
            H L   TL
Sbjct  126  HSLACFTL  133



>ref|XP_002518871.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43404.1| conserved hypothetical protein [Ricinus communis]
Length=668

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/67 (45%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +1

Query  4    LGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKW  183
            LGWLK+N D AL     R+GLG V+RD+ G  + A+     G F  +E EA+ ++EAL +
Sbjct  593  LGWLKINTDTALFLKQGRIGLGCVVRDSNGRMIMARSERRVGRFTAREAEALSMKEALSY  652

Query  184  IKDLQYD  204
            +KD Q D
Sbjct  653  MKDYQMD  659



>ref|XP_003599929.1| hypothetical protein MTR_3g049170 [Medicago truncatula]
 ref|XP_003599934.1| hypothetical protein MTR_3g049260 [Medicago truncatula]
Length=266

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 61/130 (47%), Gaps = 12/130 (9%)
 Frame = +1

Query  4    LGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKW  183
            LG  K N+DAA     +  G+G  +RD+EGTFV AK      L+     E +G+   L+W
Sbjct  134  LGRYKCNIDAACSSHFKWTGIGICVRDSEGTFVLAKVASYPCLYSVDVGEMLGLHSTLQW  193

Query  184  IKDLQYDFIQLQLYSSFDLIINDVKELAKDFLN--INFLFAKRSA-----NKVAHLLTRE  342
            + D+Q+D +  +  S    + +D   L    LN  + FL   R +     N     + R+
Sbjct  194  LSDMQFDNVDFETDSK---MTSDAMLLRTTILNFVVLFLHVVRYSDFSLPNSRVKFVRRQ  250

Query  343  TLFKSDCSVY  372
               K DCS Y
Sbjct  251  A--KRDCSCY  258



>ref|XP_003607370.1| LCR-like protein [Medicago truncatula]
Length=141

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 59/125 (47%), Gaps = 19/125 (15%)
 Frame = +1

Query  10   WLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIK  189
            +LK NVDAA+    R  G+G  +RD+ G F+ A              +A+G+R+A+ W+ 
Sbjct  24   YLKCNVDAAIFEEQRSFGIGICIRDSRGNFIKA------------STKAMGLRDAILWLG  71

Query  190  DLQYDFIQLQLYSSFDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTRETLFKSDCSV  369
             L    +Q++L           + L + F N    F +  AN VAH L RE+   +   V
Sbjct  72   QLGLSKVQIELD-------RKCRSLLQQFSNFKINFVRIQANYVAHGLARESKLYARHHV  124

Query  370  YFFIP  384
            +  IP
Sbjct  125  FDSIP  129



>gb|ABN06084.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=519

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 33/117 (28%), Positives = 55/117 (47%), Gaps = 5/117 (4%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G  K NVDA       R+G+G  +RD +G +V AK I    +   +  EA+G+  AL+W+
Sbjct  366  GRFKCNVDAGFSTSKNRIGIGICVRDDDGAYVLAKTISFDVVHPVRVGEALGLYHALEWL  425

Query  187  KDLQYDFIQLQL-----YSSFDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTRE  342
             D+Q+D +   +     Y +F+   +D+ E          LF+    N     + R+
Sbjct  426  SDMQFDNMDFAMDSKITYDAFNSQKDDISEFGHIISARQSLFSTHFTNSRVEFIRRQ  482



>ref|XP_008346598.1| PREDICTED: uncharacterized protein LOC103409561 [Malus domestica]
Length=216

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 71/148 (48%), Gaps = 17/148 (11%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREAL-  177
            P G LKLNVD A        G+G +  D+ GTFVAA       +F P   EA+ +RE L 
Sbjct  59   PPGRLKLNVDGAWCKETNLGGVGLIFWDSNGTFVAATSRRFGDIFSPIHIEALAIREGLL  118

Query  178  ----KWIKDLQYDFIQLQLYSSF---DLIINDVKELAKDFLNINFLFA-------KRSAN  315
                + ++ +  +   LQ+ S+     L ++ ++ + +D +++  L         +  AN
Sbjct  119  MAIERGVQSISLESDSLQIISALKESSLNVSTIEPIIEDTISLLLLVTEATAYNVRHQAN  178

Query  316  KVAHLLTRETLFKSDCSVYFFIPFPSIV  399
             VAH L R  L+   C+  +F   PS++
Sbjct  179  FVAHRLARFALYGXGCT--WFDETPSMI  204



>gb|ABD32189.2| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=612

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 33/117 (28%), Positives = 55/117 (47%), Gaps = 5/117 (4%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G  K NVDA       R+G+G  +RD +G +V AK I    +   +  EA+G+  AL+W+
Sbjct  459  GRFKCNVDAGFSTSKNRIGIGICVRDDDGAYVLAKTISFDVVHPVRVGEALGLYHALEWL  518

Query  187  KDLQYDFIQLQL-----YSSFDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTRE  342
             D+Q+D +   +     Y +F+   +D+ E          LF+    N     + R+
Sbjct  519  SDMQFDNMDFAMDSKITYDAFNSQKDDISEFGHIISARQSLFSTHFTNSRVEFIRRQ  575



>ref|XP_006464882.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=769

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 67/139 (48%), Gaps = 15/139 (11%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P GW K+NVDAA+   N+R+GLG V+R++EG F+ A   P   L +    EA   R  L+
Sbjct  614  PAGWFKVNVDAAIKLENQRVGLGIVIRNSEGKFITAAIKPSKWLDRVDYAEAEATRFGLE  673

Query  181  WIKDLQ-------------YDFIQLQLYSSFDL--IINDVKELAKDFLNINFLFAKRSAN  315
              +                 D +  +  +  ++  I+++V++  K   ++    + R+ N
Sbjct  674  VAESAGCLPLIVETDSKEVTDLVSARKSTKAEIFWIVSEVQDTMKRLKHVKIQHSPRTCN  733

Query  316  KVAHLLTRETLFKSDCSVY  372
              AH L +  L  +DC ++
Sbjct  734  GFAHTLAKLVLDYTDCVIW  752



>gb|ABN08583.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=207

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 50/92 (54%), Gaps = 5/92 (5%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G  K N+DA      +R G+   LRD  GTFV AK +P   ++     EA+G+  A++W+
Sbjct  98   GRFKCNIDADFSEQFQRTGIRMCLRDDSGTFVLAKVMPFDQVYLVAVGEALGLYHAIQWM  157

Query  187  KDLQYDFIQLQLYS-----SFDLIINDVKELA  267
            +D+Q+D I  +L S     +F  I+ D+ +  
Sbjct  158  QDMQFDNIDFELDSKITRDAFHSIMTDITKFG  189



>gb|AAP44645.1| putative reverse transcriptase [Oryza sativa Japonica Group]
Length=404

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 68/139 (49%), Gaps = 16/139 (12%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P G   +N DAA+   +R MG+G ++RD  G  + A    IS +  P+  EA+ +R AL 
Sbjct  250  PAGVWMINSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAIRRALG  309

Query  181  WIKD--LQYDFI---------QLQLY----SSFDLIINDVKELAKDFLNINFLFAKRSAN  315
              K+  LQ+  +         ++Q      S    +I D+K+LA  F+  +F+   R +N
Sbjct  310  LAKEEGLQHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVNRLSN  369

Query  316  KVAHLLTRETLFKSDCSVY  372
              AH L R     S C+VY
Sbjct  370  LAAHSLARNAEL-STCTVY  387



>ref|XP_002528833.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33567.1| conserved hypothetical protein [Ricinus communis]
Length=141

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +1

Query  10   WLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIK  189
            WLKLNVD AL     R+GLG ++R+A G F+AAK + + G  + K  +A+GV EAL  +K
Sbjct  67   WLKLNVDVALFRSLSRIGLGMIVRNATGNFMAAKIVILDGCLEVKVAKAVGVCEALSLVK  126

Query  190  D  192
            +
Sbjct  127  E  127



>ref|XP_003593785.1| hypothetical protein MTR_2g017550 [Medicago truncatula]
Length=197

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = +1

Query  4    LGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKW  183
            LG  K N+DAA     +   +G  LRD  GTFV AK +    L+     EA+G+  AL+W
Sbjct  125  LGRYKCNIDAAFSNQFQWTSIGVCLRDDSGTFVLAKTLQFHHLYLVVVGEALGLFHALRW  184

Query  184  IKDLQYDFIQLQ  219
             +D+ +D+IQ Q
Sbjct  185  PQDIHFDYIQRQ  196



>gb|KEH25827.1| hypothetical protein MTR_6g034915 [Medicago truncatula]
Length=176

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 59/117 (50%), Gaps = 11/117 (9%)
 Frame = +1

Query  52   RRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQLYSS  231
            R++ +G  +RDA G F  AK +  + + KP+  E +G+  A++W+ +LQ   +  ++ + 
Sbjct  55   RKIYVGLCIRDAAGNFRKAKMMWSNPICKPEIGEVLGLLYAIQWVHELQLTNVDFEMDAK  114

Query  232  -----FDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTRETLFKSDCSVYFFIPF  387
                 F    N+V E      N    F+ R AN+VAH L RE LF     V+  +P 
Sbjct  115  LVVDYFTKGNNNVSE------NFKMEFSWRQANEVAHTLAREALFLPSSQVFNDVPL  165



>ref|XP_007203129.1| hypothetical protein PRUPE_ppa024061mg, partial [Prunus persica]
 gb|EMJ04328.1| hypothetical protein PRUPE_ppa024061mg, partial [Prunus persica]
Length=140

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 65/122 (53%), Gaps = 10/122 (8%)
 Frame = +1

Query  1    PLGWLKLNVDAA--LDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREA  174
            P+G  KLNVD A  L+ G  R+G+  V+R+ +G  +AA  +P++     K  E +     
Sbjct  9    PVGKYKLNVDVAFILETGAGRIGV--VVRNDKGEVMAAMALPLASATSSKHAEIMAFLFG  66

Query  175  LKWIKDLQYDFIQLQLYSSFDLIINDV----KELAKDFLNINFLFAKRSANKVAHLLTRE  342
            +K+ +D  +  I ++  S    +INDV    KE  + F ++   F+ R +N+VAH L R 
Sbjct  67   MKFTRDAGFSSILIE--SDSQGVINDVKKDEKESLQQFEDVIISFSPRGSNQVAHFLARH  124

Query  343  TL  348
             L
Sbjct  125  AL  126



>ref|XP_003624042.1| hypothetical protein MTR_7g078610 [Medicago truncatula]
Length=187

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 61/135 (45%), Gaps = 16/135 (12%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G  K NVDAA      R G+G  LRD EG FV AK      L +      + V EA+  I
Sbjct  48   GQYKCNVDAAFSSNFNRTGIGICLRDEEGAFVLAKMTSFPCLHQ------VTVGEAMNNI  101

Query  187  KDLQYDF-IQLQLY-------SSFDLIINDVKEL-AKDFLNINFLFAKRSANKVAHLLTR  339
             D + D  I    +       S F  +I   K L +  F+N    F +R AN VA+ L R
Sbjct  102  -DFELDSKITCDAFRSSRDDVSEFRHVIASCKALFSTFFINSRVEFTRRLANVVAYALVR  160

Query  340  ETLFKSDCSVYFFIP  384
            E  F +   +Y+ IP
Sbjct  161  EATFLASPVIYYHIP  175



>ref|XP_008226303.1| PREDICTED: uncharacterized protein LOC103325890 [Prunus mume]
Length=271

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 61/143 (43%), Gaps = 19/143 (13%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G LK+NVD +   GN   G+G V+RD+ G FVA + + +  +F   + EA+  RE    I
Sbjct  117  GSLKINVDGSWTAGNTYGGVGIVVRDSNGKFVAGRALHVDNVFSALQVEAMAAREGA--I  174

Query  187  KDLQYDFI-------QLQLYSSF----------DLIINDVKELAKDFLNINFLFAKRSAN  315
              ++ DF         LQ+ S+             ++ D K L        F   +R AN
Sbjct  175  LAVEGDFNNAIFESDSLQIVSAIRSSSVDRSNVGPVVEDTKALLTQITGDGFTHIRRVAN  234

Query  316  KVAHLLTRETLFKSDCSVYFFIP  384
              AH L R        + +F  P
Sbjct  235  GAAHRLARYASHTGTMTTWFEEP  257



>gb|AES64036.2| hypothetical protein MTR_2g017550 [Medicago truncatula]
Length=164

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = +1

Query  4    LGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKW  183
            LG  K N+DAA     +   +G  LRD  GTFV AK +    L+     EA+G+  AL+W
Sbjct  92   LGRYKCNIDAAFSNQFQWTSIGVCLRDDSGTFVLAKTLQFHHLYLVVVGEALGLFHALRW  151

Query  184  IKDLQYDFIQLQ  219
             +D+ +D+IQ Q
Sbjct  152  PQDIHFDYIQRQ  163



>ref|XP_002465515.1| hypothetical protein SORBIDRAFT_01g040340 [Sorghum bicolor]
 gb|EER92513.1| hypothetical protein SORBIDRAFT_01g040340 [Sorghum bicolor]
Length=778

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 42/151 (28%), Positives = 70/151 (46%), Gaps = 18/151 (12%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G +K+NVDAAL   +RR+ +  + RD EG ++ A  +   G+ +P+  E +  RE L   
Sbjct  627  GQVKINVDAALSKNSRRIAVAAIARDCEGKYLGASGLVFEGITEPEIAEILACREGLDLA  686

Query  187  KDLQYDFIQLQLYSSFD---------------LIINDVKELAKDFLNINFLFAKRSANKV  321
             DL      L+L S  D                I+ ++ + A+ F  + F+   R  N  
Sbjct  687  SDLL--VTSLRLASDCDNAIRSLKGDGMGPYGQIVKEINDRARVFSAVEFVHENRQVNID  744

Query  322  AHLLTRE-TLFKSDCSVYFFIPFPSIV*YIS  411
            AH + R   L ++D  V+F  P   +  Y++
Sbjct  745  AHCIARSLVLAETDRHVWFVEPPCGVCNYVN  775



>ref|XP_003619023.1| hypothetical protein MTR_6g032980 [Medicago truncatula]
Length=131

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 59/129 (46%), Gaps = 7/129 (5%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
             LG  K NVDA+      ++G+G  +RD EG FV AK    +  F P  D  +G    L 
Sbjct  2    TLGRYKCNVDASFSNSLNKVGIGVCIRDEEGLFVLAK----TEWFAPIVDVDLGEAMGLL  57

Query  181  WIKDLQYDFIQLQLYSSFDLIINDVKE-LAKDFLNINFLFAKRSANKVAHLLTRETLFKS  357
             I D  Y        S+  +IIND +  LA D  N +  F +R AN   H L ++  F  
Sbjct  58   TIVDNVYG--GSNGVSNNMVIINDCRHMLATDLANSDLKFIRRQANDATHSLVKKAPFNH  115

Query  358  DCSVYFFIP  384
               +Y+ I 
Sbjct  116  SFHIYYNIS  124



>ref|XP_006493122.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X2 [Citrus sinensis]
Length=765

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/139 (27%), Positives = 67/139 (48%), Gaps = 15/139 (11%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P GW K+NVDAA+   N+R+GLG V+R++EG F+ A   P   + +    EA   R  L+
Sbjct  614  PAGWFKVNVDAAIKLENQRVGLGIVIRNSEGKFITAAIKPSKWIDRVDYAEAEATRFGLE  673

Query  181  WIKDLQ-------------YDFIQLQLYSSFDL--IINDVKELAKDFLNINFLFAKRSAN  315
              +                 D +  +  +  ++  I+++V++  K   ++    + R+ N
Sbjct  674  VAESAGCLPLIVETDSKEVTDLVSARKSTKAEIFWIVSEVQDTMKRLKHVKLQHSPRACN  733

Query  316  KVAHLLTRETLFKSDCSVY  372
              AH L +  L  +DC ++
Sbjct  734  GFAHTLAKLALDYTDCVIW  752



>gb|KDP24857.1| hypothetical protein JCGZ_24451 [Jatropha curcas]
Length=104

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P GW+K+NVDA+L      +G+G V+RD+   F+AA+   I  L   K  EAI +RE L 
Sbjct  33   PPGWIKINVDASLGGSGGFVGIGAVVRDSHAHFLAARTWGIPDLLDAKSAEAIAIREVLS  92

Query  181  WIKDLQY  201
            WIKD  Y
Sbjct  93   WIKDKVY  99



>ref|XP_006493121.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X1 [Citrus sinensis]
Length=968

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/139 (27%), Positives = 67/139 (48%), Gaps = 15/139 (11%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P GW K+NVDAA+   N+R+GLG V+R++EG F+ A   P   + +    EA   R  L+
Sbjct  817  PAGWFKVNVDAAIKLENQRVGLGIVIRNSEGKFITAAIKPSKWIDRVDYAEAEATRFGLE  876

Query  181  WIKDLQ-------------YDFIQLQLYSSFDL--IINDVKELAKDFLNINFLFAKRSAN  315
              +                 D +  +  +  ++  I+++V++  K   ++    + R+ N
Sbjct  877  VAESAGCLPLIVETDSKEVTDLVSARKSTKAEIFWIVSEVQDTMKRLKHVKLQHSPRACN  936

Query  316  KVAHLLTRETLFKSDCSVY  372
              AH L +  L  +DC ++
Sbjct  937  GFAHTLAKLALDYTDCVIW  955



>ref|XP_008337941.1| PREDICTED: uncharacterized protein LOC103401016 [Malus domestica]
Length=298

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 58/128 (45%), Gaps = 15/128 (12%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P G +K+N+D + + G    G G ++RD++G FVA +      +  P   EA+ ++  L 
Sbjct  167  PHGRIKMNIDGSWNVGRLIAGFGAIIRDSDGCFVATRTGSFKDICSPLLSEAMAMKVGLL  226

Query  181  WIKDLQYDFI-----QLQLYSSF-DLIIN---------DVKELAKDFLNINFLFAKRSAN  315
            W  D  Y F+      LQ+  +  DL +N         D K L       N  +  R+AN
Sbjct  227  WAIDRGYQFLIIETDSLQIVEALRDLTLNLSIIGQVVEDYKALLNTITEANITYIHRNAN  286

Query  316  KVAHLLTR  339
              AH L +
Sbjct  287  AAAHYLAK  294



>ref|XP_003624433.1| hypothetical protein MTR_7g083150 [Medicago truncatula]
Length=272

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 70/154 (45%), Gaps = 27/154 (18%)
 Frame = +1

Query  10   WLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKED-----EAIGVREA  174
            W K N+DA+      ++GLG  +R+  G F+ AK    +  F P  D     E IG+  A
Sbjct  119  WYKCNIDASFSPSLNKVGLGMCIRNDAGEFMLAK----TDWFAPLCDALMWGEVIGLYTA  174

Query  175  LKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKD-FLNINFLFAKR  306
            L+W+ DLQ+D +   L                S +  II+  + L ++ F N +  F +R
Sbjct  175  LQWVLDLQFDNVDFVLDSKTVVDHVNFDVDDNSEYGCIISICRRLLQNSFQNYHVEFNRR  234

Query  307  SANKVAHLLTRETLFKSDCSVYFFIPFPSIV*YI  408
              N +AH LT   +   + S Y     PS + +I
Sbjct  235  QVNGIAHKLTE--IVPLNHSSYIIDDAPSCIWHI  266



>ref|XP_003614263.1| hypothetical protein MTR_5g047250 [Medicago truncatula]
 gb|AES97221.1| hypothetical protein MTR_5g047250 [Medicago truncatula]
Length=108

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 52/105 (50%), Gaps = 11/105 (10%)
 Frame = +1

Query  73   VLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQLYSSFDLIIND  252
             LRD +GTFVAA  I         E EA  + + ++WI  L Y  +  +L         D
Sbjct  4    CLRDEKGTFVAALTIYCEAAMIIVEGEAWDLYQDIQWISSLGYHDVIFEL---------D  54

Query  253  VKELAKDFLNINFLFAKRSANKVAHLLTRETLFKSDCSVYFFIPF  387
             K +A D  NI  +F +R AN  AH+L++E L  +  S +  IPF
Sbjct  55   CKMVADDVHNI--VFTRRQANGSAHVLSQEALSHASRSTFDVIPF  97



>ref|XP_003609683.1| hypothetical protein MTR_4g120000 [Medicago truncatula]
Length=134

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 60/144 (42%), Gaps = 32/144 (22%)
 Frame = +1

Query  13   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKD  192
            +K N+D           +   LR   GTFV A+     G+      EA+G+   L+W+ D
Sbjct  1    MKCNIDVVFSTQRNHTDISICLRGEGGTFVLARATSFGGVHPIDIGEALGLHLDLQWVSD  60

Query  193  LQYDFI---------QLQLYSSFDLIINDVKE-----------LAKDFLNINFLFAKRSA  312
            LQ D I         Q  +YSS++    D+ E           L+  F+N    F +R A
Sbjct  61   LQLDNIDFEVDSKNTQEAIYSSWE----DISEFGNIITTFWVLLSSKFVNFRTEFVRRQA  116

Query  313  NKVAHLLTRETLFKSDCSVYFFIP  384
            N VA+L           ++YF IP
Sbjct  117  NAVAYLACP--------TIYFHIP  132



>ref|XP_003610669.1| hypothetical protein MTR_5g005740 [Medicago truncatula]
Length=261

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 55/117 (47%), Gaps = 16/117 (14%)
 Frame = +1

Query  58   MGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQL-----  222
            +G+G  +RD  GTFV AK++  S + +    EA+G+  AL W+ +L    +  +L     
Sbjct  2    VGIGMCIRDENGTFVLAKQVRFSPICEVHIGEALGLLAALDWVHNLSLGPVDFELDAKRV  61

Query  223  ----------YSSFDLIINDVKELAKDF-LNINFLFAKRSANKVAHLLTRETLFKSD  360
                       + F  II   K L  +F +N    F +R AN+VAH L +  L  + 
Sbjct  62   VDDFNSLNCDVTEFGNIIEHCKSLCSNFYVNSRVEFVRRQANEVAHNLAKAALLSAS  118



>ref|XP_008383144.1| PREDICTED: uncharacterized protein LOC103445866 [Malus domestica]
Length=256

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 57/126 (45%), Gaps = 16/126 (13%)
 Frame = +1

Query  10   WLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIK  189
            W++ N DAA D      G+G V+R+ +G F+    + + G+  P   E +  REAL + +
Sbjct  114  WIQSNFDAAWDAQLEIGGVGVVIRNNKGEFMVIVAMRVEGVGSPLLVEIMAAREALIFSQ  173

Query  190  DLQYDFIQ----------------LQLYSSFDLIINDVKELAKDFLNINFLFAKRSANKV  321
              Q   ++                L   S F  II +++++  DF      F +RS NKV
Sbjct  174  HQQTTHVEVEGDALMVSTTLQHEGLNDSSPFGHIITNIRQILNDFSQCKVTFGRRSTNKV  233

Query  322  AHLLTR  339
             H L R
Sbjct  234  VHRLAR  239



>ref|XP_003623678.1| hypothetical protein MTR_7g074420 [Medicago truncatula]
Length=245

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 56/140 (40%), Gaps = 20/140 (14%)
 Frame = +1

Query  4    LGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKW  183
            LG  K N+D A  Y + R G+       EG FV AK +    +      EA  V   L+W
Sbjct  96   LGRYKCNIDDAFSYSHNRTGIDIY----EGIFVLAKAVSFPCVSPVDVGEAFEVHNTLQW  151

Query  184  IKDLQYDFIQLQL---------------YSSFDLIINDVKELAKD-FLNINFLFAKRSAN  315
            + D+Q+D I  ++                S F  II   + L    F N    FA R AN
Sbjct  152  LSDMQFDNIDFEVDSNITLDAFHSTCDNISEFRCIIASCRSLFNSYFTNSRVEFAMRQAN  211

Query  316  KVAHLLTRETLFKSDCSVYF  375
               H L  E  F    +VYF
Sbjct  212  VATHTLVGEATFLVFPTVYF  231



>ref|XP_003596821.1| hypothetical protein MTR_2g086490 [Medicago truncatula]
Length=138

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 55/125 (44%), Gaps = 16/125 (13%)
 Frame = +1

Query  58   MGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQL-----  222
            +G+G  + D +G F  AK    S L   +  EA+G+   L+W+ DL YD +   L     
Sbjct  2    VGIGICIHDDQGEFFMAKTDCFSPLCVVEVSEAVGLHMTLQWVADLHYDNVDFVLDSKSV  61

Query  223  ----------YSSFDLIINDVKEL-AKDFLNINFLFAKRSANKVAHLLTRETLFKSDCSV  369
                       S    II+  ++L    F N +  F +R AN+VAH L R     +   V
Sbjct  62   VERFNSNLGDSSELGCIIHTCRQLFDCHFQNSHVEFNRRQANEVAHELARVAPSHASSHV  121

Query  370  YFFIP  384
            Y  +P
Sbjct  122  YGDVP  126



>gb|AAU89136.1| F-box domain containing protein [Oryza sativa Japonica Group]
Length=855

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 68/139 (49%), Gaps = 16/139 (12%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P G   +N DAA+   +R MG+G ++RD  G  + A    IS +  P+  EA+ +R AL 
Sbjct  701  PAGVWMINSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAIRRALG  760

Query  181  WIKD--LQYDFI---------QLQLY----SSFDLIINDVKELAKDFLNINFLFAKRSAN  315
              K+  LQ+  +         ++Q      S    +I D+K+LA  F+  +F+   R +N
Sbjct  761  LAKEEGLQHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVNRLSN  820

Query  316  KVAHLLTRETLFKSDCSVY  372
              AH L R     S C+VY
Sbjct  821  LAAHSLARNAEL-STCTVY  838



>gb|EEC72753.1| hypothetical protein OsI_06384 [Oryza sativa Indica Group]
Length=556

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 38/139 (27%), Positives = 64/139 (46%), Gaps = 16/139 (12%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P G   +N DAA+    R+MG+G V+RD  G  + A      G+  P+  EA  +R AL 
Sbjct  402  PAGVFLINTDAAVFQAERQMGVGVVIRDQHGNCLLAANTRFMGITDPETAEACAIRHALW  461

Query  181  WIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFAKRSAN  315
              K+  +  + +                  S    ++ D+K+L  +F++++F+     +N
Sbjct  462  LAKEEGFHNVIVACDCLSVIQKLNSPGRDRSKIGCLVEDIKKLGVEFISVSFIHVSHCSN  521

Query  316  KVAHLLTRETLFKSDCSVY  372
              AH L R +   S C+VY
Sbjct  522  VAAHTLARCSE-PSVCNVY  539



>gb|KHN31589.1| hypothetical protein glysoja_043032, partial [Glycine soja]
Length=155

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 60/128 (47%), Gaps = 20/128 (16%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
             ++K NVDAAL   + + G    +R++EG F++A      G+ KP+E E+  V   L+WI
Sbjct  20   NFMKCNVDAALFQEDNKFGFAACIRNSEGVFISAISW-FQGIPKPQEAESYAVLSTLQWI  78

Query  187  KDLQYDFIQLQLYSSFDLIINDVKE--------------LAKDFLNIN---FLFAKRSAN  315
             DLQ   + ++  +    I + +                 AK   N++     F  R AN
Sbjct  79   SDLQLTNVIIE--TDCKAIPHAIHSKRFHELEAGRILCICAKKICNLHNCRIQFVSREAN  136

Query  316  KVAHLLTR  339
            +V H LTR
Sbjct  137  QVTHNLTR  144



>gb|EEC75888.1| hypothetical protein OsI_12930 [Oryza sativa Indica Group]
Length=834

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 68/139 (49%), Gaps = 16/139 (12%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P G   +N DAA+   +R MG+G ++RD  G  + A    IS +  P+  EA+ +R AL 
Sbjct  680  PAGVWMINSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAIRRALG  739

Query  181  WIKD--LQYDFI---------QLQLY----SSFDLIINDVKELAKDFLNINFLFAKRSAN  315
              K+  LQ+  +         ++Q      S    +I D+K+LA  F+  +F+   R +N
Sbjct  740  LAKEEGLQHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVNRLSN  799

Query  316  KVAHLLTRETLFKSDCSVY  372
              AH L R     S C+VY
Sbjct  800  LAAHSLARNAEL-STCTVY  817



>ref|XP_007203380.1| hypothetical protein PRUPE_ppa025995mg [Prunus persica]
 gb|EMJ04579.1| hypothetical protein PRUPE_ppa025995mg [Prunus persica]
Length=209

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 67/140 (48%), Gaps = 15/140 (11%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P G LKLNVD A      +  LG V+R+  G  + A  +PI+  F  K  E + +RE L+
Sbjct  49   PPGKLKLNVDGACSTSVWKRELGAVVRNVHGDLMGAISVPITRCFSAKIIELLAIREGLQ  108

Query  181  WIKDLQYDFIQLQL------------YSSFDL---IINDVKELAKDFLNINFLFAKRSAN  315
            +  +  Y+ + ++L              +F +   IIN++  L+++F  ++F+FA R  N
Sbjct  109  FAWEDGYNSLVVELDAKNAINDIVSGTEAFRVAGGIINNIHMLSRNFDFLSFVFAPRLCN  168

Query  316  KVAHLLTRETLFKSDCSVYF  375
             V   L +  L      V+ 
Sbjct  169  TVVERLAKFALGSVSIDVWL  188



>ref|XP_002510892.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51494.1| conserved hypothetical protein [Ricinus communis]
Length=192

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 58/111 (52%), Gaps = 17/111 (15%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFV-AAKEIPISGLFKPKEDEAIGVREAL  177
            PLG  K+  DAA+   + ++GLG ++RD  G F+ AAK   +     P   EA+  RE L
Sbjct  45   PLGPCKMRCDAAVFVESNKLGLGCIIRDDSGRFIAAAKHNSMRVRLIPSIAEALSCREGL  104

Query  178  KWIKDL--QYDFI-----QLQLY---------SSFDLIINDVKELAKDFLN  282
             W+K L  Q++ I     Q+ ++         S F L+++D   +AKD ++
Sbjct  105  SWLKSLLGQHNVIVDSDSQVLIHAINNSRSDLSEFGLVVDDCISIAKDIVS  155



>ref|XP_010696211.1| PREDICTED: uncharacterized protein LOC104908759 [Beta vulgaris 
subsp. vulgaris]
Length=338

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 68/148 (46%), Gaps = 16/148 (11%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P    KLN DAA+ + N R+GLG V+RD  G  + A  + + G+      EA+  R  ++
Sbjct  183  PSALYKLNTDAAM-FKNNRIGLGGVVRDQAGDMLMATCVVVDGVEDVDVAEALSARHGIQ  241

Query  181  WIKD-------LQYDFIQLQLY--------SSFDLIINDVKELAKDFLNINFLFAKRSAN  315
               D       ++ D ++L  Y        S F  I+ D+   A    NI F   +RS N
Sbjct  242  TAVDAGLRQLIMEVDCLKLFNYLRDGRRESSPFGFIVQDILCAAGLCSNIRFAHVRRSGN  301

Query  316  KVAHLLTRETLFKSDCSVYFFIPFPSIV  399
            KVAH L + +    DC V+     P IV
Sbjct  302  KVAHNLAKLSFSIVDCRVWLEEVPPEIV  329



>gb|KHN38789.1| hypothetical protein glysoja_047929, partial [Glycine soja]
Length=187

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 38/66 (58%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            PLG LK NVDA++       G+G  L D  GTFV A+      + KP E EA  ++++L+
Sbjct  86   PLGSLKCNVDASIFKEEPSFGIGMCLHDDNGTFVKARTASSMSIPKPDEAEAFALKKSLE  145

Query  181  WIKDLQ  198
            WI+ L 
Sbjct  146  WIQSLH  151



>ref|XP_006378610.1| hypothetical protein POPTR_0010s18040g, partial [Populus trichocarpa]
 gb|ERP56407.1| hypothetical protein POPTR_0010s18040g, partial [Populus trichocarpa]
Length=146

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 58/120 (48%), Gaps = 6/120 (5%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P+G+LK N D  +      MG GFV+R+ EG  V      I G F P   EA+ ++  L+
Sbjct  13   PVGFLKCNTDVGILDQGAAMGAGFVIRNNEGAVVYCGCWEIIGFFSPTLAEALCLKNVLQ  72

Query  181  WI--KDLQYDFIQLQ----LYSSFDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTRE  342
            ++  + L    I+L     + S   +I  D + L     + N    + SAN VAH L+++
Sbjct  73   FMISQGLSNFLIELDAKIVVDSGTGMIFEDCRGLINRGSSFNLCNVRISANVVAHCLSKK  132



>gb|ABD28554.2| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=118

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 39/71 (55%), Gaps = 0/71 (0%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G  K N+DA      +R G+   +RD++ TFV AK +    +      EA+G+  AL+W+
Sbjct  38   GRYKCNIDATFSSRFKRTGIDICVRDSDSTFVLAKTVTYPCIVSVDVGEALGLHSALQWL  97

Query  187  KDLQYDFIQLQ  219
             D+Q+D +  +
Sbjct  98   SDMQFDSVDFE  108



>ref|XP_010236322.1| PREDICTED: uncharacterized protein LOC104583970 [Brachypodium 
distachyon]
Length=284

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 63/143 (44%), Gaps = 13/143 (9%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P+   K+NVDAA+        +  V RD +G F+ A    I+G+  P   E +  REAL 
Sbjct  131  PVDHAKINVDAAVAKQVCAGAITAVCRDMDGRFLGASAQVIAGINDPGTLETLACREALS  190

Query  181  WIKDLQYDFIQLQL-------------YSSFDLIINDVKELAKDFLNINFLFAKRSANKV  321
              +DLQ   +++                  F L++ ++K     F ++ F+   R++N  
Sbjct  191  LAEDLQLAHLRVASDCLEVIMALMGDNLGRFALVLQEIKRCYPRFASVEFVHEGRASNME  250

Query  322  AHLLTRETLFKSDCSVYFFIPFP  390
            AH L R +  + +    + +  P
Sbjct  251  AHTLARASTSRQEGRYIWLVESP  273



>ref|XP_003623409.1| hypothetical protein MTR_7g070460 [Medicago truncatula]
Length=163

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 54/122 (44%), Gaps = 16/122 (13%)
 Frame = +1

Query  67   GFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQL--------  222
            G   ++  GTFV AK      +      EA+G+  +L+W+ D+Q+D +   +        
Sbjct  30   GVTKKEGIGTFVLAKAFSYLCIVPVDVGEALGLHSSLQWLSDMQFDNVDFDINSKVTADA  89

Query  223  -------YSSFDLIINDVKELAKD-FLNINFLFAKRSANKVAHLLTRETLFKSDCSVYFF  378
                    S F  II+  + L  + F N    F +R  N V H LTRET   +  + YF 
Sbjct  90   LLASRNDLSKFGCIISSCRSLFSNLFSNSRVEFVRRQVNAVTHALTRETTSLTSPAGYFD  149

Query  379  IP  384
            IP
Sbjct  150  IP  151



>gb|EEE59647.1| hypothetical protein OsJ_12023 [Oryza sativa Japonica Group]
Length=1145

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 68/139 (49%), Gaps = 16/139 (12%)
 Frame = +1

Query  1     PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
             P G   +N DAA+   +R MG+G ++RD  G  + A    IS +  P+  EA+ +R AL 
Sbjct  991   PAGVWMINSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAIRRALG  1050

Query  181   WIKD--LQYDFI---------QLQLY----SSFDLIINDVKELAKDFLNINFLFAKRSAN  315
               K+  LQ+  +         ++Q      S    +I D+K+LA  F+  +F+   R +N
Sbjct  1051  LAKEEGLQHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVNRLSN  1110

Query  316   KVAHLLTRETLFKSDCSVY  372
               AH L R     S C+VY
Sbjct  1111  LAAHSLARNAEL-STCTVY  1128



>ref|XP_003616829.1| hypothetical protein MTR_5g084710 [Medicago truncatula]
Length=123

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (49%), Gaps = 4/121 (3%)
 Frame = +1

Query  13   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKD  192
            +K N+DA+  +     G+   + D +G FV AK + +S L      EA+G+    +W+ D
Sbjct  1    MKCNIDASFSHVWNCTGISVCVYD-DGAFVLAKIMSLSTLCPVSMGEALGLFYGPEWLSD  59

Query  193  LQYDFIQLQLYSSFDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTRETLFKSDCSVY  372
            +  D ++ Q     ++++   +     F N    F KR AN+VAH L  E    +  ++Y
Sbjct  60   MHMDNVERQ---RSNILLECKRLFNSKFTNSRVKFNKRQANEVAHALAGEPALSASRTIY  116

Query  373  F  375
            F
Sbjct  117  F  117



>ref|XP_003605496.1| hypothetical protein MTR_4g032310 [Medicago truncatula]
Length=283

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/141 (28%), Positives = 64/141 (45%), Gaps = 16/141 (11%)
 Frame = +1

Query  13   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKD  192
            LK NVD +       +G GF +R+  G  + AK +  + +F     EA+G+  A++W+ +
Sbjct  132  LKCNVDVSFSEALNCVGFGFCIRNEFGNLIKAKTMWSNPVFASDVGEALGLSNAIRWVHE  191

Query  193  LQYDFIQLQLYSS-----FDLIINDVKELAK-----------DFLNINFLFAKRSANKVA  324
            LQ   I  +L +      F+   ND+ E               F N    F++R AN+VA
Sbjct  192  LQLLNINFELDAKKVVDYFNNGSNDISEFGSIVEECRRSHNFYFANSKVEFSRRQANEVA  251

Query  325  HLLTRETLFKSDCSVYFFIPF  387
            H L +E    +    +  +PF
Sbjct  252  HTLAQEATSLASPHNFNDVPF  272



>ref|XP_003593670.1| hypothetical protein MTR_2g014850 [Medicago truncatula]
Length=114

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 51/105 (49%), Gaps = 3/105 (3%)
 Frame = +1

Query  70   FVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQLYSSFDLIIN  249
              +RD    F+ A      G   P+E EA+G+R+A+  +  + YD    Q  + F  II+
Sbjct  1    MCIRDQRSRFIKAATTWYEGCPPPQEAEAVGLRDAILCVDSI-YDKNNNQ--AEFGSIID  57

Query  250  DVKELAKDFLNINFLFAKRSANKVAHLLTRETLFKSDCSVYFFIP  384
            D + L + F N    F +R  N VAH   R ++ ++   V+  IP
Sbjct  58   DCRSLLQKFTNFKISFVRRQVNVVAHSFARVSILQARHQVFDLIP  102



>ref|XP_006593242.1| PREDICTED: uncharacterized protein LOC102666191 [Glycine max]
Length=192

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 60/128 (47%), Gaps = 20/128 (16%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
             ++K NVDAAL   + + G    +R++EG F++A      G+ KP+E E+  V   L+WI
Sbjct  41   NFMKCNVDAALFQEDNKFGFAACIRNSEGVFISAISW-FQGIPKPQEAESYAVLSTLQWI  99

Query  187  KDLQYDFIQLQLYSSFDLIINDVKE--------------LAKDFLNIN---FLFAKRSAN  315
             DLQ   + ++  +    I + +                 AK   N++     F  R AN
Sbjct  100  SDLQLTNVIIE--TDCKAIPHAIHSKRFHELEAGRILCICAKKICNLHNCRIQFVSREAN  157

Query  316  KVAHLLTR  339
            +V H LTR
Sbjct  158  QVTHNLTR  165



>ref|XP_003589048.1| hypothetical protein MTR_1g017840 [Medicago truncatula]
 gb|AES59299.1| hypothetical protein MTR_1g017840 [Medicago truncatula]
Length=162

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G LK N+DA       R  +G  +RD + TFV AK I ++ +      EA+G+  AL+W+
Sbjct  63   GRLKCNMDAGFSVATNRTDIGICVRDDDCTFVLAKTISLNVVHSVDVGEAMGLYHALEWL  122

Query  187  KDLQYDFIQLQLYS  228
             ++Q+D +   + S
Sbjct  123  SNMQFDNVDFAMDS  136



>ref|XP_003594782.1| hypothetical protein MTR_2g034570 [Medicago truncatula]
Length=157

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 35/126 (28%), Positives = 55/126 (44%), Gaps = 21/126 (17%)
 Frame = +1

Query  13   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKD  192
            LK NVDA+      R+G GF +RD                   K   A+GV  A++W+++
Sbjct  40   LKCNVDASFSDALNRVGFGFCIRD------------------EKVGGALGVSHAIRWVRE  81

Query  193  LQYDFIQLQLYSSFDLIINDVKE-LAKDFLNINFLFAKRSANKVAHLLTRETLFKSDCSV  369
            LQ   +  +L   F  I+ + +      F N    F++R A +VAH L R   F +   +
Sbjct  82   LQLTNVDFEL--DFGAIVEECRRNCVTYFENSKVEFSQRQATEVAHTLARNVTFLTSPQI  139

Query  370  YFFIPF  387
            +   P 
Sbjct  140  FNVAPL  145



>ref|NP_194638.1| ribonuclease H-like protein [Arabidopsis thaliana]
 emb|CAB43923.1| putative protein [Arabidopsis thaliana]
 emb|CAB79667.1| putative protein [Arabidopsis thaliana]
 gb|AAY78807.1| putative reverse transcriptase/RNA-dependent DNA polymerase [Arabidopsis 
thaliana]
 gb|AEE85585.1| ribonuclease H-like protein [Arabidopsis thaliana]
Length=575

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 39/146 (27%), Positives = 67/146 (46%), Gaps = 20/146 (14%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEG--TFVAAKEIPISGLFKPKEDEAIGVREA  174
            P  W+K N DA  +  N R G+G+VLR+ +G   ++ A+ +P   L    E E   +R A
Sbjct  424  PHQWVKCNTDATWNRDNERCGIGWVLRNEKGEVKWMGARALP--KLKSVLEAELEAMRWA  481

Query  175  LKWIKDLQYDFIQL--------------QLYSSFDLIINDVKELAKDFLNINFLFAKRSA  312
            +  +   QY+++                +++ S    I D++ L   F  + F+F  R  
Sbjct  482  VLSLSRFQYNYVIFESDSQVLIEILNNDEIWPSLKPTIQDLQRLLSQFTEVKFVFIPREG  541

Query  313  NKVAHLLTRETL--FKSDCSVYFFIP  384
            N +A  + RE+L     D  +Y  +P
Sbjct  542  NTLAERVARESLSFLNYDPKLYSIVP  567



>ref|XP_010679712.1| PREDICTED: uncharacterized protein LOC104895014 [Beta vulgaris 
subsp. vulgaris]
Length=197

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 68/143 (48%), Gaps = 17/143 (12%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G  K+N DAA+ Y +  +GLG V+RDA G  + A  + +    +  E EA   R ALK  
Sbjct  41   GHYKVNSDAAI-YKDCTVGLGGVMRDANGDIMGATSMHLKLDMEVHEAEACAARHALKIA  99

Query  187  KD-------LQYDFIQLQLY--------SSFDLIINDVKELAKDFLNINFLFAKRSANKV  321
             +       L+ D ++L  +        +SF  I+ D+  L     +I+F   +R  N+V
Sbjct  100  MEAGFRNIVLESDCLKLISHLKRKKRDDTSFGNIVEDILWLGNCCSSISFSHVRREGNRV  159

Query  322  AHLLTRETLFKSDCSVYFFIPFP  390
            AH+L + +  + DC   +    P
Sbjct  160  AHILAQRSK-EYDCMRVWLEEVP  181



>ref|XP_006285982.1| hypothetical protein CARUB_v10007509mg, partial [Capsella rubella]
 gb|EOA18880.1| hypothetical protein CARUB_v10007509mg, partial [Capsella rubella]
Length=172

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 60/130 (46%), Gaps = 13/130 (10%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK--  180
            GW+K N DA+   GNR  GLG+++R++ G F+        G   P E E   +  A++  
Sbjct  20   GWVKCNYDASHHEGNRDSGLGWIIRNSTGIFLHGGMGRFQGRATPAEAECTALLWAIQAT  79

Query  181  WIK-----DLQYDFIQL-QLYSSFDLI-----INDVKELAKDFLNINFLFAKRSANKVAH  327
            W       D + D + + QL  S +       +N +++    F +I F F  R  N  A 
Sbjct  80   WANGYRRIDFEGDNLTITQLLQSREATPRLHYLNTIQQWRSMFTDIRFSFRHREQNSCAD  139

Query  328  LLTRETLFKS  357
            +L ++ L  S
Sbjct  140  ILAKQALNNS  149



>gb|AAG13524.1|AC068924_29 putative non-LTR retroelement reverse transcriptase [Oryza sativa 
Japonica Group]
Length=1382

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 65/136 (48%), Gaps = 17/136 (13%)
 Frame = +1

Query  10    WLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIK  189
             W+ +N DAA+   +R MG+G ++RD  G  + A    IS +  P+  EA+ +R AL   K
Sbjct  1232  WM-INSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAIRRALGLAK  1290

Query  190   DLQYDFIQL---------------QLYSSFDLIINDVKELAKDFLNINFLFAKRSANKVA  324
             +   + I +               +  S    +I D+K+LA  F+  +F+   R +N  A
Sbjct  1291  EEGLEHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVNRLSNLAA  1350

Query  325   HLLTRETLFKSDCSVY  372
             H L R     S C+VY
Sbjct  1351  HSLARNAEL-STCTVY  1365



>ref|XP_010513219.1| PREDICTED: uncharacterized protein LOC104789182 [Camelina sativa]
Length=1754

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 36/130 (28%), Positives = 61/130 (47%), Gaps = 14/130 (11%)
 Frame = +1

Query  1     PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
             P+GW+K NVD A    + + G+G+VLRD +   +      +  + KP + E  G+R A+ 
Sbjct  1599  PMGWVKCNVDGAWRSDSEQCGIGWVLRDEQKKVIWLGARALPRVNKPLDVEVEGLRWAML  1658

Query  181   WIKDLQYDFIQLQLYSSFDL--------------IINDVKELAKDFLNINFLFAKRSANK  318
              +  +QY  +  +  S   L              II D+ +L++ F  +  +F  R  N 
Sbjct  1659  SLARIQYPKVIFETDSQLVLSLIKGNTESNHYAPIIQDINQLSQRFEKVKMVFTYREGNG  1718

Query  319   VAHLLTRETL  348
             VA  + +E L
Sbjct  1719  VADRVAKEAL  1728



>ref|XP_008367209.1| PREDICTED: uncharacterized protein LOC103430850 [Malus domestica]
Length=174

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/138 (28%), Positives = 60/138 (43%), Gaps = 17/138 (12%)
 Frame = +1

Query  13   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKD  192
            +K N D A D      G G V+R++EG F+AAK I   G+      EA   R  + +++ 
Sbjct  33   IKCNFDGAWDEKGSVGGFGIVVRNSEGGFMAAKAIKEEGVRSTLHAEAADARAVMLFLRK  92

Query  193  LQYDFIQL----------------QLYSSFDLIINDVKELAKDFLNINFLFAKRSANKVA  324
               + +Q+                 L   +  +  D ++L + F      F +R  NKV 
Sbjct  93   WGTERVQVAGDALLVTSAIQNAGAALSGHYGQLFEDTRQLLQGFKQWKVTFGRRETNKVV  152

Query  325  HLLTRETLFKSDCSVYFF  378
            H L R +L   D SV++F
Sbjct  153  HRLARFSL-TIDHSVFWF  169



>gb|AAP54617.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|EAZ16681.1| hypothetical protein OsJ_32156 [Oryza sativa Japonica Group]
Length=1339

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 65/136 (48%), Gaps = 17/136 (13%)
 Frame = +1

Query  10    WLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIK  189
             W+ +N DAA+   +R MG+G ++RD  G  + A    IS +  P+  EA+ +R AL   K
Sbjct  1189  WM-INSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAIRRALGLAK  1247

Query  190   DLQYDFIQL---------------QLYSSFDLIINDVKELAKDFLNINFLFAKRSANKVA  324
             +   + I +               +  S    +I D+K+LA  F+  +F+   R +N  A
Sbjct  1248  EEGLEHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVNRLSNLAA  1307

Query  325   HLLTRETLFKSDCSVY  372
             H L R     S C+VY
Sbjct  1308  HSLARNAEL-STCTVY  1322



>ref|XP_010667872.1| PREDICTED: uncharacterized protein LOC104884867 [Beta vulgaris 
subsp. vulgaris]
Length=183

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 59/126 (47%), Gaps = 16/126 (13%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G  KLN DAAL  GN+ +G+G V+RD +G  V A      G       EA+  R+ ++  
Sbjct  29   GIYKLNTDAALLPGNQ-VGIGGVVRDHDGEVVVALCCREQGGSDVAVAEALSARKGIQVA  87

Query  187  K-----------DLQYDFIQLQ----LYSSFDLIINDVKELAKDFLNINFLFAKRSANKV  321
                        D Q  F  L+      S F  I+ND++ +A +   + F   +RS NKV
Sbjct  88   MQAGFSRLMVEVDCQQLFFHLKERRSTASPFGKIVNDIQVMASNCQQVVFSHVRRSGNKV  147

Query  322  AHLLTR  339
            AH L +
Sbjct  148  AHCLAQ  153



>emb|CDP14369.1| unnamed protein product [Coffea canephora]
Length=347

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/126 (28%), Positives = 57/126 (45%), Gaps = 14/126 (11%)
 Frame = +1

Query  4    LGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKW  183
            +GW+K+N DAA+     R G G + RD  G  + A  +P +     K++EA+ +R A+  
Sbjct  187  VGWVKINSDAAVQQKAERAGWGMIARDCLGNALGAWAVPDTCCSSAKQEEALALRSAMLM  246

Query  184  IKDLQYDFIQL-----QLYSSFD---------LIINDVKELAKDFLNINFLFAKRSANKV  321
             K   +  +       QL  S +          I+ D+  L  +F    F F +R  N V
Sbjct  247  AKQQGWRRVVFESDCKQLIDSINSGDGDSDIATILLDIVSLKSNFYKCCFSFTRRMNNSV  306

Query  322  AHLLTR  339
            +H L +
Sbjct  307  SHSLAK  312



>ref|XP_010667851.1| PREDICTED: uncharacterized protein LOC104884846 [Beta vulgaris 
subsp. vulgaris]
Length=179

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 66/130 (51%), Gaps = 19/130 (15%)
 Frame = +1

Query  1    PLGWL-KLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREAL  177
            P+G + KLN DA++   ++ +G+G V RD+EG  + A    + G+   +  EA+  R  L
Sbjct  22   PIGDVYKLNTDASM-VKDKGIGMGGVDRDSEGDVMMATCCGMMGIANVELAEALSARHGL  80

Query  178  KW--------------IKDLQYDFIQLQLY--SSFDLIINDVKELAKDFLNINFLFAKRS  309
            +                K L ++++Q ++Y  S F  I+ D+ E A     I+F   KR 
Sbjct  81   QLSVEAGLRSLIMEVDCKKL-FNYMQARIYEMSPFGKIVADILEYASQCTFISFAHVKRQ  139

Query  310  ANKVAHLLTR  339
             NKVAHLL +
Sbjct  140  GNKVAHLLAQ  149



>ref|XP_002531371.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31019.1| conserved hypothetical protein [Ricinus communis]
Length=143

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = +1

Query  4    LGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
             GWLK+N DA     + + G G V R  +G+FV A  I  SGLF  +  E +GVREAL 
Sbjct  85   FGWLKVNADAVSFLASAKTGFGMVARRDDGSFVVAHTISTSGLFSSRMMEIMGVREALS  143



>ref|XP_010689379.1| PREDICTED: uncharacterized protein LOC104903088 [Beta vulgaris 
subsp. vulgaris]
Length=259

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 63/127 (50%), Gaps = 16/127 (13%)
 Frame = +1

Query  4    LGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKW  183
             G  K+N DAA+   + ++GLG V+RD  G  +AA    + G  +  E EA+  R A   
Sbjct  102  FGLYKINSDAAVSE-DGKVGLGGVMRDDVGDVIAAVCEEVRGRVEVSEAEAMAARLAFST  160

Query  184  IKD-------LQYDFIQL--QL------YSSFDLIINDVKELAKDFLNINFLFAKRSANK  318
              D       L+ D ++L  QL       +SF  I  D++ELAK + NI+F F  R  NK
Sbjct  161  AIDVGLRDIILESDCLKLITQLKNGTEDQTSFGFITRDIQELAKLYRNISFEFVSREGNK  220

Query  319  VAHLLTR  339
            VA  L  
Sbjct  221  VAQKLAH  227



>ref|XP_003599939.1| hypothetical protein MTR_3g049310 [Medicago truncatula]
Length=155

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 57/141 (40%), Gaps = 15/141 (11%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G  K N+DAA     +   +G  +RD +GTFV AK      L+     E +G+   L+W+
Sbjct  3    GRYKCNIDAACSSHFKWTDIGICVRDFQGTFVLAKVASYHCLYSVDVGEVLGLHSTLEWL  62

Query  187  KDLQYDFIQLQLYSSFD---------------LIINDVKELAKDFLNINFLFAKRSANKV  321
             D+Q+D +  +  S                  L I+ V         + +       N +
Sbjct  63   SDMQFDNVDFETDSKMTSDDMLLRTTILYFVVLFIHVVPYSNLSLPTLGWSLLGDKPNGI  122

Query  322  AHLLTRETLFKSDCSVYFFIP  384
            AH L  E    ++  VYF IP
Sbjct  123  AHALAGEATLLANSVVYFDIP  143



>gb|KHN34964.1| hypothetical protein glysoja_004730, partial [Glycine soja]
Length=131

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 50/122 (41%), Gaps = 15/122 (12%)
 Frame = +1

Query  61   GLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDL-------------QY  201
            G+G  LRD    +V A    +SG   P E EA  +   + WIK L               
Sbjct  6    GVGMGLRDCNRNYVKAMTSIVSGTPTPNEVEACALHSTIIWIKRLGLSNVVIETDCKTPV  65

Query  202  DFIQLQLYSSFD--LIINDVKELAKDFLNINFLFAKRSANKVAHLLTRETLFKSDCSVYF  375
            D  Q    +S D  +I N  ++L     N    F KR  N V H LTR + F  +  V+ 
Sbjct  66   DCFQADTKNSIDFHVIFNSCRDLLSPISNFRVSFVKRHVNHVTHNLTRTSRFYVNFHVFD  125

Query  376  FI  381
            +I
Sbjct  126  YI  127



>ref|XP_009137097.1| PREDICTED: uncharacterized protein LOC103861143 [Brassica rapa]
Length=154

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 63/139 (45%), Gaps = 15/139 (11%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDE---------  153
            PLGW+K NVD +     +    G+V+RD+ GT+  A +   + +    E E         
Sbjct  9    PLGWVKCNVDGSFSAQQQTSTAGWVIRDSNGTYKGAGQANGNHVNNALESEIQALIVAMQ  68

Query  154  -AIGVREALKWIKDLQYDFIQLQLYSSFDLIINDVKELAKDFLNINFLFAKRSANKVAHL  330
                 R   K IK L  + +    Y+     I +V    + F +I+F++  R  N+VA  
Sbjct  69   NCWSKRYCSKMIKILNNEVLHFTGYN----WIREVNWWKQKFEDISFMWIGRDGNQVADG  124

Query  331  LTRETLFKSDCSVYFFIPF  387
            L +  +  ++ S YFFI F
Sbjct  125  LAKNEI-PNNVSFYFFILF  142



>ref|XP_002515720.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46667.1| conserved hypothetical protein [Ricinus communis]
Length=156

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            GW+K ++DAA     R +G+G +  D EG FV  K   ++G    KE EA+G++EAL W 
Sbjct  42   GWVKCDMDAATFENGRVIGIGLMSMDEEGRFVKGKSFCMNGRIAIKEAEAMGLKEALSWC  101



>dbj|BAF36334.1| hypothetical protein [Ipomoea trifida]
Length=162

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEI  117
            P  W+KL VD ALD+ N +MG GFVLR++ GTF+AAK++
Sbjct  116  PERWIKLTVDVALDFYNSKMGFGFVLRNSNGTFMAAKKV  154



>ref|XP_007214838.1| hypothetical protein PRUPE_ppa018217mg, partial [Prunus persica]
 gb|EMJ16037.1| hypothetical protein PRUPE_ppa018217mg, partial [Prunus persica]
Length=320

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 60/143 (42%), Gaps = 19/143 (13%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G LK+N+D +   GN   G+G V+RD+ G FVA + + +  +F   + EA   RE    I
Sbjct  152  GGLKINLDGSWTAGNTYGGVGIVVRDSNGRFVAGRALRVDNVFSALQVEASAAREGA--I  209

Query  187  KDLQYDFI-------QLQLYSSF----------DLIINDVKELAKDFLNINFLFAKRSAN  315
              ++ DF         LQ+ S+             ++ D K L        F   +R AN
Sbjct  210  LAVERDFNNVIFESDSLQILSAIRSSSVDRSNVGQVVEDTKALLTQITGDGFTHIRRVAN  269

Query  316  KVAHLLTRETLFKSDCSVYFFIP  384
              AH L R        + +F  P
Sbjct  270  GAAHRLARYASHLGTTTTWFEEP  292



>ref|XP_006603254.1| PREDICTED: uncharacterized protein LOC102660201 [Glycine max]
Length=214

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/128 (26%), Positives = 60/128 (47%), Gaps = 15/128 (12%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G++K N+D A     +  G G  ++D +G FV A      G+ +  E EA+ + + L W+
Sbjct  76   GFVKCNIDVAYFQEQQWWGKGMCIQDDKGWFVRATMNIRHGMPEVHEGEALVLLQTLTWL  135

Query  187  KDLQYDFIQLQLY---------------SSFDLIINDVKELAKDFLNINFLFAKRSANKV  321
            K++ Y +++++                 S F +I+N  K +   F N      ++ AN +
Sbjct  136  KNMDYQYVEVESDCKRLTDSLDRNIMDDSEFGMILNKCKRILMSFPNHKVSLIRKQANCI  195

Query  322  AHLLTRET  345
            AH L R +
Sbjct  196  AHSLARAS  203



>ref|XP_003636511.1| hypothetical protein MTR_043s0014 [Medicago truncatula]
Length=132

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 56/130 (43%), Gaps = 20/130 (15%)
 Frame = +1

Query  70   FVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQL---------  222
              +R+A+G F  A          P E EA+G+++ + W+ +L    +Q++L         
Sbjct  1    MCIRNAQGHFFKALTKWFDYYPTPLEAEALGLKDTIVWLGELGLSMVQIELDCKLVVDSI  60

Query  223  ------YSSFDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTRETLFKSDCSVYFFIP  384
                   S F  II+  + L   F N    F +R AN VAH LTR     +   +Y  IP
Sbjct  61   MENSNNQSDFGNIISSCRSLLNQFRNFKISFVRRQANYVAHTLTRALKLDACHHIYDLIP  120

Query  385  FPSIV*YISS  414
                  YISS
Sbjct  121  S-----YISS  125



>emb|CCA66036.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1369

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 44/128 (34%), Positives = 65/128 (51%), Gaps = 16/128 (13%)
 Frame = +1

Query  1     PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
             P+G +KLNVDAA+ + +  +G+G V+RDAEG  + A       +  P   EA  +R  LK
Sbjct  1214  PVGMVKLNVDAAV-FKHVGIGMGGVVRDAEGDVLLATCCGGWAMEDPAMAEACSLRYGLK  1272

Query  181   WI-----------KDLQYDFIQLQLYSS----FDLIINDVKELAKDFLNINFLFAKRSAN  315
                           D +  F+QL+  +S    F  +++D+  LA    N+ F   KR  N
Sbjct  1273  VAYEAGFRNLVVEMDCKKLFLQLRGKASDVTPFGRVVDDILYLASKCSNVVFEHVKRHCN  1332

Query  316   KVAHLLTR  339
             KVAHLL +
Sbjct  1333  KVAHLLAQ  1340



>ref|XP_010233514.1| PREDICTED: uncharacterized protein LOC104583329 [Brachypodium 
distachyon]
Length=137

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 39/86 (45%), Gaps = 2/86 (2%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P+G  K+NVD  L           + RD  G F+ A  I + GL  P   EAI   E L 
Sbjct  48   PVGLCKINVDTGLVASGNPGACAAIFRDETGKFLGASSISLKGLSDPTAAEAIACNEGLS  107

Query  181  WIKDLQYDFIQLQLYSSFDLIINDVK  258
              +DLQ    +  L S    +IND+K
Sbjct  108  LAQDLQ--LARFVLASDCSNVINDLK  131



>gb|EEE64789.1| hypothetical protein OsJ_19645 [Oryza sativa Japonica Group]
Length=205

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 61/139 (44%), Gaps = 15/139 (11%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVRE---  171
            P GW K+NVD A D G+ R G+G V+RD  G  + +    +    + +E E +   E   
Sbjct  47   PEGWAKINVDGAFDQGDGRCGIGVVIRDCLGRVLLSSWRYLRRCSQAEEAELLACSEGIN  106

Query  172  -ALKWIK---DLQYDFIQLQLY--------SSFDLIINDVKELAKDFLNINFLFAKRSAN  315
             A +WI     L+ D +             S +  ++ ++K   +    ++     R  N
Sbjct  107  LAAEWIHLPVILESDCLMATTSIAGKDMERSRWTFLLREIKAAVRRLQEVSVHHVNRECN  166

Query  316  KVAHLLTRETLFKSDCSVY  372
            +VAH L +     + C+V+
Sbjct  167  RVAHELAQLAKRTAHCAVW  185



>ref|XP_003623176.1| hypothetical protein MTR_7g065310 [Medicago truncatula]
Length=227

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 56/133 (42%), Gaps = 16/133 (12%)
 Frame = +1

Query  34   ALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQ  213
             +++     G+G  + D  G FV AK    S L      E +G+  AL+W+ DL YD + 
Sbjct  83   VIEWTKPTYGIGICICDVHGEFVMAKIDCFSPLCDVDVGEVVGLHMALQWVADLHYDHVN  142

Query  214  LQLYS-----SFDLIINDVKELA-----------KDFLNINFLFAKRSANKVAHLLTRET  345
              L S      F+  + D  EL             +F N +  F +R AN VAH L R  
Sbjct  143  FVLDSKSVVVHFNSNLGDSSELGCIIQVCRQLFDCNFQNSHIEFNRRQANGVAHELDRVD  202

Query  346  LFKSDCSVYFFIP  384
               +   +Y  +P
Sbjct  203  PSHASSHIYDDVP  215



>ref|XP_003613452.1| hypothetical protein MTR_5g036840 [Medicago truncatula]
Length=261

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 48/99 (48%), Gaps = 5/99 (5%)
 Frame = +1

Query  16   KLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDL  195
            K N+DAA    +    +G  +RD+EG+FV +K I    +      EA+G+  AL+W+ D+
Sbjct  79   KCNIDAAFSSHHNHTSIGICIRDSEGSFVLSKTITSLCIVLVDVGEALGLHSALQWLSDM  138

Query  196  QYDFIQLQLYSSFDLII-----NDVKELAKDFLNINFLF  297
            Q D +  +  S   + +     ND+ E      +   LF
Sbjct  139  QLDNVDFETDSKVTVDVFLSTRNDLSEFGSIISSCRSLF  177



>ref|XP_010485231.1| PREDICTED: uncharacterized protein LOC104763574 [Camelina sativa]
Length=1808

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 45/158 (28%), Positives = 72/158 (46%), Gaps = 20/158 (13%)
 Frame = +1

Query  1     PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGT--FVAAKEIPISGLFKPKEDEAIGVREA  174
             PL W+K N+D A      R G+G+VLRD +G+  ++ A+ +P +      E EA+  R A
Sbjct  1647  PLEWVKCNMDGAWPREGDRSGVGWVLRDHQGSVLWMGARALPRTRSVLEVETEAL--RWA  1704

Query  175   LKWIKDLQYDFIQLQLYSSFDLI---------------INDVKELAKDFLNINFLFAKRS  309
             +  +   QY  +  +   S DLI               + D+K L + F  + F F KR 
Sbjct  1705  MVSVARFQYKKVIFE-SDSQDLISAINGDERRPPIATLLEDIKCLCRQFEEVTFKFTKRG  1763

Query  310   ANKVAHLLTRETLFKSDCSVYFFIPFPSIV*YISSSFL  423
              N VA  + +ET       + F+   P  + Y+  + L
Sbjct  1764  GNAVADRIAQETTSFQRNEIRFYSNAPRWLEYLVETEL  1801



>gb|KEH21242.1| hypothetical protein MTR_8g099580 [Medicago truncatula]
Length=309

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G +K N+DA     + +  +G  +RD  G FV AK I   G++     EA+G+  AL+W+
Sbjct  191  GQMKCNIDAVFSNHHNKTDIGICIRDEGGVFVLAKTISFVGVYFVDIGEALGLYHALQWV  250

Query  187  KDLQYDFIQLQLYS  228
             D+Q D I  ++ S
Sbjct  251  SDMQLDNIDFEVDS  264



>ref|XP_009378422.1| PREDICTED: uncharacterized protein LOC103966921 [Pyrus x bretschneideri]
Length=377

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/147 (26%), Positives = 67/147 (46%), Gaps = 17/147 (12%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            GW+K N+D   D      G+G V+R++EG F+AA  +  +G+      EA+  R    + 
Sbjct  221  GWIKCNLDVVWDEIGLHGGIGIVVRNSEGEFIAAMVVWENGIRSVLHAEAVVARATAVFT  280

Query  187  KDLQYDFIQ-----LQLYSS-----------FDLIINDVKELAKDFLNINFLFAKRSANK  318
            +    + +Q     L + S+           +  +  D +++ + F   N  F +R  NK
Sbjct  281  RQWSTEQVQGEGDALMVISAIQNEGTAHQGPYGHLFADTRQILQSFKQWNVSFGRRDTNK  340

Query  319  VAHLLTRETLFKSDCSVYFFIPFPSIV  399
            VAH L R +L     + +F  P P ++
Sbjct  341  VAHHLARFSLALDHPASWFEEP-PDVI  366



>gb|KEH40134.1| hypothetical protein MTR_1g022215 [Medicago truncatula]
Length=90

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 38/70 (54%), Gaps = 0/70 (0%)
 Frame = +1

Query  13   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKD  192
            +K NVDA       + G+G  +RD +G FV A+ I   G++   + E +G+  AL+W  D
Sbjct  1    MKRNVDAEFSSQRNKTGVGICIRDEDGVFVLARTITFIGVYPVDKGEVLGLYHALQWASD  60

Query  193  LQYDFIQLQL  222
            +  D I  ++
Sbjct  61   MHLDNIDFEV  70



>gb|KEH37989.1| hypothetical protein MTR_2g055490 [Medicago truncatula]
Length=112

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 46/106 (43%), Gaps = 17/106 (16%)
 Frame = +1

Query  67   GFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQLYSSFDLII  246
            G  +RD    FV AK +  S        E +G+  AL+W  D+ +D +  +  S      
Sbjct  12   GICIRDFADIFVLAKALSYSCYVSTDVGETLGLHSALQWFDDMHFDNVDFETDS------  65

Query  247  NDVKELAKDFLNINFLFAKRSANKVAHLLTRETLFKSDCSVYFFIP  384
                        +   F +R AN +AH L R+TL  +  +VY+ IP
Sbjct  66   -----------KLTVEFVRRQANGIAHALARDTLLLTSPAVYYDIP  100



>ref|XP_002527468.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34866.1| conserved hypothetical protein [Ricinus communis]
Length=158

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 57/114 (50%), Gaps = 24/114 (21%)
 Frame = +1

Query  4    LGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKW  183
            LG+LK NVDAA   G  R G GFVLRD  G     +++      +P   EA+G+RE L W
Sbjct  61   LGYLKYNVDAATFNG--RTGFGFVLRDHAGLLF--QQLMDLRRLRP-HTEAMGLRETLSW  115

Query  184  IKDLQYDFIQLQLYSSFDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTRET  345
            +K   +                +V EL    +N++  F  RS N+VAH+L R +
Sbjct  116  LKANSHC---------------NVLEL----VNVSVPFVARSVNRVAHVLPRAS  150



>ref|XP_009121392.1| PREDICTED: uncharacterized protein LOC103846249 [Brassica rapa]
Length=253

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 62/141 (44%), Gaps = 18/141 (13%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P  WLK NVDA+          G+++RD  G +  A ++  + +  P E E   +  A++
Sbjct  94   PNQWLKCNVDASFIDTREPSSAGWIIRDEHGIYKGAVQVQGNMICSPLESELQAILMAVQ  153

Query  181  --WIKDLQYDFIQLQLYSSFDLIIND-------------VKELAKDFLNINFLFAKRSAN  315
              W K      I+     + D I+ND             ++  A+   NI+F + KR AN
Sbjct  154  FCWTKGYNKIIIESDCRKAID-ILNDLVLHFDSFNWKREIRWWAEKIQNISFQWVKREAN  212

Query  316  KVAHLLTRETLFKSDCSVYFF  378
            KVA  L R  L   D S Y F
Sbjct  213  KVADSLARTPLH--DMSSYCF  231



>ref|XP_003594303.1| hypothetical protein MTR_2g027020 [Medicago truncatula]
 gb|AES64554.1| hypothetical protein MTR_2g027020 [Medicago truncatula]
Length=188

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 59/125 (47%), Gaps = 12/125 (10%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G LK ++D        ++G+   +RD EG FV AK +  + L      EA+G+  A+KWI
Sbjct  13   GRLKCSIDLCFSASTNKLGICTCIRDEEGCFVLAKSMWFTLLCSIDVGEALGLYHAIKWI  72

Query  187  KDLQYDFI-QLQLYSSFDLIINDVKELAKDF-LNINFL----------FAKRSANKVAHL  330
             DL+   +   ++   F+   +D+ E      +NI +           F +R AN+V H 
Sbjct  73   HDLRLPNVDSKRVVDYFNRSNDDITEYGIIMDINIYYCSLYLTNSRVGFTRRQANEVVHE  132

Query  331  LTRET  345
            LT  +
Sbjct  133  LTNAS  137



>ref|XP_003614676.1| hypothetical protein MTR_5g057370 [Medicago truncatula]
Length=247

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 38/72 (53%), Gaps = 0/72 (0%)
 Frame = +1

Query  4    LGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKW  183
            LG  K N+D A      R G+G  + D+EG FV AK +    ++     EA G+  A++W
Sbjct  120  LGRYKCNIDVAFLSSLNRTGIGICVHDSEGKFVLAKVVSFPCIYSVDVGEAWGLHSAMQW  179

Query  184  IKDLQYDFIQLQ  219
              D+Q+D +  +
Sbjct  180  SSDMQFDNVDFE  191



>ref|XP_002453054.1| hypothetical protein SORBIDRAFT_04g037485 [Sorghum bicolor]
 gb|EES06030.1| hypothetical protein SORBIDRAFT_04g037485 [Sorghum bicolor]
Length=172

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 52/113 (46%), Gaps = 5/113 (4%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P  ++K NVDAA+     +  +  V RD  G +VAA  + I GL  P   EA+   EA+ 
Sbjct  37   PEAFVKFNVDAAVARAEDKRTVSVVCRDNVGNYVAASAMVIDGLTDPSSLEALACNEAIS  96

Query  181  WIKDLQYDFIQLQLYSSFDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTR  339
               D     I  Q   ++  ++ ++K  +  F  + F    R +N  AH L +
Sbjct  97   LAMD-----IWKQSLCAYSSVLKEIKARSTLFQEVVFKHEGRESNCEAHALAK  144



>ref|XP_003595161.1| hypothetical protein MTR_2g039110 [Medicago truncatula]
Length=162

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 54/122 (44%), Gaps = 16/122 (13%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G LK NVDA+      R  +G  +RD E TFV A  + +S +      E + +   L+W+
Sbjct  33   GRLKCNVDASFSDQLNRTCIGICVRDDECTFVLANTVSLSPMCSVVVGEPLSLFHPLQWL  92

Query  187  KDLQYDFIQLQLYS---------------SFDLIINDVKEL-AKDFLNINFLFAKRSANK  318
             D+Q+D +   L S                F  +I+  + L    F N    F +R +N+
Sbjct  93   SDMQFDNVDFVLDSKITTDAFHNRQVDVTEFGQVISTCRSLFNSHFSNSKVEFNRRQSNE  152

Query  319  VA  324
            VA
Sbjct  153  VA  154



>emb|CAN77449.1| hypothetical protein VITISV_016970 [Vitis vinifera]
Length=517

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 57/113 (50%), Gaps = 18/113 (16%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G LK NVDA +   ++ +GLG +LR+  G+        ++G+  PK  EA+G+REA +W+
Sbjct  362  GMLKCNVDAXIFSKHQTIGLGVILRNEFGSVXGCYSKVVNGVSSPKXAEALGLREAARWL  421

Query  187  KDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFA  300
             +L+   + ++L                S F ++I D + L   FL+ NF   
Sbjct  422  LELRVSNVIVELDAKGVYDSFYSKALDRSEFGMLIQDCRSL---FLDQNFTLC  471



>ref|XP_006577722.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=249

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  162
            PL + K N+DAA+    RR GLG  LRD+ G F+ AK + + G+ +P E EA+G
Sbjct  180  PLVFAKCNLDAAVFGNQRRFGLGMCLRDSLGRFIIAKSVLVEGMLQPVEAEALG  233



>gb|KHN20416.1| Putative ribonuclease H protein [Glycine soja]
Length=249

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIG  162
            PL + K N+DAA+    RR GLG  LRD+ G F+ AK + + G+ +P E EA+G
Sbjct  180  PLVFAKCNLDAAVFGNQRRFGLGMCLRDSLGRFIIAKSVLVEGMLQPVEAEALG  233



>ref|XP_002522452.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF39944.1| nucleic acid binding protein, putative [Ricinus communis]
Length=483

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 60/136 (44%), Gaps = 20/136 (15%)
 Frame = +1

Query  16   KLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDL  195
            KLNVDA+      + G  FVLRD  G ++    I    +  P   EA  ++EAL WI   
Sbjct  352  KLNVDASSSAERGKSGASFVLRDNAGIWITGVLIIRPYIANPDVAEAWALKEALSWIHAK  411

Query  196  QYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFAKRSANKVAHL  330
              + +Q++                 S    ++ D ++L +     N +F   SAN VAH+
Sbjct  412  GMEEVQIETDCLRNIELLEEELHPNSYLLCLLKDCQDLLRVLNRCNLVFVYGSANTVAHM  471

Query  331  LTRETLFKSDCSVYFF  378
            +++ T     CS + F
Sbjct  472  ISKAT-----CSAHMF  482



>gb|EMT25602.1| F-box/WD-40 repeat-containing protein [Aegilops tauschii]
Length=779

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 38/129 (29%), Positives = 59/129 (46%), Gaps = 15/129 (12%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P+G +K+NVDAA+  G     +G + RD + TF+ A  +  S L  P   E + +REA+ 
Sbjct  48   PVGLVKINVDAAV--GRAHGAVGAMCRDRDRTFLGASAVVFSNLSDPGTLETLAIREAMA  105

Query  181  WIKDLQYDFIQL-------------QLYSSFDLIINDVKELAKDFLNINFLFAKRSANKV  321
               DL    IQ+             Q   S+  I++++ +    F   N     RS+N  
Sbjct  106  LANDLYVGRIQIASDCKVAVDDIHQQFKGSYSAIVHEIIQYKSTFDICNIGHEFRSSNTE  165

Query  322  AHLLTRETL  348
            AH L +  L
Sbjct  166  AHKLAKHAL  174



>ref|XP_006471930.1| PREDICTED: uncharacterized protein LOC102617744 [Citrus sinensis]
Length=294

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 66/148 (45%), Gaps = 27/148 (18%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKP--KEDEAIGVREA  174
            P   LKLNVDAA +  ++++GLG VLRD+ G  VAA      G+ +   ++D +    EA
Sbjct  140  PTNVLKLNVDAATNSKDQKVGLGAVLRDSNGRVVAA------GIKQASFRKDVSFAEAEA  193

Query  175  LKWIKDLQYDFIQLQLYSSFDL-------------------IINDVKELAKDFLNINFLF  297
            ++W   +        L    D                    II++++   ++F  I+F F
Sbjct  194  IQWGLQIAKKAAAASLIVETDCKDVAELVNNTKGSRSEIFWIISEIQTQKREFQRIHFNF  253

Query  298  AKRSANKVAHLLTRETLFKSDCSVYFFI  381
              R  N  AH L +  L K   +V+  I
Sbjct  254  VPRFCNAHAHSLAKHALRKDTTAVWLDI  281



>ref|XP_008227720.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=342

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 61/128 (48%), Gaps = 15/128 (12%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREAL-  177
            P+ + K+NVD A +   +  G+G V+RD+ G F+  +      +F   + EA+  RE + 
Sbjct  186  PMSFFKINVDGAWNADTKSGGVGVVVRDSTGAFIVGRARKFDNVFSALQSEALAAREGVV  245

Query  178  ----KWIKDLQYDFIQLQL-----YSSFDL-----IINDVKELAKDFLNINFLFAKRSAN  315
                + + ++ ++   LQ+     YSS D      I+ D K L        F   +R+AN
Sbjct  246  LEAERGLTNICFESDSLQIVTALGYSSLDRSFIGPILEDSKFLLLQITGEGFNHVRRTAN  305

Query  316  KVAHLLTR  339
            + AH + R
Sbjct  306  EAAHHIAR  313



>ref|XP_007227312.1| hypothetical protein PRUPE_ppa016553mg [Prunus persica]
 gb|EMJ28511.1| hypothetical protein PRUPE_ppa016553mg [Prunus persica]
Length=992

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 64/144 (44%), Gaps = 16/144 (11%)
 Frame = +1

Query  13   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREAL-----  177
            LK+NVD A   G    G+G V+RD+ G FVA     ++ +F   + EA+  R        
Sbjct  840  LKINVDGAWKPGTTEGGVGVVVRDSTGKFVAGCATKLTNVFSAPQVEALAARTNTILAME  899

Query  178  KWIKDLQYDFIQLQLYSSF----------DLIINDVKELAKDFLNINFLFAKRSANKVAH  327
            +  +++ ++   LQ+ ++             ++ D K L        F   +R+AN VAH
Sbjct  900  RGYQNVVFESDALQIVTALRNHSIDRSVIGPVVEDTKSLLTQITGEGFTHIRRTANGVAH  959

Query  328  LLTRETLFKSDCSVYFFIPFPSIV  399
             L R  L     S+Y+F   P  +
Sbjct  960  RLARFALHIGG-SLYWFEEPPDFI  982



>ref|XP_010688579.1| PREDICTED: uncharacterized protein LOC104902491 [Beta vulgaris 
subsp. vulgaris]
Length=1325

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 38/126 (30%), Positives = 60/126 (48%), Gaps = 16/126 (13%)
 Frame = +1

Query  7     GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
             GWLK+N DA ++ GN  +GLG V+RD+ G    A    +   +     EA+  + A++  
Sbjct  1173  GWLKVNFDAHVN-GNGEIGLGAVMRDSAGVVKFAATKRVEARWDATLAEAMAAKFAVEVT  1231

Query  187   KDLQYDFI-----QLQLYSSFD----------LIINDVKELAKDFLNINFLFAKRSANKV  321
               L YD +      L++  +             +  D++ L   F+  +FL  KR+ N V
Sbjct  1232  LRLGYDNVLFEGDALEVVQAVKNNSEGVAPLFRVFYDIRRLVSSFVAFSFLHVKRTGNVV  1291

Query  322   AHLLTR  339
             AHLL R
Sbjct  1292  AHLLAR  1297



>ref|XP_003598902.1| hypothetical protein MTR_3g023170 [Medicago truncatula]
Length=274

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 58/129 (45%), Gaps = 2/129 (2%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G  K NVDA+      ++G G  +RDAEG FV A+    + L      E   V    +  
Sbjct  135  GRFKCNVDASFSTTLNKVGFGACIRDAEGNFVIARTAWTTLLLDVNMGELNMVHMDFETN  194

Query  187  KDLQYDFI-QLQLYSSFDLIINDVKE-LAKDFLNINFLFAKRSANKVAHLLTRETLFKSD  360
              +  D I   +  S F  IIND +  L+ + +N +  F +R  N VAH L +E L  + 
Sbjct  195  SKVVADRIYGKEGVSDFMAIINDCRHLLSTNLVNSDVKFIRRQVNGVAHSLAKEALHHAS  254

Query  361  CSVYFFIPF  387
              +   IP 
Sbjct  255  LHIRLNIPH  263



>ref|XP_010681661.1| PREDICTED: uncharacterized protein LOC104896591 [Beta vulgaris 
subsp. vulgaris]
Length=197

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 60/128 (47%), Gaps = 16/128 (13%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G  K+N DAA+ + +R +GLG V+RDA G  + A  + +       E EA   R AL+  
Sbjct  41   GSYKINADAAI-FKDRTVGLGGVMRDAAGEVMGATCMHLEVELGVDEAEACAARHALQTA  99

Query  187  KDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFAKRSANKV  321
             ++    I L+                 SSF  ++ D+  L   F +I+F   +R  N+V
Sbjct  100  VEMGLRHIVLESDSLKVISHLLTKKGDESSFGNVVEDILWLGGFFSSISFNHVRREGNRV  159

Query  322  AHLLTRET  345
            AH + + +
Sbjct  160  AHTIAQRS  167



>ref|XP_010682232.1| PREDICTED: uncharacterized protein LOC104897109 [Beta vulgaris 
subsp. vulgaris]
Length=332

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 63/128 (49%), Gaps = 16/128 (13%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P  ++K+NVDA + +GN  + +G ++RD  G+  AA    I+  + P+  EA   R  L 
Sbjct  178  PQSYVKVNVDAHVMHGN-GVSMGMIIRDEHGSIKAAGVKRIASNWAPELAEAGAARFGLD  236

Query  181  WIKDLQYDFIQLQLYSS---------------FDLIINDVKELAKDFLNINFLFAKRSAN  315
              + L +D + L+  +S                 L  +D+ E++  FL+ + +  KR+ N
Sbjct  237  VARRLGFDRVVLECDASNVVRCIRERRQGAAPIFLFYDDILEISSSFLSFDCVHVKRAGN  296

Query  316  KVAHLLTR  339
             VAH + R
Sbjct  297  TVAHSVAR  304



>ref|XP_008226963.1| PREDICTED: uncharacterized protein LOC103326508 [Prunus mume]
Length=224

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/132 (27%), Positives = 62/132 (47%), Gaps = 16/132 (12%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P+G  KLNVDAA        G+G V+R+ +G  +AA  +P++     K  E + +   +K
Sbjct  65   PVGKYKLNVDAAFIPETGVGGIGAVVRNDKGEVMAAMALPLASATSSKHAEIMALLFGMK  124

Query  181  WIKDLQYDFI----------------QLQLYSSFDLIINDVKELAKDFLNINFLFAKRSA  312
            + +D  +  I                + + ++S   +I+D+K   + F ++   F+ R  
Sbjct  125  FAQDAGFSSILIESDSQGVINDVRKDEEESWASDGHLIDDIKRSLQHFEDVIISFSPRGG  184

Query  313  NKVAHLLTRETL  348
            N+VAH   R  L
Sbjct  185  NQVAHFPARHAL  196



>ref|XP_002532287.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30102.1| conserved hypothetical protein [Ricinus communis]
Length=346

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 54/122 (44%), Gaps = 15/122 (12%)
 Frame = +1

Query  64   LGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQL-------  222
            +G VLRDA   F+        GL + +E E + +REAL WI+   Y  +  +L       
Sbjct  211  IGMVLRDATRVFMCCASNCYEGLVQVRESETMRLREALSWIRGKWYQRVIFELDCQQIVH  270

Query  223  --------YSSFDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTRETLFKSDCSVYFF  378
                       F  +I +  EL  +  + + +F KR AN++A++L R     +   V F 
Sbjct  271  AVTNFLASVDEFGSLIRECAELLAENNSYSVIFVKRQANEIAYMLARAPHSHAGLRVCFE  330

Query  379  IP  384
             P
Sbjct  331  PP  332



>ref|XP_006487438.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=335

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 65/139 (47%), Gaps = 15/139 (11%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEG-TFVAA-KEIPISGLFKPKEDEAIGVREA  174
            P  W+K+NVDAA+D  ++  GLG V++D  G  FVAA K +   G     E EA      
Sbjct  181  PPRWVKINVDAAIDAKSKCSGLGAVIKDPSGKCFVAAVKSVTSKGDVLLAEAEADEWGTY  240

Query  175  LKWIKDLQYDFIQLQLYSSFDL-------------IINDVKELAKDFLNINFLFAKRSAN  315
            L   + +Q   ++    ++ DL             II+D++ L   F +    F  RS N
Sbjct  241  LAKEEGMQAVILETDSKATVDLINNNGNYMTEVHWIISDIQSLMSQFSHFVAKFIPRSCN  300

Query  316  KVAHLLTRETLFKSDCSVY  372
              AH L +  L K+D  V+
Sbjct  301  TCAHKLAKIALGKTDSFVW  319



>ref|XP_009787297.1| PREDICTED: uncharacterized protein LOC104235275 [Nicotiana sylvestris]
Length=201

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 53/109 (49%), Gaps = 16/109 (15%)
 Frame = +1

Query  13   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKD  192
            LK N+DA+ +        G V+RD    F+  +   I   F     EA+ V+EAL W+K 
Sbjct  80   LKCNIDASFNLATGEARAGMVVRDRHSEFLRGRSTYIGATFSSMMAEALAVKEALSWLK-  138

Query  193  LQYDFIQLQLYSSFDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTR  339
            L YD  +++L            E+   F+ ++++   RSAN+VA  L R
Sbjct  139  LHYDDTKIEL------------EMDSLFVKLHWI---RSANQVAQALAR  172



>ref|XP_003622120.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
Length=894

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/123 (28%), Positives = 57/123 (46%), Gaps = 16/123 (13%)
 Frame = +1

Query  64   LGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQL-------  222
            +G  +RD EG +V+AK   +S +      E +G+  A+ W++DLQ   +  +L       
Sbjct  321  IGVYIRDDEGRYVSAKTEWMSPILDVDLGETLGLLSAMYWVRDLQLGIVDFELDSKNVID  380

Query  223  --------YSSFDLIINDVKE-LAKDFLNINFLFAKRSANKVAHLLTRETLFKSDCSVYF  375
                     S+F  +IND +  LA   +  +  F +R AN+V H   R  L  +   ++ 
Sbjct  381  SLYGSKSGVSNFSAVINDCRRLLASVLVTSDVRFIRRQANEVDHSFARVVLRHASFHIHI  440

Query  376  FIP  384
             IP
Sbjct  441  RIP  443



>ref|XP_003592602.1| hypothetical protein MTR_1g109000 [Medicago truncatula]
 gb|AES62853.1| hypothetical protein MTR_1g109000 [Medicago truncatula]
Length=87

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  13   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKD  192
            +K N+DA+  + +  +G+G ++RD  G FV AK I ++ L + +E +A G+  A+ W+ +
Sbjct  13   MKCNIDASFCHTHNMVGIGILIRDDRGHFVQAKTIQVTPLLQVQEGKAKGLLHAMNWVIE  72

Query  193  L  195
            L
Sbjct  73   L  73



>ref|XP_004293042.2| PREDICTED: uncharacterized protein LOC101293660 [Fragaria vesca 
subsp. vesca]
Length=816

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 69/146 (47%), Gaps = 20/146 (14%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P G +K+NVD +   G      GFV+RD  G+F+A        +   +  E +  ++A+ 
Sbjct  659  PHGIVKINVDGSFISGTHSGSTGFVIRDNSGSFLACGGQAHKAVVSAEHVEVLACKQAIV  718

Query  181  WI-----------KDLQYDFIQLQLYSSFDL-----IINDVKELAKDFLNINFLFAKRSA  312
            +             D Q  ++QL  +   +L     + +D+  + +D+ ++  +  KRS 
Sbjct  719  FAIANNFQPAIIESDAQVVYLQLINHHQANLSVLGRLYDDIGNMIQDYGSVRIMHTKRSV  778

Query  313  NKVAHLLT--RETLFKSDCSVYFFIP  384
            N+VAHL+    +TL +   + YF +P
Sbjct  779  NRVAHLMAGHSKTLVRE--TFYFSVP  802



>gb|ABN09176.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=260

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 62/143 (43%), Gaps = 15/143 (10%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            PL  +K NV+ AL   N  MG G   RD+ G F+            P E EA G+ EA+K
Sbjct  106  PLTVVKCNVECALFNNNSIMGYGLCFRDSMGHFLPGMSNYEFLRVTPSEAEATGLLEAVK  165

Query  181  WI--KDLQ-----------YDFIQLQLYSSFDL--IINDVKELAKDFLNINFLFAKRSAN  315
                + +Q            D +   +    +L  II   K+L     N +  F +R AN
Sbjct  166  LAIARGMQSVIFKSDCKIVVDAVNSSVNPHNELGDIIFYCKQLLSLHANFSVRFVRRQAN  225

Query  316  KVAHLLTRETLFKSDCSVYFFIP  384
            KVAH + R +L      ++F +P
Sbjct  226  KVAHNIARASLSHPSPHIFFDVP  248



>ref|XP_002530993.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31381.1| conserved hypothetical protein [Ricinus communis]
Length=98

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 42/88 (48%), Gaps = 18/88 (20%)
 Frame = +1

Query  76   LRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQLYSSFDLIINDV  255
            + D++G  VA K   + G    +  EA+  +EAL W+KD                  ND 
Sbjct  1    MSDSQGELVAVKNGCLRGPLILEVAEALSCKEALLWLKD------------------NDC  42

Query  256  KELAKDFLNINFLFAKRSANKVAHLLTR  339
            + LAKDF    F F KR+AN V HLL +
Sbjct  43   QVLAKDFEECIFSFIKRTANHVTHLLAK  70



>ref|XP_010689711.1| PREDICTED: uncharacterized protein LOC104903385 [Beta vulgaris 
subsp. vulgaris]
Length=1533

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 41/132 (31%), Positives = 61/132 (46%), Gaps = 16/132 (12%)
 Frame = +1

Query  1     PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
             P G++KLN DA++   +  +GLG V RD++G  + +        + P+  E   V  A++
Sbjct  1377  PDGFVKLNSDASIG-DDGWIGLGVVARDSQGKILFSAVRRTKAYWPPEVAECKAVHFAIR  1435

Query  181   WIKD--LQYDFIQLQ-------------LYSSFDLIINDVKELAKDFLNINFLFAKRSAN  315
               K   LQ   I+                YS  D I+ DV  L + F ++NF+  KR  N
Sbjct  1436  LAKSHGLQSVVIESDSQIVTTRLSRAALFYSDLDSILGDVLALCRSFNSVNFMHVKRDGN  1495

Query  316   KVAHLLTRETLF  351
              VAH L R   F
Sbjct  1496  TVAHNLARVVPF  1507



>ref|XP_011470556.1| PREDICTED: uncharacterized protein LOC105353255 [Fragaria vesca 
subsp. vesca]
Length=623

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 41/140 (29%), Positives = 58/140 (41%), Gaps = 15/140 (11%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            GW K + D A      R G G V+RD  G F A     +  +  P   E I + E LK  
Sbjct  469  GWYKCSCDGAFVTDIHRGGSGVVIRDEHGQFRAGAGKVLVQVTSPFHAELIALLEGLKLA  528

Query  187  KDL-------QYDFIQLQL--------YSSFDLIINDVKELAKDFLNINFLFAKRSANKV  321
            + L       + D + LQ          S+   II +VKE    + +   L   R AN+V
Sbjct  529  ETLHISKIVFETDCLLLQQAVSQPDTDLSTLGTIIAEVKEFLHRYADFRVLHVPREANRV  588

Query  322  AHLLTRETLFKSDCSVYFFI  381
            AH+L    L  S+   +F +
Sbjct  589  AHILANHALNYSESQSWFVV  608



>ref|XP_010666974.1| PREDICTED: uncharacterized protein LOC104884077 [Beta vulgaris 
subsp. vulgaris]
Length=172

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 61/132 (46%), Gaps = 16/132 (12%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P G++K+NVDA+L      +GLG V RD  G  + A        + P+  EA  +  AL+
Sbjct  16   PAGFIKVNVDASLKEEGW-VGLGVVARDHTGQVLFAATRRTRAYWTPEVSEAKAMAMALR  74

Query  181  WIK-----------DLQYDFIQLQ----LYSSFDLIINDVKELAKDFLNINFLFAKRSAN  315
              +           D Q   I+L       S  DL+++D+  L+  F +I +   KR  N
Sbjct  75   LSRARNIPHVIFESDCQSLVIKLSKGNVFLSDLDLVMSDIMCLSTSFTSIAWSHVKRGGN  134

Query  316  KVAHLLTRETLF  351
             VAH L + T F
Sbjct  135  FVAHHLAQFTPF  146



>ref|XP_002447811.1| hypothetical protein SORBIDRAFT_06g016240 [Sorghum bicolor]
 gb|EES12139.1| hypothetical protein SORBIDRAFT_06g016240 [Sorghum bicolor]
Length=342

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 61/129 (47%), Gaps = 13/129 (10%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P G +K+NVDAA+   + +     V RD+ G FV A  +   G+  P+  EA+  RE+L 
Sbjct  187  PAGVMKINVDAAISKNSSKASASAVARDSSGMFVGASVVVTEGISDPEIMEAVACRESLA  246

Query  181  WIKDLQYDFIQLQL-------------YSSFDLIINDVKELAKDFLNINFLFAKRSANKV  321
               DL    I++               + S+  +I ++K     F ++ F++  R +N  
Sbjct  247  LASDLLLQKIRVACDNITVVRNIRGKGFGSYGHVIQEIKARGDSFTSVEFVYEGRMSNGD  306

Query  322  AHLLTRETL  348
            AH L R +L
Sbjct  307  AHRLARGSL  315



>ref|XP_007207608.1| hypothetical protein PRUPE_ppa018906mg [Prunus persica]
 gb|EMJ08807.1| hypothetical protein PRUPE_ppa018906mg [Prunus persica]
Length=339

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 66/137 (48%), Gaps = 17/137 (12%)
 Frame = +1

Query  13   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDE------------A  156
            +K+NVD A++      GLG V+RD+ G  + A    + G+F PK  +             
Sbjct  177  VKINVDGAVNLLIGFRGLGIVIRDSMGDLLLAAYKGLHGMFSPKATKLYAAIMRLQIASQ  236

Query  157  IGVREALKWIKDLQYDFIQLQLYSSFDLI----INDVKELAKDFLNINFLFAKRSANKVA  324
            +G R  +  + D +   + LQ Y    L+    +++V+ L   F +I+  FA R  N+VA
Sbjct  237  MGHRSVILEM-DAKEIIMNLQTYEQSWLVEGALVDEVRGLFNRFDHISCHFAPRERNQVA  295

Query  325  HLLTRETLFKSDCSVYF  375
            HLL ++ L   D  V+ 
Sbjct  296  HLLAKQALLPQDFQVWL  312



>ref|XP_006427454.1| hypothetical protein CICLE_v10027161mg, partial [Citrus clementina]
 gb|ESR40694.1| hypothetical protein CICLE_v10027161mg, partial [Citrus clementina]
Length=164

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/137 (28%), Positives = 69/137 (50%), Gaps = 20/137 (15%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKED--EAIGVREA  174
            P  W K+NVDAA+     R G+G ++ ++ G  +AA    +  +F    +  EA+ V   
Sbjct  7    PPSWYKVNVDAAVSSTEDRAGIGVLVCNSTGEVMAASICTV--IFSRDIEFVEAVAVHNG  64

Query  175  LKWIKDL----------QYDFIQL---QLYSSFDL--IINDVKE-LAKDFLNINFLFAKR  306
            L+ + D+           ++ + L   +++S  ++  +I+DV+E L+    +    FA R
Sbjct  65   LQLVMDIGLAPAIIESDSFNVVNLINNKIHSRCEVGWLISDVQEVLSSSESSFQVKFAPR  124

Query  307  SANKVAHLLTRETLFKS  357
            S N+VAH L++  L  S
Sbjct  125  SCNEVAHHLSKLALCNS  141



>ref|XP_008226959.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=370

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 65/133 (49%), Gaps = 27/133 (20%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKE----IPISGLFKPKEDEAIGVR  168
            P G++KLN D   +   R++G+G+VLRD  G F+ A      + +S L      EA  V 
Sbjct  233  PSGFVKLNCDGEWEAQTRKLGVGWVLRDGIGCFINAGGYGDMLCVSALMA----EAEAVP  288

Query  169  EALKWIKDLQYDFIQLQLYS-----------------SFDLIINDVKELAKDFLNINFLF  297
            EAL   + L++ F+++ + S                   + I+ D++ L +    ++FL+
Sbjct  289  EAL--TRCLEFGFVKVAVESDSLSLIKMLNKKGVVDLEIEGILFDIQCLTQHADQVDFLY  346

Query  298  AKRSANKVAHLLT  336
            A R  N+ AH +T
Sbjct  347  APRICNQAAHKVT  359



>gb|KDP36415.1| hypothetical protein JCGZ_08684 [Jatropha curcas]
Length=115

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 37/64 (58%), Gaps = 1/64 (2%)
 Frame = +1

Query  1    PL-GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREAL  177
            PL G LKLNVDAA D    R G G++LRD  G  +  K + +  +      EA+ +REAL
Sbjct  22   PLQGTLKLNVDAAFDLNTHRAGGGWILRDHLGFCLGGKLMDLGVVASSLMAEALSIREAL  81

Query  178  KWIK  189
             W+K
Sbjct  82   SWVK  85



>gb|KDP37578.1| hypothetical protein JCGZ_08269 [Jatropha curcas]
Length=95

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 43/94 (46%), Gaps = 15/94 (16%)
 Frame = +1

Query  115  IPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQLYSS---------------FDLIIN  249
            + + G   P   +AI  REAL W+K    D +  +  S                F  I+ 
Sbjct  1    MSVLGAHDPHTADAILFREALSWVKGKGMDRVLFETNSQMLVQALQRPLNDGTYFGSIVA  60

Query  250  DVKELAKDFLNINFLFAKRSANKVAHLLTRETLF  351
            D K L ++  + +F F KRSAN+VAHLLT    +
Sbjct  61   DCKLLIEELSHCSFCFMKRSANRVAHLLTTNVYY  94



>gb|KJB22308.1| hypothetical protein B456_004G040000 [Gossypium raimondii]
Length=175

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 59/129 (46%), Gaps = 15/129 (12%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G+ K+N DAA D    R+  G ++ + +G  +A+K +    +      EAI   +A+   
Sbjct  41   GFFKINFDAAFDNSKNRLCSGIIVMNFKGDVLASKTMVHDNIPSKFAVEAIACLQAVTMG  100

Query  187  KDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFAKRSANKV  321
            +DL   +++++                 S+    I+D+KE    F    F  A+R+ANK 
Sbjct  101  RDLGMKYVEIEGGSLIVIKKVKNPNKDKSAIGSYIHDIKEQNVTFYECKFQHARRAANKS  160

Query  322  AHLLTRETL  348
            AH L  E L
Sbjct  161  AHNLASERL  169



>ref|XP_003616537.1| hypothetical protein MTR_5g081540 [Medicago truncatula]
Length=122

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 47/95 (49%), Gaps = 16/95 (17%)
 Frame = +1

Query  151  EAIGVREALKWIKDLQYDFIQLQ----------LY-----SSFDLIINDVKELAKD-FLN  282
            EA+G+  AL+W+ D+Q+D +  +          LY     S F  II   + L    F N
Sbjct  14   EALGLYLALQWLSDMQFDNVDFETDFNLTVDAFLYDRNDTSEFGCIITSCRSLFNSLFSN  73

Query  283  INFLFAKRSANKVAHLLTRETLFKSDCSVYFFIPF  387
                F +R AN +AH L R+T   +  SVY+ +PF
Sbjct  74   SRVEFFRRQANGIAHALARDTTLLASLSVYYSLPF  108



>ref|XP_003615225.1| hypothetical protein MTR_5g065390 [Medicago truncatula]
Length=365

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/72 (31%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +1

Query  13   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKD  192
            LK N+D      + R  +G  LRD EG FV AK +  +G++  +  E +G+   ++W+ D
Sbjct  253  LKCNIDTTFSTPHNRTSVGICLRDDEGIFVLAKIVSFAGVYSAEVGETLGLFHTIQWLSD  312

Query  193  LQYDFIQLQLYS  228
            ++ + I  ++ S
Sbjct  313  MKMNNIDFEVDS  324



>ref|XP_008345353.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=953

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/132 (29%), Positives = 59/132 (45%), Gaps = 19/132 (14%)
 Frame = +1

Query  4    LGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKW  183
             G +K+N DAA    +RR G+G+V RD  G   AA              E I +R AL  
Sbjct  794  FGTIKINTDAAWXKDSRRAGVGWVGRDFAGVLQAAGGSGTILCQSAAAAEVIAIRTALS-  852

Query  184  IKDLQYDFIQLQLYS-----------------SFDLIINDVKELAKDFLNINFLFAKRSA  312
               +++ F  + + S                 + D I+ D+K LA+ F ++ F F  R +
Sbjct  853  -ACIKHGFNHVIVESDAQKIIHMIRKEVSEDFNLDCILGDIKILARMFTSVTFAFVPRES  911

Query  313  NKVAHLLTRETL  348
            N+ AHL+ +  L
Sbjct  912  NQAAHLVAKYVL  923



>ref|XP_006483194.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=765

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/150 (29%), Positives = 66/150 (44%), Gaps = 28/150 (19%)
 Frame = +1

Query  13   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKP--KEDEAIGVREALKWI  186
            LKLNVDAA+    +++GLG ++RDAEG  +A       G+ +   +E  ++   EA+ W 
Sbjct  614  LKLNVDAAVSTKXQKVGLGAIVRDAEGKILAV------GIKQAQFRERVSLAEAEAIHWG  667

Query  187  KDLQYDFIQLQLYSSFDL-------------------IINDVKELAKDFLNINFLFAKRS  309
              +        L    D                    I++DV+  +KDF  + F F  R+
Sbjct  668  LQVANQISSSSLIVESDCKEVVELLNNTKGSRTEIHWILSDVRRESKDFKQVQFSFIPRT  727

Query  310  ANKVAHLLTRETLFKSDCSVYFFIPFPSIV  399
             N  AH L +  L  S   V+    FP+ V
Sbjct  728  CNTYAHALAKFALRNSSTDVWVGT-FPAEV  756



>ref|XP_010680467.1| PREDICTED: uncharacterized protein LOC104895604 [Beta vulgaris 
subsp. vulgaris]
Length=349

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 57/133 (43%), Gaps = 18/133 (14%)
 Frame = +1

Query  1    PLGWLKLNVDAAL-DYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREAL  177
            P G +KLN DA+L D G   +GLG V RD+EG    A    +   + P+  E   +  A 
Sbjct  178  PAGVIKLNTDASLADEG--WVGLGVVARDSEGKVCFAATKRVRAFWPPEVAECKAIYMAT  235

Query  178  KWIKDLQYDFIQLQ---------------LYSSFDLIINDVKELAKDFLNINFLFAKRSA  312
            +  K   Y  +  +                +S  D I+ D+  +   F +++F   +R  
Sbjct  236  RLAKAHGYGDVIFESDSLVATKRLTKAAIFFSDLDAILGDILSMCNAFSSVSFSHVRRDG  295

Query  313  NKVAHLLTRETLF  351
            N VAH L R   F
Sbjct  296  NSVAHNLARVVPF  308



>ref|XP_010682311.1| PREDICTED: uncharacterized protein LOC104897185 [Beta vulgaris 
subsp. vulgaris]
Length=345

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 62/128 (48%), Gaps = 20/128 (16%)
 Frame = +1

Query  7    GWLKLNVDAAL--DYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            GW+K NVDA +  D+G   +G+G V RD  G  +    +     ++ +  EA  V E ++
Sbjct  193  GWVKCNVDAGMVADFG---VGVGAVCRDEVGEVLGCAVLQQHVGWEMRVAEARAVFEGVR  249

Query  181  WIKDL-------QYDFIQL--------QLYSSFDLIINDVKELAKDFLNINFLFAKRSAN  315
              K+L       + D +Q+           S F LII D+ E  K F  + + F KR+ N
Sbjct  250  LAKNLGVRKLIVESDCLQVISALKSKSTGASDFYLIIEDIPEFVKFFNVVVWSFVKRTGN  309

Query  316  KVAHLLTR  339
            KVAH++  
Sbjct  310  KVAHMMAH  317



>ref|XP_003630976.1| hypothetical protein MTR_8g105730 [Medicago truncatula]
Length=306

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 60/126 (48%), Gaps = 16/126 (13%)
 Frame = +1

Query  13   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKD  192
            LK NVDA+       +G G  +RD    F+ AK +  + +      EA+G+   ++W+++
Sbjct  170  LKCNVDASFSEALNCVGFGLCIRDEYRNFIKAKTLWSNPVCSSDVGEALGLYHDIQWVRE  229

Query  193  LQYDFIQLQL---------------YSSFDLIINDVKELAKD-FLNINFLFAKRSANKVA  324
            LQ   +  ++                S F  ++++ ++ + D F N    F++R +N VA
Sbjct  230  LQLSNVDFEMDAKKVVDYFNKGRNDISEFGAVMDECRKNSIDYFENSKVEFSRRQSNVVA  289

Query  325  HLLTRE  342
            H L +E
Sbjct  290  HALAQE  295



>ref|XP_010686173.1| PREDICTED: uncharacterized protein LOC104900455 [Beta vulgaris 
subsp. vulgaris]
Length=225

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/135 (30%), Positives = 58/135 (43%), Gaps = 23/135 (17%)
 Frame = +1

Query  1    PLGW-------LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAI  159
            P GW       +K+N DA    G+   G+G V RD  G  +A          +P+  EA 
Sbjct  64   PTGWSKPKASYVKVNTDAG-QIGSLGCGIGVVCRDEFGEVLATGTFEHQVESEPRVAEAK  122

Query  160  GVREALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFL  294
             +   +K   +L Y  ++++                 S F+LII+DV  L   F N+   
Sbjct  123  AIFYGMKLALELGYSCVEVESDSLMAIQALRSDKGGSSEFNLIIDDVLALVSSFNNVIRS  182

Query  295  FAKRSANKVAHLLTR  339
            F KR  NKV H+LT 
Sbjct  183  FVKRLRNKVTHMLTH  197



>ref|XP_009799002.1| PREDICTED: uncharacterized protein LOC104245133 [Nicotiana sylvestris]
Length=184

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/141 (27%), Positives = 63/141 (45%), Gaps = 17/141 (12%)
 Frame = +1

Query  13   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKD  192
            +KLN D A    N   GLG   R+  G ++       S +  P   E + + E LK  K+
Sbjct  2    IKLNCDGAFSSNNNVAGLGGAFRNNNGDWIMGFH-KASQIISPTHAELMALLEGLKIAKE  60

Query  193  LQYDFIQLQLYSSFDLIINDVKELAKDFLNI----NFLFAK----------RSANKVAHL  330
            +  +F+ L++ +    +I  + E + +F NI     +L  +          R  N+VAH+
Sbjct  61   M--NFLNLEIETDCTNVIKLIYEDSYNFSNIVSEYRWLMHQLKLPHLKHNFREGNEVAHM  118

Query  331  LTRETLFKSDCSVYFFIPFPS  393
            L +E +     +  FF P PS
Sbjct  119  LAKEAIKNPPSTKCFFHPCPS  139



>ref|XP_002524117.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38327.1| conserved hypothetical protein [Ricinus communis]
Length=91

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 38/84 (45%), Gaps = 14/84 (17%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P    K+NVDAA              RD+ G FV AK   ISG   P   EA  VREAL 
Sbjct  4    PSDMYKMNVDAA--------------RDSFGLFVMAKHGCISGPLNPTLAEASSVREALS  49

Query  181  WIKDLQYDFIQLQLYSSFDLIIND  252
            WIK      IQ++L S    + + 
Sbjct  50   WIKQAGLSHIQVELDSQMGALCSS  73



>ref|XP_002526185.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36189.1| conserved hypothetical protein [Ricinus communis]
Length=180

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 45/84 (54%), Gaps = 8/84 (10%)
 Frame = +1

Query  4    LGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKW  183
            +G++K N+DA++      +  G V RDA+G F+ A+   I+ +  P   EA+  REAL W
Sbjct  98   IGYVKCNMDASIYLTKGNIAFGMVTRDADGRFLEARNGLINAIMDPLLAEALSCREALSW  157

Query  184  IKD-------LQYDFIQLQLYSSF  234
            +K        ++YD  Q   + SF
Sbjct  158  LKTAGKEKVLVEYD-CQCVKWCSF  180



>ref|XP_010680493.1| PREDICTED: uncharacterized protein LOC104895631 [Beta vulgaris 
subsp. vulgaris]
Length=192

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 62/126 (49%), Gaps = 16/126 (13%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G  KLN DA++   ++ +G+G V+RD+EG  + A    + G+   +  EA+  R  L+ +
Sbjct  38   GVYKLNTDASM-IKDKGIGMGGVVRDSEGDVMLATYCGMVGISNVEVAEALSARHGLQVV  96

Query  187  -----KDLQYDFIQLQLY----------SSFDLIINDVKELAKDFLNINFLFAKRSANKV  321
                 ++L  +    +LY          S F  I+ D+ + A     I+F   KR  NKV
Sbjct  97   VEAGLRNLIVEVDCKKLYNHLHARISEVSLFGKIVADILDYASHCSYISFSHVKRQGNKV  156

Query  322  AHLLTR  339
            AHLL +
Sbjct  157  AHLLAQ  162



>ref|XP_010673165.1| PREDICTED: uncharacterized protein LOC104889605 [Beta vulgaris 
subsp. vulgaris]
Length=188

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 56/133 (42%), Gaps = 18/133 (14%)
 Frame = +1

Query  1    PLGWLKLNVDAAL-DYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREAL  177
            P G +KLN DA+L D G   +GLG V RD+EG    A    +   + P+  E   +  A 
Sbjct  33   PAGAIKLNTDASLADEG--WVGLGVVARDSEGKVCFAAARRVRAFWPPEVAECKAIYMAT  90

Query  178  KWIKDLQYDFIQLQ---------------LYSSFDLIINDVKELAKDFLNINFLFAKRSA  312
            +  K   Y  +  +                 S  D I+ D+  +   F +++F   +R  
Sbjct  91   RLAKAHGYRDVIFESDSLVATKRLTKAAIFLSDLDAILGDILSMCNAFSSVSFSHVRRDG  150

Query  313  NKVAHLLTRETLF  351
            N VAH L R   F
Sbjct  151  NSVAHNLARVVPF  163



>ref|XP_003627791.1| hypothetical protein MTR_8g038340 [Medicago truncatula]
 gb|AET02267.1| hypothetical protein MTR_8g038340 [Medicago truncatula]
Length=248

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/69 (32%), Positives = 39/69 (57%), Gaps = 0/69 (0%)
 Frame = +1

Query  16   KLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDL  195
            K NVDA+  +   ++GL   +RD EG FV  K   ++ L     +EA+G+   L W++D+
Sbjct  177  KCNVDASFSHSFNQVGLRLCIRDDEGRFVLVKTEWLTPLLYVDSEEALGLLSTLHWVRDM  236

Query  196  QYDFIQLQL  222
            ++  +  +L
Sbjct  237  RFSIVDFEL  245



>gb|KEH18875.1| hypothetical protein MTR_8g031080 [Medicago truncatula]
Length=398

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 61/127 (48%), Gaps = 12/127 (9%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G LK NVDA+      ++G+G  +RD EG FV AK +    L      EA+G        
Sbjct  274  GRLKCNVDASFSSSTNKVGVGMCIRDEEGHFVRAKTMWHKPLCSVDIGEALG--------  325

Query  187  KDLQYDFIQLQLYSSFDLIINDVKELAKDFLNINFL-FAKRSANKVAHLLTRETLFKSDC  363
              L +D     + + F + ++  +     FL  + + F++R AN+VAH L +  L++   
Sbjct  326  --LHHDIGNGDI-TEFGINMDSNRHYCSLFLPKSHVEFSRRQANRVAHELAKAALYEPSF  382

Query  364  SVYFFIP  384
             ++  +P
Sbjct  383  RIFDDVP  389



>gb|KEH16790.1| hypothetical protein MTR_0093s0070 [Medicago truncatula]
Length=205

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +1

Query  61   GLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQLYS  228
            G+G  +RD EGTF+ AK + IS +      EA+G+ ++L+W+ D+Q+D +   L S
Sbjct  126  GIGICIRDDEGTFMLAKTVYISPMCSVVVGEALGLFQSLQWLSDMQFDNVDFTLDS  181



>ref|XP_002468357.1| hypothetical protein SORBIDRAFT_01g044485 [Sorghum bicolor]
 gb|EER95355.1| hypothetical protein SORBIDRAFT_01g044485 [Sorghum bicolor]
Length=212

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 53/113 (47%), Gaps = 4/113 (4%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P  ++K NVDAA+     +  +  V RD  G +VAA  + I GL  P   EA+   EA+ 
Sbjct  76   PEAFVKFNVDAAVARAEDKGTVTVVCRDNVGNYVAASAMVIDGLTDPSSLEALACNEAIS  135

Query  181  WIKDLQYDFIQLQLYSSFDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTR  339
               D+    +Q +    F L + ++K  +  F  + F    R +N  AH L +
Sbjct  136  LAMDIG---VQAKFVCLF-LSVEEIKARSTLFQEVVFKHEGRESNCEAHALAK  184



>gb|KHN31016.1| hypothetical protein glysoja_020314, partial [Glycine soja]
Length=142

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 56/132 (42%), Gaps = 19/132 (14%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P  ++K N DA++     + GL   ++D +GTF++      SG+  P E EA  ++ AL 
Sbjct  3    PYDFVKCNTDASIFQDQSKFGLATSVQDTDGTFISVMSSWFSGIPSPLEAEARSLQLALD  62

Query  181  WIKDLQYDFIQLQLYSSFDLIINDVK-----------------ELAKDFLNINFLFAKRS  309
            W    + +   L L +    IIN +K                 E    F N    F  + 
Sbjct  63   WQSSQKQN--NLILETDCKQIINCIKAKKFQNNEVGDILRNCVEKISTFQNCIVQFVTQQ  120

Query  310  ANKVAHLLTRET  345
            AN+V H L R +
Sbjct  121  ANQVVHSLARAS  132



>ref|XP_003607874.1| hypothetical protein MTR_4g083950 [Medicago truncatula]
Length=133

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 52/119 (44%), Gaps = 16/119 (13%)
 Frame = +1

Query  76   LRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQL-----------  222
            +RD  GTFV  K    S + +    EA G+   L+W+ +L    I  ++           
Sbjct  3    IRDEHGTFVLTKTDWFSPICEVHIGEAFGLISTLEWVHELNLGSIDFEMDAKRVVDSFLS  62

Query  223  ----YSSFDLIINDVKELAKDFL-NINFLFAKRSANKVAHLLTRETLFKSDCSVYFFIP  384
                 + F +II + K L + +  N    F +R AN++AH L +  L  +   V F IP
Sbjct  63   SRHDVTEFGIIIQNCKTLFRHYYENSTVEFVRRQANEIAHKLAKTALLSTSLQVLFEIP  121



>ref|XP_003614550.1| hypothetical protein MTR_5g055330 [Medicago truncatula]
Length=138

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 46/90 (51%), Gaps = 2/90 (2%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G  K N+DAA       + LG  + D  G F  AK IP+  +      EA+G+  AL+W+
Sbjct  25   GRFKCNIDAAFLNKQNVICLGMCICDEGGVFGLAKVIPLPVMHNVIVGEAMGLYHALEWL  84

Query  187  KDLQYDFIQLQL--YSSFDLIINDVKELAK  270
             D+++D +   L   S+ D  IN   ++++
Sbjct  85   SDMRFDNVDFALDSKSTMDAFINPRPDISE  114



>gb|KHN23277.1| hypothetical protein glysoja_040246, partial [Glycine soja]
Length=147

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/116 (26%), Positives = 51/116 (44%), Gaps = 15/116 (13%)
 Frame = +1

Query  13   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKD  192
            ++ NVDAA+    ++ G G  LRD +G F+ A     +G+  P+E EA  + +A+ W   
Sbjct  32   VECNVDAAIFEDVKQFGAGLCLRDEKGNFLKAFTATTTGVPTPREAEAWALHQAINWTHH  91

Query  193  LQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFAKRSAN  315
            L    +  +L                + F  I++  + +  +  N    F KR AN
Sbjct  92   LGMQNVIFELDCKLVVDNMVNNKKGSTEFHAILHRCRAILSNSPNSRMSFEKRQAN  147



>gb|KHN00089.1| hypothetical protein glysoja_046125, partial [Glycine soja]
Length=147

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 61/143 (43%), Gaps = 15/143 (10%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            PLG LK N+  A         L   +RD  G FV A            E +A+ +  AL+
Sbjct  5    PLGTLKCNIGVAFVKEENSFKLVVFIRDDRGQFVMALSHTSPFKLLIHERKALAMLVALQ  64

Query  181  WIKDLQYDFIQL---------QLY------SSFDLIINDVKELAKDFLNINFLFAKRSAN  315
            W+KDL+ D I +         ++Y      S + +I+++ + + +D  N    F  R AN
Sbjct  65   WLKDLEIDDIIIESDCLQVENEVYNCRSDKSKYGVILSNCRIMLRDLQNFWVCFVGRQAN  124

Query  316  KVAHLLTRETLFKSDCSVYFFIP  384
             V H L R    + D   +  +P
Sbjct  125  SVTHSLDRALNSQVDPHYFRHVP  147



>ref|XP_003623221.1| hypothetical protein MTR_7g067370 [Medicago truncatula]
Length=126

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/109 (27%), Positives = 51/109 (47%), Gaps = 1/109 (1%)
 Frame = +1

Query  70   FVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQLYSSFDLIIN  249
              + D +G F+ AK   ++ L   K  E +G+   L+W++DLQ   +  +L S   ++I 
Sbjct  1    MCIHDKDGRFMLAKIEWMASLHDVKLGEVLGLLSVLRWVRDLQLSIVDFELDSKIVVVIK  60

Query  250  DVKE-LAKDFLNINFLFAKRSANKVAHLLTRETLFKSDCSVYFFIPFPS  393
            D +  LA D  +    F +R    V+H L R   + +   ++    F S
Sbjct  61   DCRSMLAYDLASSVVRFIRRQVKVVSHSLPRMATYHASFCIHILWNFFS  109



>ref|XP_003615350.1| hypothetical protein MTR_5g066880 [Medicago truncatula]
Length=110

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 42/94 (45%), Gaps = 16/94 (17%)
 Frame = +1

Query  151  EAIGVREALKWIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFL-N  282
            EA+G+  AL+W+ D+Q+D +  +                 S F  II+    L   F  N
Sbjct  13   EALGMHSALQWLSDMQFDNVDFETNSKLTAQAFLSTRNDLSEFGCIISSCCSLFNTFFSN  72

Query  283  INFLFAKRSANKVAHLLTRETLFKSDCSVYFFIP  384
                F +R  N V H L RE    +  +VYF+IP
Sbjct  73   SRMEFVRRQVNVVVHALAREVTSLTSPAVYFYIP  106



>ref|XP_002529707.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32673.1| conserved hypothetical protein [Ricinus communis]
Length=72

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 32/57 (56%), Gaps = 0/57 (0%)
 Frame = +1

Query  58   MGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQLYS  228
            +G+GF+LRD  G  ++     + G    KE EA  + EA+ W+K L Y  +  +LYS
Sbjct  2    VGMGFILRDEIGQLLSCDSRSMHGTCTSKEAEAKALWEAISWVKSLHYTQVIFELYS  58



>ref|XP_003612943.1| hypothetical protein MTR_5g030850 [Medicago truncatula]
Length=82

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 6/74 (8%)
 Frame = +1

Query  13   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKD  192
            LK NVD +  + N  MG+   +RD  G F+ AK   +S +   K++EA  + +A+KW+  
Sbjct  2    LKCNVDVS--FSNNEMGICMYIRDHNGNFMRAKTTNLSAILLVKDNEAYNLLQAIKWV--  57

Query  193  LQYDFIQLQLYSSF  234
                 I L LYS+ 
Sbjct  58   --VSSILLLLYSNL  69



>ref|XP_006491472.1| PREDICTED: uncharacterized protein LOC102626455 [Citrus sinensis]
Length=1452

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 67/150 (45%), Gaps = 28/150 (19%)
 Frame = +1

Query  13    LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKP--KEDEAIGVREALKWI  186
             LKLNVDAA+   ++++GLG ++RDAEG  +A       G+ +   +E  ++   EA+ W 
Sbjct  1301  LKLNVDAAVSTKDQKVGLGAIVRDAEGKILAV------GIKQAQFRERVSLAEAEAIHWG  1354

Query  187   KDLQYDFIQLQLYSSFDL-------------------IINDVKELAKDFLNINFLFAKRS  309
               +        L    D                    I++DV+  +K+F  + F F  R+
Sbjct  1355  LQVANQISSSSLIVESDCKEVVELLNNTKGSRTEIHWILSDVRRESKEFKQVQFSFIPRT  1414

Query  310   ANKVAHLLTRETLFKSDCSVYFFIPFPSIV  399
              N  AH L +  L  S   V+    FP+ V
Sbjct  1415  CNTYAHALAKFALRNSSTDVWVGT-FPAEV  1443



>ref|XP_003601635.1| hypothetical protein MTR_3g083790 [Medicago truncatula]
Length=175

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 47/99 (47%), Gaps = 18/99 (18%)
 Frame = +1

Query  151  EAIGVREALKWIKDLQYDFIQL-----QLYSSFDLIINDVKELA-----------KDFLN  282
            EAIG+  AL+WI DLQ+D +       Q+  SF   ++D  EL              F N
Sbjct  4    EAIGLHTALQWISDLQFDNVDFVLDSKQIVDSFHTGVDDDSELGCIITACRQLFQDSFQN  63

Query  283  INFLFAKRSANKVAHLLTRETLFKSDCSVYFFIPFPSIV  399
             +  F +R AN+VAH L R  +  SD S   +   PS +
Sbjct  64   THVEFNRRQANEVAHKLAR--VAPSDPSPTIYDDVPSCI  100



>ref|XP_003596081.1| hypothetical protein MTR_2g065980 [Medicago truncatula]
Length=122

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 50/105 (48%), Gaps = 16/105 (15%)
 Frame = +1

Query  73   VLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQL----------  222
             +RD  GTFV AK    S + +   +EA+G+  AL+W+ +L    I  ++          
Sbjct  2    CIRDEHGTFVLAKTDWFSPICEVHIEEALGLISALEWVHELNLGPIDFEMDVKRVVDSFL  61

Query  223  -----YSSFDLIINDVKELAKDFL-NINFLFAKRSANKVAHLLTR  339
                  + F +II + K L + +  N    F +R ANKVAH L +
Sbjct  62   SSRHDVTEFGIIIQNCKTLFRHYYENSTVEFVRRQANKVAHKLAK  106



>gb|EAZ40370.1| hypothetical protein OsJ_24816 [Oryza sativa Japonica Group]
Length=613

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 57/146 (39%), Gaps = 17/146 (12%)
 Frame = +1

Query  13   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKD  192
            LKLN+D A    N   G GF+LRD EG  V A+   I  +      EA+    AL+ + +
Sbjct  455  LKLNIDGAFQAANLSGGWGFILRDHEGNGVLARAGRIELVHDALSAEAVACLHALRAVLN  514

Query  193  LQYDFIQLQ-----LYSSFDLIINDVKELAKDFLNINFL-----------FAKRSANKVA  324
              + +  ++     L S+ D    D       F  I  L           FA  S N  A
Sbjct  515  HGFSYFSVETDSSILVSALDSACYDQSTAGVTFKQIRTLLRMDLGMIKVSFANHSCNSCA  574

Query  325  HLLTRETLFKSDCSVYFFI-PFPSIV  399
            H L R+      C +  +  P P  V
Sbjct  575  HELARKGASWDPCHMSIWADPLPDFV  600



>ref|XP_004963954.1| PREDICTED: uncharacterized protein LOC101785093, partial [Setaria 
italica]
Length=1236

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 37/130 (28%), Positives = 63/130 (48%), Gaps = 8/130 (6%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G  K+N DAA+D    +  +  V R+  G FVAA  + +  +  P+  EA+   EAL   
Sbjct  156  GLCKINTDAAVDGARSKGAIAVVCRENNGEFVAASAMTVPNVTDPETLEAMACLEALALA  215

Query  187  KDLQYDFIQLQLYSSFDL-IINDVKELAKDFLNINFLFAKRSANKVAHLLT----RETLF  351
            +D     I+  + +S  L ++ ++KE+ + F    F    R  ++ AH LT    R+ ++
Sbjct  216  EDCA---IRKMIVASDCLNVVRNIKEMPRSFECAKFAHEGREFSREAHYLTKHMDRQWMY  272

Query  352  KSDCSVYFFI  381
             +D     FI
Sbjct  273  NADRRSKVFI  282



>gb|ABA99010.1| expressed protein [Oryza sativa Japonica Group]
 gb|EAZ20576.1| hypothetical protein OsJ_36185 [Oryza sativa Japonica Group]
Length=268

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 53/126 (42%), Gaps = 19/126 (15%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            GW+K+N D + D  N   G+G V+RD+ G  V A    I       E E +  +E L   
Sbjct  115  GWMKINTDGSCDSKNGNGGVGAVVRDSSGRVVLALSRHIDRCGSALEAELLACKEGLSLA  174

Query  187  KDLQYDFIQL-----------------QLYSSFDLIINDVKELAKDFLNINFLFAKRSAN  315
              LQY  + L                 ++ S    II +   L +    I F   +RS N
Sbjct  175  --LQYTLLPLVLETDCLEALKLLKSKEKVMSPEVFIIREANSLLQGNREIKFSKGQRSQN  232

Query  316  KVAHLL  333
            +V+HLL
Sbjct  233  RVSHLL  238



>gb|EEC75227.1| hypothetical protein OsI_11496 [Oryza sativa Indica Group]
Length=1059

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 62/139 (45%), Gaps = 22/139 (16%)
 Frame = +1

Query  1     PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAI--GVREA  174
             P+GW+K+NVD A  + +   G G V+RD  G+ +      +S   +  E  A   G+R A
Sbjct  922   PVGWVKINVDGAFVHQSGEAGAGVVIRDHLGSVL------LSSWKEEAEATACMEGIRLA  975

Query  175   LKWIK---DLQYDFIQLQL--------YSSFDLIINDVKELAKDFLNINFLFAKRSANKV  321
              +W+K    L+ D+  + L         SS   I+ DVK        +     KR AN V
Sbjct  976   AEWVKLPAILETDYANIGLALETMATDRSSLWHIMRDVKSAFALLPGVQISRVKRGANGV  1035

Query  322   AHLLTRET---LFKSDCSV  369
             AH L  E    L   DC+ 
Sbjct  1036  AHSLAPECVSELIALDCTC  1054



>gb|KHN09137.1| hypothetical protein glysoja_025598, partial [Glycine soja]
Length=85

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G LKLNVD A+   +   G+   + D +GTF+ AK     G+  PKE EA    ++L WI
Sbjct  7    GMLKLNVDVAIFQQHSSFGVRLCISDEKGTFLQAKTQWKHGIPVPKEVEAWAFLQSLLWI  66

Query  187  KDLQYDFIQLQLYSS  231
            + L+   I +++ S+
Sbjct  67   QQLECHNICIEVASN  81



>ref|XP_003621044.1| hypothetical protein MTR_7g006490 [Medicago truncatula]
Length=263

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 53/124 (43%), Gaps = 16/124 (13%)
 Frame = +1

Query  16   KLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDL  195
            K  +DA+      ++G+G    D  G FV AK+   S L      E +G+   LKW   L
Sbjct  122  KCFIDASFSSAMNKVGIGMCFHDDAGDFVLAKKSWFSPLCDVNIGEVVGLHTILKWTSHL  181

Query  196  QYDFIQLQL---------------YSSFDLIINDVKELAKD-FLNINFLFAKRSANKVAH  327
            Q+D + L L                S F  II + ++L +  F N +  F +R AN + +
Sbjct  182  QFDNVDLALDSKKVVDAFRRCVGDSSEFGCIIVECRQLFQSRFQNSHVEFNRRQANGITY  241

Query  328  LLTR  339
             L  
Sbjct  242  ELAH  245



>ref|XP_003629565.1| hypothetical protein MTR_8g079540 [Medicago truncatula]
 gb|AET04041.1| hypothetical protein MTR_8g079540 [Medicago truncatula]
Length=121

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 41/76 (54%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P  ++K NVDA+      R+G+G  LRD    FV AK I +  +      EA+G+  AL+
Sbjct  31   PNSFVKCNVDASFSEHYNRVGIGMCLRDEFCMFVGAKMIWLQPIMLVDTGEALGLLAALE  90

Query  181  WIKDLQYDFIQLQLYS  228
            W ++L++  I   L S
Sbjct  91   WARELEFKKIIFCLNS  106



>ref|XP_008358038.1| PREDICTED: uncharacterized protein LOC103421772 [Malus domestica]
Length=244

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 66/145 (46%), Gaps = 16/145 (11%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVRE--ALK  180
            G +KLN D A D  +   G   ++ D++G F+A        +  P   EAI VRE  AL 
Sbjct  92   GQVKLNXDGAWDATHLVGGXRAIIXDSDGNFLAGLSKSSLYISSPFFXEAIAVREGLALA  151

Query  181  WIKDLQ--------YDFIQLQLYSSFD-----LIINDVKELAKDFLNINFLFAKRSANKV  321
            + +  Q           +Q   YSS D     LI  D + +A     ++F   +R AN+V
Sbjct  152  YSRGFQNIIVESDSXQIVQALCYSSPDLSXVGLIXEDSRAIAXAITGVSFTHIRRQANEV  211

Query  322  AHLLTRETLFKSDCSVYFFIPFPSI  396
            AH   R +   +  +++F  P P+I
Sbjct  212  AHRXARYSFSSTIPALWFEEP-PNI  235



>ref|XP_006473914.1| PREDICTED: uncharacterized protein LOC102629934 [Citrus sinensis]
Length=304

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 59/126 (47%), Gaps = 15/126 (12%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P GW K+NVDAA+    +R GLG V+R++EG  +AA   P   L K    EA   +  L+
Sbjct  149  PEGWFKVNVDAAVKMEQQRTGLGIVIRNSEGKVMAAAMKPSKFLSKVDAAEAEAAKFGLE  208

Query  181  WIKDLQY-------------DFIQLQLYSSFDL--IINDVKELAKDFLNINFLFAKRSAN  315
              +++               + I L+  +  ++  +I+++++  K    +      R  N
Sbjct  209  IAENVGCFPLIIESDSKEVVELISLKKSTRTEIFWVISEIQDRMKRLKKVKIQHTPRGCN  268

Query  316  KVAHLL  333
             +AH L
Sbjct  269  SLAHSL  274



>ref|XP_007213514.1| hypothetical protein PRUPE_ppa020664mg, partial [Prunus persica]
 gb|EMJ14713.1| hypothetical protein PRUPE_ppa020664mg, partial [Prunus persica]
Length=171

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/132 (26%), Positives = 59/132 (45%), Gaps = 16/132 (12%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P G  KLNVDAA        G+G V+R+ +G  +AA  +P++     K  E +     +K
Sbjct  39   PAGKYKLNVDAAFIPETGVGGIGAVVRNDKGEVMAAMALPLASATSSKHAEIMAFLFGMK  98

Query  181  WIKDLQYDFI----------------QLQLYSSFDLIINDVKELAKDFLNINFLFAKRSA  312
            + +D     I                + + ++S   +I D+K   + F ++   ++ R  
Sbjct  99   FARDAGCSSILIESDSQGVVNDVKKDEEESWASDGHLIGDIKRSLQHFEDVIISYSPRGV  158

Query  313  NKVAHLLTRETL  348
            N+VAH L +  L
Sbjct  159  NQVAHFLAKHAL  170



>ref|XP_007217601.1| hypothetical protein PRUPE_ppa018407mg [Prunus persica]
 gb|EMJ18800.1| hypothetical protein PRUPE_ppa018407mg [Prunus persica]
Length=356

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/144 (26%), Positives = 64/144 (44%), Gaps = 19/144 (13%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P G  KLNVDAA        G+  V+R+ +G  +AA  +P++     K  E +     +K
Sbjct  208  PAGKYKLNVDAAFIPETGVGGIDVVVRNDKGEVMAAMALPLASATSSKHAEIMAFLFEMK  267

Query  181  WIKDLQYDFI----------------QLQLYSSFDLIINDVKELAKDFLNINFLFAKRSA  312
            +  D  +  I                + + ++S   +I+D+K   + F ++   F+ R  
Sbjct  268  FAWDAGFSSILIESDSQGVVNDVKKDEEESWASDGHLIDDIKRSLQHFEDVIISFSPRGG  327

Query  313  NKVAHLLTRETLFKSDCSVYFFIP  384
            N+VAH L +  L   +C+    IP
Sbjct  328  NQVAHFLAKHAL---NCNTMLMIP  348



>gb|ABK28206.1| unknown [Arabidopsis thaliana]
Length=293

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/132 (26%), Positives = 58/132 (44%), Gaps = 18/132 (14%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGT--FVAAKEIPISGLFKPKEDEAIGVREA  174
            P  W+K N DA     N R G+G++LR+  G   ++ A+ +P +      E EA+  R A
Sbjct  141  PYQWVKCNTDATWQLENPRCGIGWILRNESGGVLWMGARALPRTKNVLEAELEAL--RWA  198

Query  175  LKWIKDLQYDFIQLQ--------------LYSSFDLIINDVKELAKDFLNINFLFAKRSA  312
            +  +    Y  I  +               + +    + D+++L   F  + F F  R  
Sbjct  199  VLTMSRFNYKRIIFESDAQALVNLLNSDDFWPTLQPALEDIQQLLHHFEEVKFEFTPRGG  258

Query  313  NKVAHLLTRETL  348
            NKVA  + RE++
Sbjct  259  NKVADRIARESI  270



>ref|XP_003604221.1| hypothetical protein MTR_4g006750 [Medicago truncatula]
Length=197

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 60/135 (44%), Gaps = 28/135 (21%)
 Frame = +1

Query  58   MGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQL-----  222
            +G+G  +RD E  ++  K   ++ L      EA+G+  A+ W++DLQ   +  +L     
Sbjct  73   IGIGVCIRDDECRYLLVKTEWMTPLLDVDLSEALGLLSAMYWVRDLQLSILDFELDSKTV  132

Query  223  ----------YSSFDLIINDVKE-LAKDFLNINFLFAKRSANKVAHLLTRETLFKSDCSV  369
                       S+F  +IND +  LA +    +  F +R  N+VAH         S  S 
Sbjct  133  VDSLYGSNCGVSNFSAVINDCRRLLASNLATSDVRFIRRQTNEVAH---------SFASF  183

Query  370  YFFIPFPSIV*YISS  414
            +  I  PS   YIS+
Sbjct  184  HIHIRIPS---YIST  195



>ref|NP_180979.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 gb|AAC27408.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
 gb|ABE65469.1| hypothetical protein At2g34320 [Arabidopsis thaliana]
 gb|AEC08958.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
Length=292

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/132 (26%), Positives = 58/132 (44%), Gaps = 18/132 (14%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGT--FVAAKEIPISGLFKPKEDEAIGVREA  174
            P  W+K N DA     N R G+G++LR+  G   ++ A+ +P +      E EA+  R A
Sbjct  141  PYQWVKCNTDATWQLENPRCGIGWILRNESGGVLWMGARALPRTKNVLEAELEAL--RWA  198

Query  175  LKWIKDLQYDFIQLQ--------------LYSSFDLIINDVKELAKDFLNINFLFAKRSA  312
            +  +    Y  I  +               + +    + D+++L   F  + F F  R  
Sbjct  199  VLTMSRFNYKRIIFESDAQALVNLLNSDDFWPTLQPALEDIQQLLHHFEEVKFEFTPRGG  258

Query  313  NKVAHLLTRETL  348
            NKVA  + RE++
Sbjct  259  NKVADRIARESI  270



>gb|KHN02823.1| hypothetical protein glysoja_043630 [Glycine soja]
Length=148

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P  +LK N+DAA+   N   G+G  LRD  G F  A  +  +G    KE EA  + +A+K
Sbjct  32   PHNFLKCNLDAAIFNDNNLFGVGICLRDNNGCFFKAITLTANGKPTLKEVEAWALHKAIK  91

Query  181  WIKDL  195
            W + L
Sbjct  92   WTQQL  96



>ref|XP_009145555.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=900

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/141 (26%), Positives = 63/141 (45%), Gaps = 14/141 (10%)
 Frame = +1

Query  4    LGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKW  183
            +GW+K N D A +    +   G+V+RD  G +  + +          E E   +  AL+ 
Sbjct  745  IGWIKCNTDGAYNSTQHQTSAGWVIRDENGIYKGSAQARGRTRNDALECELQAILMALQH  804

Query  184  IKDLQYDFIQLQ--LYSSFDLI------------INDVKELAKDFLNINFLFAKRSANKV  321
               L Y  I ++     + D+I              +++  A  F +I+F + +RSANKV
Sbjct  805  CWSLGYRKIIMESDCQKAIDIINKKRLHFAYYNWKREIQWWANKFQDISFQWTRRSANKV  864

Query  322  AHLLTRETLFKSDCSVYFFIP  384
            A LL +      D S ++++P
Sbjct  865  ADLLAKRLEDGVDFSFHYYVP  885



>gb|KHN07187.1| hypothetical protein glysoja_038049 [Glycine soja]
Length=108

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 50/98 (51%), Gaps = 2/98 (2%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G  KLN    +   +   G G  LR   G FV A+   ++ +  PKE E+ G+ + + WI
Sbjct  6    GCFKLNTHVTIFQDHSCFGAGLCLRCYHGNFVKARTQWLTRILHPKEAESWGLLQGILWI  65

Query  187  KDLQYDFIQLQLYSSFDLIINDVKELAKDFLNINFLFA  300
            ++L    I +++   + L+++D+     +F+++  + +
Sbjct  66   QELGLQDITIEV--GYKLVVDDLMCCKDNFIDVETIIS  101



>gb|EMS64578.1| hypothetical protein TRIUR3_16998 [Triticum urartu]
Length=337

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 57/119 (48%), Gaps = 18/119 (15%)
 Frame = +1

Query  91   GTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQLYSSFDLIIND------  252
            GT+V +  +   GL  P   EA+  REA   +KDL+     + + S    ++ND      
Sbjct  212  GTYVGSSALVFHGLTDPTTLEALACREATALVKDLR--ITNICVASDCLSVVNDIHTGTL  269

Query  253  ------VKE---LAKDFLNINFLFAKRSANKVAHLLTRETLFKSDC-SVYFFIPFPSIV  399
                  VKE   +A  FL+ +F+   R +NK AH L R TL   +   V+FF PF + +
Sbjct  270  GITAPVVKEINNIAIYFLSCSFIHEGRLSNKEAHSLARHTLHLDEGRHVWFFNPFDTAI  328



>ref|XP_003627352.1| hypothetical protein MTR_8g022030 [Medicago truncatula]
Length=334

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 57/129 (44%), Gaps = 14/129 (11%)
 Frame = +1

Query  16   KLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDL  195
            K  VD +    + ++G+G  +R ++G FV A+    S L      EAI + + L+W+  +
Sbjct  203  KCKVDDSFSSDHNKVGIGMCIRYSDGGFVLARTTWFSPLCSVDLGEAICLSQVLQWVSSI  262

Query  196  QYDFIQLQLYSSFDLIINDVKELA-KDFLNINFLFAKRSANKVAHLLTRETLFKSDCSVY  372
                        F  II   ++++ K F N    F +R  N VAH LT  T   +  S  
Sbjct  263  M-----------FGSIIQYCRQISHKSFYNSVVEFNRRQKNMVAHELTHATPLNT--SFE  309

Query  373  FFIPFPSIV  399
             FI  P  +
Sbjct  310  LFIGAPMCI  318



>ref|XP_003627584.1| hypothetical protein MTR_8g031800 [Medicago truncatula]
 gb|AET02060.1| hypothetical protein MTR_8g031800 [Medicago truncatula]
Length=113

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 0/78 (0%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G  K N+DA+      ++GL   LRD  G FV A+    + L      EA+ +   L+W+
Sbjct  16   GRSKYNIDASFSSSLNKVGLRMCLRDNTGDFVLAQTDWFAPLCDVDAGEAVRLYTTLEWV  75

Query  187  KDLQYDFIQLQLYSSFDL  240
             D+Q+D+++  L S  D 
Sbjct  76   SDIQFDYVEFALDSKRDF  93



>ref|XP_003636292.1| hypothetical protein MTR_036s0078 [Medicago truncatula]
 ref|XP_003636850.1| hypothetical protein MTR_062s1027 [Medicago truncatula]
Length=158

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 61/147 (41%), Gaps = 22/147 (15%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPK----EDEAIGVREA  174
            G LK NVD           +G  + D E TFV AK + +S    P       E  G+  A
Sbjct  12   GRLKCNVDDLFSNKLNTTCIGIYIHDDECTFVLAKTLSLS--LSPMCFVVMGETTGLFHA  69

Query  175  LKWIKDLQYDFIQLQL---------------YSSFDLIINDVKEL-AKDFLNINFLFAKR  306
            LKW  D+Q++ +   L                + + L+I+  + L    F N  + F +R
Sbjct  70   LKWPSDMQFENVDFALDSKITTDAFHHHRVDVTKYGLVISACRILFNTHFSNSKYEFNRR  129

Query  307  SANKVAHLLTRETLFKSDCSVYFFIPF  387
              N++AH +       +  ++Y+ + F
Sbjct  130  QTNEIAHTIVEVATLSASPNIYYIVFF  156



>ref|XP_006596580.1| PREDICTED: uncharacterized protein LOC102666294 [Glycine max]
Length=216

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 49/92 (53%), Gaps = 3/92 (3%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
              G+LK NVDA +   +++ G G  +RD  G F+ AK     G+  P   EA G+ +A++
Sbjct  109  SFGYLKCNVDATIFNQDQQFGNGMCIRDHNGQFIQAK-TWFQGVSDPTIAEACGLYQAME  167

Query  181  WIKDLQYDFIQLQLYSSFDLIINDVKELAKDF  276
            W+K+   + I  +L + F  +++D     KD 
Sbjct  168  WLKESYNNNIISELDNKF--VVDDFNHNNKDL  197



>gb|KEH17434.1| hypothetical protein MTR_0015s0120 [Medicago truncatula]
Length=366

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 45/94 (48%), Gaps = 9/94 (10%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G  K N+DA+      ++G+   +RD  GTFV AK   IS L      E +G+  AL+W+
Sbjct  278  GRFKCNIDASFSRHLNKIGIDICIRDDSGTFVLAKTEWISPLCDVHVGETLGLLSALEWV  337

Query  187  KDLQYDFIQLQLYSSFDLIINDVKELAKDFLNIN  288
              LQ   I  +L         D K +  +FL+ N
Sbjct  338  HKLQLRPIDFEL---------DAKRVVDNFLSTN  362



>ref|XP_003614633.1| hypothetical protein MTR_5g056500 [Medicago truncatula]
 gb|AES97591.1| hypothetical protein MTR_5g056500 [Medicago truncatula]
Length=108

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 37/70 (53%), Gaps = 0/70 (0%)
 Frame = +1

Query  13   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKD  192
            +K NVDA +       G+   L    G F+ AK     GL +P E EA G++EA KW+  
Sbjct  17   VKCNVDATIFKDQGCYGIDMCLTGDRGEFMRAKTAWYRGLSQPNEAEARGLKEARKWLGT  76

Query  193  LQYDFIQLQL  222
            L+Y  + ++L
Sbjct  77   LRYTSVSIEL  86



>ref|XP_006415078.1| hypothetical protein EUTSA_v10009492mg, partial [Eutrema salsugineum]
 gb|ESQ33431.1| hypothetical protein EUTSA_v10009492mg, partial [Eutrema salsugineum]
Length=88

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 38/68 (56%), Gaps = 2/68 (3%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P  WLK N D++   GN  +G+G+++RD  G  + +    +  +  P + EA+G  +AL+
Sbjct  20   PENWLKCNFDSSDRKGNTTVGVGWIIRDHNGKHITSGNAALRQVRSPLQAEAMGFLQALQ  79

Query  181  --WIKDLQ  198
              WIK  +
Sbjct  80   VIWIKGFR  87



>gb|EEE55133.1| hypothetical protein OsJ_02920 [Oryza sativa Japonica Group]
Length=1049

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 33/113 (29%), Positives = 55/113 (49%), Gaps = 15/113 (13%)
 Frame = +1

Query  1     PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
             P G + +N DAAL   + + GL FV+RD   T + A    I+GL  P+  EA+ +R AL+
Sbjct  936   PPGMVLINSDAALFQASNQTGLAFVIRDHSATCLLAANKRITGLLSPELAEALAIRFALE  995

Query  181   WIKDLQYDFIQL---------------QLYSSFDLIINDVKELAKDFLNINFL  294
               K   +  + +               +  S   +I+ D+K+L  +FL  +F+
Sbjct  996   HAKAEGFQNVLMASDCLSVIKRIQSGARDLSVVGVIVRDIKKLETEFLECSFI  1048



>ref|XP_008222895.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=605

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 37/124 (30%), Positives = 60/124 (48%), Gaps = 14/124 (11%)
 Frame = +1

Query  4    LGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKW  183
            +G  K+NVD AL  G+   G+G V+R+  G F+AA    I   +  ++ E +   E L++
Sbjct  481  VGIYKINVDGALKSGDSIRGVGVVVRNENGDFMAACVRRIQASYGARQMELMATIEGLRF  540

Query  184  IKDLQY----------DFIQLQLYSSFD----LIINDVKELAKDFLNINFLFAKRSANKV  321
              D+ +          D I   L +  +    L+I +VK L  +F  +   +  R +NKV
Sbjct  541  AIDMGFTDAVLEMDAQDCIHSILSTECNGVDGLLIEEVKSLLNNFRAVGCQWTPRCSNKV  600

Query  322  AHLL  333
            AH L
Sbjct  601  AHDL  604



>ref|XP_003635882.1| hypothetical protein MTR_014s0022 [Medicago truncatula]
 ref|XP_003636134.1| hypothetical protein MTR_029s0026 [Medicago truncatula]
 gb|KEH27933.1| hypothetical protein MTR_5g049680 [Medicago truncatula]
Length=107

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 39/72 (54%), Gaps = 0/72 (0%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G  K N+DA+      ++G+G  LRD   TF+ AK   IS L +    EA+G+  AL+W+
Sbjct  16   GRYKCNIDASFSRHLNKVGIGICLRDDTRTFILAKANWISPLREVHIGEALGLLSALEWV  75

Query  187  KDLQYDFIQLQL  222
             DL    I  ++
Sbjct  76   HDLNLGPIDFEM  87



>gb|KEH42462.1| hypothetical protein MTR_1g069475 [Medicago truncatula]
Length=250

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 45/90 (50%), Gaps = 5/90 (6%)
 Frame = +1

Query  13   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKD  192
            LK NVDA        +G GF +RD  G F+ AK +  + +      EA+G+  A++W+ +
Sbjct  151  LKCNVDALFSDALNCVGFGFCIRDEAGNFIRAKTMWSNPVCSTDVGEALGLSHAIRWVHE  210

Query  193  LQ-----YDFIQLQLYSSFDLIINDVKELA  267
            LQ     ++F   ++   F+   ND+ E  
Sbjct  211  LQLTNVDFEFDAKKVVDYFNRGSNDITEFG  240



>gb|KEH31239.1| hypothetical protein MTR_4g094272 [Medicago truncatula]
Length=140

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 1/61 (2%)
 Frame = +1

Query  13   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKD  192
            +K NVDA+      R G+G   RD EG FV AK +  + +    E +A+G+  A++WI D
Sbjct  81   MKCNVDASFSASRNRFGIG-CTRDDEGQFVLAKTMWFALMCSVDEGDALGLYHAMRWISD  139

Query  193  L  195
            L
Sbjct  140  L  140



>ref|XP_006485449.1| PREDICTED: uncharacterized protein LOC102621413 [Citrus sinensis]
Length=2303

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 36/146 (25%), Positives = 69/146 (47%), Gaps = 27/146 (18%)
 Frame = +1

Query  1     PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAA--KEIPISGLFKPKEDEAIGVREA  174
             P  +LK+NVDAA++  ++  GLG V++D  G  VAA  K++P+      +E  +    EA
Sbjct  1180  PGNFLKVNVDAAINNRDQVAGLGAVIKDPSGKIVAAGTKQVPL------REGVSFAEAEA  1233

Query  175   LKW----IKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLF  297
             ++W     ++L    + ++                 +    +I+D++E  +DF  + F  
Sbjct  1234  MEWGLQIARELSLSALIMETDCKEVVDLLNNTKGSRTGISWVISDIQEQRRDFKEVKFRH  1293

Query  298   AKRSANKVAHLLTRETLFKSDCSVYF  375
               R+ N  AH L +  +  +  +V+ 
Sbjct  1294  IPRTCNTCAHSLAKLAVGANTSAVWL  1319



>ref|XP_010269328.1| PREDICTED: uncharacterized protein LOC104606020 [Nelumbo nucifera]
Length=167

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 60/129 (47%), Gaps = 19/129 (15%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P G+LK+N D       ++ G+GFV+RD  G+F+ A+ IPI+ L  P   EA  + E++K
Sbjct  18   PNGFLKINFDGT--NSTQKSGVGFVVRDHTGSFIFARAIPIN-LSPPVVSEATALLESIK  74

Query  181  WIKDLQY----------DFIQLQLYS------SFDLIINDVKELAKDFLNINFLFAKRSA  312
            +   + +            I+L L        S   +++  + L       +  F  RS 
Sbjct  75   FTISMGFSHTIFEGDNESIIKLLLEENSNPPWSILTLLSSCRSLLNHLDGFSVTFTLRSG  134

Query  313  NKVAHLLTR  339
             +VAH + +
Sbjct  135  KQVAHHIAK  143



>ref|XP_009361347.1| PREDICTED: uncharacterized protein LOC103951644 [Pyrus x bretschneideri]
Length=197

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/135 (30%), Positives = 60/135 (44%), Gaps = 24/135 (18%)
 Frame = +1

Query  1    PLGW-------LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAI  159
            P GW       +KLNVDA+ +  ++R   G V+R+ EG FVAAK + I G       EA 
Sbjct  31   PAGWAPPCLPFMKLNVDASWEANSKRGFAGVVIRNHEGNFVAAKRVQI-GAPSVAVAEAS  89

Query  160  GVREALKWIKDLQYDFIQLQLYSSFDL----------------IINDVKELAKDFLNINF  291
             +    +  K L  + I ++  S  ++                +I+ V  L  DF +  +
Sbjct  90   AILLGCELAKGLGLECIIVESDSKENILSLAQGSARGSWEAFPVISKVLRLGGDFQDCRW  149

Query  292  LFAKRSANKVAHLLT  336
             +  RSAN  AH L 
Sbjct  150  SWVPRSANLAAHSLA  164



>ref|XP_010677668.1| PREDICTED: uncharacterized protein LOC104893266 [Beta vulgaris 
subsp. vulgaris]
Length=190

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/132 (26%), Positives = 55/132 (42%), Gaps = 16/132 (12%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P G +KLN DA+L      +G+G + R++EG    A    +   + P+  E   +  A +
Sbjct  33   PAGAIKLNTDASLAEEG-WVGIGVIARNSEGKVCFAATRRVRAYWPPEVAECKAIYMATR  91

Query  181  WIKDLQYDFIQLQ---------------LYSSFDLIINDVKELAKDFLNINFLFAKRSAN  315
              K   Y  +  +                +S  D I+ D+  +   F +++F   KR  N
Sbjct  92   LAKAHGYGDVIFESDSLVATRRLTKAAIFFSDLDAILGDILAMCNAFSSVSFSHVKRDGN  151

Query  316  KVAHLLTRETLF  351
             VAH L R   F
Sbjct  152  TVAHNLARVVSF  163



>ref|XP_003615215.1| hypothetical protein MTR_5g065190 [Medicago truncatula]
Length=216

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 39/83 (47%), Gaps = 7/83 (8%)
 Frame = +1

Query  1    PLGW-------LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAI  159
            P+ W       +K N+D        R+ +G  LRD  G FV AK I   G++     EA+
Sbjct  110  PVCWKALVQDRMKCNIDVMFPNLRNRIDIGICLRDEGGVFVLAKTISFVGVYPVDIGEAL  169

Query  160  GVREALKWIKDLQYDFIQLQLYS  228
            G+   L+W+ D+      L+L S
Sbjct  170  GLYHVLQWVIDMHQTISILKLIS  192



>emb|CCA65997.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1363

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/144 (28%), Positives = 60/144 (42%), Gaps = 21/144 (15%)
 Frame = +1

Query  7     GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVA--AKEIPISGLFKPKEDEAIGVREALK  180
             G+LKLN D A        G+G V RDA G +    AK +       P+  E + +RE L+
Sbjct  1204  GFLKLNTDGAWKADWENAGIGGVFRDAVGNWELGFAKRVDAGS---PEAAELMAIREGLQ  1260

Query  181   WIKDLQYDFIQLQL----------------YSSFDLIINDVKELAKDFLNINFLFAKRSA  312
                D  Y  ++++                      +I+ D+  L     ++ FL  KR  
Sbjct  1261  VAWDCNYHKLEVECDAKGVVQLLAKPLEAENHPLGVIVMDICILLTRHWSVEFLHIKREG  1320

Query  313   NKVAHLLTRETLFKSDCSVYFFIP  384
             NKVAH L  E + + +  V F  P
Sbjct  1321  NKVAHCLAAEAVNQVEERVIFINP  1344



>ref|XP_010683805.1| PREDICTED: uncharacterized protein LOC104898417 [Beta vulgaris 
subsp. vulgaris]
Length=293

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 57/128 (45%), Gaps = 16/128 (13%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P  ++KLNVDA +  G   +  G V+RD  G+ +A     +   + P   EA   R  L+
Sbjct  139  PTSFVKLNVDAHVSQGGG-VSFGMVVRDEWGSLLAVGVRRMGVNWTPDVAEAGAARFGLE  197

Query  181  WIKDLQYDFIQLQL---------------YSSFDLIINDVKELAKDFLNINFLFAKRSAN  315
             ++ L Y  + L+                 +   L+ +D+ E++  F N   +  KRS N
Sbjct  198  VVRSLGYTKVVLECDAIGVVRAIVNRKTGAAPIFLLFDDILEISSSFSNFKCVHVKRSGN  257

Query  316  KVAHLLTR  339
             VAH + R
Sbjct  258  TVAHSVAR  265



>ref|XP_008341962.1| PREDICTED: uncharacterized protein LOC103404776 [Malus domestica]
Length=353

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/124 (27%), Positives = 57/124 (46%), Gaps = 15/124 (12%)
 Frame = +1

Query  13   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKW---  183
            +K+N D++     ++ G   V+R   G F+AAK   +  +F P + +A+ +RE++ W   
Sbjct  222  VKMNTDSSWSDVKKKXGFEVVIRGDRGVFMAAKCGMLEDVFSPIQAKAMAIRESMLWAMQ  281

Query  184  --IKDLQYDFIQLQLY-----SSFDL-----IINDVKELAKDFLNINFLFAKRSANKVAH  327
              IK L      LQ+      SS ++     I+ D+K L +    +         N +AH
Sbjct  282  MGIKKLVLKTDSLQIVEALQDSSLNMSAVGQIMEDIKVLLQSITEVAMTHTHHKVNSIAH  341

Query  328  LLTR  339
             L R
Sbjct  342  RLAR  345



>ref|XP_003600985.1| hypothetical protein MTR_3g071710 [Medicago truncatula]
Length=101

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/71 (30%), Positives = 37/71 (52%), Gaps = 0/71 (0%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G+++ N D A+      +G+G  + D+ G    A  + I       E EA G+ ++LKW+
Sbjct  9    GYVQCNSDVAIVSAQNGVGMGACVHDSAGRLTPANSMWIPSTMTAVEGEAWGLLQSLKWL  68

Query  187  KDLQYDFIQLQ  219
              L  +FI+L+
Sbjct  69   VSLNLEFIELE  79



>gb|EEE66057.1| hypothetical protein OsJ_22054 [Oryza sativa Japonica Group]
Length=940

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 36/126 (29%), Positives = 57/126 (45%), Gaps = 15/126 (12%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G + +N DAA+       GLGF+ RD  G  + A     SG  +P+  EA+ +R AL+  
Sbjct  788  GTILINTDAAVFQSVNSFGLGFLFRDHSGLCLFAANERHSGCIQPEMAEALAIRCALRTA  847

Query  187  KDLQYDFIQL---------------QLYSSFDLIINDVKELAKDFLNINFLFAKRSANKV  321
             +  +  I L               +  S    +++D+  LA  FL+ +F+   R  N  
Sbjct  848  MEEGHQKIVLASDCLAIIQKIQSGARDRSMVGALVSDINFLAAGFLDCSFIHVNRVTNAA  907

Query  322  AHLLTR  339
            AHLL +
Sbjct  908  AHLLAQ  913



>ref|XP_002459655.1| hypothetical protein SORBIDRAFT_02g008050 [Sorghum bicolor]
 gb|EER96176.1| hypothetical protein SORBIDRAFT_02g008050 [Sorghum bicolor]
Length=237

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 57/124 (46%), Gaps = 13/124 (10%)
 Frame = +1

Query  19   LNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQ  198
            +NVDAA+   +       + RD  G F+ A  + + G+  P+  EAI  RE +    DLQ
Sbjct  89   INVDAAISKNDLIAAAAAIARDDNGHFLGASALVLRGISDPEVMEAIACREGMSLALDLQ  148

Query  199  -YDF------------IQLQLYSSFDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTR  339
              +F            I+   +  +  II+++KE    F ++  +  +R +N  AH + R
Sbjct  149  VVNFRLASDNQNVVKNIRQGSHGVYGQIIHEIKERRFSFASVEIVHERRESNVDAHNIAR  208

Query  340  ETLF  351
              LF
Sbjct  209  SALF  212



>ref|XP_007032521.1| Uncharacterized protein TCM_018523 [Theobroma cacao]
 gb|EOY03447.1| Uncharacterized protein TCM_018523 [Theobroma cacao]
Length=348

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 59/140 (42%), Gaps = 17/140 (12%)
 Frame = +1

Query  13   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK---W  183
            LK+N   A+   + + G G V+R  EG F+AA     +   +    E   ++E L+   W
Sbjct  159  LKINCAGAVSASSHQAGFGAVIRTQEGYFLAASSGKPAACEEAIVAEISAIKEGLRLADW  218

Query  184  IK--------DLQYDFIQLQ------LYSSFDLIINDVKELAKDFLNINFLFAKRSANKV  321
            +K        D  +   +LQ      L   +  ++N+VK +   F N  FL   + AN V
Sbjct  219  MKLQEVEVRSDSLFVITELQKPGNSWLAFPYHQLLNEVKGIVATFRNCKFLHVGQEANSV  278

Query  322  AHLLTRETLFKSDCSVYFFI  381
            AH L     F      +F+ 
Sbjct  279  AHWLAMYGFFVETIQSWFYT  298



>ref|XP_008243683.1| PREDICTED: uncharacterized protein LOC103341914 [Prunus mume]
Length=196

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/127 (26%), Positives = 62/127 (49%), Gaps = 13/127 (10%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P G  KLNVDAA        G+G V+R+ +G  +AA  +P+  +  PK  E + ++  +K
Sbjct  65   PAGKYKLNVDAAYIPETCVGGIGGVVRNDKGEVMAAMALPLVTVTSPKYAEIMALQFGMK  124

Query  181  WIKDLQYDFIQLQLYSSFDLIINDVKE-----------LAKDFLNINFLFAKRSANKVAH  327
            + +D  +  I ++  S    +++D+K+           + +   ++   F+    N+VA+
Sbjct  125  FARDAGFSSILIE--SDSQGVVSDLKKDEEESWASVRGVCEQLDDVTVSFSPMGCNQVAY  182

Query  328  LLTRETL  348
             L R  L
Sbjct  183  RLARHAL  189



>ref|XP_007206269.1| hypothetical protein PRUPE_ppa016210mg [Prunus persica]
 gb|EMJ07468.1| hypothetical protein PRUPE_ppa016210mg [Prunus persica]
Length=186

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 57/126 (45%), Gaps = 8/126 (6%)
 Frame = +1

Query  13   LKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPI-SGLFKPKEDEAIGV---REALK  180
            LK+NVD A   G    G+G V++D+ G FVA + +   +G     E     V    +AL+
Sbjct  64   LKINVDGAWKPGTTEGGVGVVVKDSTGKFVAVEALAARTGTILAMERGYQNVVFESDALQ  123

Query  181  WIKDLQYDFIQLQLYSSFDLIINDVKELAKDFLNINFLFAKRSANKVAHLLTRETLFKSD  360
             +  L+   I     S    ++ D K L        F   +R+AN VAH L R  L    
Sbjct  124  IVTALRNHSID---RSVIGPVVEDTKSLLTQITGEGFTHIRRTANGVAHRLARFALHIGG  180

Query  361  CSVYFF  378
             S+Y+F
Sbjct  181  -SLYWF  185



>gb|ABN07957.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=380

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 35/64 (55%), Gaps = 0/64 (0%)
 Frame = +1

Query  4    LGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKW  183
            +G  K NVDAA      R+G G  +RDA G  V ++    + L   +  EAIG+  A++W
Sbjct  293  VGRFKCNVDAAFSASLHRVGFGACIRDANGNHVISRTECFTPLLDVEMGEAIGLLHAMRW  352

Query  184  IKDL  195
             KDL
Sbjct  353  AKDL  356



>gb|KJB30629.1| hypothetical protein B456_005G152500 [Gossypium raimondii]
Length=118

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 36/72 (50%), Gaps = 0/72 (0%)
 Frame = +1

Query  4    LGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKW  183
            LG LK NVD A+   N  MG   VLR+ EG F       +     P   E I V+EAL W
Sbjct  14   LGKLKCNVDGAIFTDNGCMGWAAVLRNDEGNFFQCISGFMKSTLSPFLLEIIVVQEALSW  73

Query  184  IKDLQYDFIQLQ  219
            +K L  D + ++
Sbjct  74   LKSLHVDNVIIE  85



>ref|XP_003627271.1| hypothetical protein MTR_8g020570 [Medicago truncatula]
Length=228

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/135 (30%), Positives = 59/135 (44%), Gaps = 22/135 (16%)
 Frame = +1

Query  43   YGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQL  222
            YG+ R+     LRD    FV+AK    S L      EA+G   ALKW+ +L YD +   L
Sbjct  91   YGSIRI----CLRDDRSEFVSAKTYCFSPLCNVVVGEAVGFHTALKWMAELHYDNVDFAL  146

Query  223  YSS---------------FDLIINDVKELAK-DFLNINFLFAKRSANKVAHLLTRETLFK  354
             S+               F  I++  K+L +  F N    F +R  N + H LT+  +  
Sbjct  147  DSNIVVDHFRSSLENDNEFGCIMHACKQLFQISFQNSYVEFNRRQTNGITHALTK--VAP  204

Query  355  SDCSVYFFIPFPSIV  399
            S  S + +   PS +
Sbjct  205  SHASFHDYDNVPSCI  219



>ref|XP_009346162.1| PREDICTED: uncharacterized protein LOC103937909 [Pyrus x bretschneideri]
Length=415

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 59/126 (47%), Gaps = 19/126 (15%)
 Frame = +1

Query  1    PLGWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALK  180
            P G LK+NVD A D  N   G+G ++R+ +G FV A    I  +F P + EA+ +R  L+
Sbjct  255  PSGKLKINVDGAWDKENCVRGVGIIIRNDKGAFVGAATRIIIDVFSPIQVEALAMRVCLE  314

Query  181  WIKD-------LQYDFIQLQLYSSFDLIINDVKELAKDFLNINFLFA----------KRS  309
             + +       ++ D +Q+ L +    +  +V  +      I FL A           R 
Sbjct  315  LVVERGLSKINIESDALQIILIAKKSSV--NVSPMGPIIEGIKFLLAVVAEALVTHVHRQ  372

Query  310  ANKVAH  327
            AN +AH
Sbjct  373  ANSIAH  378



>ref|XP_008376986.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=341

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 28/56 (50%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREA  174
            GWLK N D A D       +G VLRD  G FVAA    + G+  P   E I  REA
Sbjct  245  GWLKCNFDGAWDEHGAVGAVGIVLRDGAGEFVAATAFKVEGISSPLLAETIAAREA  300



>ref|XP_003613245.1| hypothetical protein MTR_5g034450 [Medicago truncatula]
 gb|AES96203.1| hypothetical protein MTR_5g034450 [Medicago truncatula]
Length=114

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +1

Query  7    GWLKLNVDAALDYGNRRMGLGFVLRDAEGTFVAAKEIPISGLFKPKEDEAIGVREALKWI  186
            G  K N+DA+      R+G+   +RD EG FV AK +    ++     EA G+  A++WI
Sbjct  34   GRFKCNIDASFSAFTNRLGIEMCIRDKEGRFVFAKTMWFIPIYLVDVGEAFGLYHAIQWI  93

Query  187  KDLQYDFIQLQLYS  228
             DL+   +  ++ S
Sbjct  94   HDLRLPNVDFEVDS  107



>ref|XP_003615631.1| hypothetical protein MTR_5g070290 [Medicago truncatula]
Length=307

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 48/106 (45%), Gaps = 16/106 (15%)
 Frame = +1

Query  85   AEGTFVAAKEIPISGLFKPKEDEAIGVREALKWIKDLQYDFIQLQ---------LYSSFD  237
            A G FV A+ I   G++     EA+ +  AL+W+ D+ +D I  +         LYS ++
Sbjct  187  ARGVFVLARTISFIGVYPVDIGEALDLYHALQWVSDMHFDNIDFEVDSKTTKNGLYSGWE  246

Query  238  -------LIINDVKELAKDFLNINFLFAKRSANKVAHLLTRETLFK  354
                   +II     L   F N    F +R AN VAH L ++  F 
Sbjct  247  DITEFGNIIIASRSLLLSKFTNSRVEFVRRQANVVAHTLAKKPHFS  292



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555628969350