BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP008F05 585 bp,

Length=564
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO99237.1|  unnamed protein product                                171   6e-54   Coffea canephora [robusta coffee]
emb|CDP08010.1|  unnamed protein product                                169   1e-48   Coffea canephora [robusta coffee]
ref|XP_007035120.1|  Glutathione S-transferase tau 7                    169   3e-48   Theobroma cacao [chocolate]
ref|XP_007035121.1|  Glutathione S-transferase tau 7 isoform 1          166   3e-47   Theobroma cacao [chocolate]
emb|CBI26437.3|  unnamed protein product                                164   1e-46   Vitis vinifera
ref|XP_007035122.1|  Glutathione S-transferase tau 7 isoform 2          164   1e-46   Theobroma cacao [chocolate]
ref|XP_002266900.1|  PREDICTED: probable glutathione S-transferase      164   1e-46   Vitis vinifera
emb|CDP08048.1|  unnamed protein product                                165   2e-46   Coffea canephora [robusta coffee]
gb|KEH20685.1|  glutathione S-transferase                               163   2e-46   Medicago truncatula
ref|NP_001234088.1|  uncharacterized protein LOC543815                  163   2e-46   Solanum lycopersicum
gb|ACJ83863.1|  unknown                                                 163   3e-46   Medicago truncatula
gb|KDP40336.1|  hypothetical protein JCGZ_02334                         162   5e-46   Jatropha curcas
ref|XP_006433894.1|  hypothetical protein CICLE_v10002406mg             162   6e-46   Citrus clementina
ref|XP_002266994.1|  PREDICTED: probable glutathione S-transferase      162   6e-46   Vitis vinifera
gb|KDO81087.1|  hypothetical protein CISIN_1g027498mg                   162   7e-46   Citrus sinensis [Valencia orange]
emb|CBI26438.3|  unnamed protein product                                162   7e-46   Vitis vinifera
ref|XP_002268774.2|  PREDICTED: probable glutathione S-transferase      162   7e-46   Vitis vinifera
ref|XP_009593034.1|  PREDICTED: glutathione transferase GST 23-like     161   1e-45   Nicotiana tomentosiformis
emb|CAN73419.1|  hypothetical protein VITISV_027346                     161   2e-45   Vitis vinifera
ref|XP_011091312.1|  PREDICTED: glutathione transferase GST 23-like     160   4e-45   Sesamum indicum [beniseed]
ref|XP_006472526.1|  PREDICTED: glutathione transferase GST 23-like     159   5e-45   Citrus sinensis [Valencia orange]
ref|XP_006354565.1|  PREDICTED: glutathione transferase GST 23-li...    159   5e-45   Solanum tuberosum [potatoes]
ref|XP_006378334.1|  hypothetical protein POPTR_0010s08170g             159   5e-45   Populus trichocarpa [western balsam poplar]
emb|CDO99236.1|  unnamed protein product                                159   6e-45   Coffea canephora [robusta coffee]
ref|XP_003629836.1|  Receptor-like protein kinase                       168   1e-44   
ref|XP_002280532.1|  PREDICTED: probable glutathione S-transferase      148   2e-44   Vitis vinifera
gb|AFK34023.1|  unknown                                                 155   2e-44   Medicago truncatula
tpg|DAA46028.1|  TPA: hypothetical protein ZEAMMB73_911431              154   4e-44   Zea mays [maize]
ref|XP_007159485.1|  hypothetical protein PHAVU_002G241400g             157   4e-44   Phaseolus vulgaris [French bean]
ref|XP_009778650.1|  PREDICTED: glutathione transferase GST 23-like     157   5e-44   Nicotiana sylvestris
ref|XP_011030495.1|  PREDICTED: probable glutathione S-transferase      157   5e-44   Populus euphratica
ref|XP_002280676.1|  PREDICTED: probable glutathione S-transferase      147   6e-44   Vitis vinifera
ref|XP_010521899.1|  PREDICTED: glutathione S-transferase U7-like       156   8e-44   Tarenaya hassleriana [spider flower]
ref|XP_006420238.1|  hypothetical protein CICLE_v10005771mg             157   8e-44   Citrus clementina
gb|KEH35720.1|  glutathione S-transferase, amino-terminal domain ...    156   1e-43   Medicago truncatula
gb|AFK37185.1|  unknown                                                 156   1e-43   Medicago truncatula
ref|XP_010938159.1|  PREDICTED: glutathione transferase GST 23-like     156   1e-43   Elaeis guineensis
ref|XP_006580178.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    155   2e-43   
ref|XP_008804683.1|  PREDICTED: probable glutathione S-transferase      152   2e-43   
gb|AFK41941.1|  unknown                                                 145   2e-43   Lotus japonicus
gb|AJE59654.1|  tau class glutathione S-transferase                     154   4e-43   Glycine max [soybeans]
emb|CDP11459.1|  unnamed protein product                                154   5e-43   Coffea canephora [robusta coffee]
gb|ACU14737.1|  unknown                                                 153   7e-43   Glycine max [soybeans]
gb|AEC32486.1|  tau class glutathione S-transferase                     153   7e-43   Glycine soja [wild soybean]
ref|XP_006420237.1|  hypothetical protein CICLE_v10005779mg             151   7e-43   Citrus clementina
ref|XP_003524975.2|  PREDICTED: probable glutathione S-transferase      152   8e-43   
gb|AFF18814.1|  glutathione transferase                                 153   9e-43   Dimocarpus longan [longan]
gb|KHN48020.1|  Glutathione transferase GST 23                          145   1e-42   Glycine soja [wild soybean]
ref|XP_006489726.1|  PREDICTED: probable glutathione S-transferas...    153   2e-42   Citrus sinensis [Valencia orange]
ref|NP_001104997.1|  LOC541848                                          152   3e-42   
gb|ACG44510.1|  glutathione S-transferase GSTU6                         152   3e-42   Zea mays [maize]
ref|XP_008793319.1|  PREDICTED: probable glutathione S-transferase      152   4e-42   Phoenix dactylifera
gb|AAG34804.1|AF243369_1  glutathione S-transferase GST 14              150   5e-42   Glycine max [soybeans]
gb|KHN06423.1|  Putative glutathione S-transferase                      151   6e-42   Glycine soja [wild soybean]
ref|XP_007016281.1|  Glutathione S-transferase tau 7, putative          152   1e-41   Theobroma cacao [chocolate]
ref|XP_010243655.1|  PREDICTED: probable glutathione S-transferase      151   1e-41   Nelumbo nucifera [Indian lotus]
gb|KDP42499.1|  hypothetical protein JCGZ_00296                         149   1e-41   Jatropha curcas
emb|CAN63628.1|  hypothetical protein VITISV_018696                     150   2e-41   Vitis vinifera
ref|XP_003632015.1|  PREDICTED: probable glutathione S-transferase      150   2e-41   Vitis vinifera
gb|KJB19709.1|  hypothetical protein B456_003G127600                    150   3e-41   Gossypium raimondii
ref|XP_010069125.1|  PREDICTED: glutathione transferase GST 23-like     149   4e-41   Eucalyptus grandis [rose gum]
ref|XP_010521898.1|  PREDICTED: glutathione S-transferase U7-like       149   5e-41   Tarenaya hassleriana [spider flower]
ref|XP_008224351.1|  PREDICTED: probable glutathione S-transferase      149   5e-41   Prunus mume [ume]
ref|XP_006489727.1|  PREDICTED: probable glutathione S-transferas...    149   7e-41   Citrus sinensis [Valencia orange]
ref|XP_007226113.1|  hypothetical protein PRUPE_ppa011087mg             149   8e-41   Prunus persica
ref|XP_002285212.1|  PREDICTED: glutathione transferase GST 23          149   8e-41   Vitis vinifera
ref|XP_010069124.1|  PREDICTED: glutathione transferase GST 23-like     149   8e-41   Eucalyptus grandis [rose gum]
ref|XP_010469949.1|  PREDICTED: glutathione S-transferase U1            149   8e-41   Camelina sativa [gold-of-pleasure]
ref|XP_002285214.1|  PREDICTED: glutathione transferase GST 23          149   8e-41   Vitis vinifera
ref|XP_010510486.1|  PREDICTED: glutathione S-transferase U1-like       149   9e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010922854.1|  PREDICTED: probable glutathione S-transferase      148   1e-40   Elaeis guineensis
ref|XP_006437359.1|  hypothetical protein CICLE_v10032702mg             147   1e-40   Citrus clementina
ref|XP_010521901.1|  PREDICTED: glutathione S-transferase U1-like       148   1e-40   Tarenaya hassleriana [spider flower]
ref|XP_003532764.1|  PREDICTED: probable glutathione S-transferase      137   1e-40   
ref|XP_010542655.1|  PREDICTED: glutathione S-transferase U1-like       148   1e-40   Tarenaya hassleriana [spider flower]
ref|XP_002520474.1|  glutathione s-transferase, putative                148   2e-40   
ref|XP_010650092.1|  PREDICTED: glutathione S-transferase U1-like       145   2e-40   Vitis vinifera
gb|KDP42182.1|  hypothetical protein JCGZ_02912                         148   2e-40   Jatropha curcas
ref|XP_003629835.1|  Glutathione S-transferase GST                      140   2e-40   Medicago truncatula
ref|XP_010025836.1|  PREDICTED: glutathione transferase GST 23-like     149   2e-40   Eucalyptus grandis [rose gum]
ref|XP_002520478.1|  glutathione s-transferase, putative                147   2e-40   Ricinus communis
ref|XP_002285220.1|  PREDICTED: glutathione transferase GST 23          148   2e-40   Vitis vinifera
ref|XP_008219369.1|  PREDICTED: glutathione transferase GST 23-like     147   2e-40   Prunus mume [ume]
gb|ABW81199.1|  glutathione-S-transferase 9                             148   2e-40   Arabidopsis cebennensis
ref|XP_002524047.1|  glutathione s-transferase, putative                147   2e-40   Ricinus communis
ref|XP_002520476.1|  glutathione s-transferase, putative                147   2e-40   Ricinus communis
ref|XP_010938160.1|  PREDICTED: glutathione transferase GST 23-like     147   2e-40   Elaeis guineensis
ref|NP_001237959.1|  uncharacterized protein LOC100305870               147   2e-40   Glycine max [soybeans]
emb|CDP11462.1|  unnamed protein product                                148   3e-40   Coffea canephora [robusta coffee]
ref|XP_002520472.1|  glutathione s-transferase, putative                147   3e-40   Ricinus communis
ref|XP_011016467.1|  PREDICTED: glutathione S-transferase U8-like       145   3e-40   Populus euphratica
ref|XP_002307924.1|  hypothetical protein POPTR_0006s02510g             140   3e-40   Populus trichocarpa [western balsam poplar]
gb|KDP34500.1|  hypothetical protein JCGZ_11050                         147   3e-40   Jatropha curcas
ref|XP_006484731.1|  PREDICTED: probable glutathione S-transferas...    147   4e-40   Citrus sinensis [Valencia orange]
ref|XP_006420236.1|  hypothetical protein CICLE_v10005779mg             147   4e-40   Citrus clementina
gb|KDP39591.1|  hypothetical protein JCGZ_02611                         139   5e-40   Jatropha curcas
ref|XP_004133937.1|  PREDICTED: probable glutathione S-transferas...    146   5e-40   Cucumis sativus [cucumbers]
ref|XP_006489728.1|  PREDICTED: glutathione S-transferase U8-like       147   5e-40   Citrus sinensis [Valencia orange]
ref|XP_007223941.1|  hypothetical protein PRUPE_ppa011108mg             146   6e-40   Prunus persica
ref|XP_002881053.1|  glutathione S-transferase 19                       146   7e-40   Arabidopsis lyrata subsp. lyrata
ref|XP_006437360.1|  hypothetical protein CICLE_v10032686mg             146   7e-40   Citrus clementina
emb|CDP15482.1|  unnamed protein product                                139   7e-40   Coffea canephora [robusta coffee]
ref|XP_002527848.1|  glutathione s-transferase, putative                146   8e-40   Ricinus communis
ref|XP_002524046.1|  glutathione s-transferase, putative                146   8e-40   Ricinus communis
ref|NP_001063423.1|  Os09g0467200                                       146   8e-40   
ref|XP_006420235.1|  hypothetical protein CICLE_v10006671mg             143   8e-40   Citrus clementina
ref|XP_010650966.1|  PREDICTED: glutathione S-transferase U8            146   8e-40   Vitis vinifera
emb|CAN73674.1|  hypothetical protein VITISV_001109                     149   9e-40   Vitis vinifera
ref|XP_008781341.1|  PREDICTED: glutathione transferase GST 23-like     146   1e-39   Phoenix dactylifera
ref|XP_010060069.1|  PREDICTED: glutathione transferase GST 23-like     146   1e-39   Eucalyptus grandis [rose gum]
ref|XP_006294917.1|  hypothetical protein CARUB_v10023969mg             146   1e-39   Capsella rubella
gb|AAT98377.1|  glutathione S-transferase                               142   1e-39   Populus trichocarpa [western balsam poplar]
gb|KFK44228.1|  hypothetical protein AALP_AA1G231200                    145   1e-39   Arabis alpina [alpine rockcress]
ref|XP_010278876.1|  PREDICTED: probable glutathione S-transferase      145   1e-39   Nelumbo nucifera [Indian lotus]
ref|XP_010414381.1|  PREDICTED: glutathione S-transferase U1-like       145   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_002881054.1|  glutathione-s-transferase 9                        145   1e-39   Arabidopsis lyrata subsp. lyrata
gb|KDO46806.1|  hypothetical protein CISIN_1g027333mg                   145   1e-39   Citrus sinensis [Valencia orange]
ref|XP_006484732.1|  PREDICTED: probable glutathione S-transferas...    144   1e-39   Citrus sinensis [Valencia orange]
ref|XP_010279601.1|  PREDICTED: glutathione S-transferase U1-like       143   1e-39   Nelumbo nucifera [Indian lotus]
ref|XP_002460369.1|  hypothetical protein SORBIDRAFT_02g027080          145   1e-39   Sorghum bicolor [broomcorn]
ref|XP_004957087.1|  PREDICTED: glutathione transferase GST 23-like     145   1e-39   Setaria italica
ref|NP_001104993.1|  glutathione S-transferase GST 33                   145   1e-39   
ref|XP_002524048.1|  glutathione s-transferase, putative                145   1e-39   Ricinus communis
gb|KDP42500.1|  hypothetical protein JCGZ_00297                         145   2e-39   Jatropha curcas
ref|XP_011004483.1|  PREDICTED: probable glutathione S-transferase      140   2e-39   Populus euphratica
ref|NP_001234957.1|  glutathione S-transferase GST 17                   145   2e-39   Glycine max [soybeans]
gb|ACU20120.1|  unknown                                                 145   2e-39   Glycine max [soybeans]
ref|XP_008232144.1|  PREDICTED: probable glutathione S-transferase      145   2e-39   Prunus mume [ume]
ref|XP_011040645.1|  PREDICTED: probable glutathione S-transferase      140   2e-39   Populus euphratica
ref|XP_009141006.1|  PREDICTED: glutathione S-transferase U2            146   2e-39   Brassica rapa
emb|CDP06552.1|  unnamed protein product                                145   2e-39   Coffea canephora [robusta coffee]
ref|XP_009370896.1|  PREDICTED: probable glutathione S-transferase      145   2e-39   Pyrus x bretschneideri [bai li]
emb|CDY51366.1|  BnaA04g28600D                                          145   2e-39   Brassica napus [oilseed rape]
ref|XP_002264117.1|  PREDICTED: probable glutathione S-transferase      145   2e-39   Vitis vinifera
ref|XP_008793318.1|  PREDICTED: glutathione transferase GST 23-like     145   2e-39   Phoenix dactylifera
ref|XP_002281694.2|  PREDICTED: uncharacterized protein LOC100246830    149   3e-39   Vitis vinifera
emb|CAN72240.1|  hypothetical protein VITISV_010777                     145   3e-39   Vitis vinifera
ref|XP_004299557.1|  PREDICTED: probable glutathione S-transferase      139   3e-39   Fragaria vesca subsp. vesca
gb|KDO57583.1|  hypothetical protein CISIN_1g046710mg                   145   3e-39   Citrus sinensis [Valencia orange]
emb|CAN73675.1|  hypothetical protein VITISV_001110                     144   3e-39   Vitis vinifera
ref|NP_180510.1|  glutathione S-transferase tau 1                       144   3e-39   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001234986.1|  glutathione S-transferase GST 19                   144   3e-39   Glycine max [soybeans]
emb|CDY51364.1|  BnaA04g28580D                                          144   3e-39   Brassica napus [oilseed rape]
ref|XP_009343223.1|  PREDICTED: probable glutathione S-transferas...    133   4e-39   Pyrus x bretschneideri [bai li]
emb|CBI16039.3|  unnamed protein product                                147   4e-39   Vitis vinifera
ref|XP_002269118.1|  PREDICTED: glutathione S-transferase U9            144   4e-39   Vitis vinifera
ref|XP_002518184.1|  glutathione s-transferase, putative                144   4e-39   Ricinus communis
gb|ADB11358.1|  tau class glutathione transferase GSTU26                144   4e-39   Populus trichocarpa [western balsam poplar]
ref|XP_002264055.2|  PREDICTED: probable glutathione S-transferas...    144   4e-39   Vitis vinifera
ref|XP_011010098.1|  PREDICTED: probable glutathione S-transferase      140   4e-39   Populus euphratica
ref|XP_010238250.1|  PREDICTED: glutathione transferase GST 23-li...    138   4e-39   Brachypodium distachyon [annual false brome]
emb|CDX97884.1|  BnaC04g40550D                                          144   5e-39   Brassica napus [oilseed rape]
emb|CAN78656.1|  hypothetical protein VITISV_006850                     144   5e-39   Vitis vinifera
ref|NP_001104994.1|  glutathione transferase GST 23                     144   5e-39   Zea mays [maize]
gb|AFF18816.1|  glutathione transferase                                 144   5e-39   Dimocarpus longan [longan]
ref|XP_010469952.1|  PREDICTED: glutathione S-transferase U4 isof...    144   6e-39   Camelina sativa [gold-of-pleasure]
tpg|DAA61851.1|  TPA: hypothetical protein ZEAMMB73_518022              144   6e-39   Zea mays [maize]
ref|XP_002275657.2|  PREDICTED: probable glutathione S-transferase      144   6e-39   Vitis vinifera
gb|KDP42181.1|  hypothetical protein JCGZ_02911                         144   7e-39   Jatropha curcas
gb|ADB11327.1|  tau class glutathione transferase GSTU45                143   8e-39   Populus trichocarpa [western balsam poplar]
gb|KHN06425.1|  Putative glutathione S-transferase                      144   9e-39   Glycine soja [wild soybean]
gb|KJB28257.1|  hypothetical protein B456_005G037700                    143   9e-39   Gossypium raimondii
ref|XP_006373901.1|  hypothetical protein POPTR_0016s10120g             141   9e-39   Populus trichocarpa [western balsam poplar]
ref|XP_011000057.1|  PREDICTED: probable glutathione S-transferase      143   9e-39   Populus euphratica
gb|KJB76665.1|  hypothetical protein B456_012G099100                    138   1e-38   Gossypium raimondii
ref|XP_004134389.1|  PREDICTED: probable glutathione S-transferas...    143   1e-38   Cucumis sativus [cucumbers]
ref|XP_002532525.1|  glutathione s-transferase, putative                143   1e-38   Ricinus communis
ref|XP_006294909.1|  hypothetical protein CARUB_v10023960mg             144   1e-38   Capsella rubella
gb|KFK44230.1|  hypothetical protein AALP_AA1G231500                    148   1e-38   Arabis alpina [alpine rockcress]
ref|XP_009370935.1|  PREDICTED: glutathione transferase GST 23-like     143   1e-38   Pyrus x bretschneideri [bai li]
gb|AJE59670.1|  tau class glutathione S-transferase                     143   1e-38   Glycine max [soybeans]
ref|XP_010414384.1|  PREDICTED: glutathione S-transferase U4-like       143   1e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010510490.1|  PREDICTED: glutathione S-transferase U4-like       143   1e-38   Camelina sativa [gold-of-pleasure]
ref|XP_008438426.1|  PREDICTED: probable glutathione S-transferas...    143   1e-38   Cucumis melo [Oriental melon]
gb|KDO66687.1|  hypothetical protein CISIN_1g041211mg                   143   1e-38   Citrus sinensis [Valencia orange]
ref|XP_010271919.1|  PREDICTED: glutathione transferase GST 23-like     142   1e-38   Nelumbo nucifera [Indian lotus]
ref|XP_009606319.1|  PREDICTED: probable glutathione S-transferase      142   1e-38   Nicotiana tomentosiformis
ref|XP_009625219.1|  PREDICTED: probable glutathione S-transferase      142   2e-38   Nicotiana tomentosiformis
ref|XP_008453455.1|  PREDICTED: probable glutathione S-transferase      133   2e-38   Cucumis melo [Oriental melon]
gb|KCW65100.1|  hypothetical protein EUGRSUZ_G02605                     137   2e-38   Eucalyptus grandis [rose gum]
ref|XP_006410006.1|  hypothetical protein EUTSA_v10017660mg             142   2e-38   Eutrema salsugineum
ref|XP_008438211.1|  PREDICTED: probable glutathione S-transferase      142   2e-38   Cucumis melo [Oriental melon]
ref|XP_008346194.1|  PREDICTED: probable glutathione S-transferase      142   2e-38   Malus domestica [apple tree]
ref|XP_010693951.1|  PREDICTED: glutathione S-transferase U7-like       142   2e-38   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|ADB11328.1|  tau class glutathione transferase GSTU46                142   2e-38   Populus trichocarpa [western balsam poplar]
gb|ACU20730.1|  unknown                                                 140   2e-38   Glycine max [soybeans]
ref|XP_008240197.1|  PREDICTED: probable glutathione S-transferase      135   2e-38   Prunus mume [ume]
emb|CBI16040.3|  unnamed protein product                                145   2e-38   Vitis vinifera
ref|XP_002523997.1|  glutathione s-transferase, putative                132   2e-38   Ricinus communis
ref|XP_007145574.1|  hypothetical protein PHAVU_007G250000g             142   2e-38   Phaseolus vulgaris [French bean]
ref|NP_180503.1|  glutathione S-transferase tau 7                       142   2e-38   Arabidopsis thaliana [mouse-ear cress]
gb|AFK35732.1|  unknown                                                 134   2e-38   Lotus japonicus
gb|KFK44227.1|  hypothetical protein AALP_AA1G231100                    142   2e-38   Arabis alpina [alpine rockcress]
gb|KHN48021.1|  Putative glutathione S-transferase                      144   2e-38   Glycine soja [wild soybean]
emb|CDX97882.1|  BnaC04g40570D                                          142   2e-38   Brassica napus [oilseed rape]
ref|XP_009141004.1|  PREDICTED: glutathione S-transferase U4            142   3e-38   Brassica rapa
ref|XP_010661155.1|  PREDICTED: probable glutathione S-transferas...    142   3e-38   Vitis vinifera
ref|XP_010243637.1|  PREDICTED: probable glutathione S-transferase      142   3e-38   Nelumbo nucifera [Indian lotus]
ref|XP_007026863.1|  Tau class glutathione transferase GSTU45           142   3e-38   Theobroma cacao [chocolate]
ref|XP_002281843.2|  PREDICTED: glutathione S-transferase U7            142   3e-38   Vitis vinifera
emb|CDP21862.1|  unnamed protein product                                142   3e-38   Coffea canephora [robusta coffee]
ref|XP_006373657.1|  hypothetical protein POPTR_0016s02350g             142   3e-38   Populus trichocarpa [western balsam poplar]
emb|CAN62219.1|  hypothetical protein VITISV_042912                     142   3e-38   Vitis vinifera
emb|CDY53373.1|  BnaC04g54530D                                          142   3e-38   Brassica napus [oilseed rape]
ref|XP_007016280.1|  Glutathione S-transferase tau 7, putative          142   3e-38   Theobroma cacao [chocolate]
ref|XP_002520477.1|  glutathione s-transferase, putative                142   3e-38   Ricinus communis
ref|XP_007208953.1|  hypothetical protein PRUPE_ppb016836mg             142   3e-38   Prunus persica
gb|AFK34634.1|  unknown                                                 134   3e-38   Lotus japonicus
ref|XP_010921338.1|  PREDICTED: glutathione transferase GST 23-like     142   3e-38   Elaeis guineensis
gb|ABW81136.1|  GST36                                                   142   4e-38   Capsella rubella
ref|XP_006409999.1|  hypothetical protein EUTSA_v10017210mg             142   4e-38   Eutrema salsugineum
ref|XP_004983860.1|  PREDICTED: probable glutathione S-transferas...    142   4e-38   
ref|XP_007034532.1|  Glutathione S-transferase tau 7                    142   4e-38   Theobroma cacao [chocolate]
emb|CAN73676.1|  hypothetical protein VITISV_001111                     141   4e-38   Vitis vinifera
ref|XP_002321502.2|  hypothetical protein POPTR_0015s04200g             142   4e-38   Populus trichocarpa [western balsam poplar]
ref|XP_006420234.1|  hypothetical protein CICLE_v10005809mg             142   4e-38   Citrus clementina
ref|XP_009369409.1|  PREDICTED: glutathione S-transferase U9-like       142   4e-38   Pyrus x bretschneideri [bai li]
ref|XP_002275539.1|  PREDICTED: glutathione S-transferase U8            141   4e-38   Vitis vinifera
ref|XP_007218360.1|  hypothetical protein PRUPE_ppa011115mg             141   4e-38   Prunus persica
ref|XP_010042776.1|  PREDICTED: glutathione S-transferase U8-like       141   4e-38   Eucalyptus grandis [rose gum]
gb|KHG20964.1|  Glutathione S-transferase U7 -like protein              142   4e-38   Gossypium arboreum [tree cotton]
ref|XP_006489767.1|  PREDICTED: glutathione transferase GST 23-like     140   5e-38   Citrus sinensis [Valencia orange]
gb|AAP04395.1|  glutathione S-transferase U1                            138   5e-38   Nicotiana benthamiana
ref|XP_010469954.1|  PREDICTED: glutathione S-transferase U5            141   5e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010037768.1|  PREDICTED: probable glutathione S-transferase      141   5e-38   Eucalyptus grandis [rose gum]
ref|XP_011000484.1|  PREDICTED: probable glutathione S-transferase      141   6e-38   Populus euphratica
gb|ABW81132.1|  GST40                                                   141   6e-38   Capsella rubella
ref|XP_006660720.1|  PREDICTED: glutathione transferase GST 23-like     141   6e-38   
ref|XP_004299656.1|  PREDICTED: probable glutathione S-transferase      131   6e-38   Fragaria vesca subsp. vesca
ref|XP_006373996.1|  hypothetical protein POPTR_0016s12610g             141   6e-38   Populus trichocarpa [western balsam poplar]
emb|CDP09302.1|  unnamed protein product                                141   7e-38   Coffea canephora [robusta coffee]
ref|XP_010269443.1|  PREDICTED: probable glutathione S-transferase      141   7e-38   Nelumbo nucifera [Indian lotus]
emb|CDY40167.1|  BnaC04g13950D                                          141   7e-38   Brassica napus [oilseed rape]
ref|XP_008232147.1|  PREDICTED: probable glutathione S-transferase      141   7e-38   Prunus mume [ume]
ref|XP_007026865.1|  Tau class glutathione transferase GSTU45           141   7e-38   Theobroma cacao [chocolate]
gb|KHG11259.1|  Glutathione transferase GST 23                          141   7e-38   Gossypium arboreum [tree cotton]
ref|XP_002520473.1|  glutathione s-transferase, putative                141   7e-38   
emb|CDX97887.1|  BnaC04g40520D                                          141   7e-38   Brassica napus [oilseed rape]
ref|XP_010243636.1|  PREDICTED: probable glutathione S-transferase      141   7e-38   Nelumbo nucifera [Indian lotus]
ref|XP_009789711.1|  PREDICTED: probable glutathione S-transferase      141   8e-38   Nicotiana sylvestris
ref|XP_002521517.1|  glutathione s-transferase, putative                141   8e-38   Ricinus communis
ref|XP_007220010.1|  hypothetical protein PRUPE_ppb024827mg             141   8e-38   Prunus persica
ref|XP_002467617.1|  hypothetical protein SORBIDRAFT_01g030980          141   8e-38   Sorghum bicolor [broomcorn]
ref|XP_004160429.1|  PREDICTED: probable glutathione S-transferas...    132   8e-38   
ref|XP_004137330.1|  PREDICTED: probable glutathione S-transferas...    132   8e-38   Cucumis sativus [cucumbers]
gb|KJB27950.1|  hypothetical protein B456_005G038200                    141   8e-38   Gossypium raimondii
ref|XP_004983859.1|  PREDICTED: probable glutathione S-transferas...    141   8e-38   
emb|CDP19810.1|  unnamed protein product                                141   8e-38   Coffea canephora [robusta coffee]
ref|XP_006852814.1|  hypothetical protein AMTR_s00033p00172070          141   8e-38   
ref|XP_010939723.1|  PREDICTED: glutathione transferase GST 23-like     140   9e-38   Elaeis guineensis
ref|XP_011039096.1|  PREDICTED: probable glutathione S-transferase      141   9e-38   Populus euphratica
gb|KCW65098.1|  hypothetical protein EUGRSUZ_G02603                     128   9e-38   Eucalyptus grandis [rose gum]
gb|ABW81037.1|  glutathione-s-transferase 7                             141   9e-38   Arabidopsis lyrata subsp. lyrata
ref|XP_007029835.1|  Glutathione S-transferase TAU 8                    129   9e-38   Theobroma cacao [chocolate]
gb|AFK47276.1|  unknown                                                 140   9e-38   Lotus japonicus
ref|XP_010067034.1|  PREDICTED: glutathione transferase GST 23-like     141   1e-37   Eucalyptus grandis [rose gum]
ref|XP_009618409.1|  PREDICTED: probable glutathione S-transferase      140   1e-37   Nicotiana tomentosiformis
ref|XP_010263987.1|  PREDICTED: probable glutathione S-transferase      140   1e-37   Nelumbo nucifera [Indian lotus]
gb|KJB44380.1|  hypothetical protein B456_007G249200                    137   1e-37   Gossypium raimondii
gb|ACU15611.1|  unknown                                                 140   1e-37   Glycine max [soybeans]
gb|KCW49504.1|  hypothetical protein EUGRSUZ_K030211                    137   1e-37   Eucalyptus grandis [rose gum]
gb|ABW81194.1|  glutathione-S-transferase 5                             140   1e-37   Arabidopsis cebennensis
ref|XP_002532523.1|  glutathione s-transferase, putative                140   1e-37   Ricinus communis
ref|XP_002862399.1|  glutathione-s-transferase                          140   1e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_002269072.1|  PREDICTED: glutathione S-transferase U9-like       137   1e-37   Vitis vinifera
gb|KJB28236.1|  hypothetical protein B456_005G036300                    141   1e-37   Gossypium raimondii
gb|ABW81189.1|  glutathione-S-transferase                               141   1e-37   Arabidopsis cebennensis
ref|NP_001147494.1|  glutathione S-transferase GSTU6                    140   1e-37   Zea mays [maize]
ref|XP_010279423.1|  PREDICTED: probable glutathione S-transferase      140   1e-37   Nelumbo nucifera [Indian lotus]
ref|XP_008780312.1|  PREDICTED: glutathione S-transferase U22-like      137   1e-37   Phoenix dactylifera
gb|KJB80746.1|  hypothetical protein B456_013G113600                    140   1e-37   Gossypium raimondii
ref|XP_010510487.1|  PREDICTED: glutathione S-transferase U2-like       140   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006827224.1|  hypothetical protein AMTR_s00010p00260290          139   1e-37   
ref|XP_010521903.1|  PREDICTED: glutathione S-transferase U1-like       140   1e-37   Tarenaya hassleriana [spider flower]
ref|XP_002275435.3|  PREDICTED: glutathione S-transferase U8            140   1e-37   Vitis vinifera
ref|XP_009626800.1|  PREDICTED: probable glutathione S-transferase      140   1e-37   Nicotiana tomentosiformis
emb|CAN72033.1|  hypothetical protein VITISV_032560                     137   1e-37   Vitis vinifera
gb|KDO57582.1|  hypothetical protein CISIN_1g043218mg                   140   1e-37   Citrus sinensis [Valencia orange]
ref|XP_010279540.1|  PREDICTED: probable glutathione S-transferas...    140   1e-37   Nelumbo nucifera [Indian lotus]
gb|ABW74574.1|  putative gluthiathiones S-transferase 40                140   2e-37   
ref|XP_008372419.1|  PREDICTED: glutathione transferase GST 23-like     140   2e-37   
ref|XP_009781253.1|  PREDICTED: probable glutathione S-transferase      140   2e-37   
ref|XP_002881051.1|  glutathione-s-transferase 2                        140   2e-37   
gb|AFF18812.1|  glutathione transferase                                 140   2e-37   
ref|XP_002520475.1|  glutathione s-transferase, putative                140   2e-37   
emb|CBI15230.3|  unnamed protein product                                144   2e-37   
ref|NP_001234086.1|  uncharacterized protein LOC543814                  140   2e-37   
ref|XP_006489729.1|  PREDICTED: probable glutathione S-transferas...    140   2e-37   
gb|KDO57584.1|  hypothetical protein CISIN_1g036834mg                   140   2e-37   
ref|XP_002523996.1|  glutathione s-transferase, putative                140   2e-37   
ref|XP_008239955.1|  PREDICTED: glutathione S-transferase U10-like      140   2e-37   
ref|XP_010510491.1|  PREDICTED: glutathione S-transferase U5-like       140   2e-37   
gb|KFK44229.1|  hypothetical protein AALP_AA1G231400                    140   2e-37   
ref|XP_002881047.1|  glutathione-s-transferase 5                        140   2e-37   
ref|XP_009144374.1|  PREDICTED: glutathione S-transferase U5-like       140   2e-37   
ref|XP_002318530.2|  hypothetical protein POPTR_0012s04770g             140   2e-37   
ref|XP_011092669.1|  PREDICTED: glutathione S-transferase U7-like       140   2e-37   
ref|XP_009335025.1|  PREDICTED: probable glutathione S-transferas...    132   2e-37   
ref|XP_006437357.1|  hypothetical protein CICLE_v10032696mg             137   2e-37   
ref|XP_010414382.1|  PREDICTED: glutathione S-transferase U2            140   2e-37   
ref|XP_008438425.1|  PREDICTED: probable glutathione S-transferase      140   2e-37   
ref|NP_001238721.1|  glutathione S-transferase GST 13                   139   2e-37   
gb|ADN03963.1|  GST1                                                    139   3e-37   
ref|XP_006849222.1|  hypothetical protein AMTR_s00027p00229840          139   3e-37   
gb|KJB28264.1|  hypothetical protein B456_005G038800                    139   3e-37   
ref|XP_003632026.2|  PREDICTED: probable glutathione S-transferase      139   3e-37   
ref|XP_010939722.1|  PREDICTED: glutathione transferase GST 23-like     140   3e-37   
gb|EYU26622.1|  hypothetical protein MIMGU_mgv1a013365mg                139   3e-37   
gb|KJB42412.1|  hypothetical protein B456_007G151400                    139   3e-37   
ref|XP_011041578.1|  PREDICTED: probable glutathione S-transferase      139   3e-37   
ref|XP_010663365.1|  PREDICTED: glutathione S-transferase U9-like       140   3e-37   
ref|XP_007034540.1|  Glutathione S-transferase tau 7                    139   3e-37   
ref|XP_008812228.1|  PREDICTED: glutathione transferase GST 23-like     135   3e-37   
gb|KJB36831.1|  hypothetical protein B456_006G178600                    139   3e-37   
gb|KHG11257.1|  Glutathione transferase GST 23                          139   3e-37   
emb|CDY45446.1|  BnaA05g12550D                                          139   3e-37   
ref|XP_006296522.1|  hypothetical protein CARUB_v10025711mg             139   4e-37   
gb|KJB28259.1|  hypothetical protein B456_005G037900                    139   4e-37   
ref|XP_011004746.1|  PREDICTED: probable glutathione S-transferase      139   4e-37   
ref|XP_007034527.1|  Glutathione S-transferase tau 7                    139   4e-37   
dbj|BAC21263.1|  glutathione S-transferase                              139   4e-37   
ref|XP_010093877.1|  Glutathione transferase GST 23                     139   4e-37   
gb|EMT19525.1|  hypothetical protein F775_31981                         139   4e-37   
ref|XP_011099171.1|  PREDICTED: glutathione transferase GST 23-like     140   4e-37   
emb|CDY51369.1|  BnaA04g28630D                                          139   4e-37   
ref|XP_006852815.1|  hypothetical protein AMTR_s00033p00172170          139   4e-37   
ref|XP_002322571.1|  hypothetical protein POPTR_0016s02370g             139   4e-37   
gb|ABW81196.1|  gluthathione-S-transferase 7                            139   4e-37   
ref|XP_008775490.1|  PREDICTED: probable glutathione S-transferas...    139   4e-37   
ref|XP_010037769.1|  PREDICTED: probable glutathione S-transferase      139   5e-37   
ref|XP_010646030.1|  PREDICTED: probable glutathione S-transferase      139   5e-37   
ref|XP_010041602.1|  PREDICTED: glutathione S-transferase U7-like       135   5e-37   
ref|XP_008438428.1|  PREDICTED: probable glutathione S-transferas...    139   5e-37   
ref|NP_001238439.1|  probable glutathione S-transferase                 139   5e-37   
ref|XP_006476608.1|  PREDICTED: glutathione S-transferase U10-like      139   5e-37   
ref|XP_004983855.1|  PREDICTED: probable glutathione S-transferas...    139   5e-37   
emb|CAN60691.1|  hypothetical protein VITISV_044168                     139   5e-37   
ref|XP_002881050.1|  glutathione-s-transferase 3                        139   5e-37   
ref|XP_007200187.1|  hypothetical protein PRUPE_ppa016218mg             138   6e-37   
ref|XP_009335026.1|  PREDICTED: probable glutathione S-transferas...    131   6e-37   
ref|XP_007210928.1|  hypothetical protein PRUPE_ppa026181mg             137   6e-37   
ref|XP_008240195.1|  PREDICTED: probable glutathione S-transferase      138   6e-37   
gb|KHN05112.1|  Putative glutathione S-transferase                      139   6e-37   
ref|XP_010037776.1|  PREDICTED: probable glutathione S-transferase      139   6e-37   
emb|CDY45445.1|  BnaA05g12560D                                          139   6e-37   
gb|ACU15816.1|  unknown                                                 139   6e-37   
ref|XP_009768031.1|  PREDICTED: probable glutathione S-transferase      139   6e-37   
ref|XP_010039176.1|  PREDICTED: probable glutathione S-transferase      138   6e-37   
gb|KEH26957.1|  glutathione S-transferase                               139   7e-37   
ref|XP_002264054.1|  PREDICTED: glutathione transferase GST 23          139   7e-37   
gb|AFF18805.1|  glutathione transferase                                 135   7e-37   
ref|XP_004983846.1|  PREDICTED: probable glutathione S-transferas...    139   7e-37   
gb|KHG09979.1|  Glutathione S-transferase U8 -like protein              138   7e-37   
emb|CDP10683.1|  unnamed protein product                                138   7e-37   
ref|XP_006489730.1|  PREDICTED: probable glutathione S-transferas...    138   8e-37   
gb|EAY79299.1|  hypothetical protein OsI_34425                          139   8e-37   
ref|XP_010469950.1|  PREDICTED: glutathione S-transferase U2-like       138   8e-37   
ref|NP_180506.1|  glutathione S-transferase tau  5                      138   8e-37   
ref|XP_002881042.1|  glutathione-s-transferase                          139   8e-37   
ref|XP_009343225.1|  PREDICTED: probable glutathione S-transferas...    133   8e-37   
ref|XP_006376726.1|  hypothetical protein POPTR_0012s04780g             138   8e-37   
ref|XP_006410002.1|  hypothetical protein EUTSA_v10017209mg             138   8e-37   
ref|XP_006346688.1|  PREDICTED: probable glutathione S-transferas...    140   9e-37   
gb|KJB28258.1|  hypothetical protein B456_005G037800                    138   9e-37   
gb|ADB11377.1|  putative tau class glutathione transferase GSTU53       138   9e-37   
ref|XP_008806389.1|  PREDICTED: glutathione transferase GST 23-like     138   9e-37   
emb|CDP20459.1|  unnamed protein product                                139   9e-37   
dbj|BAK02670.1|  predicted protein                                      138   9e-37   
gb|ABW81139.1|  GST33                                                   138   9e-37   
ref|XP_006367664.1|  PREDICTED: probable glutathione S-transferas...    138   9e-37   
ref|NP_180509.1|  glutathione S-transferase tau 2                       138   9e-37   
gb|ABW81192.1|  gluthathione-S-transferase 3                            138   9e-37   
ref|XP_011004953.1|  PREDICTED: probable glutathione S-transferase      138   9e-37   
ref|XP_004504278.1|  PREDICTED: probable glutathione S-transferas...    133   1e-36   
ref|XP_007034533.1|  Glutathione S-transferase tau 7                    138   1e-36   
gb|ADB11374.1|  tau class glutathione transferase GSTU50                138   1e-36   
ref|XP_009770038.1|  PREDICTED: probable glutathione S-transferase      138   1e-36   
ref|XP_007134780.1|  hypothetical protein PHAVU_010G075400g             138   1e-36   
ref|XP_002467620.1|  hypothetical protein SORBIDRAFT_01g031000          138   1e-36   
ref|XP_010693980.1|  PREDICTED: probable glutathione S-transferase      138   1e-36   
ref|XP_011459710.1|  PREDICTED: probable glutathione S-transferase      134   1e-36   
ref|XP_010245130.1|  PREDICTED: probable glutathione S-transferas...    138   1e-36   
ref|XP_007200028.1|  hypothetical protein PRUPE_ppa024281mg             137   1e-36   
ref|XP_009335024.1|  PREDICTED: probable glutathione S-transferas...    129   1e-36   
ref|XP_006420233.1|  hypothetical protein CICLE_v10005812mg             138   1e-36   
ref|XP_004307164.1|  PREDICTED: glutathione transferase GST 23-li...    138   1e-36   
ref|XP_006367672.1|  PREDICTED: probable glutathione S-transferas...    137   1e-36   
ref|XP_009365488.1|  PREDICTED: probable glutathione S-transferase      137   1e-36   
ref|XP_007201513.1|  hypothetical protein PRUPE_ppa015182mg             137   1e-36   
ref|XP_002277724.2|  PREDICTED: glutathione transferase GST 23          138   1e-36   
ref|XP_010091847.1|  Glutathione transferase GST 23                     137   1e-36   
ref|XP_009133847.1|  PREDICTED: glutathione S-transferase U5            138   1e-36   
ref|XP_008438427.1|  PREDICTED: probable glutathione S-transferas...    138   1e-36   
ref|XP_007036677.1|  Tau class glutathione transferase GSTU26           137   1e-36   
ref|XP_010279541.1|  PREDICTED: probable glutathione S-transferas...    138   1e-36   
gb|KHN06986.1|  Putative glutathione S-transferase                      138   1e-36   
ref|XP_004243192.1|  PREDICTED: probable glutathione S-transferase      137   1e-36   
ref|XP_009140998.1|  PREDICTED: glutathione S-transferase U7            137   1e-36   
ref|XP_004983843.1|  PREDICTED: probable glutathione S-transferas...    137   1e-36   
gb|KJB28263.1|  hypothetical protein B456_005G038700                    137   1e-36   
ref|XP_006480912.1|  PREDICTED: glutathione S-transferase U8-like       137   1e-36   
gb|AAF64450.1|AF239928_1  glutathione S-transferase                     137   2e-36   
gb|ABE86679.1|  Intracellular chloride channel                          137   2e-36   
ref|XP_011013656.1|  PREDICTED: probable glutathione S-transferase      137   2e-36   
ref|XP_002465032.1|  hypothetical protein SORBIDRAFT_01g030810          138   2e-36   
gb|ACJ86045.1|  unknown                                                 137   2e-36   
ref|XP_010663654.1|  PREDICTED: probable glutathione S-transferase      135   2e-36   
ref|XP_004299558.1|  PREDICTED: probable glutathione S-transferase      137   2e-36   
ref|XP_011036235.1|  PREDICTED: probable glutathione S-transferase      137   2e-36   
gb|AFK47637.1|  unknown                                                 137   2e-36   
ref|XP_003632028.2|  PREDICTED: glutathione transferase GST 23-like     137   2e-36   
ref|XP_010060807.1|  PREDICTED: glutathione S-transferase U25-lik...    137   2e-36   
ref|XP_008775488.1|  PREDICTED: probable glutathione S-transferas...    137   2e-36   
ref|XP_003529123.1|  PREDICTED: probable glutathione S-transferas...    137   2e-36   
ref|XP_010060806.1|  PREDICTED: glutathione S-transferase U19-lik...    137   2e-36   
gb|ADB11357.1|  tau class glutathione transferase GSTU25                137   2e-36   
ref|XP_002262767.1|  PREDICTED: probable glutathione S-transferase      137   2e-36   
gb|AFP20277.1|  glutathione transferase 23                              137   2e-36   
ref|XP_011029701.1|  PREDICTED: glutathione transferase GST 23-li...    137   2e-36   
gb|ADC95628.1|  glutathione S-transferase                               137   2e-36   
ref|XP_004290019.1|  PREDICTED: probable glutathione S-transferase      137   2e-36   
gb|AEB77869.1|  glutathione S-transferase protein                       137   2e-36   
ref|XP_006429233.1|  hypothetical protein CICLE_v10012710mg             137   2e-36   
ref|XP_008784133.1|  PREDICTED: glutathione S-transferase U10-like      137   2e-36   
ref|XP_011029700.1|  PREDICTED: glutathione transferase GST 23-li...    137   2e-36   
gb|AFK41515.1|  unknown                                                 135   2e-36   
gb|AEB77872.1|  glutathione S-transferase protein                       137   2e-36   
ref|XP_004157056.1|  PREDICTED: glutathione S-transferase U8-like       137   2e-36   
ref|NP_001237698.1|  glutathione S-transferase GST 20                   137   2e-36   
gb|AFK38903.1|  unknown                                                 137   2e-36   
gb|ACN60408.1|  glutathione S-transferase                               137   2e-36   
ref|XP_007210650.1|  hypothetical protein PRUPE_ppa019399mg             137   2e-36   
ref|XP_002264437.1|  PREDICTED: probable glutathione S-transferase      137   2e-36   
ref|XP_003578262.1|  PREDICTED: glutathione transferase GST 23-li...    137   2e-36   
ref|XP_002323591.2|  glutathione S-transferase GST 15 family protein    137   2e-36   
ref|XP_009629347.1|  PREDICTED: probable glutathione S-transferase      137   2e-36   
ref|XP_008239963.1|  PREDICTED: glutathione S-transferase U10-like      137   2e-36   
ref|XP_006849225.1|  hypothetical protein AMTR_s00027p00230720          134   2e-36   
ref|XP_009144373.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    137   2e-36   
ref|XP_008781207.1|  PREDICTED: probable glutathione S-transferase      137   3e-36   
ref|XP_004229525.1|  PREDICTED: glutathione transferase GST 23-like     132   3e-36   
ref|XP_010942640.1|  PREDICTED: glutathione transferase GST 23-like     137   3e-36   
ref|XP_010414385.1|  PREDICTED: glutathione S-transferase U5-like       137   3e-36   
gb|ACU16110.1|  unknown                                                 135   3e-36   
emb|CAN65425.1|  hypothetical protein VITISV_005300                     144   3e-36   
gb|ABW81138.1|  GST34                                                   137   3e-36   
gb|AGV54744.1|  glutathione transferase                                 137   3e-36   
gb|KHG11258.1|  putative glutathione S-transferase                      137   3e-36   
ref|XP_008239964.1|  PREDICTED: glutathione S-transferase U10-like      137   3e-36   
ref|XP_008451810.1|  PREDICTED: probable glutathione S-transferas...    137   3e-36   
dbj|BAD91093.1|  glutathione S-transferase GST 18                       137   3e-36   
ref|XP_011041491.1|  PREDICTED: probable glutathione S-transferase      137   3e-36   
ref|NP_180508.1|  glutathione S-transferase tau 3                       137   3e-36   
gb|AJE59685.1|  tau class glutathione S-transferase                     137   3e-36   
ref|XP_007140454.1|  hypothetical protein PHAVU_008G113600g             137   3e-36   
ref|XP_010051836.1|  PREDICTED: probable glutathione S-transferas...    137   3e-36   
ref|XP_010029766.1|  PREDICTED: glutathione S-transferase U9-like       137   3e-36   
ref|NP_001065132.1|  Os10g0529900                                       137   3e-36   
ref|XP_006829814.1|  hypothetical protein AMTR_s00119p00077600          137   3e-36   
ref|XP_006849232.1|  hypothetical protein AMTR_s00027p00233060          137   3e-36   
ref|XP_002262644.1|  PREDICTED: probable glutathione S-transferase      136   4e-36   
ref|XP_007200430.1|  hypothetical protein PRUPE_ppa011142mg             136   4e-36   
ref|XP_003634746.1|  PREDICTED: probable glutathione S-transferase      136   4e-36   
ref|XP_010663865.1|  PREDICTED: glutathione S-transferase U9-like       137   4e-36   
emb|CAN83043.1|  hypothetical protein VITISV_027913                     136   4e-36   
gb|ADD71974.1|  glutathione S-transferase                               136   4e-36   
ref|XP_002892975.1|  predicted protein                                  136   4e-36   
ref|NP_001238691.1|  glutathione S-transferase                          136   4e-36   
ref|XP_002881046.1|  glutathione-s-tranferase 6                         136   4e-36   
ref|XP_010279542.1|  PREDICTED: probable glutathione S-transferas...    137   4e-36   
ref|XP_003634751.1|  PREDICTED: probable glutathione S-transferase      136   4e-36   
gb|ADB11367.1|  putative tau class glutathione transferase GSTU41       136   4e-36   
ref|XP_002319750.2|  hypothetical protein POPTR_0013s06950g             136   4e-36   
ref|XP_002520480.1|  glutathione s-transferase, putative                136   4e-36   
ref|XP_002283736.1|  PREDICTED: probable glutathione S-transferase      136   4e-36   
ref|XP_007037326.1|  Glutathione S-transferase tau 9                    137   4e-36   
gb|ABW74586.1|  glutathione-S-transferase                               136   4e-36   
gb|AEB77867.1|  glutathione S-transferase protein                       136   4e-36   
ref|XP_003529124.1|  PREDICTED: probable glutathione S-transferas...    136   4e-36   
ref|XP_010037779.1|  PREDICTED: probable glutathione S-transferase      136   4e-36   
gb|AFK45620.1|  unknown                                                 136   4e-36   
ref|XP_010923032.1|  PREDICTED: probable glutathione S-transferase      136   5e-36   
ref|XP_006488416.1|  PREDICTED: glutathione S-transferase U7-like       136   5e-36   
ref|XP_004229524.1|  PREDICTED: glutathione transferase GST 23-like     130   5e-36   
gb|KDO66686.1|  hypothetical protein CISIN_1g041800mg                   136   5e-36   
ref|XP_002267733.1|  PREDICTED: probable glutathione S-transferase      136   5e-36   
ref|XP_009606318.1|  PREDICTED: probable glutathione S-transferase      136   5e-36   
gb|ABK27093.1|  unknown                                                 137   5e-36   
ref|XP_010037778.1|  PREDICTED: glutathione S-transferase U8-like       136   5e-36   
gb|AFK44026.1|  unknown                                                 136   5e-36   
ref|XP_010060808.1|  PREDICTED: probable glutathione S-transferase      136   5e-36   
ref|XP_007200139.1|  hypothetical protein PRUPE_ppa017192mg             136   5e-36   
ref|XP_006849223.1|  hypothetical protein AMTR_s00027p00230090          136   5e-36   
gb|AFK37419.1|  unknown                                                 136   5e-36   
ref|XP_010039178.1|  PREDICTED: probable glutathione S-transferase      136   5e-36   
ref|XP_007211046.1|  hypothetical protein PRUPE_ppa019082mg             136   5e-36   
gb|AEI01103.1|  glutathione transferase                                 136   5e-36   
ref|XP_002465034.1|  hypothetical protein SORBIDRAFT_01g030930          136   5e-36   
ref|XP_003623200.1|  Glutathione S-transferase GST                      135   5e-36   
ref|NP_001236169.1|  uncharacterized protein LOC100500052               136   6e-36   



>emb|CDO99237.1| unnamed protein product [Coffea canephora]
Length=227

 Score =   171 bits (433),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M   +G+K++GFWVSP+VLRVKWAL++KG+EYEYIEED+FNK+PLL +LNPV  +VPVLV
Sbjct  1    MEENQGVKLLGFWVSPYVLRVKWALKLKGIEYEYIEEDVFNKSPLLLKLNPVKGQVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
            H+GKP+PES++ILEYIDE WKH+PLLP DPYERA +RFWA FA  K+
Sbjct  61   HDGKPIPESIVILEYIDEVWKHSPLLPQDPYERANSRFWAKFAAEKL  107


 Score = 66.6 bits (161),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  379  EALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVA  558
            EALCS+G+  E A+N++MEA+EK+E ELNGK+FFGG+K G+++LV G++++ LP++EE+ 
Sbjct  113  EALCSRGEDHERAINASMEALEKMEKELNGKKFFGGDKIGFVDLVAGFISYQLPVYEEIV  172

Query  559  SL  564
            S+
Sbjct  173  SM  174



>emb|CDP08010.1| unnamed protein product [Coffea canephora]
Length=231

 Score =   169 bits (428),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M    G+K++GFWVSPF  RVKWAL++KG++YEYIEEDI+NK+PLLS+LNPV+  VPVLV
Sbjct  1    MEETGGVKLLGFWVSPFAQRVKWALKLKGVQYEYIEEDIYNKSPLLSKLNPVYGMVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRE  401
            HNGKP+ ES++ILEYIDE WK  PLLP DPYERA+ARFWA FAE K+      +     E
Sbjct  61   HNGKPISESIIILEYIDEVWKQAPLLPQDPYERAQARFWAKFAEEKVRQSVWEAMCSSGE  120

Query  402  TARKCSK  422
              +K  K
Sbjct  121  EKQKAVK  127



>ref|XP_007035120.1| Glutathione S-transferase tau 7 [Theobroma cacao]
 gb|EOY06046.1| Glutathione S-transferase tau 7 [Theobroma cacao]
Length=248

 Score =   169 bits (427),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 105/135 (78%), Gaps = 4/135 (3%)
 Frame = +3

Query  12   KQDRNITVVIMAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLN  191
            KQ++ I   +MA +E +K++GFWVSPFV RV+WAL++KG++YEYIEEDIFNK+ LL +LN
Sbjct  16   KQEQEI---LMATKE-VKLLGFWVSPFVFRVEWALKIKGVKYEYIEEDIFNKSTLLMELN  71

Query  192  PVHAKVPVLVHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDP  371
            PV  KVPVLVH+GK + ES +ILEYIDETWK NPLLP DPY+RA ARFWA FAE KIL+ 
Sbjct  72   PVRKKVPVLVHDGKVIAESFVILEYIDETWKQNPLLPQDPYQRALARFWAKFAEEKILEG  131

Query  372  TRGSTVFQRETARKC  416
               +   Q E  +K 
Sbjct  132  AWNALCSQGEEKQKA  146


 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 55/79 (70%), Gaps = 10/79 (13%)
 Frame = +1

Query  358  RFWTPPGE---------ALCSKGKQQESAVNSameamekleaelNGKQ-FFGGEKTGYLN  507
            RFW    E         ALCS+G++++ A+   +EAMEK+E EL GKQ FFGGE  GYL+
Sbjct  118  RFWAKFAEEKILEGAWNALCSQGEEKQKALRQTIEAMEKIEGELEGKQQFFGGESVGYLD  177

Query  508  LVVGWVAHNLPIFEEVASL  564
            +++GW+++ LP++EEV S+
Sbjct  178  IILGWISYWLPVWEEVGSM  196



>ref|XP_007035121.1| Glutathione S-transferase tau 7 isoform 1 [Theobroma cacao]
 gb|EOY06047.1| Glutathione S-transferase tau 7 isoform 1 [Theobroma cacao]
Length=241

 Score =   166 bits (419),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 97/125 (78%), Gaps = 1/125 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA EE +K++GFWVSP V RVKWAL +KG++YEYIEEDIFNK+ LL +LNPVH KVPVLV
Sbjct  1    MATEE-VKLLGFWVSPPVFRVKWALEIKGVKYEYIEEDIFNKSTLLMELNPVHKKVPVLV  59

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRE  401
            H+GK + ES +ILEYIDETWK NPLLP DPY+RA ARFWA FAE KIL     +   Q E
Sbjct  60   HDGKAIAESFVILEYIDETWKQNPLLPQDPYQRALARFWAKFAEEKILRGAWNALCSQGE  119

Query  402  TARKC  416
              +K 
Sbjct  120  EKQKA  124


 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 55/79 (70%), Gaps = 10/79 (13%)
 Frame = +1

Query  358  RFWTPPGE---------ALCSKGKQQESAVNSameamekleaelNGK-QFFGGEKTGYLN  507
            RFW    E         ALCS+G++++ A+   +EAMEK+E EL GK QFFGGE  GYL+
Sbjct  96   RFWAKFAEEKILRGAWNALCSQGEEKQKALEQTIEAMEKIEGELEGKEQFFGGESVGYLD  155

Query  508  LVVGWVAHNLPIFEEVASL  564
            +++GW+++ LP++EEV S+
Sbjct  156  IILGWISYCLPVWEEVGSM  174



>emb|CBI26437.3| unnamed protein product [Vitis vinifera]
Length=231

 Score =   164 bits (415),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++G WVSPFV RV+WAL+ KG+EYEY+EED+ NK+ LL   NPVH KVPVL+HNG
Sbjct  3    EEQVKLLGIWVSPFVKRVEWALKFKGIEYEYVEEDLTNKSSLLLTSNPVHQKVPVLLHNG  62

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETAR  410
             P+ ESL+I+EYIDE WK NP+LP DP+ERA+ARFWA F E KI + TR + V + E   
Sbjct  63   NPIVESLVIIEYIDENWKQNPILPQDPHERAKARFWANFIEQKITEATRTALVTEGEQQE  122

Query  411  KCSK  422
            K  K
Sbjct  123  KVVK  126



>ref|XP_007035122.1| Glutathione S-transferase tau 7 isoform 2, partial [Theobroma 
cacao]
 gb|EOY06048.1| Glutathione S-transferase tau 7 isoform 2, partial [Theobroma 
cacao]
Length=222

 Score =   164 bits (414),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++GFWVSP V RVKWAL +KG++YEYIEEDIFNK+ LL +LNPVH KVPVLVH+GK
Sbjct  1    EEVKLLGFWVSPPVFRVKWALEIKGVKYEYIEEDIFNKSTLLMELNPVHKKVPVLVHDGK  60

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETARK  413
             + ES +ILEYIDETWK NPLLP DPY+RA ARFWA FAE KIL     +   Q E  +K
Sbjct  61   AIAESFVILEYIDETWKQNPLLPQDPYQRALARFWAKFAEEKILRGAWNALCSQGEEKQK  120

Query  414  C  416
             
Sbjct  121  A  121


 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 55/79 (70%), Gaps = 10/79 (13%)
 Frame = +1

Query  358  RFWTPPGE---------ALCSKGKQQESAVNSameamekleaelNGK-QFFGGEKTGYLN  507
            RFW    E         ALCS+G++++ A+   +EAMEK+E EL GK QFFGGE  GYL+
Sbjct  93   RFWAKFAEEKILRGAWNALCSQGEEKQKALEQTIEAMEKIEGELEGKEQFFGGESVGYLD  152

Query  508  LVVGWVAHNLPIFEEVASL  564
            +++GW+++ LP++EEV S+
Sbjct  153  IILGWISYCLPVWEEVGSM  171



>ref|XP_002266900.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=236

 Score =   164 bits (415),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++G WVSPFV RV+WAL+ KG+EYEY+EED+ NK+ LL   NPVH KVPVL+HNG
Sbjct  8    EEQVKLLGIWVSPFVKRVEWALKFKGIEYEYVEEDLTNKSSLLLTSNPVHQKVPVLLHNG  67

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETAR  410
             P+ ESL+I+EYIDE WK NP+LP DP+ERA+ARFWA F E KI + TR + V + E   
Sbjct  68   NPIVESLVIIEYIDENWKQNPILPQDPHERAKARFWANFIEQKITEATRTALVTEGEQQE  127

Query  411  KCSK  422
            K  K
Sbjct  128  KVVK  131



>emb|CDP08048.1| unnamed protein product [Coffea canephora]
Length=279

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M    G+K+ GFWVSPF  RVKWAL++KG++YEYIEED +NK+PLL +LNPV+ KVPVLV
Sbjct  1    MEEAGGVKLFGFWVSPFAQRVKWALKLKGIQYEYIEEDKYNKSPLLLKLNPVYGKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRE  401
            HNGKP+ ES++ILEYIDE WK  PLLP DPYERA+A FWA FAE K+      +     +
Sbjct  61   HNGKPISESIIILEYIDEVWKQAPLLPQDPYERAQAHFWAKFAEEKVRQSVVEAMCSSGD  120

Query  402  TARKCSKLS  428
              +K  KL+
Sbjct  121  EKQKAVKLA  129



>gb|KEH20685.1| glutathione S-transferase [Medicago truncatula]
Length=224

 Score =   163 bits (413),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 96/128 (75%), Gaps = 0/128 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
              + +K+VGFWVSPFV RV+WAL++KG+ YEY+EEDIFNKTPLL +LNPVH KVPVLVH 
Sbjct  2    GSQDVKLVGFWVSPFVKRVEWALKLKGVNYEYVEEDIFNKTPLLLELNPVHKKVPVLVHA  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETA  407
             KP+ ES +ILEYIDETWK +PLLP  PYERA ARFWA FAE K+L+    +     E  
Sbjct  62   QKPIAESFIILEYIDETWKQSPLLPQHPYERALARFWADFAEQKLLNAAWIAMCNSGEEQ  121

Query  408  RKCSKLSH  431
             K  K++ 
Sbjct  122  EKALKVAR  129


 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 53/78 (68%), Gaps = 9/78 (12%)
 Frame = +1

Query  358  RFWTPPGE---------ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW    E         A+C+ G++QE A+  A EA+EK+E E+ GK+FFGG+  GYL+L
Sbjct  96   RFWADFAEQKLLNAAWIAMCNSGEEQEKALKVAREAIEKIEEEIKGKKFFGGDNIGYLDL  155

Query  511  VVGWVAHNLPIFEEVASL  564
             +GW+++ LP+FEEV S+
Sbjct  156  ALGWISYWLPVFEEVGSM  173



>ref|NP_001234088.1| uncharacterized protein LOC543815 [Solanum lycopersicum]
 gb|AAG16758.1| putative glutathione S-transferase T3 [Solanum lycopersicum]
Length=225

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A E +K++G+W SPF L+V WAL++KG+EYEY EED+ NK+PLL Q NPVH K+PVLVHN
Sbjct  2    ASEKVKLLGYWASPFALKVHWALKLKGIEYEYQEEDLSNKSPLLLQYNPVHKKIPVLVHN  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGS  383
            GKP+ ESL+ILEYI+ETWKHNPLLP DPYERA+ARFWA F + K +    G+
Sbjct  62   GKPIAESLVILEYIEETWKHNPLLPEDPYERAKARFWAKFVDDKCVPGIFGT  113



>gb|ACJ83863.1| unknown [Medicago truncatula]
 gb|AFK45626.1| unknown [Medicago truncatula]
Length=224

 Score =   163 bits (412),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 96/128 (75%), Gaps = 0/128 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
              + +K+VGFWVSPFV RV+WAL++KG+ YEY+EEDIFNKTPLL +LNPVH KVPVLVH 
Sbjct  2    GSQDVKLVGFWVSPFVKRVEWALKLKGVNYEYVEEDIFNKTPLLLELNPVHKKVPVLVHA  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETA  407
             KP+ ES +ILEYIDETWK +PLLP  PYERA ARFWA FAE K+L+    +     E  
Sbjct  62   QKPIAESFIILEYIDETWKQSPLLPQHPYERALARFWADFAEQKLLNAAWIAMCNSGEER  121

Query  408  RKCSKLSH  431
             K  K++ 
Sbjct  122  EKALKVAR  129


 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 53/78 (68%), Gaps = 9/78 (12%)
 Frame = +1

Query  358  RFWTPPGE---------ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW    E         A+C+ G+++E A+  A EA+EK+E E+ GK+FFGG+  GYL+L
Sbjct  96   RFWADFAEQKLLNAAWIAMCNSGEEREKALKVAREAIEKIEEEIKGKKFFGGDNIGYLDL  155

Query  511  VVGWVAHNLPIFEEVASL  564
             +GW+++ LP+FEEV S+
Sbjct  156  ALGWISYWLPVFEEVGSM  173



>gb|KDP40336.1| hypothetical protein JCGZ_02334 [Jatropha curcas]
Length=230

 Score =   162 bits (410),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 100/130 (77%), Gaps = 1/130 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA +E +K++G WVSPFV RV+WAL++KG++YEYIEEDIFNK+PLL QLNPV+ KVPVLV
Sbjct  1    MAKKEEVKLLGLWVSPFVRRVEWALKLKGVDYEYIEEDIFNKSPLLLQLNPVNKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPTRGSTVFQR  398
            H  K + ES +ILEYIDETWKHN PLLP DPY+RA+ARFWA FAE KI +    +     
Sbjct  61   HGNKVIAESFVILEYIDETWKHNYPLLPQDPYQRAKARFWAKFAEEKIFEAAWNALCSLG  120

Query  399  ETARKCSKLS  428
            +   +  K++
Sbjct  121  DEKERAIKMT  130


 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 52/78 (67%), Gaps = 9/78 (12%)
 Frame = +1

Query  358  RFWTPPGE---------ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW    E         ALCS G ++E A+   +EA+EKLE EL GKQFFGGE  GY+++
Sbjct  98   RFWAKFAEEKIFEAAWNALCSLGDEKERAIKMTIEALEKLEGELEGKQFFGGENIGYVDI  157

Query  511  VVGWVAHNLPIFEEVASL  564
            + GW+++ LP++EEV S+
Sbjct  158  LAGWISYWLPVWEEVGSM  175



>ref|XP_006433894.1| hypothetical protein CICLE_v10002406mg [Citrus clementina]
 gb|ESR47134.1| hypothetical protein CICLE_v10002406mg [Citrus clementina]
Length=222

 Score =   162 bits (409),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AEE +K++G+W SPF LRVKWAL++KG+ YEY+EE++ NK+PLL + NPV+ K+PVLVHN
Sbjct  2    AEESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVHN  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETA  407
            GKPL ESLLI+EYIDE WK NPLLP DPYERA ARFWA F + K +    G+   + E  
Sbjct  62   GKPLAESLLIIEYIDEAWKQNPLLPEDPYERANARFWAKFFDEKCVPEVMGAFASKGEEQ  121

Query  408  RKCSK  422
             K +K
Sbjct  122  EKAAK  126



>ref|XP_002266994.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=236

 Score =   162 bits (410),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++G W SPFV R++WAL+ KG+EYEY+EED+ NK+ LL   NPVH KVPVL+HNG
Sbjct  8    EEQVKLLGIWFSPFVRRIEWALKFKGIEYEYVEEDLTNKSSLLLTSNPVHQKVPVLLHNG  67

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETAR  410
             P+ ESL+I+EYIDE WK NP+LP DP+ERA+ARFWA F E KI + TR + V + E  +
Sbjct  68   NPIVESLVIIEYIDENWKQNPILPQDPHERAKARFWANFIEQKITEATRTALVTEGEQQK  127

Query  411  KCSK  422
            K  K
Sbjct  128  KVVK  131



>gb|KDO81087.1| hypothetical protein CISIN_1g027498mg [Citrus sinensis]
Length=222

 Score =   162 bits (409),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AEE +K++G+W SPF LRVKWAL++KG+ YEY+EE++ NK+PLL + NPV+ K+PVLVHN
Sbjct  2    AEESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVHN  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETA  407
            GKPL ESLLI+EYIDE WK NPLLP DPYERA ARFWA F + K +    G+   + E  
Sbjct  62   GKPLAESLLIIEYIDEAWKQNPLLPDDPYERANARFWAKFFDEKCVPEVMGAFASKGEEQ  121

Query  408  RKCSK  422
             K +K
Sbjct  122  EKAAK  126



>emb|CBI26438.3| unnamed protein product [Vitis vinifera]
Length=231

 Score =   162 bits (410),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++G W SPFV R++WAL+ KG+EYEY+EED+ NK+ LL   NPVH KVPVL+HNG
Sbjct  3    EEQVKLLGIWFSPFVRRIEWALKFKGIEYEYVEEDLTNKSSLLLTSNPVHQKVPVLLHNG  62

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETAR  410
             P+ ESL+I+EYIDE WK NP+LP DP+ERA+ARFWA F E KI + TR + V + E  +
Sbjct  63   NPIVESLVIIEYIDENWKQNPILPQDPHERAKARFWANFIEQKITEATRTALVTEGEQQK  122

Query  411  KCSK  422
            K  K
Sbjct  123  KVVK  126



>ref|XP_002268774.2| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
 emb|CBI26443.3| unnamed protein product [Vitis vinifera]
Length=236

 Score =   162 bits (410),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++G W SPFV RV+WAL+ KG+EYEY+EED+ NK+ LL   NPV+ KVPVL+HNG
Sbjct  9    EEQVKLLGSWYSPFVKRVEWALKFKGIEYEYVEEDLINKSSLLLTSNPVYKKVPVLLHNG  68

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETAR  410
             P+ ++L+I+EYIDETWKHNP+LP DP+ERA+ARFWA F E K+ D  R + + Q E   
Sbjct  69   NPIAQTLVIIEYIDETWKHNPILPQDPHERAKARFWADFIEVKLTDVVRTALITQGEQQE  128

Query  411  KCSK  422
            K  K
Sbjct  129  KAVK  132



>ref|XP_009593034.1| PREDICTED: glutathione transferase GST 23-like [Nicotiana tomentosiformis]
Length=225

 Score =   161 bits (408),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A EG+K++G+W SP+ LRV WAL++KG+EY+Y EED+ NK+PLL Q NPVH K+PVLVHN
Sbjct  2    AGEGVKLLGYWASPYALRVHWALKLKGVEYDYQEEDLPNKSPLLLQYNPVHKKIPVLVHN  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            GKP+ ESL+ILEYIDETWK NPLLP DPYERA+ARFWA F + K +
Sbjct  62   GKPIAESLVILEYIDETWKQNPLLPEDPYERAKARFWAKFVDDKCV  107



>emb|CAN73419.1| hypothetical protein VITISV_027346 [Vitis vinifera]
Length=236

 Score =   161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++G W SPFV R++WAL+ KG+EYEY+EED+ NK+ LL   NPVH KVPVL+HNG
Sbjct  8    EEQVKLLGIWFSPFVRRIEWALKFKGIEYEYVEEDLTNKSSLLLTSNPVHXKVPVLLHNG  67

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETAR  410
             P+ ESL+I+EYIDE WK NP+LP DP+ERA+ARFWA F E KI + TR + V + E   
Sbjct  68   NPIVESLVIIEYIDENWKQNPILPQDPHERAKARFWANFIEQKITEATRTALVTEGEQQX  127

Query  411  KCSK  422
            K  K
Sbjct  128  KVVK  131



>ref|XP_011091312.1| PREDICTED: glutathione transferase GST 23-like [Sesamum indicum]
Length=231

 Score =   160 bits (404),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 98/124 (79%), Gaps = 0/124 (0%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            E  +K+VGFWVSPFV RV+WAL++KG+EYEYIEEDIFNK+PLLS+LNP++ KVPVLVH+G
Sbjct  6    ESSVKLVGFWVSPFVHRVRWALKLKGVEYEYIEEDIFNKSPLLSELNPLYKKVPVLVHDG  65

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETAR  410
            KPL +S +ILEY+D+ W+ NPL P DPY+RA+A  WA FA+ K+L+    +   + +T  
Sbjct  66   KPLSDSSIILEYVDQKWRSNPLFPDDPYQRAQAHLWARFADEKVLESAWLALCSEGKTQE  125

Query  411  KCSK  422
            +  K
Sbjct  126  RAVK  129


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  382  ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEV  555
            ALCS+GK QE AV  A+E +E +E +L GK+FFGG+  G+++L++G++++ LP++EEV
Sbjct  116  ALCSEGKTQERAVKQAIENLEHVEEKLKGKRFFGGDIIGHVDLMMGFISYMLPVWEEV  173



>ref|XP_006472526.1| PREDICTED: glutathione transferase GST 23-like [Citrus sinensis]
Length=222

 Score =   159 bits (403),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AEE +K++G+W SPF LRVKWAL++KG+ YEY+EE++ NK+PLL + NPV+ K+PVLVHN
Sbjct  2    AEESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVHN  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETA  407
            GKPL ESLLI+EYIDE WK NPLLP DPYERA AR WA F + K +    G+   + E  
Sbjct  62   GKPLAESLLIIEYIDEAWKQNPLLPDDPYERANARLWAKFFDEKCVPEVMGAFASKGEEQ  121

Query  408  RKCSK  422
             K +K
Sbjct  122  EKAAK  126



>ref|XP_006354565.1| PREDICTED: glutathione transferase GST 23-like isoform X1 [Solanum 
tuberosum]
Length=225

 Score =   159 bits (403),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++G W SP  LRV WAL++KG+EY+Y EED+ NK+PLL Q NPVH K+PVLVHNGK
Sbjct  4    EKVKLLGNWASPSALRVHWALKLKGIEYDYQEEDLRNKSPLLLQYNPVHKKIPVLVHNGK  63

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETARK  413
            P+ ESL+ILEYI+ETWKHNPLLP DPYERA+ARFWA F + K +    G+ V   E  +K
Sbjct  64   PIAESLVILEYIEETWKHNPLLPEDPYERAKARFWAKFVDDKCVPGIFGTFVKVGEEQQK  123

Query  414  CSK  422
             +K
Sbjct  124  IAK  126



>ref|XP_006378334.1| hypothetical protein POPTR_0010s08170g [Populus trichocarpa]
 gb|ADB11376.1| tau class glutathione transferase GSTU52 [Populus trichocarpa]
 gb|ERP56131.1| hypothetical protein POPTR_0010s08170g [Populus trichocarpa]
Length=229

 Score =   159 bits (403),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 95/129 (74%), Gaps = 0/129 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA  E +K++GFW SPF  RV+WAL++KG++YEYIEEDIFNK+ LL +LNPVH KVPVLV
Sbjct  1    MANTEQVKLLGFWASPFARRVEWALKLKGVDYEYIEEDIFNKSSLLMELNPVHKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRE  401
            H  K + ES +ILE+IDETWK  PL+P DPYERA+ RFWA FAE KILD    +     E
Sbjct  61   HGRKVIAESFVILEFIDETWKQCPLMPQDPYERAKTRFWAKFAEEKILDGAWIAMCSLGE  120

Query  402  TARKCSKLS  428
               K  KL+
Sbjct  121  EKEKAIKLA  129


 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 53/78 (68%), Gaps = 9/78 (12%)
 Frame = +1

Query  358  RFWTPPGE---------ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW    E         A+CS G+++E A+  A+EA+EK+E EL GK FFGGE  GYL++
Sbjct  97   RFWAKFAEEKILDGAWIAMCSLGEEKEKAIKLAVEAIEKIEGELKGKHFFGGENIGYLDI  156

Query  511  VVGWVAHNLPIFEEVASL  564
             +GW+++ LP++EEV S+
Sbjct  157  AMGWMSYWLPVWEEVGSM  174



>emb|CDO99236.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   159 bits (403),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = +3

Query  66   VVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPLPE  245
            ++GFW SPFV RVKWAL++KG+EYEYIEED+F+K+ LL +LNPV   VPVLVHN KP+ E
Sbjct  8    LLGFWASPFVQRVKWALKLKGVEYEYIEEDLFDKSSLLLKLNPVQKLVPVLVHNRKPISE  67

Query  246  SLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETARKCSKL  425
            S+LILEYIDE WK NPLLP DPYERA+ARFWA FAE K+ + T  +   + E   K  K 
Sbjct  68   SILILEYIDEVWKQNPLLPHDPYERAQARFWAKFAEEKVRESTWDALCSRGEEREKAVKS  127

Query  426  S  428
            S
Sbjct  128  S  128


 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 54/80 (68%), Gaps = 11/80 (14%)
 Frame = +1

Query  358  RFWTPPGE---------ALCSKGKQQESAVNSameamek--leaelNGKQFFGGEKTGYL  504
            RFW    E         ALCS+G+++E AV S++EA+EK   E +L G +FFGGE  G++
Sbjct  96   RFWAKFAEEKVRESTWDALCSRGEEREKAVKSSIEALEKFEEELKLKGTKFFGGETIGFV  155

Query  505  NLVVGWVAHNLPIFEEVASL  564
            +LV G++++ LP+FEEV S+
Sbjct  156  DLVAGFISYQLPVFEEVGSM  175



>ref|XP_003629836.1| Receptor-like protein kinase [Medicago truncatula]
Length=869

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 107/144 (74%), Gaps = 5/144 (3%)
 Frame = +3

Query  9    EKQDRNITVV----IMAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPL  176
            E++DR   +V    IM +++ +K+VGFWVSPFV RV+WAL++KG+ YEY+EEDIFNKTPL
Sbjct  631  ERRDRGNKLVQQYNIMGSQD-VKLVGFWVSPFVKRVEWALKLKGVNYEYVEEDIFNKTPL  689

Query  177  LSQLNPVHAKVPVLVHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEF  356
            L +LNPVH KVPVLVH  KP+ ES +ILEYIDETWK +PLLP  PYERA ARFWA FAE 
Sbjct  690  LLELNPVHKKVPVLVHAQKPIAESFIILEYIDETWKQSPLLPQHPYERALARFWADFAEQ  749

Query  357  KILDPTRGSTVFQRETARKCSKLS  428
            K+L+    +     E   K  K++
Sbjct  750  KLLNAAWIAMCNSGEEQEKALKVA  773


 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 53/78 (68%), Gaps = 9/78 (12%)
 Frame = +1

Query  358  RFWTPPGE---------ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW    E         A+C+ G++QE A+  A EA+EK+E E+ GK+FFGG+  GYL+L
Sbjct  741  RFWADFAEQKLLNAAWIAMCNSGEEQEKALKVAREAIEKIEEEIKGKKFFGGDNIGYLDL  800

Query  511  VVGWVAHNLPIFEEVASL  564
             +GW+++ LP+FEEV S+
Sbjct  801  ALGWISYWLPVFEEVGSM  818



>ref|XP_002280532.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=225

 Score =   148 bits (374),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +KV+G  +S F +RV+WAL++KG+EYEYI+ED+ NK+P+L + NPVH KVPVLVH  K
Sbjct  3    EEVKVIGSILSGFCVRVEWALKLKGVEYEYIKEDLRNKSPMLLKYNPVHKKVPVLVHGDK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            P+PESL+ILEYIDETWK NPLLP DPYERA ARFWA +A+ K L
Sbjct  63   PIPESLVILEYIDETWKDNPLLPEDPYERAMARFWAKYADEKCL  106


 Score = 57.4 bits (137),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  379  EALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVA  558
            EA  ++G+++E A+ SA+E+   LE  + GK+FFGGEK G+L+LVVGW+ H L + EEV 
Sbjct  111  EAFKAEGEEKEKAMESALESFAFLEKAIKGKKFFGGEKMGFLDLVVGWIPHWLSVLEEVG  170

Query  559  SL  564
             +
Sbjct  171  GM  172



>gb|AFK34023.1| unknown [Medicago truncatula]
Length=149

 Score =   155 bits (392),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AE+ L ++GFW SPFVLRVKWAL +KG++Y+Y+EED  NK+ +L Q NPV+ KVPVLVH+
Sbjct  2    AEDSLTILGFWGSPFVLRVKWALELKGVQYQYVEEDFKNKSDMLLQYNPVYKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            GK + ESL+ILEYIDE WK NPLLP DPYERA+ARFWA FA+ K +
Sbjct  62   GKSISESLVILEYIDEIWKQNPLLPHDPYERAKARFWAKFADEKCV  107



>tpg|DAA46028.1| TPA: hypothetical protein ZEAMMB73_911431 [Zea mays]
Length=108

 Score =   154 bits (388),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA EEGLKV+G  VSPFVLRV  AL MKG+ YEY+EEDI NK+ LL + NPVH KVPVL+
Sbjct  1    MAGEEGLKVLGLQVSPFVLRVCLALNMKGVSYEYVEEDISNKSELLLKSNPVHKKVPVLI  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            HNGKP+ ESL+I++Y+DE +   P+LP DPYERA ARFWA +A+ K+L
Sbjct  61   HNGKPICESLVIMQYVDELFAGRPILPTDPYERATARFWAAYADDKVL  108



>ref|XP_007159485.1| hypothetical protein PHAVU_002G241400g [Phaseolus vulgaris]
 gb|ESW31479.1| hypothetical protein PHAVU_002G241400g [Phaseolus vulgaris]
Length=228

 Score =   157 bits (397),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 99/132 (75%), Gaps = 4/132 (3%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M +EE +KVV FWVSPF +RV+WAL++KG+EYEYIEEDIFNK+ LL QLNPVH KVPVL+
Sbjct  1    MGSEE-VKVVSFWVSPFGIRVEWALKLKGIEYEYIEEDIFNKSNLLLQLNPVHKKVPVLL  59

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPT---RGSTVF  392
            H  KP+ ES +IL+YIDE WKH PLLP  PY+RA   FWA F + K+LDP+     S+  
Sbjct  60   HAHKPIAESFIILQYIDEIWKHYPLLPQHPYQRALVHFWANFGDQKLLDPSWIAMCSSGD  119

Query  393  QRETARKCSKLS  428
             +E A K ++ S
Sbjct  120  DQENALKVARES  131


 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  367  TPPGEALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIF  546
             P   A+CS G  QE+A+  A E+MEK+E E+ GK+FFGG+  GYL++ +GW+++ LP++
Sbjct  108  DPSWIAMCSSGDDQENALKVARESMEKIEEEIKGKKFFGGDNIGYLDIALGWISYWLPVW  167

Query  547  EEVASL  564
            EEV S+
Sbjct  168  EEVGSM  173



>ref|XP_009778650.1| PREDICTED: glutathione transferase GST 23-like [Nicotiana sylvestris]
Length=225

 Score =   157 bits (397),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            EG+K++G W SPF LRV WAL++KG+EY+Y EED+ NK+PLL Q NPVH K+PVLVHNGK
Sbjct  4    EGVKLLGHWASPFALRVHWALKLKGVEYDYQEEDLPNKSPLLLQYNPVHKKIPVLVHNGK  63

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            P+ ES +ILEYIDETWK NPLLP DPYERA+ARFWA F + K +
Sbjct  64   PIAESSVILEYIDETWKKNPLLPEDPYERAKARFWAKFIDDKCV  107



>ref|XP_011030495.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=229

 Score =   157 bits (397),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA+ E +K++GFW SPF  RV+WAL++KG++YEYIEEDIFNK+ LL +LNPVH KVPVLV
Sbjct  1    MASTEQVKLLGFWASPFARRVEWALKLKGVDYEYIEEDIFNKSTLLMELNPVHKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRE  401
               K + ES +ILE+IDETWK  PL+P DPYERA  RFWA FAE KILD    +     E
Sbjct  61   RGRKVIAESFVILEFIDETWKQCPLMPQDPYERAMTRFWAKFAEEKILDAAWIAMCSLGE  120

Query  402  TARKCSKLS  428
               K  KL+
Sbjct  121  EKEKALKLA  129


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 54/78 (69%), Gaps = 9/78 (12%)
 Frame = +1

Query  358  RFWTPPGE---------ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW    E         A+CS G+++E A+  A+EAMEK+E EL GKQFFGGE  GYL++
Sbjct  97   RFWAKFAEEKILDAAWIAMCSLGEEKEKALKLAVEAMEKIEGELKGKQFFGGENIGYLDI  156

Query  511  VVGWVAHNLPIFEEVASL  564
             +GW+++ LP++EEV S+
Sbjct  157  AMGWMSYWLPVWEEVGSM  174



>ref|XP_002280676.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=225

 Score =   147 bits (370),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +KV+G   S F +RV+WAL++KG+EYEYI+ED+ NK+P+L + NPVH KVPVLVH  K
Sbjct  3    EEVKVIGSIKSGFCVRVEWALKLKGVEYEYIKEDLRNKSPMLLKYNPVHKKVPVLVHGDK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            P+PESL+ILEYIDETWK NPLLP DPYERA ARFWA +A+ K +
Sbjct  63   PIPESLVILEYIDETWKDNPLLPEDPYERAMARFWAKYADEKCM  106


 Score = 57.4 bits (137),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  379  EALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVA  558
            EA  ++G+++E A+ SA+E+   LE  + GK+FFGGEK G+L+LVVGW+ H L + EEV 
Sbjct  111  EAFKAEGEEKEKAMESALESFAFLEKAIKGKKFFGGEKMGFLDLVVGWIPHWLSVLEEVG  170

Query  559  SL  564
             +
Sbjct  171  GM  172



>ref|XP_010521899.1| PREDICTED: glutathione S-transferase U7-like [Tarenaya hassleriana]
Length=222

 Score =   156 bits (395),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA EE +K++G W SPF  R++ AL++KG+ Y+Y+EED+ NK+PLL QLNPVH K+PV V
Sbjct  1    MAEEEEVKLLGLWSSPFSCRIEMALKLKGVPYKYLEEDLENKSPLLLQLNPVHKKIPVFV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            HNGKP+ ESL+IL+YIDETWKHNP+LP DPYERA ARFWA F + ++L
Sbjct  61   HNGKPIAESLVILDYIDETWKHNPILPQDPYERAMARFWARFIDEQVL  108



>ref|XP_006420238.1| hypothetical protein CICLE_v10005771mg [Citrus clementina]
 gb|ESR33478.1| hypothetical protein CICLE_v10005771mg [Citrus clementina]
Length=236

 Score =   157 bits (396),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 97/131 (74%), Gaps = 2/131 (2%)
 Frame = +3

Query  36   VIMAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPV  215
            +IMA +  +KV+GFW SPFV RV WAL++KG+E+EYIEEDIFNK+  L +LNPVH KVPV
Sbjct  1    MIMATK--VKVLGFWCSPFVFRVVWALKLKGVEFEYIEEDIFNKSTRLLELNPVHKKVPV  58

Query  216  LVHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQ  395
            LVH+ K + ESL+ILEYIDETW  +PLLP DPYERA ARFWA FA+ K++     ST  +
Sbjct  59   LVHDDKVIVESLVILEYIDETWPQDPLLPQDPYERAMARFWAKFADEKLMQTAWKSTCTK  118

Query  396  RETARKCSKLS  428
             E      K +
Sbjct  119  GEEKEDALKAT  129


 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +1

Query  388  CSKGKQQESAVNSameamekleaelNGKQFFGGE-KTGYLNLVVGWVAHNLPIFEEVASL  564
            C+KG+++E A+ + ME +EK+E EL GK +FGGE K  YL + +GW+ + +PI+EE+AS+
Sbjct  116  CTKGEEKEDALKATMEVLEKIEGELKGKSYFGGENKYAYLEIAIGWINYLIPIWEEIASI  175



>gb|KEH35720.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=223

 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AE+ L ++GFW SPFVLRVKWAL +KG++Y+Y+EED  NK+ +L Q NPV+ KVPVLVH+
Sbjct  2    AEDSLTILGFWGSPFVLRVKWALELKGVQYQYVEEDFKNKSDMLLQYNPVYKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            GK + ESL+ILEYIDE WK NPLLP DPYERA+ARFWA FA+ K +
Sbjct  62   GKSISESLVILEYIDEIWKQNPLLPHDPYERAKARFWAKFADEKCV  107



>gb|AFK37185.1| unknown [Medicago truncatula]
Length=223

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AE+ L ++GFW SPFVLRVKWAL +KG++Y+Y+EED  NK+ +L Q NPV+ KVPVLVH+
Sbjct  2    AEDSLTILGFWGSPFVLRVKWALELKGVQYQYVEEDFKNKSDMLLQYNPVYKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            GK + ESL+ILEYIDE WK NPLLP DPYERA+ARFWA FA+ K +
Sbjct  62   GKSISESLVILEYIDEIWKQNPLLPHDPYERAKARFWAKFADEKCV  107



>ref|XP_010938159.1| PREDICTED: glutathione transferase GST 23-like [Elaeis guineensis]
Length=225

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A+  +K++G W SPFVLR+KWAL+MKG+EY++IEED+ NK+PLL + NPVH KVPVLVH 
Sbjct  2    AKAEVKLLGTWSSPFVLRIKWALKMKGVEYDFIEEDLQNKSPLLLKYNPVHKKVPVLVHE  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            GKP+ ESL+ILEY+DETWK NP+LP DPY+RA ARFW+ F E K L
Sbjct  62   GKPIAESLVILEYMDETWKENPILPEDPYQRAMARFWSKFGEEKCL  107



>ref|XP_006580178.1| PREDICTED: LOW QUALITY PROTEIN: glutathione S-transferase U1-like 
[Glycine max]
Length=206

 Score =   155 bits (391),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M +E+ +K+V FW SPF  RV+WAL++KG++YEYIEED++N + L+ +LNPVH KVP+LV
Sbjct  1    MGSEDRVKLVNFWASPFGKRVEWALKLKGVKYEYIEEDVYNMSSLVMELNPVHKKVPILV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRE  401
            H  KP+ ES  ILEYIDETWK  PLLP DPY+RA ARFWA F E K++   R +    R+
Sbjct  61   HAQKPIAESFTILEYIDETWKQYPLLPQDPYQRALARFWANFGEQKLMRAARKAMTTSRD  120

Query  402  TARKCSK  422
               K  K
Sbjct  121  ERAKALK  127



>ref|XP_008804683.1| PREDICTED: probable glutathione S-transferase [Phoenix dactylifera]
Length=115

 Score =   152 bits (383),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+ G W SPFV+R+KWALR+KG+EYEYIEED+ NK+ LL + NPVH KVPV+VHNGKP+
Sbjct  6    VKLFGIWSSPFVIRIKWALRIKGVEYEYIEEDLSNKSNLLLEYNPVHKKVPVIVHNGKPI  65

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
             ES +ILEYI+ETWK+NP+LP DPYERA ARFW  F E K+
Sbjct  66   AESPVILEYIEETWKNNPILPEDPYERAMARFWCKFGEDKV  106



>gb|AFK41941.1| unknown [Lotus japonicus]
Length=228

 Score =   145 bits (365),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
              + +K++  W SPF  RV+WAL++KG+EYEY+EEDIFNK+ LL +LNPVH K+PVLVH 
Sbjct  2    GSQDVKLLSSWPSPFSERVEWALKLKGVEYEYVEEDIFNKSSLLLELNPVHKKIPVLVHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILD  368
             K + ES +I+EYIDETWK  PLLP DPYERA ARFWA F E K+L+
Sbjct  62   HKTIAESFIIIEYIDETWKQYPLLPHDPYERALARFWANFTEQKLLE  108


 Score = 57.4 bits (137),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  382  ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVAS  561
            A+C  G +QE A+N A EAMEK+E  + GK+FFGGE  GYL++ VGW+++ + I+EEV S
Sbjct  113  AMCITGDEQEKALNEAREAMEKIEEVIEGKRFFGGENIGYLDIAVGWISYWIHIWEEVGS  172

Query  562  L  564
            +
Sbjct  173  I  173



>gb|AJE59654.1| tau class glutathione S-transferase [Glycine max]
Length=217

 Score =   154 bits (390),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M +E+ +K+V FW SPF  RV+WAL++KG++YEYIEED++N + L+ +LNPVH KVP+LV
Sbjct  1    MGSEDRVKLVNFWASPFGKRVEWALKLKGVKYEYIEEDVYNMSSLVMELNPVHKKVPILV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRE  401
            H  KP+ ES  ILEYIDETWK  PLLP DPY+RA ARFWA F E K++   R +    R+
Sbjct  61   HAQKPIAESFTILEYIDETWKQYPLLPQDPYQRALARFWANFGEQKLMRAARKAMTTSRD  120

Query  402  TARKCSK  422
               K  K
Sbjct  121  ERAKALK  127



>emb|CDP11459.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   154 bits (390),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A EG+K++G+W SPF LRV+ AL++KG+EYEY EED+ NK+PLL Q NPV+ KVPVL+H 
Sbjct  2    AGEGVKLLGYWASPFALRVRSALKLKGIEYEYQEEDLGNKSPLLLQGNPVYKKVPVLLHK  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETA  407
            GK + ESL+ILEYIDE WKHNPLLP DPYERAR+RFWA F + K +    G      E  
Sbjct  62   GKSISESLVILEYIDEVWKHNPLLPEDPYERARSRFWAKFVDEKCVPALVGVITKVGEEL  121

Query  408  RKCSK  422
             K ++
Sbjct  122  EKSAR  126



>gb|ACU14737.1| unknown [Glycine max]
Length=244

 Score =   153 bits (386),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 90/109 (83%), Gaps = 1/109 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M +EE +K++ F+ SPF  RV+WAL++KG+EYEYIE+DIFNKT LL QLNPVH KVPVLV
Sbjct  1    MGSEE-VKLLSFFASPFGKRVEWALKLKGVEYEYIEQDIFNKTSLLLQLNPVHKKVPVLV  59

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILD  368
            H  KP+ ES +I+EY+DETWK  PLLP DPY+RA ARFWA FAE K+LD
Sbjct  60   HAHKPIAESFVIVEYVDETWKQYPLLPRDPYQRALARFWANFAEQKLLD  108


 Score = 47.8 bits (112),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  385  LCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVASL  564
            + S G +Q++AV  A EA+EK+E E+ GK++FGGE  GYL++ +GW+++ LPI+EEV S+
Sbjct  114  MYSSGDEQQNAVKVAREAIEKIEEEIKGKKYFGGENIGYLDIALGWISYWLPIWEEVGSI  173



>gb|AEC32486.1| tau class glutathione S-transferase [Glycine soja]
 gb|KHN06426.1| Putative glutathione S-transferase [Glycine soja]
Length=224

 Score =   153 bits (386),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 90/109 (83%), Gaps = 1/109 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M +EE +K++ F+ SPF  RV+WAL++KG+EYEYIE+DIFNKT LL QLNPVH KVPVLV
Sbjct  1    MGSEE-VKLLSFFASPFGKRVEWALKLKGVEYEYIEQDIFNKTSLLLQLNPVHKKVPVLV  59

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILD  368
            H  KP+ ES +I+EY+DETWK  PLLP DPY+RA ARFWA FAE K+LD
Sbjct  60   HAHKPIAESFVIVEYVDETWKQYPLLPQDPYQRALARFWANFAEQKLLD  108


 Score = 47.8 bits (112),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  385  LCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVASL  564
            + S G +Q++AV  A EA+EK+E E+ GK++FGGE  GYL++ +GW+++ LPI+EEV S+
Sbjct  114  MYSSGDEQQNAVKVAREAIEKIEEEIKGKKYFGGENIGYLDIALGWISYWLPIWEEVGSI  173



>ref|XP_006420237.1| hypothetical protein CICLE_v10005779mg [Citrus clementina]
 gb|ESR33477.1| hypothetical protein CICLE_v10005779mg [Citrus clementina]
Length=234

 Score =   151 bits (381),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +KV+GFW SPFV RV WAL++KG+E+EYIEED+FNK+  L +LNPVH KVPVLVH+ K +
Sbjct  5    VKVLGFWCSPFVFRVVWALKLKGVEFEYIEEDVFNKSTRLLELNPVHKKVPVLVHDDKVI  64

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGST  386
             ES +ILEYIDETW  +PLLP DPYE+A ARFWA FA+ K++     ST
Sbjct  65   VESFVILEYIDETWPQDPLLPQDPYEKATARFWAKFADEKLMQTACKST  113


 Score = 49.7 bits (117),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = +1

Query  391  SKGKQQESAVNSameamekleaelNGKQFFGGE-KTGYLNLVVGWVAHNLPIFEEVASL  564
            +KG+++E A+ + MEA+EK+E EL GK +FGGE K  YL + +GW+ + LPI+EE+AS+
Sbjct  115  TKGEEKEDALKATMEALEKIEGELKGKSYFGGENKYAYLEIAIGWINYLLPIWEEIASI  173



>ref|XP_003524975.2| PREDICTED: probable glutathione S-transferase [Glycine max]
 gb|AJE59657.1| tau class glutathione S-transferase [Glycine max]
Length=224

 Score =   152 bits (385),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 90/109 (83%), Gaps = 1/109 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M +EE +K++ F+ SPF  RV+WAL++KG+EYEYIE+DIFNKT LL QLNPVH KVPVLV
Sbjct  1    MGSEE-VKLLSFFASPFGKRVEWALKLKGVEYEYIEQDIFNKTSLLLQLNPVHKKVPVLV  59

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILD  368
            H  KP+ ES +I+EY+DETWK  PLLP DPY+RA ARFWA FAE K+LD
Sbjct  60   HAHKPIAESFVIVEYVDETWKQYPLLPRDPYQRALARFWANFAEQKLLD  108


 Score = 47.8 bits (112),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  385  LCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVASL  564
            + S G +Q++AV  A EA+EK+E E+ GK++FGGE  GYL++ +GW+++ LPI+EEV S+
Sbjct  114  MYSSGDEQQNAVKVAREAIEKIEEEIKGKKYFGGENIGYLDIALGWISYWLPIWEEVGSI  173



>gb|AFF18814.1| glutathione transferase, partial [Dimocarpus longan]
Length=216

 Score =   153 bits (387),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  63   KVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPLP  242
            +++GFW SPFV RVKWAL +KG++YEYIEEDIFNK+  L +LNPVH KVPV VH  + + 
Sbjct  1    QLLGFWASPFVFRVKWALELKGIDYEYIEEDIFNKSSRLLELNPVHKKVPVFVHEHRVIS  60

Query  243  ESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPT  374
            ES +ILEYIDETW+ NPLLP DPY+RA ARFWA FAE K+L+P 
Sbjct  61   ESFVILEYIDETWRQNPLLPQDPYQRAMARFWAKFAEEKLLEPA  104



>gb|KHN48020.1| Glutathione transferase GST 23 [Glycine soja]
 gb|AJE59669.1| tau class glutathione S-transferase [Glycine max]
Length=228

 Score =   145 bits (367),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
              E +K++ FWVSPF  RV+WAL++KG+EYEYIEEDIFNK+ LL +LNPVH KVPVLVH 
Sbjct  2    GSEDVKLLNFWVSPFGKRVEWALKLKGVEYEYIEEDIFNKSNLLLELNPVHKKVPVLVHA  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
             KP+ ES +ILEYIDETWK  PLLP +PY+RA ARFWA   E K+
Sbjct  62   QKPIAESFIILEYIDETWKKYPLLPHNPYQRALARFWATCVEQKL  106


 Score = 54.3 bits (129),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  382  ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVAS  561
            A+ + G +QE A+  A E MEK+E E+ GK FFGG+  GYL++ +GW+A+ +P++EEV S
Sbjct  113  AMSTSGDEQEEAMKEAKEMMEKIEEEIKGKNFFGGDNIGYLDIAIGWIAYLVPVWEEVGS  172

Query  562  L  564
            +
Sbjct  173  M  173



>ref|XP_006489726.1| PREDICTED: probable glutathione S-transferase-like [Citrus sinensis]
Length=234

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 94/124 (76%), Gaps = 3/124 (2%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +KV+GFW SPFV RV WAL++KG+E+EYIEEDIFNK+  L +LNPVH KVPVLVH+ K +
Sbjct  5    VKVLGFWCSPFVFRVVWALKLKGVEFEYIEEDIFNKSTRLLELNPVHKKVPVLVHDDKVI  64

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVF---QRETAR  410
             ES +ILEYIDETW  +PLLP DPYERA ARFWA FA+ K++     ST     ++E A 
Sbjct  65   VESFVILEYIDETWPQDPLLPQDPYERAMARFWAKFADEKLMQTAWKSTWTKGEEKEDAL  124

Query  411  KCSK  422
            K +K
Sbjct  125  KATK  128



>ref|NP_001104997.1| LOC541848 [Zea mays]
 gb|AAG34847.1|AF244704_1 glutathione S-transferase GST 39 [Zea mays]
Length=200

 Score =   152 bits (383),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA EEGLKV+G  VSPFVLRV  AL MKG+ YEY+EEDI NK+ LL + NPVH KVPVL+
Sbjct  1    MAGEEGLKVLGLQVSPFVLRVCLALNMKGVSYEYVEEDISNKSELLLKSNPVHKKVPVLI  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            HNGKP+ ESL+I++Y+DE +   P+LP DPYERA ARFWA +A+ K+ 
Sbjct  61   HNGKPICESLVIMQYVDELFAGRPILPTDPYERATARFWAAYADDKLF  108



>gb|ACG44510.1| glutathione S-transferase GSTU6 [Zea mays]
 tpg|DAA46029.1| TPA: glutathione S-transferase GSTU6 [Zea mays]
Length=200

 Score =   152 bits (383),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA EEGLKV+G  VSPFVLRV  AL MKG+ YEY+EEDI NK+ LL + NPVH KVPVL+
Sbjct  1    MAGEEGLKVLGLQVSPFVLRVCLALNMKGVSYEYVEEDISNKSELLLKSNPVHKKVPVLI  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            HNGKP+ ESL+I++Y+DE +   P+LP DPYERA ARFWA +A+ K+ 
Sbjct  61   HNGKPICESLVIMQYVDELFAGRPILPTDPYERATARFWAAYADDKLF  108



>ref|XP_008793319.1| PREDICTED: probable glutathione S-transferase [Phoenix dactylifera]
Length=226

 Score =   152 bits (384),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AE  +K++G W SPFVLR+KWAL++KG+EY++IEED+ NK+PLL + NPVH KVPVLVH+
Sbjct  2    AEAEVKLLGTWSSPFVLRIKWALKLKGVEYDFIEEDLQNKSPLLLKYNPVHKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            GK + ES +ILEYIDETWK NP+LP DPY+RA ARFW+ F + K L
Sbjct  62   GKSIAESYVILEYIDETWKENPILPEDPYQRAMARFWSKFGDEKFL  107



>gb|AAG34804.1|AF243369_1 glutathione S-transferase GST 14, partial [Glycine max]
Length=219

 Score =   150 bits (378),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++ F+ SPF  RV+WAL++KG+EYEYIE+DIFNKT LL QLNPVH KVPVLVH  KP+
Sbjct  1    VKLLSFFASPFGKRVEWALKLKGVEYEYIEQDIFNKTSLLLQLNPVHKKVPVLVHAHKPI  60

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILD  368
             ES +I+EY+DETWK  PLLP DPY+RA ARFWA FAE K+LD
Sbjct  61   AESFVIVEYVDETWKQYPLLPRDPYQRALARFWANFAEQKLLD  103


 Score = 47.8 bits (112),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  385  LCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVASL  564
            + S G +Q++AV  A EA+EK+E E+ GK++FGGE  GYL++ +GW+++ LPI+EEV S+
Sbjct  109  MYSSGDEQQNAVKVAREAIEKIEEEIKGKKYFGGENIGYLDIALGWISYWLPIWEEVGSI  168



>gb|KHN06423.1| Putative glutathione S-transferase [Glycine soja]
Length=217

 Score =   151 bits (382),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M +E+ +K+V FW SPF  RV+WAL++KG++YEYIEED++N + L+ +LNPVH KVP+LV
Sbjct  1    MGSEDRVKLVNFWASPFGKRVEWALKLKGVKYEYIEEDVYNMSSLVMELNPVHKKVPILV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRE  401
            H  KP+ ES  ILEYIDETWK  PLLP DP +RA ARFWA F E K++   R +    R+
Sbjct  61   HAQKPIAESFTILEYIDETWKQYPLLPQDPNQRALARFWANFGEQKLMRAARKAMTTSRD  120

Query  402  TARKCSK  422
               K  K
Sbjct  121  ERAKALK  127



>ref|XP_007016281.1| Glutathione S-transferase tau 7, putative [Theobroma cacao]
 gb|EOY33900.1| Glutathione S-transferase tau 7, putative [Theobroma cacao]
Length=261

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA E+ +K+ G W SP+  RV+ AL++KG+ YEY+EED+ +K+ LL + NPVH K+PVLV
Sbjct  38   MADEDEVKLFGMWASPYSRRVELALKLKGIPYEYVEEDLSSKSCLLLKYNPVHQKIPVLV  97

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTV  389
            HNGKP+ ESL+ILEYIDETW +NP+LP DPY+RA ARFWA F + K+L  TR ++V
Sbjct  98   HNGKPIAESLVILEYIDETWTNNPILPQDPYDRAMARFWAKFIDEKLLMTTRKASV  153



>ref|XP_010243655.1| PREDICTED: probable glutathione S-transferase [Nelumbo nucifera]
Length=230

 Score =   151 bits (381),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 94/129 (73%), Gaps = 8/129 (6%)
 Frame = +3

Query  57   GLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKP  236
            G+K++GFW SP+V RV WAL++KG+EYEYIEEDIFNK+ +L + NPVH KVPVLVHNGKP
Sbjct  13   GVKLIGFWSSPYVYRVIWALKLKGVEYEYIEEDIFNKSDILLKYNPVHKKVPVLVHNGKP  72

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQ--RETAR  410
            + ES+++LEYIDETW  +P+LP D  ERA ARFWA FAE       +GS ++   R +  
Sbjct  73   IVESMVVLEYIDETWPEHPVLPEDAQERATARFWAKFAE------DKGSCIWAMFRSSGE  126

Query  411  KCSKLSHGS  437
            K  K    S
Sbjct  127  KVEKAKKES  135



>gb|KDP42499.1| hypothetical protein JCGZ_00296 [Jatropha curcas]
Length=224

 Score =   149 bits (377),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 89/116 (77%), Gaps = 1/116 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E LKV   W SPF LRV WAL++KG+EYE + ED+ NK+PLL Q NPV+ KVPVL+HNGK
Sbjct  3    EELKVFRTWSSPFALRVVWALKLKGIEYETVYEDLSNKSPLLLQYNPVYKKVPVLLHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRE  401
            PL ESL+ILEYIDETWK NPLLP DP ERARARFWA F + K+   T  + VF +E
Sbjct  63   PLCESLVILEYIDETWKQNPLLPEDPLERARARFWAKFCDDKVAQ-TIFNGVFLKE  117


 Score = 47.0 bits (110),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +1

Query  385  LCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEV  555
               +GK+QE A+  A+E ++ LE EL GK+FFGG+K G ++L +GW+AH   +FEE+
Sbjct  114  FLKEGKEQEEAIPLAIENLKHLEKELRGKKFFGGDKIGLVDLALGWLAHYNGVFEEI  170



>emb|CAN63628.1| hypothetical protein VITISV_018696 [Vitis vinifera]
Length=227

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A++ +K++GFW SPF  RV WAL++KG++YEYIEEDIFNK+PLL QLNP+H +VPVL+H 
Sbjct  2    AQQEVKLLGFWASPFAYRVIWALKLKGVDYEYIEEDIFNKSPLLLQLNPLHKRVPVLIHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETA  407
             + + ES +I++YIDETW   PLLP  PYERA ARFWA FAE K+L+        + E  
Sbjct  62   HRVICESYVIVQYIDETWPQYPLLPQHPYERAMARFWAEFAESKLLETAWMGICSRGEER  121

Query  408  RKCSKLS  428
             + +KL+
Sbjct  122  ERAAKLA  128


 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 50/75 (67%), Gaps = 9/75 (12%)
 Frame = +1

Query  358  RFWTPPGEA---------LCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW    E+         +CS+G+++E A   A+EA+EK+E  + GK+ FGGE  GYL++
Sbjct  96   RFWAEFAESKLLETAWMGICSRGEERERAAKLAIEAVEKIEELVKGKKLFGGESIGYLDI  155

Query  511  VVGWVAHNLPIFEEV  555
             +GW+++ LPI+EEV
Sbjct  156  CLGWISYWLPIWEEV  170



>ref|XP_003632015.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=227

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A++ +K++GFW SPF  RV WAL++KG++YEYIEEDIFNK+PLL QLNP+H +VPVL+H 
Sbjct  2    AQQEVKLLGFWASPFAYRVIWALKLKGVDYEYIEEDIFNKSPLLLQLNPLHKRVPVLIHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETA  407
             + + ES +I++YIDETW   PLLP  PYERA ARFWA FAE K+L+        + E  
Sbjct  62   HRVICESYVIVQYIDETWPQYPLLPQHPYERAMARFWAEFAESKLLETAWMGICSRGEER  121

Query  408  RKCSKLS  428
             + +KL+
Sbjct  122  ERAAKLA  128


 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 49/75 (65%), Gaps = 9/75 (12%)
 Frame = +1

Query  358  RFWTPPGEA---------LCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW    E+         +CS+G+++E A   A+EA+ K+E  + GK+ FGGE  GYL++
Sbjct  96   RFWAEFAESKLLETAWMGICSRGEERERAAKLAIEAVAKIEELVKGKKLFGGESIGYLDI  155

Query  511  VVGWVAHNLPIFEEV  555
             +GW+++ LPI+EEV
Sbjct  156  CLGWISYWLPIWEEV  170



>gb|KJB19709.1| hypothetical protein B456_003G127600 [Gossypium raimondii]
Length=236

 Score =   150 bits (379),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M  +E +KV G W SP+  RV+ AL++KG+ YEYIEED+ NK+ LL Q NPVH K+PVLV
Sbjct  12   MGDDEEVKVFGMWASPYSRRVELALKLKGIPYEYIEEDLSNKSALLIQHNPVHQKIPVLV  71

Query  222  HNGKPLPESLLILEYIDETWKHNP-LLPADPYERARARFWAGFAEFKILDPTR  377
            HNGK +PESL+ILEYIDETW++NP LL  DPY+RA ARFWA F + KIL  TR
Sbjct  72   HNGKSIPESLVILEYIDETWRNNPILLSQDPYDRAMARFWAKFIDEKILSTTR  124



>ref|XP_010069125.1| PREDICTED: glutathione transferase GST 23-like [Eucalyptus grandis]
 gb|KCW57370.1| hypothetical protein EUGRSUZ_H00155 [Eucalyptus grandis]
Length=226

 Score =   149 bits (377),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA  + ++++G WVSPFV RV+WAL++KG+ Y+YIEEDI NK+ LL +LNPVH KVPVLV
Sbjct  1    MANPKEVELLGLWVSPFVRRVEWALKLKGIAYDYIEEDILNKSALLLRLNPVHQKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            H G+ + ES LILEYIDETWK +PLLP DPY+RA ARFWA  AE ++L
Sbjct  61   HGGRVICESFLILEYIDETWKQSPLLPQDPYDRATARFWASVAEGQLL  108


 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 9/78 (12%)
 Frame = +1

Query  358  RFWTPPGE---------ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW    E         ALCS+G+++E A+  A EA+  +E  + GK FFGGE  GYL+L
Sbjct  97   RFWASVAEGQLLRNAWIALCSEGEEKERAIEFATEALGHIEGVIEGKAFFGGEGIGYLDL  156

Query  511  VVGWVAHNLPIFEEVASL  564
             +GWV H LP+++E+ S+
Sbjct  157  AIGWVCHWLPVWDELGSM  174



>ref|XP_010521898.1| PREDICTED: glutathione S-transferase U7-like [Tarenaya hassleriana]
 gb|ABW81092.1| GST16 [Cleome spinosa]
Length=224

 Score =   149 bits (376),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 91/122 (75%), Gaps = 0/122 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++G W S F  R+  ALR+KG+ YEY+E+D+ NK+PLL Q+NPVH KVPVLVHNGK
Sbjct  3    EEVKLLGMWASLFSRRIDMALRIKGVPYEYLEQDLTNKSPLLLQMNPVHKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETARK  413
             + ESL+ILEYID+TW HNP+LP DPYERA ARFWA F + KI+       + + E AR+
Sbjct  63   SIAESLVILEYIDQTWSHNPILPQDPYERAMARFWARFIDEKIVPTGIEIAIEKDEEARE  122

Query  414  CS  419
             +
Sbjct  123  AA  124



>ref|XP_008224351.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=224

 Score =   149 bits (376),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 93/128 (73%), Gaps = 4/128 (3%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A + +K++G+  SPF  RV+WAL++KG++YEY+EEDIFNK+PLL QLNPV  KVPVLVH 
Sbjct  2    ATDKVKLLGYVFSPFSRRVEWALKLKGIDYEYVEEDIFNKSPLLLQLNPVRKKVPVLVHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPT----RGSTVFQ  395
             + + ES  ILEYIDETWK NPLLP DPY RA +RFWA F E K+LD        ST  Q
Sbjct  62   NEVVSESFTILEYIDETWKQNPLLPQDPYARAISRFWANFTEEKVLDAAFTALICSTGEQ  121

Query  396  RETARKCS  419
            +E A K +
Sbjct  122  QEKALKST  129


 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  385  LCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVAS  561
            +CS G+QQE A+ S +EA+E +E +L GK+  GGE  GYL++ +GW+++ LPI+EEV S
Sbjct  115  ICSTGEQQEKALKSTIEALEHIEGDLMGKKILGGESIGYLDIAMGWISYWLPIWEEVGS  173



>ref|XP_006489727.1| PREDICTED: probable glutathione S-transferase-like [Citrus sinensis]
Length=234

 Score =   149 bits (376),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +KV+G W SPFV RV WAL++KG+E+EYIEEDIFNK+  L +LNPVH KVPVLVH+ K +
Sbjct  5    VKVLGVWCSPFVFRVVWALKLKGVEFEYIEEDIFNKSTRLLELNPVHKKVPVLVHDDKVI  64

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETARKCS  419
             ES +ILEYIDETW  +PLLP DPYERA ARFWA FA+ K++     ST  + E      
Sbjct  65   VESFVILEYIDETWPQDPLLPQDPYERAMARFWAKFADEKLMQTVWKSTWTKGEEKEDAL  124

Query  420  KLS  428
            K +
Sbjct  125  KAT  127


 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = +1

Query  391  SKGKQQESAVNSameamekleaelNGKQFFGGE-KTGYLNLVVGWVAHNLPIFEEVASL  564
            +KG+++E A+ + MEA+EK+E EL GK +FGGE K  YL + +GW+ + +PI+EE+AS+
Sbjct  115  TKGEEKEDALKATMEALEKIEGELKGKSYFGGENKYAYLEVAIGWINYLIPIWEEIASI  173



>ref|XP_007226113.1| hypothetical protein PRUPE_ppa011087mg [Prunus persica]
 gb|EMJ27312.1| hypothetical protein PRUPE_ppa011087mg [Prunus persica]
Length=224

 Score =   149 bits (375),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 93/128 (73%), Gaps = 4/128 (3%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A + +K++G+  SPF  RV+WAL++KG++YEY+EEDIFNK+PLL QLNPV  KVPVLVH 
Sbjct  2    ATDKVKLLGYVFSPFSRRVEWALKLKGIDYEYVEEDIFNKSPLLLQLNPVRKKVPVLVHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPT----RGSTVFQ  395
             + + ES  ILEYIDETWK NPLLP DPY RA +RFWA F E K+LD        ST  Q
Sbjct  62   NEVVSESFTILEYIDETWKQNPLLPQDPYARAISRFWANFTEEKVLDAGFTALICSTGEQ  121

Query  396  RETARKCS  419
            +E A K +
Sbjct  122  QEKALKST  129


 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  385  LCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVAS  561
            +CS G+QQE A+ S +EA+E +E +L GK+  GGE  GYL++ +GW+++ LPI+EEV S
Sbjct  115  ICSTGEQQEKALKSTIEALEHIEGDLMGKKILGGESIGYLDIAMGWISYWLPIWEEVGS  173



>ref|XP_002285212.1| PREDICTED: glutathione transferase GST 23 [Vitis vinifera]
Length=227

 Score =   149 bits (375),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A++ +K++GFW SPF  RV WAL++KG++YEYIEED+FNK+PLL QLNP+H  VPVL+H 
Sbjct  2    AQQEVKLLGFWASPFAYRVIWALKLKGVDYEYIEEDVFNKSPLLLQLNPLHKSVPVLIHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETA  407
             + + ES +I++YIDETW   PLLP  PYERA ARFWA FAE K+++        + E  
Sbjct  62   HRVICESFVIVQYIDETWPQYPLLPQHPYERAMARFWAEFAESKLMESAWMGQCSRGEER  121

Query  408  RKCSKLS  428
             + +KL+
Sbjct  122  ERAAKLA  128


 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 48/75 (64%), Gaps = 9/75 (12%)
 Frame = +1

Query  358  RFWTPPGEA---------LCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW    E+          CS+G+++E A   AME +EK+E  + GK+ FGGE  GYL++
Sbjct  96   RFWAEFAESKLMESAWMGQCSRGEERERAAKLAMETVEKIEELVKGKKLFGGESIGYLDI  155

Query  511  VVGWVAHNLPIFEEV  555
             +GW+++ LPI+EEV
Sbjct  156  CLGWLSYWLPIWEEV  170



>ref|XP_010069124.1| PREDICTED: glutathione transferase GST 23-like [Eucalyptus grandis]
 gb|KCW57369.1| hypothetical protein EUGRSUZ_H00154 [Eucalyptus grandis]
Length=226

 Score =   149 bits (375),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 97/134 (72%), Gaps = 0/134 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA  + ++++G WVSPFV RV+WAL++KG+ Y+YIEEDI NK+ LL +LNPVH KVPVLV
Sbjct  1    MANPKEVELLGLWVSPFVRRVEWALKLKGIAYDYIEEDILNKSALLLRLNPVHQKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRE  401
            H G+ + ES LILEYIDETWK  PLLP DPY+RA ARFWA  AE ++L     ++  + E
Sbjct  61   HAGRVVCESFLILEYIDETWKQIPLLPRDPYDRAMARFWASVAEGQLLANAWVASCSEGE  120

Query  402  TARKCSKLSHGSHG  443
               +  K++  + G
Sbjct  121  EQERAIKVATEALG  134


 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 49/78 (63%), Gaps = 9/78 (12%)
 Frame = +1

Query  358  RFWTPPGE---------ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW    E         A CS+G++QE A+  A EA+  +E  + GK FFGGE  GYL+L
Sbjct  97   RFWASVAEGQLLANAWVASCSEGEEQERAIKVATEALGHIEGVIKGKAFFGGEGIGYLDL  156

Query  511  VVGWVAHNLPIFEEVASL  564
             +GWVA+ LPI++EV S+
Sbjct  157  AIGWVAYWLPIWDEVGSM  174



>ref|XP_010469949.1| PREDICTED: glutathione S-transferase U1 [Camelina sativa]
Length=224

 Score =   149 bits (375),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++GFW SPF  RV+ AL++KG+ YEY+EED+ NKTPLL +LNP+H KVPVLVHN 
Sbjct  5    EETVKLLGFWGSPFSRRVEMALKLKGVPYEYLEEDLPNKTPLLLELNPLHKKVPVLVHND  64

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            K LPES LILEYID+TWK+NP+LP DPYE+A ARFWA F + +IL
Sbjct  65   KVLPESHLILEYIDQTWKNNPILPQDPYEKAMARFWAKFIDEQIL  109



>ref|XP_002285214.1| PREDICTED: glutathione transferase GST 23 [Vitis vinifera]
Length=227

 Score =   149 bits (375),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A++ +K++GFW SPF  RV WAL++KG++YEYIEED+FNK+PLL QLNP+H +VPVL+H 
Sbjct  2    AQQEVKLLGFWASPFAYRVIWALKLKGVDYEYIEEDVFNKSPLLLQLNPLHKRVPVLIHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETA  407
             + + ES +I++YIDETW   PLLP  PYERA ARFWA FAE K+ +    +   + E  
Sbjct  62   HRVICESYVIVQYIDETWPQYPLLPQHPYERAMARFWAEFAESKLFESAWMALCSRGEER  121

Query  408  RKCSKLS  428
             + +KL+
Sbjct  122  ERAAKLA  128


 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 50/75 (67%), Gaps = 9/75 (12%)
 Frame = +1

Query  358  RFWTPPGE---------ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW    E         ALCS+G+++E A   AMEA+EK+E  + GK+ FGGE  GYL++
Sbjct  96   RFWAEFAESKLFESAWMALCSRGEERERAAKLAMEAVEKIEELVKGKKLFGGESIGYLDI  155

Query  511  VVGWVAHNLPIFEEV  555
             +GW+++ LPI+EEV
Sbjct  156  CLGWISYWLPIWEEV  170



>ref|XP_010510486.1| PREDICTED: glutathione S-transferase U1-like [Camelina sativa]
Length=225

 Score =   149 bits (375),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++GFW SPF  RV+ AL++KG+ YEY+EED+ NKTPLL +LNP+H KVPVLVHN 
Sbjct  5    EETVKLLGFWGSPFSRRVEMALKLKGVPYEYLEEDLPNKTPLLLELNPLHKKVPVLVHND  64

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            K LPES LILEYID+TWK+NP+LP DPYE+A ARFWA F + +IL
Sbjct  65   KVLPESHLILEYIDQTWKNNPILPQDPYEKAMARFWAKFIDEQIL  109



>ref|XP_010922854.1| PREDICTED: probable glutathione S-transferase [Elaeis guineensis]
Length=224

 Score =   148 bits (374),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+ G W SPFVL VKWALR+KG+EYEYIEED+ NK+ LL + NPVH KVPV+VHNGKP+
Sbjct  6    VKLFGIWSSPFVLIVKWALRIKGVEYEYIEEDLSNKSNLLLEYNPVHKKVPVMVHNGKPI  65

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDP  371
             ES +ILEYI+ETWK+NP+LP DPYERA ARFW  F   K+  P
Sbjct  66   AESAVILEYIEETWKNNPILPDDPYERAMARFWCKFVVDKLSPP  109



>ref|XP_006437359.1| hypothetical protein CICLE_v10032702mg [Citrus clementina]
 gb|ESR50599.1| hypothetical protein CICLE_v10032702mg [Citrus clementina]
Length=221

 Score =   147 bits (372),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++  W SPF LRV WAL++KG++++ IEED+ NK+PLL Q NPVH K+PVLVHNGK
Sbjct  3    EEVKLLTTWSSPFALRVVWALKLKGVQFDSIEEDLSNKSPLLLQYNPVHKKIPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
            P+ ESL+ILEY+DETW+ NPLLP  PY+RARARFWA F++ K+
Sbjct  63   PISESLVILEYVDETWRQNPLLPDGPYDRARARFWAKFSDDKV  105


 Score = 45.8 bits (107),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  385  LCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEV  555
               +GK++E A +   E ++ LE EL GK+FFGGEK G+ +L +GW+A  + + EE+
Sbjct  113  FIKQGKEREEAFDQVFENLKFLEEELKGKKFFGGEKIGFADLALGWIAERVCVLEEI  169



>ref|XP_010521901.1| PREDICTED: glutathione S-transferase U1-like [Tarenaya hassleriana]
 gb|ABW81096.1| GST19 [Cleome spinosa]
Length=223

 Score =   148 bits (374),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 94/126 (75%), Gaps = 1/126 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M  +E +K++G W SP+  R++ AL++KG+ YEY E+DIF+K+PLL QLNPVH KVPVL+
Sbjct  1    MGEKEEVKLLGMWASPYSRRIEMALKLKGVPYEYSEQDIFDKSPLLLQLNPVHKKVPVLI  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRE  401
            HNG+ + ESL+ILEYIDETWK NP+LP DPY RA ARFWA F + +IL    G +  + E
Sbjct  61   HNGQTMVESLVILEYIDETWKLNPILPQDPYGRAMARFWAKFVDEQIL-TVGGKSFVKAE  119

Query  402  TARKCS  419
              R+ +
Sbjct  120  KGREAA  125



>ref|XP_003532764.1| PREDICTED: probable glutathione S-transferase [Glycine max]
 gb|KHN48019.1| Putative glutathione S-transferase [Glycine soja]
 gb|AJE59668.1| tau class glutathione S-transferase [Glycine max]
Length=226

 Score =   137 bits (346),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +3

Query  39   IMAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVL  218
            +M ++  +K++ F +SP   RV+WAL++KG+E+EY+EEDIFNK+ LL +LNPVH KVPVL
Sbjct  1    MMGSKNDVKLLSFLLSPVGHRVEWALKLKGVEFEYVEEDIFNKSNLLLELNPVHKKVPVL  60

Query  219  VHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAE  353
            VH+ KP+ ESL+I+EYID+TWK +PLLP  PY+RA ARFW   A+
Sbjct  61   VHHQKPIAESLIIVEYIDQTWKQHPLLPQHPYQRALARFWGTVAD  105


 Score = 55.5 bits (132),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +1

Query  382  ALCSKGKQQESAVN-SameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVA  558
            A+CS G +QE +V  +     +  E  + GK+FFGG+  GYL+L  GW+ + LPI+EEV 
Sbjct  114  AMCSSGDEQEKSVKEAKEVMDKIEEEIIKGKKFFGGDNIGYLDLAFGWIPYWLPIWEEVG  173

Query  559  SL  564
            S+
Sbjct  174  SM  175



>ref|XP_010542655.1| PREDICTED: glutathione S-transferase U1-like [Tarenaya hassleriana]
Length=223

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++G+W SP+  R++ AL++KG+ YEY+EED+FNK+PLL QLNP+H  +PVLVHNGK
Sbjct  3    EEVKLLGYWASPYSRRIEMALKLKGVPYEYLEEDVFNKSPLLLQLNPIHKTIPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILD  368
             + ESLLILEYIDETW  NP+LP DPYERA ARFWA F + +I  
Sbjct  63   TINESLLILEYIDETWTQNPILPQDPYERAIARFWAKFVDDQIFS  107



>ref|XP_002520474.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF41887.1| glutathione s-transferase, putative [Ricinus communis]
Length=222

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++G W SPF  R++ AL++KG++YEYIEED+ NK+PLL   NPVH K+PVL+HNGK
Sbjct  3    EEVKLLGAWASPFSHRIELALKLKGIQYEYIEEDLSNKSPLLLSTNPVHKKIPVLIHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILD  368
            P+ ESL+ILEYI+ETW+ NP+LP DPY+RA ARFWA F + KIL 
Sbjct  63   PIAESLVILEYIEETWQSNPILPKDPYDRAVARFWAKFVDEKILQ  107



>ref|XP_010650092.1| PREDICTED: glutathione S-transferase U1-like [Vitis vinifera]
Length=130

 Score =   145 bits (365),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A++ +K++GFW SPF  RV WAL++KG++YEYIEEDIFNK+PL  QLNP+H +VPVL+H 
Sbjct  2    AQQEVKLLGFWASPFAYRVIWALKLKGVDYEYIEEDIFNKSPLFLQLNPLHKRVPVLIHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
             + + ES +I++YIDETW   PLLP  PYERA ARFWA FAE K+
Sbjct  62   HRVICESYVIVQYIDETWPQYPLLPQHPYERAMARFWAEFAESKV  106



>gb|KDP42182.1| hypothetical protein JCGZ_02912 [Jatropha curcas]
Length=226

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 89/111 (80%), Gaps = 1/111 (1%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A+E +K++G W SP+  RV+ AL++KG++YEYIEEDIFNK+PLL + NPVH KVPVL+H 
Sbjct  2    ADEEVKLIGTWASPYTRRVELALKIKGVKYEYIEEDIFNKSPLLLKYNPVHQKVPVLIHK  61

Query  228  GKPLPESLLILEYIDETWK-HNPLLPADPYERARARFWAGFAEFKILDPTR  377
            GKP+ ESL+ILEYIDETWK H+ +LP +PY RA ARFWA F E KI +  R
Sbjct  62   GKPIAESLVILEYIDETWKHHHHILPKEPYHRATARFWAKFVEEKIQETAR  112



>ref|XP_003629835.1| Glutathione S-transferase GST [Medicago truncatula]
 gb|AET04311.1| glutathione S-transferase [Medicago truncatula]
 gb|AFK38611.1| unknown [Medicago truncatula]
Length=225

 Score =   140 bits (353),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M   + +K++ F +SP   RV+WAL++KG+E++YIEEDIFNK+ LL ++NPVH KVPVLV
Sbjct  1    MMGNQDVKLLNFLLSPVGRRVEWALKLKGVEFDYIEEDIFNKSSLLLEMNPVHKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
            H  K + ESL+ILEYIDETWK  PLLP DPY+R+RARFWA  ++ K+
Sbjct  61   HGQKSIAESLIILEYIDETWKQYPLLPPDPYQRSRARFWAKLSDEKL  107


 Score = 52.4 bits (124),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  382  ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVAS  561
            AL  KG + E A+  A E MEKLE ++ GK+FFGG+  GYL+L +GW+   LPI+EE+ S
Sbjct  114  ALIKKGNEWEKALKEAREIMEKLEEDIKGKKFFGGDTIGYLDLTLGWITCFLPIWEEIGS  173



>ref|XP_010025836.1| PREDICTED: glutathione transferase GST 23-like [Eucalyptus grandis]
Length=292

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +3

Query  45   AAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVH  224
            A  E +K++G WVSPFV RV+WAL++KG+ Y+YIEEDI NK+ LL +LNP H KVPVLVH
Sbjct  68   ANPEEVKLLGLWVSPFVWRVEWALKLKGIAYDYIEEDILNKSALLLRLNPAHQKVPVLVH  127

Query  225  NGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
             G+ + ES LILEYIDETWK +PLLP DPY+RA ARFWA  AE ++L
Sbjct  128  GGRVICESFLILEYIDETWKQSPLLPQDPYDRAMARFWASVAEGQLL  174


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (62%), Gaps = 9/78 (12%)
 Frame = +1

Query  358  RFWTPPGE---------ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW    E         AL S+G+++E A+  A E +   E  + GK FFGGE  GYL+L
Sbjct  163  RFWASVAEGQLLKNAWIALISEGEEKERAIEFATEVLGHFEGVIEGKAFFGGEGIGYLDL  222

Query  511  VVGWVAHNLPIFEEVASL  564
             +GW++H+LP+++EV S+
Sbjct  223  AIGWISHSLPVYDEVGSM  240



>ref|XP_002520478.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF41891.1| glutathione s-transferase, putative [Ricinus communis]
Length=223

 Score =   147 bits (372),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 87/116 (75%), Gaps = 0/116 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +KV G W SP+  RV+ AL++KG++YEYIEED+ NK+ LL + NPVH K+PVLVHNGK
Sbjct  3    EEVKVFGTWSSPYSRRVEIALKLKGIQYEYIEEDLSNKSDLLLKYNPVHEKIPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRE  401
            P+ ESL+ILEYIDETW+ NP+LP DPY RA ARFW  F + KIL   + +   + E
Sbjct  63   PVAESLVILEYIDETWQDNPILPKDPYSRAMARFWTNFVDEKILQTAKKTRTAKAE  118



>ref|XP_002285220.1| PREDICTED: glutathione transferase GST 23 [Vitis vinifera]
Length=227

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A++ +K++GFW SPF  RV WAL++KG++YEYIEED+FNK+PLL QLNP+H  VPVL+H 
Sbjct  2    AQQEVKLLGFWASPFAYRVIWALKLKGVDYEYIEEDVFNKSPLLLQLNPLHKSVPVLIHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETA  407
             + + ES +I++YIDETW   PLLP +PYERA ARFWA FAE K+++        + E  
Sbjct  62   HRVICESFVIVQYIDETWPQYPLLPQNPYERAMARFWAEFAESKLMESAWMGQCSRGEER  121

Query  408  RKCSKLS  428
             + + L+
Sbjct  122  ERAANLA  128


 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 49/75 (65%), Gaps = 9/75 (12%)
 Frame = +1

Query  358  RFWTPPGEA---------LCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW    E+          CS+G+++E A N AME +EK+E  + GK+ FGGE  GYL++
Sbjct  96   RFWAEFAESKLMESAWMGQCSRGEERERAANLAMETVEKIEELVKGKKLFGGESIGYLDI  155

Query  511  VVGWVAHNLPIFEEV  555
             +GW+++ LPI+EEV
Sbjct  156  CLGWLSYWLPIWEEV  170



>ref|XP_008219369.1| PREDICTED: glutathione transferase GST 23-like [Prunus mume]
Length=223

 Score =   147 bits (372),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            + + +K++G W SP  LRVKW L++K +EY+Y+EED+ NK+PLL Q NPVH K+PVLVH 
Sbjct  2    SADSVKLLGNWASPSALRVKWTLKLKEIEYQYVEEDLSNKSPLLLQYNPVHKKIPVLVHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETA  407
            GKP+ ESL+ILEYI+ETWK NP+LP DPYERA+ARFWA F + K       +   + E  
Sbjct  62   GKPVAESLVILEYIEETWKPNPILPEDPYERAQARFWAKFVDEKCAPSIMSAFTKKGEEK  121

Query  408  RKCSK  422
             K +K
Sbjct  122  EKVAK  126



>gb|ABW81199.1| glutathione-S-transferase 9 [Arabidopsis cebennensis]
Length=228

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M  EE ++++GFW SPF  RVK AL++KG+ YEY+EED+ NK+PLL +LNPVH KVPVLV
Sbjct  1    MEKEEEVRLLGFWASPFTCRVKMALKLKGVPYEYLEEDLLNKSPLLLELNPVHKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
            HNGKP+ ES LILEYID+TW +NP+LP DPY++A ARF A F + ++
Sbjct  61   HNGKPILESNLILEYIDQTWTNNPILPQDPYDKAMARFLAKFVDEQV  107



>ref|XP_002524047.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF38415.1| glutathione s-transferase, putative [Ricinus communis]
Length=229

 Score =   147 bits (372),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA +E +KV+G W SPFV RV+ AL +KG+ YE + E + NK+P L + NPV+ K+PVLV
Sbjct  1    MAGQEEVKVLGGWFSPFVFRVEVALTLKGIPYEAVVESLTNKSPELLKYNPVYKKIPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRG  380
            HNGKP+ ESL+I+EYIDETWKHNP+LP DPYERA ARFWA F + K+ +  RG
Sbjct  61   HNGKPISESLIIVEYIDETWKHNPILPEDPYERAMARFWAYFVDNKLTEALRG  113



>ref|XP_002520476.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF41889.1| glutathione s-transferase, putative [Ricinus communis]
Length=230

 Score =   147 bits (372),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 90/117 (77%), Gaps = 1/117 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E LK++G W SPF  R++ AL++KG++Y+YIE+D+ NK+PLL   NPVH K+PVL+HN  
Sbjct  3    EELKLLGTWASPFSHRIRLALKLKGIQYQYIEQDLSNKSPLLLMSNPVHKKIPVLLHNDS  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPT-RGSTVFQRE  401
            P+ ESL+ILEYID+TWKH+PLLP DPY+RA ARFWA F + KIL    +GS    +E
Sbjct  63   PIAESLVILEYIDQTWKHHPLLPKDPYDRAIARFWAKFVDEKILQTALKGSAATGKE  119



>ref|XP_010938160.1| PREDICTED: glutathione transferase GST 23-like [Elaeis guineensis]
Length=225

 Score =   147 bits (372),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 96/132 (73%), Gaps = 11/132 (8%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA+   +K+ G W SP V RV+WAL++KG+EYEYIEEDI NK+  L + NP++ +VPVL+
Sbjct  1    MASGGEVKLFGMWASPAVRRVEWALKLKGIEYEYIEEDISNKSKDLVKYNPINKQVPVLL  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGST--VF-  392
            HNGKP+ ESL+I+EYIDE WKHNP+LP DPYERA ARFWA ++E    D  RG+   VF 
Sbjct  61   HNGKPIIESLVIIEYIDEVWKHNPILPKDPYERAMARFWATYSE----DKCRGAVREVFF  116

Query  393  ----QRETARKC  416
                +R  A KC
Sbjct  117  AEGEKRVKAIKC  128



>ref|NP_001237959.1| uncharacterized protein LOC100305870 [Glycine max]
 gb|ACU13765.1| unknown [Glycine max]
Length=205

 Score =   147 bits (370),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
              E +K++ FWVSPF  RV+WAL++KG+EYEYIEEDIFNK+ LL +LNPVH KVPVLVH 
Sbjct  2    GSEDVKLLNFWVSPFGKRVEWALKLKGVEYEYIEEDIFNKSNLLLELNPVHKKVPVLVHA  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
             KP+ ES +ILEYIDETWK  PLLP +PY+RA ARFWA   E K+
Sbjct  62   QKPIAESFIILEYIDETWKKYPLLPHNPYQRALARFWATCVEQKL  106



>emb|CDP11462.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   148 bits (374),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +3

Query  66   VVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPLPE  245
            ++G+W SPF LRV+ AL++KG+EYEY EED+ NK+PLL Q NPV+ K+PVL+HNGK + E
Sbjct  44   LLGYWGSPFALRVRSALKLKGIEYEYQEEDLGNKSPLLLQSNPVYKKIPVLLHNGKSISE  103

Query  246  SLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGS  383
            SL+ILEYIDE WKHNPLLP DPYERAR+RFWA F + K +    G+
Sbjct  104  SLVILEYIDEVWKHNPLLPEDPYERARSRFWAKFVDEKCVPALVGT  149



>ref|XP_002520472.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF41885.1| glutathione s-transferase, putative [Ricinus communis]
Length=222

 Score =   147 bits (371),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 89/120 (74%), Gaps = 0/120 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++G W SPF  R++ AL++KG++YEYIEED+ NK+ LL   NPVH K+PVL+HNGK
Sbjct  3    EEVKLLGTWASPFSHRIELALKLKGIQYEYIEEDLSNKSTLLLSTNPVHKKIPVLIHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETARK  413
            P+ ESL+ILEYI+ETW +NP+LP DPY RA ARFWA F E KIL       V + E  ++
Sbjct  63   PIAESLVILEYIEETWPNNPILPKDPYNRALARFWAKFVEEKILQTASKFRVAKEEEKKQ  122



>ref|XP_011016467.1| PREDICTED: glutathione S-transferase U8-like [Populus euphratica]
Length=152

 Score =   145 bits (366),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 91/118 (77%), Gaps = 1/118 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G W SPF  RV+ AL++KG+EYEYIE+D+ NK+PLL + NP+H KVPVLVHNGK +
Sbjct  4    VKLLGAWGSPFSRRVEMALKLKGVEYEYIEQDLANKSPLLLKYNPIHKKVPVLVHNGKAM  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETARK  413
             ESL+ILEYIDETWK NP+LP DPY++A ARFWA F + K + P     ++ +E  R+
Sbjct  64   AESLVILEYIDETWKSNPILPEDPYDKAMARFWAKFIDEKCM-PAIWQIMWSKENERE  120



>ref|XP_002307924.1| hypothetical protein POPTR_0006s02510g [Populus trichocarpa]
 gb|EEE91447.1| hypothetical protein POPTR_0006s02510g [Populus trichocarpa]
 gb|ADB11389.1| tau class glutathione transferase GSTU18 [Populus trichocarpa]
Length=225

 Score =   140 bits (354),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +KV   W SPF LRV WALR+KG++++ I ED+FNK+PLL Q NPV  KVPVLVHNGK
Sbjct  3    EEVKVFRSWSSPFPLRVIWALRLKGVKFDVICEDLFNKSPLLLQYNPVGKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTR  377
             + ESL+ILEYI+ETWK  PLLP DPY++A ARFWA F++ K+L   +
Sbjct  63   AICESLVILEYIEETWKQTPLLPEDPYQKANARFWAKFSDDKVLQSIK  110


 Score = 51.2 bits (121),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +1

Query  379  EALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVA  558
            + L  +GK+QE  + ++++ +  LE EL GK+FFGGE  G  +L +GW+A+ L IFEEVA
Sbjct  112  DVLLKEGKEQEEGILASLQNLRYLEEELRGKKFFGGEAIGLADLALGWLAYYLNIFEEVA  171

Query  559  SL  564
             L
Sbjct  172  GL  173



>gb|KDP34500.1| hypothetical protein JCGZ_11050 [Jatropha curcas]
Length=224

 Score =   147 bits (371),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++G W SPF  R++ AL++KG++Y YIEED+FNK+PLL Q NPVH KVPVL+HNGK
Sbjct  3    EEVKLLGAWASPFSHRIELALKLKGIQYHYIEEDLFNKSPLLLQSNPVHKKVPVLIHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            P+ ESL+IL+YI+ETW++NP+LP DPY+RA  RFWA F + KIL
Sbjct  63   PISESLVILDYIEETWQNNPILPKDPYDRAVVRFWAKFIDEKIL  106



>ref|XP_006484731.1| PREDICTED: probable glutathione S-transferase-like [Citrus sinensis]
Length=225

 Score =   147 bits (370),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++  W SPF LR  W L++KG+++++I+ED+ NK+PLL Q NPV+ KVPVL+HNGK
Sbjct  3    EEVKLLKTWSSPFGLRAFWILKLKGVQFDFIDEDLSNKSPLLLQSNPVYKKVPVLIHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            P+ ESL+ILEY+DETWK NPLLP DPYERARARFWA F E K+L
Sbjct  63   PISESLVILEYVDETWKQNPLLPEDPYERARARFWAKFGEDKVL  106


 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 47/75 (63%), Gaps = 9/75 (12%)
 Frame = +1

Query  358  RFWTPPGE---------ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW   GE         A   +GK+QE A+  A+E ++ LE EL GK+FFGGEK G  +L
Sbjct  95   RFWAKFGEDKVLVSIWNAFIKQGKEQEEAIGLAIETLKFLEEELKGKRFFGGEKIGLADL  154

Query  511  VVGWVAHNLPIFEEV  555
             +GW+A+ + +FEEV
Sbjct  155  ALGWLANLIGVFEEV  169



>ref|XP_006420236.1| hypothetical protein CICLE_v10005779mg [Citrus clementina]
 gb|ESR33476.1| hypothetical protein CICLE_v10005779mg [Citrus clementina]
Length=227

 Score =   147 bits (370),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +KV+GFW SPFV RV WAL++KG+E+EYIEED+FNK+  L +LNPVH KVPVLVH+ K +
Sbjct  5    VKVLGFWCSPFVFRVVWALKLKGVEFEYIEEDVFNKSTRLLELNPVHKKVPVLVHDDKVI  64

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFK  359
             ES +ILEYIDETW  +PLLP DPYE+A ARFWA FA+ K
Sbjct  65   VESFVILEYIDETWPQDPLLPQDPYEKATARFWAKFADEK  104


 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 51/72 (71%), Gaps = 3/72 (4%)
 Frame = +1

Query  358  RFWTPPGE--ALCSKGKQQESAVNSameamekleaelNGKQFFGGE-KTGYLNLVVGWVA  528
            RFW    +  +  +KG+++E A+ + MEA+EK+E EL GK +FGGE K  YL + +GW+ 
Sbjct  95   RFWAKFADEKSTWTKGEEKEDALKATMEALEKIEGELKGKSYFGGENKYAYLEIAIGWIN  154

Query  529  HNLPIFEEVASL  564
            + LPI+EE+AS+
Sbjct  155  YLLPIWEEIASI  166



>gb|KDP39591.1| hypothetical protein JCGZ_02611 [Jatropha curcas]
Length=217

 Score =   139 bits (349),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 84/108 (78%), Gaps = 2/108 (2%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA E  +K++  W SPF LR+ WAL++KG++Y+ I+ED+ NK+PLL Q NPVH K+PV V
Sbjct  1    MAGE--VKLLKSWSSPFALRIVWALKLKGIQYDSIDEDMTNKSPLLLQYNPVHKKIPVFV  58

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            HNGKP+ ES +ILEYIDE WKH PLLP DP++RA ARF A F + K++
Sbjct  59   HNGKPIAESFVILEYIDEMWKHYPLLPQDPHKRATARFLAKFGDEKVM  106


 Score = 52.4 bits (124),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  388  CSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEV  555
             +KGK+QE A   A E ++ LE  L GK+FFGGEK G+L++ +GW+A+ +P+ EE+
Sbjct  114  ITKGKEQEEASAKATENLKYLEEALTGKRFFGGEKIGFLDIALGWLANVVPVVEEI  169



>ref|XP_004133937.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
 ref|XP_004155775.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
 gb|KGN56630.1| hypothetical protein Csa_3G126940 [Cucumis sativus]
Length=222

 Score =   146 bits (369),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE LK+   W SPF LR+ WAL++KG+EYE + ED+ NK+PLL + NP+H KVPVLVH G
Sbjct  2    EEELKLFRTWSSPFPLRIVWALKLKGIEYETVYEDLANKSPLLLEYNPIHKKVPVLVHGG  61

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTR  377
            KP+ ESL+ILEYI+ETWK NPLLP DPY+RA ARFWA F + K+L+  +
Sbjct  62   KPIAESLVILEYIEETWKQNPLLPQDPYQRAVARFWAKFGDDKVLESIK  110



>ref|XP_006489728.1| PREDICTED: glutathione S-transferase U8-like [Citrus sinensis]
Length=227

 Score =   147 bits (370),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 90/121 (74%), Gaps = 0/121 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++GFW SPF  RV WAL++KG+E+EYIEEDIFNK+  L +LNPVH KVPVLVH+ + +
Sbjct  5    VKLLGFWCSPFAFRVVWALKLKGVEFEYIEEDIFNKSTELLELNPVHKKVPVLVHDKRVI  64

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETARKCS  419
             ES +ILEYIDETW  +PLLP DPYE+A ARFWA F + K+L+    +   + E  +K  
Sbjct  65   VESFVILEYIDETWPQDPLLPQDPYEKAMARFWAKFGDEKLLESAYKAMWSKGEEKQKAM  124

Query  420  K  422
            K
Sbjct  125  K  125


 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 47/74 (64%), Gaps = 9/74 (12%)
 Frame = +1

Query  358  RFWTPPGE---------ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW   G+         A+ SKG++++ A+  A+E++EK+E  L GK F GG   GYL+L
Sbjct  95   RFWAKFGDEKLLESAYKAMWSKGEEKQKAMKEAVESLEKIEEVLGGKNFMGGNSIGYLDL  154

Query  511  VVGWVAHNLPIFEE  552
             +GW+ + +P++EE
Sbjct  155  AIGWIGYWIPVWEE  168



>ref|XP_007223941.1| hypothetical protein PRUPE_ppa011108mg [Prunus persica]
 gb|EMJ25140.1| hypothetical protein PRUPE_ppa011108mg [Prunus persica]
Length=223

 Score =   146 bits (369),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            + + +K++G W SP  LRVKW L++K +EY+Y+EED+ NK+PLL   NPVH K+PVLVH+
Sbjct  2    SADSVKLLGCWASPAALRVKWTLKLKEIEYQYVEEDLQNKSPLLLHYNPVHKKIPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETA  407
            GKP+ ESL+ILEYI+ETW  NP+LP DPYERA+ARFWA F E K       +   + E  
Sbjct  62   GKPVAESLIILEYIEETWMQNPILPEDPYERAQARFWAKFVEEKCGPSIMSAFTKKGEEK  121

Query  408  RKCSK  422
             K +K
Sbjct  122  EKGAK  126



>ref|XP_002881053.1| glutathione S-transferase 19 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57312.1| glutathione S-transferase 19 [Arabidopsis lyrata subsp. lyrata]
Length=224

 Score =   146 bits (369),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++GFW SPF  RV+ AL++KG+ YEY+EED+ NKTPLL +LNP+H KVPVLVHN 
Sbjct  5    EESVKLLGFWASPFSRRVEMALKLKGVPYEYLEEDLPNKTPLLLELNPLHKKVPVLVHND  64

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            K L ES LILEYID+TWK+NP+LP DPYE+A ARFWA F + +IL
Sbjct  65   KILLESHLILEYIDQTWKNNPILPQDPYEKAMARFWAKFIDEQIL  109



>ref|XP_006437360.1| hypothetical protein CICLE_v10032686mg [Citrus clementina]
 gb|ESR50600.1| hypothetical protein CICLE_v10032686mg [Citrus clementina]
Length=225

 Score =   146 bits (369),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++  W SPF LR  W L++KG+++++++ED+ NK+PLL Q NPV+ KVPVL+HNGK
Sbjct  3    EEVKLLKTWSSPFGLRAFWILKLKGVQFDFVDEDLSNKSPLLLQSNPVYKKVPVLIHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            P+ ESL+ILEY+DETWK NPLLP DPYERARARFWA F E K+L
Sbjct  63   PISESLVILEYVDETWKQNPLLPEDPYERARARFWAKFGEDKVL  106


 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 47/75 (63%), Gaps = 9/75 (12%)
 Frame = +1

Query  358  RFWTPPGE---------ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW   GE         A   +GK+QE A+  A+E ++ LE EL GK+FFGGEK G  +L
Sbjct  95   RFWAKFGEDKVLVSIWNAFIKQGKEQEEAIGLAIETLKFLEEELKGKRFFGGEKIGLADL  154

Query  511  VVGWVAHNLPIFEEV  555
             +GW+A+ + +FEEV
Sbjct  155  ALGWLANLIGVFEEV  169



>emb|CDP15482.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   139 bits (350),  Expect(2) = 7e-40, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E LK++G   S FV R  WAL++KGLEY YIEE+++NK+ LL +LNPV+ KVPVLVH GK
Sbjct  4    EDLKLLGTRSSSFVWRTVWALKIKGLEYTYIEENLYNKSSLLLELNPVYKKVPVLVHRGK  63

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILD  368
            P+ ESL+I+EYIDETWK NP+LP DP ERA ARFWA F++ K+ +
Sbjct  64   PICESLVIIEYIDETWKENPILPEDPLERAYARFWAKFSDEKLAE  108


 Score = 51.6 bits (122),  Expect(2) = 7e-40, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +1

Query  376  GEALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEV  555
            G+ L + G++Q  A+    EAME LE E++GK+FFGG+K GYL++V+GW A+ L   EEV
Sbjct  111  GQVLRTTGEEQAKALERMTEAMEILEREISGKKFFGGDKIGYLDIVIGWSAYWLQFLEEV  170



>ref|XP_002527848.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF34551.1| glutathione s-transferase, putative [Ricinus communis]
Length=225

 Score =   146 bits (368),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 86/115 (75%), Gaps = 0/115 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W SPF LRV WAL++KG+EYE I ED+ +K+PLL Q NPVH KVPVLVHNGK
Sbjct  3    EEVKIFRTWSSPFALRVIWALKLKGIEYETIYEDLSSKSPLLVQYNPVHKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQR  398
             + ESL+ILEY+DETWK  PLLP DP+ERARARFWA F + K+L      T  ++
Sbjct  63   AISESLVILEYMDETWKQYPLLPQDPHERARARFWAKFGDDKVLQSIFYGTFLKQ  117



>ref|XP_002524046.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF38414.1| glutathione s-transferase, putative [Ricinus communis]
Length=229

 Score =   146 bits (369),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA +E +KV+G W SPF  R + AL++KG+ YE + E++ NK+P L + NP++ K+PVLV
Sbjct  1    MAGQEEVKVLGGWFSPFAFRAEVALKLKGISYEAVAENLANKSPELLKYNPIYKKIPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRE  401
            HNGKP+ ESL+I+EYIDE WKHNP+LP DPYERA ARFWA F + K+++  R       E
Sbjct  61   HNGKPITESLIIIEYIDEVWKHNPVLPEDPYERAMARFWAYFVDNKLMEAVRRVINTTEE  120

Query  402  TARK  413
             A++
Sbjct  121  EAKQ  124



>ref|NP_001063423.1| Os09g0467200 [Oryza sativa Japonica Group]
 gb|AAK98545.1|AF402804_1 putative glutathione S-transferase OsGSTU17 [Oryza sativa Japonica 
Group]
 dbj|BAD17523.1| putative glutathione S-transferase [Oryza sativa Japonica Group]
 dbj|BAD19734.1| putative glutathione S-transferase [Oryza sativa Japonica Group]
 dbj|BAF25337.1| Os09g0467200 [Oryza sativa Japonica Group]
 gb|EAZ09424.1| hypothetical protein OsI_31697 [Oryza sativa Indica Group]
 gb|EAZ45045.1| hypothetical protein OsJ_29684 [Oryza sativa Japonica Group]
 dbj|BAG88140.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94156.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87373.1| unnamed protein product [Oryza sativa Japonica Group]
Length=223

 Score =   146 bits (368),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 88/108 (81%), Gaps = 1/108 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MAA++G+KV G W SP  +RV+WALR+KG++YEY++ED+ NK+  L + NPV  KVPVLV
Sbjct  1    MAADKGVKVFGMWASPMAIRVEWALRLKGVDYEYVDEDLANKSEALLRHNPVTKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKI  362
            H+GKPL ES +I+EYIDE WKH  P++P+DP++RA+ARFWA FAE K 
Sbjct  61   HDGKPLAESTVIVEYIDEAWKHGYPIMPSDPFDRAQARFWARFAEEKC  108


 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 9/74 (12%)
 Frame = +1

Query  358  RFWTPPGEALC---------SKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW    E  C         + G++Q   V+ A + ++ LE  L GK+FFGG+  GYL++
Sbjct  98   RFWARFAEEKCNAALYPIFMTTGEEQRKLVHEAQQCLKTLETALEGKKFFGGDAFGYLDI  157

Query  511  VVGWVAHNLPIFEE  552
            V GW A+ LP+ EE
Sbjct  158  VTGWFAYWLPVIEE  171



>ref|XP_006420235.1| hypothetical protein CICLE_v10006671mg [Citrus clementina]
 gb|ESR33475.1| hypothetical protein CICLE_v10006671mg [Citrus clementina]
Length=231

 Score =   143 bits (360),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++GFW SPF  RV WAL++KG+E+EYIEEDIFNK+  L +LNPVH KVPVLVH+ + +
Sbjct  5    VKLLGFWCSPFAFRVVWALKLKGVEFEYIEEDIFNKSTELLELNPVHKKVPVLVHDKRVI  64

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
             ES +ILEYIDETW  +PLLP DPYE+A ARFWA F + K+
Sbjct  65   VESFVILEYIDETWPQDPLLPQDPYEKAMARFWAKFGDEKV  105


 Score = 47.4 bits (111),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +1

Query  379  EALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEE  552
            +A+ SKG++++ A+  A+E++EK+E  L GK F GG   GYL+L +GW+ + +P++EE
Sbjct  115  KAMWSKGEEKQKAMKEAVESLEKIEEVLRGKNFMGGNSIGYLDLAIGWIGYWIPVWEE  172



>ref|XP_010650966.1| PREDICTED: glutathione S-transferase U8 [Vitis vinifera]
Length=220

 Score =   146 bits (368),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+ G W SP+  R++ AL++KGL++EYIEE+++NK+P L + NPVH KVPVLVHNGK
Sbjct  3    EEVKLFGAWGSPYSRRIELALKLKGLQFEYIEENLYNKSPALLKYNPVHKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFK  359
            P+ ESL+ILEYIDETWKHNP LP DPYE+A+ARFWA F + K
Sbjct  63   PVAESLVILEYIDETWKHNPFLPTDPYEKAKARFWARFIDEK  104



>emb|CAN73674.1| hypothetical protein VITISV_001109 [Vitis vinifera]
Length=341

 Score =   149 bits (376),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+ G W SPF  R++ AL++KG++YEYIEED+ NK+P L + NPVH K+PVL+H GK
Sbjct  3    EEVKLFGMWASPFSRRIEVALKLKGIQYEYIEEDLSNKSPSLLKYNPVHKKIPVLLHKGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
            P+ ESL+ILEYIDETWKHNP+LPADPYERA ARFWA F + K+
Sbjct  63   PVAESLVILEYIDETWKHNPILPADPYERAMARFWAKFLDEKL  105



>ref|XP_008781341.1| PREDICTED: glutathione transferase GST 23-like [Phoenix dactylifera]
Length=231

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 87/110 (79%), Gaps = 1/110 (1%)
 Frame = +3

Query  42   MAAEEG-LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVL  218
            MA+  G +K+ G W SP V RV+WAL+MKG+EYEYIEED+ NK+  L   NP++ +VPVL
Sbjct  1    MASGGGEVKLFGMWASPAVRRVEWALKMKGIEYEYIEEDLSNKSASLLAYNPINKQVPVL  60

Query  219  VHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILD  368
            +HNGKP+ ESL+I+EYIDE WKHNP+LP DPYER +ARFW+ ++E K  D
Sbjct  61   LHNGKPIAESLVIIEYIDEVWKHNPILPEDPYERTKARFWSTYSEGKCRD  110


 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 47/76 (62%), Gaps = 9/76 (12%)
 Frame = +1

Query  358  RFWTPPGEALC---------SKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW+   E  C         ++G+++E+A+    E +  L+ EL GK+FFGGE  G+ +L
Sbjct  98   RFWSTYSEGKCRDAVGKGYFTEGEEKENAIKYLEETVRVLDEELKGKKFFGGENLGFSDL  157

Query  511  VVGWVAHNLPIFEEVA  558
            V+GW+A  LP+ EEVA
Sbjct  158  VLGWMAFWLPVAEEVA  173



>ref|XP_010060069.1| PREDICTED: glutathione transferase GST 23-like [Eucalyptus grandis]
 gb|KCW66601.1| hypothetical protein EUGRSUZ_F00396 [Eucalyptus grandis]
Length=225

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 91/125 (73%), Gaps = 1/125 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNK-TPLLSQLNPVHAKVPVL  218
            MA    +K+ GFW SP+ LRV W L++K + Y+Y+EED+ NK + LL Q NPVH KVPVL
Sbjct  1    MADGGEVKLHGFWGSPYALRVIWTLKLKQVPYDYLEEDLPNKKSSLLLQYNPVHKKVPVL  60

Query  219  VHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQR  398
            VH+GKP+PESL+ILEYIDETWK +PLLP DPYERAR RFWA FA+ K +   +     + 
Sbjct  61   VHHGKPIPESLVILEYIDETWKQSPLLPQDPYERARVRFWAKFADEKCMPAMKAVFCTEG  120

Query  399  ETARK  413
            E  +K
Sbjct  121  EEQQK  125



>ref|XP_006294917.1| hypothetical protein CARUB_v10023969mg, partial [Capsella rubella]
 gb|EOA27815.1| hypothetical protein CARUB_v10023969mg, partial [Capsella rubella]
Length=237

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 94/120 (78%), Gaps = 1/120 (1%)
 Frame = +3

Query  9    EKQDRNITVVIMAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQL  188
            ++ +R +  V+   EE +K++GFW SPF  RV+ AL++KG+ YEY+EED+ NKT LL +L
Sbjct  3    KQTNRGVDPVMAEKEESVKLLGFWGSPFSRRVEMALKLKGVPYEYLEEDLPNKTSLLLEL  62

Query  189  NPVHAKVPVLVHNGKPLPESLLILEYIDETWK-HNPLLPADPYERARARFWAGFAEFKIL  365
            NPVH KVPVLVHN K LPES LI+EYID+TWK +NP+LP DPY++A ARFWA F + +IL
Sbjct  63   NPVHKKVPVLVHNDKVLPESHLIIEYIDQTWKNNNPILPQDPYDKAMARFWAKFIDEQIL  122



>gb|AAT98377.1| glutathione S-transferase [Populus trichocarpa]
Length=113

 Score =   142 bits (358),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G W SPF  RV+ AL++KG+EYEYIE+D+ NK+PLL + NP+H KVPVL+HNGK +
Sbjct  4    VKLLGAWGSPFSCRVEMALKLKGVEYEYIEQDLANKSPLLLKYNPIHKKVPVLLHNGKTI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
             ESL+ILEYIDETWK NP+LP DPY++A ARFWA F + K+
Sbjct  64   AESLVILEYIDETWKSNPILPEDPYDKAMARFWAKFIDEKV  104



>gb|KFK44228.1| hypothetical protein AALP_AA1G231200 [Arabis alpina]
Length=224

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 91/117 (78%), Gaps = 1/117 (1%)
 Frame = +3

Query  57   GLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKP  236
            G+K++GFW SPF  RV+ AL++KG+ YEY+E+D+ NK+PLL +LNP+  KVPVLVHNGK 
Sbjct  7    GVKLLGFWASPFSRRVEMALKLKGVPYEYLEQDLMNKSPLLLELNPIFKKVPVLVHNGKI  66

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETA  407
            LPES LILEYID+TWK+NP+LP DPYE+A A FWA F + ++  PT   +V + E  
Sbjct  67   LPESHLILEYIDQTWKNNPILPQDPYEKAMAFFWAKFVDEQV-GPTAFKSVIKAEKG  122



>ref|XP_010278876.1| PREDICTED: probable glutathione S-transferase [Nelumbo nucifera]
Length=225

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            LK+ G W SPF  RVK AL++KG++YEY EED+ NK+P L + +PVH K+PVLVH+GKP+
Sbjct  6    LKLFGAWFSPFSFRVKLALKLKGIQYEYAEEDLQNKSPELLKYSPVHKKIPVLVHDGKPI  65

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTR  377
             ESL+ILEYIDETWK NPLLP DPYERA  RFW  FAE K ++  R
Sbjct  66   VESLIILEYIDETWKQNPLLPEDPYERAMVRFWVTFAEEKFIEALR  111



>ref|XP_010414381.1| PREDICTED: glutathione S-transferase U1-like [Camelina sativa]
Length=224

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++GFW SPF  RV+ AL++KG+ YEY+EED+ NKT LL +LNP+H KVPVLVHN 
Sbjct  5    EECVKLLGFWGSPFSRRVEMALKLKGVPYEYLEEDLPNKTSLLLELNPLHKKVPVLVHND  64

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILD  368
            K LPES LILEYID+TWK+NP+LP DPYE+A ARFWA F + +IL 
Sbjct  65   KVLPESHLILEYIDQTWKNNPILPHDPYEKAMARFWAKFIDEQILS  110



>ref|XP_002881054.1| glutathione-s-transferase 9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57313.1| glutathione-s-transferase 9 [Arabidopsis lyrata subsp. lyrata]
Length=228

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M  EE ++++GFW SPF  RVK AL++KG+ YEY+EED+ NK+PLL +LNPVH KVPVLV
Sbjct  1    MEKEEEVRLLGFWASPFTCRVKMALKLKGVPYEYLEEDLMNKSPLLLELNPVHKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
            HNGKP+ ES LILEYID+TW +NP+LP DPY++A AR  A F + ++
Sbjct  61   HNGKPILESNLILEYIDQTWTNNPILPQDPYDKAMARLLAKFVDEQV  107



>gb|KDO46806.1| hypothetical protein CISIN_1g027333mg [Citrus sinensis]
Length=225

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++  W SPF LR  W L++KG+++++I+ED+ NK+PLL Q NPV+ KVPVL+HNGK
Sbjct  3    EEVKLLKTWSSPFGLRAFWILKLKGVQFDFIDEDLSNKSPLLLQSNPVYKKVPVLIHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETARK  413
            P+ ESL+ILEY+DETWK NPLLP DPYERARARFWA F + K+L     + + Q +   +
Sbjct  63   PISESLVILEYVDETWKQNPLLPEDPYERARARFWAKFGDDKVLASIWNAFIKQGKEQEE  122

Query  414  CSKLS  428
               L+
Sbjct  123  AIGLA  127


 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 47/75 (63%), Gaps = 9/75 (12%)
 Frame = +1

Query  358  RFWTPPGE---------ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW   G+         A   +GK+QE A+  A+E ++ LE EL GK+FFGGEK G  +L
Sbjct  95   RFWAKFGDDKVLASIWNAFIKQGKEQEEAIGLAIETLKFLEEELKGKRFFGGEKIGLPDL  154

Query  511  VVGWVAHNLPIFEEV  555
             +GW+A+ + +FEEV
Sbjct  155  ALGWLANLIGVFEEV  169



>ref|XP_006484732.1| PREDICTED: probable glutathione S-transferase-like [Citrus sinensis]
Length=221

 Score =   144 bits (362),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++  W SPF LRV WAL++KG++++ IEED+ NK+PLL Q NPVH K+PVLVHNGK
Sbjct  3    EEVKLLMTWSSPFALRVVWALKLKGVQFDSIEEDLSNKSPLLLQYNPVHKKIPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
            P+ ESL+ILEY+DETW+  PLLP  PY+RARARFWA F++ K+
Sbjct  63   PISESLVILEYVDETWRQYPLLPDGPYDRARARFWAKFSDDKV  105


 Score = 45.8 bits (107),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  382  ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEV  555
                +GK++E A +   E ++ LE EL GK+FFGGEK G+ +L +GW+A  + + EE+
Sbjct  112  VFIKQGKEREEAFDQVFENLKFLEEELKGKKFFGGEKIGFADLALGWIAERVCVLEEI  169



>ref|XP_010279601.1| PREDICTED: glutathione S-transferase U1-like [Nelumbo nucifera]
Length=138

 Score =   143 bits (360),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 87/115 (76%), Gaps = 0/115 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++G W SPF  RV+ AL++KG++YEYI+ED+ NK+PLL + NP+H KVPVL+HNGK
Sbjct  3    EEVKLIGAWRSPFSRRVELALKLKGVQYEYIDEDLSNKSPLLLKYNPIHKKVPVLLHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQR  398
            P+ ES +ILEYIDETWK   LLP DPYERA  RFW  F + K++D  R S V  R
Sbjct  63   PIAESAVILEYIDETWKGYHLLPEDPYERAMTRFWVKFIDEKVIDIVRRSLVGGR  117



>ref|XP_002460369.1| hypothetical protein SORBIDRAFT_02g027080 [Sorghum bicolor]
 gb|EER96890.1| hypothetical protein SORBIDRAFT_02g027080 [Sorghum bicolor]
Length=222

 Score =   145 bits (366),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AE+G+KV+G W SP V+RV+WALR+KG+EYEY++ED+ NK+  L + NPV  KVPVLVH+
Sbjct  2    AEKGVKVLGMWASPMVIRVEWALRLKGVEYEYVDEDLANKSADLLRYNPVTKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKI  362
            G P+ ES +I+EYIDE WK   P++PADPYERA+ARFWA FAE K 
Sbjct  62   GNPIAESTIIVEYIDEAWKGGYPIMPADPYERAQARFWARFAEEKC  107


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 43/75 (57%), Gaps = 9/75 (12%)
 Frame = +1

Query  358  RFWTPPGEALC---------SKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW    E  C         + G+ Q  AV  A + ++ LE  L GK+FFGG+  GYL++
Sbjct  97   RFWARFAEEKCNAALYPIFTATGEAQRKAVQEAQQCLKTLETALEGKKFFGGDAVGYLDI  156

Query  511  VVGWVAHNLPIFEEV  555
            VVGW AH LP+ EEV
Sbjct  157  VVGWYAHWLPVMEEV  171



>ref|XP_004957087.1| PREDICTED: glutathione transferase GST 23-like [Setaria italica]
Length=222

 Score =   145 bits (366),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AE+G+KV G W SP V+RV+WALR+KG+EYEY++ED+ NK+  L + NPV  KVPVLVH+
Sbjct  2    AEKGVKVFGMWASPMVIRVEWALRLKGVEYEYVDEDLANKSADLLRYNPVTKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWK-HNPLLPADPYERARARFWAGFAEFKI  362
            GKP+ ES +I+EYIDE WK  +P++PADPYERA+ARFWA +AE K 
Sbjct  62   GKPIAESTIIVEYIDEAWKGGHPIMPADPYERAQARFWARYAEDKC  107


 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 42/75 (56%), Gaps = 9/75 (12%)
 Frame = +1

Query  358  RFWTPPGEALC---------SKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW    E  C         + G++Q      A + ++ LE  L GK+FFGG+  GYL++
Sbjct  97   RFWARYAEDKCNAALYPIFTATGEEQRKVAQEAQQCLKTLETALEGKKFFGGDAVGYLDI  156

Query  511  VVGWVAHNLPIFEEV  555
            VVGW AH LP+ EEV
Sbjct  157  VVGWFAHWLPVVEEV  171



>ref|NP_001104993.1| glutathione S-transferase GST 33 [Zea mays]
 gb|AAG34841.1|AF244698_1 glutathione S-transferase GST 33 [Zea mays]
Length=233

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA  EGLKV+G  VSPFVLRV  AL  KG+ YEY+EED+ NK+ LL + NPVH KVPVL+
Sbjct  1    MAGNEGLKVLGLQVSPFVLRVCMALNTKGVSYEYVEEDLSNKSELLLKSNPVHKKVPVLI  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            HNGKP+ ESL+I++Y+DE +    +LP DPYERA ARFWA +A+ K+L
Sbjct  61   HNGKPICESLVIMQYVDELFAGRSILPTDPYERATARFWAAYADDKLL  108



>ref|XP_002524048.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF38416.1| glutathione s-transferase, putative [Ricinus communis]
Length=229

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA +E +KV+G W SPFV RV+ AL++KG++YE + E++ NK+P L + NP++ K+PVLV
Sbjct  1    MAGQEEVKVLGGWSSPFVFRVEVALKLKGIQYEAVVENLANKSPELLKYNPIYRKIPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRG  380
            HNGKP+ ESL+I+EYIDETWK NP+LP DPYERA ARFW  F + K+++  +G
Sbjct  61   HNGKPISESLIIVEYIDETWKDNPILPQDPYERAMARFWGYFVDNKLMEALKG  113



>gb|KDP42500.1| hypothetical protein JCGZ_00297 [Jatropha curcas]
Length=221

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E LKV   W S F LR  WAL++KG+EYE + ED+ NK+PLL Q NPV+ KVPVL+HNGK
Sbjct  3    EDLKVFRTWSSSFALRAVWALKLKGIEYETVYEDLSNKSPLLLQYNPVYKKVPVLLHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILD  368
            PL ESL+ILEYIDETWK NPLLP DP ERARARFWA F + K+  
Sbjct  63   PLCESLVILEYIDETWKQNPLLPEDPLERARARFWAKFGDDKVFQ  107


 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 10/76 (13%)
 Frame = +1

Query  358  RFWTPPGEA----------LCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLN  507
            RFW   G+              +GK+QE A+  A+E ++ LE EL GK+FFGGEK G L+
Sbjct  95   RFWAKFGDDKVFQSIVYGIFLKQGKEQEEAIPLAIENLKHLEKELRGKKFFGGEKIGLLD  154

Query  508  LVVGWVAHNLPIFEEV  555
            L +GW+AH+  +FEE+
Sbjct  155  LALGWLAHHNGVFEEI  170



>ref|XP_011004483.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=225

 Score =   140 bits (353),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +KV   W SPF LRV WALR+KG++++ I ED+FNK+PLL Q NPV  KVPVLVHNGK
Sbjct  3    EEVKVFRSWASPFPLRVIWALRLKGVKFDVICEDLFNKSPLLLQYNPVEKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTR  377
             + ESL+ILEYI+ETWK +PLLP DPY++A ARFWA F++ K+    +
Sbjct  63   AICESLVILEYIEETWKQSPLLPEDPYQKANARFWAKFSDDKVFQSIK  110


 Score = 48.9 bits (115),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  379  EALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVA  558
            + L  +GK+QE  + ++++ +  LE EL GK+FFGGE  G  +L +GW+A+ + IFEEV 
Sbjct  112  DVLLKEGKEQEEGILASLQNLRYLEEELRGKKFFGGEAIGLADLALGWLAYYINIFEEVV  171

Query  559  SL  564
             L
Sbjct  172  GL  173



>ref|NP_001234957.1| glutathione S-transferase GST 17 [Glycine max]
 gb|AAG34807.1|AF243372_1 glutathione S-transferase GST 17 [Glycine max]
 gb|AJE59656.1| tau class glutathione S-transferase [Glycine max]
Length=229

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M     +K++ FWVSPF  RV+WAL++KG+EYEYIEEDIFNK+ LL QLNPVH KVPVLV
Sbjct  1    MMGSGDVKLLSFWVSPFGKRVEWALKLKGIEYEYIEEDIFNKSNLLLQLNPVHKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
            H  KP+ ES +ILEYIDETWK  PLLP  P++RA ARFWA   E K+
Sbjct  61   HAHKPIAESFIILEYIDETWKQYPLLPCHPHQRALARFWATSVEQKL  107


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 52/78 (67%), Gaps = 9/78 (12%)
 Frame = +1

Query  358  RFWTPPGE---------ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW    E         A+ + G++QE AV  A+E MEK+E E+ GK+FFGG+  GYL++
Sbjct  97   RFWATSVEQKLGKAGWVAMSTSGEEQEKAVKEAIEMMEKIEEEIKGKKFFGGDNIGYLDI  156

Query  511  VVGWVAHNLPIFEEVASL  564
             +GW+A+ +P++EEV S+
Sbjct  157  ALGWIAYLVPVWEEVGSM  174



>gb|ACU20120.1| unknown [Glycine max]
Length=229

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M     +K++ FWVSPF  RV+WAL++KG+EYEYIEEDIFNK+ LL QLNPVH KVPVLV
Sbjct  1    MMGSGDVKLLSFWVSPFGKRVEWALKLKGIEYEYIEEDIFNKSNLLLQLNPVHKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
            H  KP+ ES +ILEYIDETWK  PLLP  P++RA ARFWA   E K+
Sbjct  61   HAHKPIAESFIILEYIDETWKQYPLLPCHPHQRALARFWATSVEQKL  107


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 52/78 (67%), Gaps = 9/78 (12%)
 Frame = +1

Query  358  RFWTPPGE---------ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW    E         A+ + G++QE AV  A+E MEK+E E+ GK+FFGG+  GYL++
Sbjct  97   RFWATSVEQKLGKAGWVAMSTSGEEQEKAVKEAIEMMEKIEEEIKGKKFFGGDNIGYLDI  156

Query  511  VVGWVAHNLPIFEEVASL  564
             +GW+A+ +P++EEV S+
Sbjct  157  ALGWIAYLVPVWEEVGSM  174



>ref|XP_008232144.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=223

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+   W SPF LR+ WAL++KG+ YE I ED+ NK+PLL Q NP+H KVPVLVHNGKP+
Sbjct  4    VKLFRTWSSPFALRIVWALKLKGVSYETIYEDLSNKSPLLLQYNPIHKKVPVLVHNGKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
             ESL+ILEYIDETWK NPLLP DP ERA ARFWA F + K+L
Sbjct  64   AESLVILEYIDETWKENPLLPEDPLERAAARFWAKFGDEKVL  105


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 46/78 (59%), Gaps = 9/78 (12%)
 Frame = +1

Query  358  RFWTPPG---------EALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW   G         E+  ++GK QE A+  A E +  LE EL GK+FFGGEK G  ++
Sbjct  94   RFWAKFGDEKVLPSIWESFTNEGKGQEEAIVKAKENLNYLEEELKGKKFFGGEKLGLADI  153

Query  511  VVGWVAHNLPIFEEVASL  564
             +GW+AH   +FE+VA +
Sbjct  154  ALGWLAHYESVFEDVAGM  171



>ref|XP_011040645.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=225

 Score =   140 bits (353),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +KV   W SPF LRV WALR+KG++++ I ED+FNK+PLL Q NPV  KVPVLVHNGK
Sbjct  3    EEVKVFRSWASPFPLRVIWALRLKGVKFDVICEDLFNKSPLLLQYNPVEKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTR  377
             + ESL+ILEYI+ETWK +PLLP DPY++A ARFWA F++ K+    +
Sbjct  63   AICESLVILEYIEETWKQSPLLPEDPYQKANARFWAKFSDDKVFQSMK  110


 Score = 48.9 bits (115),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  379  EALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVA  558
            + L  +GK+QE  + ++++ +  LE EL GK+FFGGE  G  +L +GW+A+ + IFEEV 
Sbjct  112  DVLLKEGKEQEEGILASLQNLRYLEEELRGKKFFGGEAIGLADLALGWLAYYINIFEEVV  171

Query  559  SL  564
             L
Sbjct  172  GL  173



>ref|XP_009141006.1| PREDICTED: glutathione S-transferase U2 [Brassica rapa]
Length=256

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 92/126 (73%), Gaps = 8/126 (6%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++GFW+SPF  RV+ AL++KG+ YEY+EED+  KTPLL +LNPVH KVPVLVHN 
Sbjct  5    EESVKLLGFWISPFSRRVEMALKLKGVPYEYLEEDLPKKTPLLLELNPVHKKVPVLVHND  64

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL--------DPTRGST  386
            K L ES +ILEYID+TW +NP+LP DPYE+A ARFWA F + +IL         P +G  
Sbjct  65   KILSESHVILEYIDQTWSNNPILPQDPYEKAMARFWAKFVDEQILPAGFMPLVKPKKGIE  124

Query  387  VFQRET  404
            V   ET
Sbjct  125  VAIEET  130



>emb|CDP06552.1| unnamed protein product [Coffea canephora]
Length=237

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+ G+WVSPF   V+ AL +KG++YEYIEED+ NK+P L Q NPV+ K+PVL+HNGK
Sbjct  2    EEVKLFGYWVSPFCRSVEIALNIKGIQYEYIEEDLTNKSPQLLQYNPVYKKIPVLLHNGK  61

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            P+ ES++ILEYIDETWK+NP+LP DP+E+ARARFWA F + K  
Sbjct  62   PIVESMVILEYIDETWKNNPILPEDPFEKARARFWANFVDQKCF  105



>ref|XP_009370896.1| PREDICTED: probable glutathione S-transferase [Pyrus x bretschneideri]
 gb|AHB33321.1| glutathione S-transferase 2 [Pyrus pyrifolia]
Length=222

 Score =   145 bits (365),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 84/121 (69%), Gaps = 0/121 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +KV+GFW SP+V RV WAL +KG++YEY+EEDIFNKT LL + NPVH  VPV VH GK
Sbjct  2    EEVKVIGFWTSPYVYRVTWALNLKGIKYEYLEEDIFNKTDLLIRHNPVHKMVPVFVHGGK  61

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETARK  413
             + ES++ILEYIDETW  NPLLP DP+ RA ARFW  F + K    TR       + AR 
Sbjct  62   SIAESMVILEYIDETWPQNPLLPNDPHARAVARFWTKFGDDKKQSFTRFYKAVGEDLARA  121

Query  414  C  416
             
Sbjct  122  V  122



>emb|CDY51366.1| BnaA04g28600D [Brassica napus]
Length=224

 Score =   145 bits (365),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++GFW SPF  RV+ AL++KG+ YEY+E+DIFNK+ LL +LNPV  KVPVLVH G
Sbjct  5    EEDVKLLGFWASPFSRRVEMALKLKGVSYEYLEQDIFNKSALLLELNPVFKKVPVLVHKG  64

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
            K L ES LILEYID+TWK+NP+LP DPYE+A ARFWA F + ++
Sbjct  65   KILAESHLILEYIDQTWKNNPILPQDPYEKAMARFWAKFVDEQV  108



>ref|XP_002264117.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=225

 Score =   145 bits (365),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 88/129 (68%), Gaps = 0/129 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E LK+   W S F LR+ WAL++KG+EYE I ED+ NK+P L Q NPVH KVPVLVHNGK
Sbjct  3    EELKLFRTWSSVFALRIVWALKIKGVEYETIFEDLSNKSPSLLQYNPVHKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETARK  413
            P+ ESL+ILEYIDETW+  PLLP DPYERA ARFWA F + K+L        F+    ++
Sbjct  63   PIAESLVILEYIDETWRETPLLPEDPYERAMARFWAKFGDDKVLTSIVWGVFFKEGKEQE  122

Query  414  CSKLSHGSH  440
             + L    H
Sbjct  123  EAMLEAMEH  131


 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 50/79 (63%), Gaps = 10/79 (13%)
 Frame = +1

Query  358  RFWTPPGE----------ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLN  507
            RFW   G+              +GK+QE A+  AME ++ LE EL GK+FFGGE+ G+++
Sbjct  95   RFWAKFGDDKVLTSIVWGVFFKEGKEQEEAMLEAMEHLQFLEDELKGKRFFGGERIGFVD  154

Query  508  LVVGWVAHNLPIFEEVASL  564
            L +GW+A+ + IFEEVA L
Sbjct  155  LALGWLANMISIFEEVAGL  173



>ref|XP_008793318.1| PREDICTED: glutathione transferase GST 23-like [Phoenix dactylifera]
Length=225

 Score =   145 bits (365),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M +   +K+ G W SP V RV+WAL++KG++YEY+EEDI NK+  L + NP++ +VPVL+
Sbjct  1    MVSGGEVKLFGMWASPAVRRVEWALKLKGIKYEYVEEDISNKSGALVRYNPINKQVPVLL  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTR  377
            HNGKP+ ESL+ILEYIDE WKH+P+LP DPYERA ARFWA ++E K  D  R
Sbjct  61   HNGKPIVESLVILEYIDEVWKHHPILPKDPYERAMARFWAAYSEDKCRDAVR  112



>ref|XP_002281694.2| PREDICTED: uncharacterized protein LOC100246830 [Vitis vinifera]
Length=446

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 91/120 (76%), Gaps = 2/120 (2%)
 Frame = +3

Query  3    G*EKQDRNITVVIMAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLS  182
            G     +++    MA E  +K+ G W SPF  R++ AL++KG++YEYIEED+ NK+P L 
Sbjct  215  GSSTASKSLQAATMAEE--VKLFGMWASPFSRRIEVALKLKGIQYEYIEEDLSNKSPSLL  272

Query  183  QLNPVHAKVPVLVHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
            + NPVH K+PVL+H GKP+ ESL+ILEYIDETWKHNP+LPADPYERA ARFWA F + K+
Sbjct  273  KYNPVHKKIPVLLHKGKPVAESLVILEYIDETWKHNPILPADPYERAMARFWAKFLDEKL  332


 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+ G W SPF  R++ AL++KG+++EYIEE++ NK+P L + NPVH K+PVLVHNGK
Sbjct  3    EEVKLFGTWASPFSRRIEVALKLKGVQFEYIEENLSNKSPALLKYNPVHKKIPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
            P+ ESL+ILEYIDETWKHNP+LP DPYE+A ARFWA + + K+
Sbjct  63   PVAESLVILEYIDETWKHNPILPTDPYEKAMARFWAKYMDDKL  105



>emb|CAN72240.1| hypothetical protein VITISV_010777 [Vitis vinifera]
Length=225

 Score =   145 bits (365),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 88/129 (68%), Gaps = 0/129 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E LK+   W S F LR+ WAL++KG+EYE I ED+ NK+P L Q NPVH KVPVLVHNGK
Sbjct  3    EELKLFRTWSSVFALRIVWALKIKGVEYETIFEDLSNKSPSLLQYNPVHKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETARK  413
            P+ ESL+ILEYIDETW+  PLLP DPYERA ARFWA F + K+L        F+    ++
Sbjct  63   PIAESLVILEYIDETWRETPLLPEDPYERAMARFWAKFGDDKVLTSIVWGVFFKEGKEQE  122

Query  414  CSKLSHGSH  440
             + L    H
Sbjct  123  EAMLEAMEH  131


 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 50/79 (63%), Gaps = 10/79 (13%)
 Frame = +1

Query  358  RFWTPPGE----------ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLN  507
            RFW   G+              +GK+QE A+  AME ++ LE EL GK+FFGGE+ G+++
Sbjct  95   RFWAKFGDDKVLTSIVWGVFFKEGKEQEEAMLEAMEHLQFLEDELKGKRFFGGERIGFVD  154

Query  508  LVVGWVAHNLPIFEEVASL  564
            L +GW+A+ + IFEEVA L
Sbjct  155  LALGWLANMISIFEEVAGL  173



>ref|XP_004299557.1| PREDICTED: probable glutathione S-transferase [Fragaria vesca 
subsp. vesca]
Length=224

 Score =   139 bits (349),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +3

Query  57   GLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKP  236
            G+K+V    S F  RV+WAL++KG+EYE+IEED+ NK+P+L + NPVH KVPVLVH+  P
Sbjct  3    GVKLVATTQSFFCTRVQWALKLKGVEYEFIEEDLRNKSPVLLKYNPVHKKVPVLVHHDTP  62

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            + ESL+ILEYIDETWK NPLLP DP++RA ARFWA FA+ K++
Sbjct  63   IVESLVILEYIDETWKENPLLPQDPFDRAAARFWAKFADEKVV  105


 Score = 49.7 bits (117),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  382  ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVAS  561
            A  ++G+ +E A+ +A+E++  LE ++ GK+FFGGE+ GYL+LV+GW+ H L   EEV  
Sbjct  111  ACTAEGEGKEKAIEAALESLAHLEKQIEGKKFFGGEQIGYLDLVLGWIPHWLNTVEEVGG  170

Query  562  L  564
            +
Sbjct  171  M  171



>gb|KDO57583.1| hypothetical protein CISIN_1g046710mg [Citrus sinensis]
Length=227

 Score =   145 bits (365),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 89/121 (74%), Gaps = 0/121 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++GFW SPF  RV WAL++KG+E+EYIEEDIFNK+  L +LNPVH KVPVLVH+ + +
Sbjct  5    VKLLGFWCSPFAFRVVWALKLKGVEFEYIEEDIFNKSTELLELNPVHKKVPVLVHDKRVI  64

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETARKCS  419
             ES + LEYIDETW  +PLLP DPYE+A ARFWA F + K+L+    +   + E  +K  
Sbjct  65   VESFVFLEYIDETWPQDPLLPQDPYEKAMARFWAKFGDEKLLESAYKAMWSKGEEKQKAM  124

Query  420  K  422
            K
Sbjct  125  K  125



>emb|CAN73675.1| hypothetical protein VITISV_001110 [Vitis vinifera]
Length=221

 Score =   144 bits (364),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+ G W SPF  R++ AL++KG+++EYIEE++ NK+P L + NPVH K+PVLVHNGK
Sbjct  3    EEVKLFGTWASPFSRRIEVALKLKGVQFEYIEENLXNKSPALLKYNPVHKKIPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
            P+ ESL+ILEYIDETWKHNP+LP DPYE+A ARFWA + + K+
Sbjct  63   PVAESLVILEYIDETWKHNPILPTDPYEKAMARFWAKYMDDKL  105



>ref|NP_180510.1| glutathione S-transferase tau 1 [Arabidopsis thaliana]
 sp|Q9ZW30.1|GSTU1_ARATH RecName: Full=Glutathione S-transferase U1; Short=AtGSTU1; AltName: 
Full=GST class-tau member 1; AltName: Full=Glutathione 
S-transferase 19 [Arabidopsis thaliana]
 gb|AAG30132.1|AF288183_1 glutathione S-transferase [Arabidopsis thaliana]
 gb|AAL16155.1|AF428387_1 At2g29490/F16P2.13 [Arabidopsis thaliana]
 gb|AAC95189.1| putative glutathione S-transferase [Arabidopsis thaliana]
 gb|AAQ22631.1| At2g29490/F16P2.13 [Arabidopsis thaliana]
 gb|AEC08260.1| glutathione S-transferase TAU1 [Arabidopsis thaliana]
Length=224

 Score =   144 bits (364),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++GFW SPF  RV+ AL++KG+ YEY+EED+ NKTPLL +LNP+H KVPVLVHN 
Sbjct  5    EESVKLLGFWASPFSRRVEMALKLKGVPYEYLEEDLPNKTPLLLELNPLHKKVPVLVHND  64

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            K L ES LILEYID+TWK++P+LP DPYE+A ARFWA F + +IL
Sbjct  65   KILLESHLILEYIDQTWKNSPILPQDPYEKAMARFWAKFIDDQIL  109



>ref|NP_001234986.1| glutathione S-transferase GST 19 [Glycine max]
 gb|AAG34809.1|AF243374_1 glutathione S-transferase GST 19 [Glycine max]
 gb|ACU14422.1| unknown [Glycine max]
 gb|AFS51730.1| tau class glutathione S-transferase [Glycine soja]
 gb|KHN41696.1| Putative glutathione S-transferase [Glycine soja]
 gb|AJE59650.1| tau class glutathione S-transferase [Glycine max]
Length=225

 Score =   144 bits (364),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 89/120 (74%), Gaps = 0/120 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++    S    RV+WALR+KG+EYEY++ED+ NK+ LL Q NPVH KVPVL+HN K
Sbjct  2    EEVKLIATHQSFPCARVEWALRIKGVEYEYLKEDLANKSSLLLQSNPVHKKVPVLLHNNK  61

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETARK  413
            P+ ESL+ILEYIDETWK NPLLP DPYERA+ARFWA F + K +    G+TV Q E   K
Sbjct  62   PIAESLVILEYIDETWKKNPLLPLDPYERAQARFWARFIDEKCVLAVWGATVAQGEEKEK  121



>emb|CDY51364.1| BnaA04g28580D [Brassica napus]
Length=224

 Score =   144 bits (364),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 91/126 (72%), Gaps = 8/126 (6%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++GFW+SPF  RV+ AL++KG+ YEY+EED+  KTPLL +LNPVH KVPVLVHN 
Sbjct  5    EECVKLLGFWISPFSRRVEMALKLKGVPYEYLEEDLPKKTPLLLELNPVHKKVPVLVHND  64

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL--------DPTRGST  386
            K L ES +ILEYID+TW +NP LP DPYE+A ARFWA F + +IL         P +G  
Sbjct  65   KILSESHVILEYIDQTWSNNPFLPQDPYEKAMARFWAKFVDEQILAAGFMPLIKPKKGIE  124

Query  387  VFQRET  404
            V   ET
Sbjct  125  VAIEET  130



>ref|XP_009343223.1| PREDICTED: probable glutathione S-transferase isoform X2 [Pyrus 
x bretschneideri]
Length=219

 Score =   133 bits (334),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++  W SPF LR+ WAL++KG+ YE I ED+ NK+PLL Q NPVH KVPVL+HNG  +
Sbjct  4    VKLLRTWSSPFPLRIVWALQLKGVPYETIYEDLSNKSPLLLQSNPVHKKVPVLLHNGNAV  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
             ESL+ILEY+DETWK NPLLP DP +RA ARFWA + + K+L
Sbjct  64   VESLIILEYVDETWKENPLLPEDPLDRATARFWARYIDDKVL  105


 Score = 55.5 bits (132),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  379  EALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVA  558
            E    +GK+QE A+  A E ++ LE EL GK+FFGGEK G++++ +GW+A+N  +FEEVA
Sbjct  110  EFFTKEGKEQEEAIVKAKENLKYLEEELKGKKFFGGEKVGFVDIALGWLAYNESLFEEVA  169

Query  559  SL  564
             +
Sbjct  170  GM  171



>emb|CBI16039.3| unnamed protein product [Vitis vinifera]
Length=308

 Score =   147 bits (370),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+ G W SP+  R++ AL++KGL++EYIEE+++NK+P L + NPVH KVPVLVHNGK
Sbjct  91   EEVKLFGAWGSPYSRRIELALKLKGLQFEYIEENLYNKSPALLKYNPVHKKVPVLVHNGK  150

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFK  359
            P+ ESL+ILEYIDETWKHNP LP DPYE+A+ARFWA F + K
Sbjct  151  PVAESLVILEYIDETWKHNPFLPTDPYEKAKARFWARFIDEK  192



>ref|XP_002269118.1| PREDICTED: glutathione S-transferase U9 [Vitis vinifera]
Length=227

 Score =   144 bits (364),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 89/128 (70%), Gaps = 1/128 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M  E  + + G W SPFV RV+ AL++KG+ YEY+EED+ NK+ LL Q NPVH KVPVLV
Sbjct  1    MGEENKVTLYGMWASPFVKRVEIALKIKGIPYEYVEEDLRNKSQLLLQYNPVHKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNP-LLPADPYERARARFWAGFAEFKILDPTRGSTVFQR  398
            HNGKP+ ESL+ILEYI+ETWK+ P LLP DPYERA+ RFWA F + + +D    +     
Sbjct  61   HNGKPITESLVILEYIEETWKNGPKLLPEDPYERAKVRFWASFIQQQFVDSMVSAAKSSG  120

Query  399  ETARKCSK  422
            E   K  K
Sbjct  121  EAHEKAMK  128



>ref|XP_002518184.1| glutathione s-transferase, putative [Ricinus communis]
 pdb|4J2F|A Chain A, Crystal Structure Of A Glutathione Transferase Family 
Member From Ricinus Communis, Target Efi-501866
 gb|EEF44317.1| glutathione s-transferase, putative [Ricinus communis]
Length=223

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E LK+ G W SPF  RV WAL++KG+ YEY+EED+FNK+PLL Q NPVH K+PVLVH GK
Sbjct  3    EVLKLHGAWPSPFSCRVIWALKLKGIPYEYVEEDLFNKSPLLLQYNPVHKKIPVLVHGGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFK  359
            P+ ES +ILEY+DETW  NPLLP+DP+ERA ARFW  F E K
Sbjct  63   PICESTIILEYLDETWPENPLLPSDPHERAVARFWVKFIEDK  104



>gb|ADB11358.1| tau class glutathione transferase GSTU26 [Populus trichocarpa]
Length=225

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +KV+G   S F  RV+WAL++KG+EYEY++EDI+NK+PLL + NPVH KVPVLVH+ KP+
Sbjct  4    VKVIGSSKSLFCARVEWALKLKGVEYEYLQEDIWNKSPLLLKHNPVHKKVPVLVHDDKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
             ESL+ILEYIDETWK  PLLP DPYERA ARFWA FAE K L
Sbjct  64   AESLVILEYIDETWKDYPLLPEDPYERAMARFWAKFAEEKCL  105



>ref|XP_002264055.2| PREDICTED: probable glutathione S-transferase isoform X1 [Vitis 
vinifera]
Length=225

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 85/116 (73%), Gaps = 1/116 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W +PF LR+ WAL++KG+EYE I ED++NK+P L Q NP H KVPVLVHNGK
Sbjct  3    EEVKLFRTWSTPFALRIVWALKIKGVEYETIFEDLYNKSPSLLQYNPAHKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRE  401
            P+ ES +ILEYIDETWK  PLLP DPYERA ARFWA F + K+     G  VF +E
Sbjct  63   PISESYVILEYIDETWKETPLLPEDPYERAMARFWAKFGDDKVFTSIFGG-VFVKE  117


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 49/79 (62%), Gaps = 10/79 (13%)
 Frame = +1

Query  358  RFWTPPGE----------ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLN  507
            RFW   G+              +GK+QE A+  AME ++ LE EL GK+FFGGE+ G+++
Sbjct  95   RFWAKFGDDKVFTSIFGGVFVKEGKEQEEAMVEAMENLQFLEEELRGKKFFGGERIGFVD  154

Query  508  LVVGWVAHNLPIFEEVASL  564
            L +GW+A+ + I E+VA L
Sbjct  155  LALGWLANLISILEDVAGL  173



>ref|XP_011010098.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=225

 Score =   140 bits (353),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 85/115 (74%), Gaps = 0/115 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +KV   W S F LRV WAL++KG+E++ I ED+ NK+PLL Q NP++ KVPVLVHNGK
Sbjct  3    EEVKVFRTWSSSFALRVIWALKLKGVEFDTIYEDLSNKSPLLLQYNPIYKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQR  398
             + ESL+ILEYIDETWK NPLLP DP+++A ARFWA F + K+L    G  + + 
Sbjct  63   VICESLVILEYIDETWKQNPLLPEDPHQQANARFWAKFGDDKVLQSIVGDVLMKE  117


 Score = 47.8 bits (112),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +1

Query  376  GEALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEV  555
            G+ L  +GK+ E  V +++E ++ LE E+ GK+FFGGE  G  ++ +GW+A+ L IFEE+
Sbjct  111  GDVLMKEGKELEEGVLASLENLKYLEEEIRGKKFFGGETIGLADIALGWLAYYLGIFEEI  170

Query  556  ASL  564
              L
Sbjct  171  LGL  173



>ref|XP_010238250.1| PREDICTED: glutathione transferase GST 23-like isoform X1 [Brachypodium 
distachyon]
Length=229

 Score =   138 bits (347),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 85/108 (79%), Gaps = 1/108 (1%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AE+G+KV G W SP  +R++WALR+K + YEY++ED+ NK+  L + NPV  KVPVLVH+
Sbjct  2    AEKGVKVFGMWASPMAIRLEWALRLKSVVYEYVDEDLGNKSDALLRYNPVTKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILD  368
            GKP+ ES +I+EYIDE WK   P++PADPYERA+ARFWA FA+ K L+
Sbjct  62   GKPVVESAIIVEYIDEAWKDGYPIMPADPYERAQARFWANFADEKDLN  109


 Score = 50.1 bits (118),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  385  LCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVA  558
              + G+ Q   V+ A + ++ LE  L GK+FFGG+  GYL+LVVGW A+ LPI EEV+
Sbjct  122  FTATGEAQGKVVHEAQQCLKTLEKALEGKKFFGGDAVGYLDLVVGWYAYWLPIIEEVS  179



>emb|CDX97884.1| BnaC04g40550D [Brassica napus]
Length=224

 Score =   144 bits (363),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++GFW SPF  RV+ AL++KG+ YEY+E+DIFNK+ LL +LNPV  KVPVLVH G
Sbjct  5    EEDVKLLGFWASPFSRRVEIALKLKGVTYEYLEQDIFNKSALLLELNPVFKKVPVLVHKG  64

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
            K L ES LILEYID+TWK+NP+LP DPYE+A ARFWA F + ++
Sbjct  65   KILAESHLILEYIDQTWKNNPILPQDPYEKAMARFWAKFVDEQV  108



>emb|CAN78656.1| hypothetical protein VITISV_006850 [Vitis vinifera]
Length=228

 Score =   144 bits (363),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W SPF LR  WAL++KG++YE I ED+ NK+PLL Q NPV  KVPVLVHNGK
Sbjct  3    EEVKLFRTWSSPFALRAVWALKIKGIDYETIFEDLSNKSPLLLQYNPVFKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            P+ ESL+ILEYIDETWKH PLLP DP+ERA ARFWA F E K+L
Sbjct  63   PIAESLVILEYIDETWKHAPLLPEDPHERATARFWAKFGEDKVL  106



>ref|NP_001104994.1| glutathione transferase GST 23 [Zea mays]
 sp|Q9FQA3.1|GST23_MAIZE RecName: Full=Glutathione transferase GST 23; AltName: Full=Glutathione 
transferase GST 36 [Zea mays]
 gb|AAG34844.1|AF244701_1 glutathione S-transferase GST 36 [Zea mays]
 gb|ACF85476.1| unknown [Zea mays]
 gb|ACG35906.1| glutathione S-transferase [Zea mays]
 tpg|DAA61852.1| TPA: glutathione S-transferase GST 23 [Zea mays]
Length=222

 Score =   144 bits (363),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AE+G+KV+G W SP V+RV+WALR+KG+EYEY++ED+ NK+  L + NPV  KVPVLVH+
Sbjct  2    AEKGVKVLGMWASPMVIRVEWALRLKGVEYEYVDEDLANKSADLLRHNPVTKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKI  362
            GKP+ ES +I+EYIDE WK   P++P DPYERA+ARFWA FAE K 
Sbjct  62   GKPVAESTIIVEYIDEVWKGGYPIMPGDPYERAQARFWARFAEDKC  107


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 44/75 (59%), Gaps = 9/75 (12%)
 Frame = +1

Query  358  RFWTPPGEALC---------SKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW    E  C         + G+ Q  AV+ A + ++ LE  L GK+FFGG+  GYL++
Sbjct  97   RFWARFAEDKCNAALYPIFTATGEAQRKAVHEAQQCLKTLETALEGKKFFGGDAVGYLDI  156

Query  511  VVGWVAHNLPIFEEV  555
            VVGW AH LP+ EEV
Sbjct  157  VVGWFAHWLPVIEEV  171



>gb|AFF18816.1| glutathione transferase, partial [Dimocarpus longan]
Length=224

 Score =   144 bits (363),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W S F LR+ WAL++KG+EY+ I ED+ NK+PLL Q NP++ KVPVL+HNGK
Sbjct  3    EKVKLFNTWSSRFGLRIVWALKLKGVEYDSINEDLSNKSPLLLQYNPIYKKVPVLLHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            P  ESL+ILEYIDETWKHNPLLP DPYE+A ARFWA F + K++
Sbjct  63   PTSESLVILEYIDETWKHNPLLPEDPYEKATARFWAKFGDDKVM  106


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 47/75 (63%), Gaps = 9/75 (12%)
 Frame = +1

Query  358  RFWTPPGE---------ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW   G+         A  ++GK+QE A+  A+E +  LE +L GK+FFGGEK G  +L
Sbjct  95   RFWAKFGDDKVMSSIWSAFTNEGKEQEDAIGQAIENLNFLEEQLKGKKFFGGEKIGLTDL  154

Query  511  VVGWVAHNLPIFEEV  555
             +GW+A+ + +FEE+
Sbjct  155  ALGWLANLVRVFEEI  169



>ref|XP_010469952.1| PREDICTED: glutathione S-transferase U4 isoform X1 [Camelina 
sativa]
Length=224

 Score =   144 bits (363),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++GFW SPF  RV+ AL++KG+ YEY+E+DI NK+PLL QLNPV+ KVPV +HNGK
Sbjct  6    EDVKLLGFWASPFTRRVEMALKLKGVPYEYLEQDIVNKSPLLLQLNPVYKKVPVFIHNGK  65

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
             +PES LILEYID+TWK NP+LP DPYE+A A FWA F + ++
Sbjct  66   HIPESHLILEYIDQTWKQNPILPQDPYEKAMALFWAKFVDEQV  108



>tpg|DAA61851.1| TPA: hypothetical protein ZEAMMB73_518022, partial [Zea mays]
Length=230

 Score =   144 bits (363),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            AE+G+KV+G W SP V+RV+WALR+KG+EYEY++ED+ NK+  L + NPV  KVPVLVH+
Sbjct  2    AEKGVKVLGMWASPMVIRVEWALRLKGVEYEYVDEDLANKSADLLRHNPVTKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKI  362
            GKP+ ES +I+EYIDE WK   P++P DPYERA+ARFWA FAE K 
Sbjct  62   GKPVAESTIIVEYIDEVWKGGYPIMPGDPYERAQARFWARFAEDKC  107


 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 44/75 (59%), Gaps = 9/75 (12%)
 Frame = +1

Query  358  RFWTPPGEALC---------SKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW    E  C         + G+ Q  AV+ A + ++ LE  L GK+FFGG+  GYL++
Sbjct  97   RFWARFAEDKCNAALYPIFTATGEAQRKAVHEAQQCLKTLETALEGKKFFGGDAVGYLDI  156

Query  511  VVGWVAHNLPIFEEV  555
            VVGW AH LP+ EEV
Sbjct  157  VVGWFAHWLPVIEEV  171



>ref|XP_002275657.2| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=218

 Score =   144 bits (362),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++G WVS F LRV+ AL++KG++YEYIE D+ NK+PLL + NPVH KVPVL+HNGK
Sbjct  3    EEVKLIGMWVSSFSLRVEIALKLKGVQYEYIEVDLTNKSPLLLKSNPVHKKVPVLLHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            P+ ESL+ILEYIDETWK NP+LP  PY+RA ARFWA + + K +
Sbjct  63   PIAESLVILEYIDETWKDNPILPQHPYDRAMARFWAKYIDEKCV  106



>gb|KDP42181.1| hypothetical protein JCGZ_02911 [Jatropha curcas]
Length=224

 Score =   144 bits (362),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
             E  +K++G W SPF  R+K AL++KG++YEYIE+D+ NK+ LL + NPVH K+PVL+HN
Sbjct  2    GEGEVKLLGTWASPFSHRIKLALKLKGIQYEYIEQDLTNKSTLLLKSNPVHKKIPVLLHN  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGST  386
            GKP+ ESL+ILEY+DE W++NP LP DPY +A ARFWA F + KIL  T  ++
Sbjct  62   GKPIAESLVILEYVDEKWQNNPFLPEDPYNKAMARFWATFVDQKILQVTLKAS  114



>gb|ADB11327.1| tau class glutathione transferase GSTU45 [Populus trichocarpa]
Length=220

 Score =   143 bits (361),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 90/118 (76%), Gaps = 1/118 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G W SPF  RV+ AL++KG+EYEYI+ED+ NK+PLL + NP+H KVPVL+HNGK +
Sbjct  4    VKLLGAWGSPFSRRVEMALKLKGVEYEYIDEDLANKSPLLLKYNPIHKKVPVLLHNGKTM  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETARK  413
             ESL+ILEYIDETWK NP+LP DPY++A ARFWA F + K + P     +  +E  R+
Sbjct  64   AESLVILEYIDETWKSNPILPEDPYDKAMARFWAKFIDEKCM-PAIWQIMLSKENERE  120



>gb|KHN06425.1| Putative glutathione S-transferase [Glycine soja]
Length=228

 Score =   144 bits (362),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++ FWVSPF  RV+WAL++KG+EYEYIEEDIFNK+ LL QLNPVH KVPVLVH  KP+
Sbjct  6    VKLLSFWVSPFGKRVEWALKLKGIEYEYIEEDIFNKSNLLLQLNPVHKKVPVLVHAHKPI  65

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
             ES +ILEYIDETWK  PLLP  P++RA ARFWA   E K+
Sbjct  66   AESFIILEYIDETWKQYPLLPCHPHQRALARFWATSVEQKL  106


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 52/78 (67%), Gaps = 9/78 (12%)
 Frame = +1

Query  358  RFWTPPGE---------ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW    E         A+ + G++QE AV  A+E MEK+E E+ GK+FFGG+  GYL++
Sbjct  96   RFWATSVEQKLGKAGWVAMSTSGEEQEKAVKEAIEMMEKIEEEIKGKKFFGGDNIGYLDI  155

Query  511  VVGWVAHNLPIFEEVASL  564
             +GW+A+ +P++EEV S+
Sbjct  156  ALGWIAYLVPVWEEVGSM  173



>gb|KJB28257.1| hypothetical protein B456_005G037700 [Gossypium raimondii]
Length=224

 Score =   143 bits (361),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 81/101 (80%), Gaps = 1/101 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDI-FNKTPLLSQLNPVHAKVPVLVHNGKP  236
            +K+ GFW SPF  RV WAL++KG+EYEYIEED+ +NK+ LL Q NPVH K+PVLVH GKP
Sbjct  4    VKLFGFWASPFSRRVIWALKLKGVEYEYIEEDLPYNKSDLLLQYNPVHKKIPVLVHGGKP  63

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFK  359
            + ESL+ILEYIDE W HNPLLP D YER+ ARFWA F E K
Sbjct  64   IAESLVILEYIDEVWPHNPLLPKDAYERSVARFWAKFIEEK  104



>ref|XP_006373901.1| hypothetical protein POPTR_0016s10120g [Populus trichocarpa]
 gb|ERP51698.1| hypothetical protein POPTR_0016s10120g [Populus trichocarpa]
Length=145

 Score =   141 bits (355),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G W SP   RV+ AL++K +EYEYIEED+ NK+PLL + NP+H KVPVL+HNGK +
Sbjct  4    VKLLGAWGSPLSRRVEMALKLKSVEYEYIEEDLANKSPLLLKYNPIHKKVPVLLHNGKTM  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETARK  413
             ESL+ILEYIDETWK NP+LP DPY++A ARFWA F + K + P     +  +E  R+
Sbjct  64   AESLVILEYIDETWKSNPILPEDPYDKAMARFWAKFIDEKCM-PAIWQIMLSKENERE  120



>ref|XP_011000057.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
 ref|XP_011000058.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=220

 Score =   143 bits (361),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 91/118 (77%), Gaps = 1/118 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G W SPF  RV+ AL++KG+EYEYIE+D+ NK+PLL + NP+H KVPVL+HNGK +
Sbjct  4    VKLLGAWGSPFSRRVEMALKLKGVEYEYIEQDLANKSPLLLKYNPIHKKVPVLLHNGKAM  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETARK  413
             ESL+ILEYIDETWK NP+LP DPY++A ARFWA F + K + P     ++ +E  R+
Sbjct  64   AESLVILEYIDETWKSNPILPEDPYDKAMARFWAKFIDEKCM-PAIWQIMWSKENERE  120



>gb|KJB76665.1| hypothetical protein B456_012G099100 [Gossypium raimondii]
Length=220

 Score =   138 bits (347),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++  W S F LRV WAL++KG+ YE I+ED+ NK+ LL Q NPVH K+PVLVHNG 
Sbjct  3    EEVKLLKTWSSRFGLRVVWALKLKGIPYEAIDEDLSNKSALLLQYNPVHKKIPVLVHNGN  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGS  383
            P+ ESL+ILEYIDETWK NP+LP DP  RAR RFWA F++ K+L    G+
Sbjct  63   PISESLVILEYIDETWKQNPILPQDPLHRARERFWAKFSDEKLLPSVWGA  112


 Score = 48.9 bits (115),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  382  ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVA  558
            A   +GK +E A+ + ME ++ +E EL GK+FF GEK G ++LV GW+A+ + IFEEV+
Sbjct  112  AFTKEGKDREEAMAATMENLKFVEEELKGKKFFSGEKIGLVDLVFGWLANLISIFEEVS  170



>ref|XP_004134389.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
 ref|XP_004172390.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
 gb|KGN56786.1| Glutathione S-transferase [Cucumis sativus]
Length=225

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 89/125 (71%), Gaps = 3/125 (2%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E LK+ G W SPF  RV WAL +KG+ Y+YIEED+ NK+PLL Q NPVH K+PVLVH GK
Sbjct  2    EELKLHGTWPSPFSYRVIWALALKGIPYQYIEEDLSNKSPLLLQYNPVHKKIPVLVHAGK  61

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFK---ILDPTRGSTVFQRET  404
            P+ ES++ILEYI++TW  NPLLP+DPYERA ARFW  F + K   +    R     +RE 
Sbjct  62   PISESMIILEYIEQTWPQNPLLPSDPYERATARFWIKFIDDKGTVVFKIFRAKNEEERED  121

Query  405  ARKCS  419
            A+K S
Sbjct  122  AKKQS  126



>ref|XP_002532525.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF29859.1| glutathione s-transferase, putative [Ricinus communis]
Length=224

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +KV+G + S F  RV+WAL++KG+EYEY++ED+ NK+P+L ++NPVH KVPVLVH  KP+
Sbjct  4    VKVIGSYTSLFCTRVEWALKIKGVEYEYLKEDLRNKSPILLKVNPVHKKVPVLVHEEKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
             ESL+ILEYIDETW  NPL P DPYERA ARFWA FA+ K L
Sbjct  64   AESLVILEYIDETWNKNPLFPQDPYERAMARFWAKFADDKCL  105


 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 46/78 (59%), Gaps = 9/78 (12%)
 Frame = +1

Query  358  RFWTPPGEALC---------SKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW    +  C          +G+++E A+ SAME+   LE ++ GK+FF GE+ GYL+L
Sbjct  94   RFWAKFADDKCLYGAFHACWKEGEEKEKAIESAMESFAMLEEQIKGKKFFNGEQIGYLDL  153

Query  511  VVGWVAHNLPIFEEVASL  564
             +GW+ + L + EEV  +
Sbjct  154  ALGWIPYWLNVMEEVGGM  171



>ref|XP_006294909.1| hypothetical protein CARUB_v10023960mg, partial [Capsella rubella]
 gb|EOA27807.1| hypothetical protein CARUB_v10023960mg, partial [Capsella rubella]
Length=239

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 92/118 (78%), Gaps = 1/118 (1%)
 Frame = +3

Query  12   KQDRNITVVIMAAE-EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQL  188
            +++R I    MA + E +K++GFW SPF  RV+ AL++KG+ Y+Y+E+DI NK+PLL QL
Sbjct  6    ERERVIERSAMAEKGEDVKLLGFWASPFTRRVEMALKLKGVPYDYLEQDIVNKSPLLLQL  65

Query  189  NPVHAKVPVLVHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
            NPV+ KVPVLVH GK +PES LILEYID+TWK NP+LP DPYE+A A FWA F + ++
Sbjct  66   NPVYKKVPVLVHKGKHIPESHLILEYIDQTWKQNPILPQDPYEKAMALFWAKFVDEQV  123



>gb|KFK44230.1| hypothetical protein AALP_AA1G231500 [Arabis alpina]
Length=439

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++GFW SPF  RVK AL++KG+ YEY+EED+ NK+PLL QLNP+H KVPVL+HNG
Sbjct  6    EERVKLLGFWASPFTCRVKMALKLKGVPYEYLEEDLVNKSPLLLQLNPLHKKVPVLIHNG  65

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
            KP+ ES+LILEYID TW +NP+LP DPYE+ARA F A F + ++
Sbjct  66   KPILESILILEYIDRTWTNNPILPQDPYEKARALFLAKFVDEQV  109


 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++GFW SPF  RV+ AL++KG+ YEY+EED+ NKTPLL +LNPVH KVPVLVHNG
Sbjct  220  EEVVKLLGFWASPFSRRVEMALKLKGVPYEYLEEDLPNKTPLLLELNPVHKKVPVLVHNG  279

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
              L ES LILEYID+TW +NP+LP DPY++A ARFWA F + +IL
Sbjct  280  NILLESHLILEYIDQTWSNNPILPQDPYDKAIARFWAKFVDEQIL  324



>ref|XP_009370935.1| PREDICTED: glutathione transferase GST 23-like [Pyrus x bretschneideri]
 ref|XP_009370948.1| PREDICTED: glutathione transferase GST 23-like [Pyrus x bretschneideri]
Length=223

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 84/102 (82%), Gaps = 1/102 (1%)
 Frame = +3

Query  57   GLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDI-FNKTPLLSQLNPVHAKVPVLVHNGK  233
            G+K++G W SP+V RV WAL++KG+EYEY+EED+ FNK+  L + NPVH KVPVLVH+GK
Sbjct  3    GVKLLGAWASPYVYRVIWALKLKGVEYEYVEEDVLFNKSDELLKYNPVHKKVPVLVHDGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFK  359
            P+ ES++ILEYI+E W HNPLLP DP++RA ARFWA F E K
Sbjct  63   PIAESIIILEYIEEVWPHNPLLPKDPHQRAEARFWAKFGEDK  104



>gb|AJE59670.1| tau class glutathione S-transferase [Glycine max]
Length=228

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M +EE +K++ F+ SPF  RV+WAL++KG+EYEYIE+DIF K+ LL +LNPVH KVPVLV
Sbjct  1    MGSEE-VKLLSFFASPFGKRVEWALKLKGVEYEYIEQDIFKKSNLLLELNPVHKKVPVLV  59

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILD  368
            H  KP+ ES +I+EY+DETWK  PLLP DPY+RA ARFWA  AE K++D
Sbjct  60   HAQKPIAESFVIVEYVDETWKQCPLLPQDPYQRALARFWAYSAEQKLID  108


 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 50/78 (64%), Gaps = 9/78 (12%)
 Frame = +1

Query  358  RFWTPPGE---------ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW    E         A+C+ G  Q++AV    E MEK+E E+ GK+FFGG+  GYL++
Sbjct  96   RFWAYSAEQKLIDAAWIAMCTSGDDQQNAVKVGRELMEKIEEEIKGKKFFGGDNIGYLDI  155

Query  511  VVGWVAHNLPIFEEVASL  564
             +GW+++ +P++EEV S+
Sbjct  156  ALGWISYWIPVWEEVGSM  173



>ref|XP_010414384.1| PREDICTED: glutathione S-transferase U4-like [Camelina sativa]
Length=223

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA    +K++GFW SPF  RV+ AL++KG+ YEY+E+DI NK+PLL QLNPV+ KVPV +
Sbjct  1    MADIGDVKLLGFWASPFSRRVEMALKLKGMPYEYLEQDIVNKSPLLLQLNPVYKKVPVFI  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
            HNGK +PES LILEYID+TWK NP+LP DPYE+A A FWA F + ++
Sbjct  61   HNGKHIPESHLILEYIDKTWKQNPILPQDPYEKAMALFWAKFVDEQV  107



>ref|XP_010510490.1| PREDICTED: glutathione S-transferase U4-like [Camelina sativa]
Length=224

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++GFW SPF  RV+ AL++KG+ YEY+E+DI NK+PLL QLNPV+ KVPV +HNGK
Sbjct  6    EDVKLLGFWASPFSRRVEMALKLKGMPYEYLEQDIVNKSPLLLQLNPVYKKVPVFIHNGK  65

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
             +PES LILEYID+TWK NP+LP DPYE++ A FWA F + ++
Sbjct  66   HIPESHLILEYIDQTWKQNPILPQDPYEKSMALFWAKFVDEQV  108



>ref|XP_008438426.1| PREDICTED: probable glutathione S-transferase isoform X1 [Cucumis 
melo]
Length=225

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 88/124 (71%), Gaps = 4/124 (3%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+ G W SPF  RV WAL +KG+ YEYIEED+ NK+PLL Q NPVH K+PVLVH GKP+
Sbjct  4    VKLHGTWPSPFSYRVIWALALKGISYEYIEEDLSNKSPLLLQYNPVHKKIPVLVHAGKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQ----RETA  407
             ES++IL+YIDETW  NPLLP+DP +RA ARFW  F E K L     S + +    +E A
Sbjct  64   SESMIILQYIDETWPENPLLPSDPLQRAAARFWIKFIEDKSLVILGVSDILEGEEYKEKA  123

Query  408  RKCS  419
            RK S
Sbjct  124  RKAS  127



>gb|KDO66687.1| hypothetical protein CISIN_1g041211mg [Citrus sinensis]
Length=222

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+ G WVSPF  R++ AL++KG+ +EY+EED+ NK+P L + NPVH K+PVLVHNGK
Sbjct  3    EEVKLYGTWVSPFSRRIELALKLKGVPFEYMEEDLSNKSPELLKYNPVHKKIPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            P+ ESL+ILEYIDETWK+NP+LP DPY+RA  RFWA F + KIL
Sbjct  63   PIAESLVILEYIDETWKNNPILPQDPYQRAMVRFWAKFIDEKIL  106



>ref|XP_010271919.1| PREDICTED: glutathione transferase GST 23-like [Nelumbo nucifera]
Length=223

 Score =   142 bits (357),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 82/111 (74%), Gaps = 0/111 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A + + ++G W SP  LR++WAL++KG+ YEYI+ED+ NK+  L   NPVH KVPVLVH 
Sbjct  2    ATDQVTLLGMWASPLSLRIEWALKIKGIHYEYIDEDLDNKSQRLLTCNPVHKKVPVLVHA  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRG  380
            GKP+ ESL+ILEYIDETW H+ +LP DPYERA ARFWA FA+ K      G
Sbjct  62   GKPIAESLVILEYIDETWSHSRILPEDPYERAMARFWAKFADDKCWTTIHG  112


 Score = 44.3 bits (103),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +1

Query  364  WTPPGEALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPI  543
            WT         G++QE+A + A+E+++ LE      +FFGG+  G+L++V GW+A+ +P+
Sbjct  107  WTTIHGVFTKTGQEQENAKSEAIESLKTLEKIPRESKFFGGDAIGFLDIVFGWMAYWVPL  166

Query  544  FEEVASL  564
             EE+  +
Sbjct  167  LEEITGI  173



>ref|XP_009606319.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=219

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 89/112 (79%), Gaps = 2/112 (2%)
 Frame = +3

Query  57   GLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKP  236
            G+K++G W SPF  RV+WAL++KG+EYE+I+ED+ NK+PLL Q NPVH K+PVL+HNGKP
Sbjct  3    GVKLLGLWYSPFSHRVEWALKIKGVEYEFIKEDLQNKSPLLLQSNPVHKKIPVLIHNGKP  62

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVF  392
            + ES++ILEYIDET++   +LP DPY+RA ARFWA F E K+  P  G T F
Sbjct  63   ISESMVILEYIDETFEGPSILPKDPYDRAIARFWAKFLEDKV--PPVGKTFF  112



>ref|XP_009625219.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=222

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G  +SPF  RV+WAL++KG+EYE+IEED+ NK+PLL Q NPVH K+PVL+HNGKP+
Sbjct  4    VKLLGVSLSPFSCRVEWALKIKGVEYEFIEEDLQNKSPLLLQSNPVHQKIPVLIHNGKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETARK  413
             ES++I+EYIDET++   +LP DPYERA ARFWA F + K L  T  +   + E + K
Sbjct  64   SESMVIVEYIDETFEGPSILPKDPYERAMARFWANFLDVKCLTTTGKAYFGKGEESDK  121



>ref|XP_008453455.1| PREDICTED: probable glutathione S-transferase [Cucumis melo]
Length=224

 Score =   133 bits (334),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G   S F +RV+WAL++KG+EYEYI ED+ NK+ LL + NPV+ K+PVL+HN K +
Sbjct  4    VKIIGSAASLFSVRVEWALKLKGIEYEYIVEDLRNKSELLLKSNPVYKKIPVLLHNDKAI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
             ESLLI+EYIDETWK NP+LP DPY+RA ARFWA F + K L
Sbjct  64   SESLLIIEYIDETWKENPILPEDPYDRANARFWAKFLDEKGL  105


 Score = 53.1 bits (126),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +1

Query  379  EALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVA  558
            EA  ++G+++E AV +A++ +  L+ E+ GK+FFGGEK GYL+L  GW+ H L + +EV 
Sbjct  110  EACQAEGEEKEKAVEAAVQHLALLDKEIQGKKFFGGEKIGYLDLAAGWICHWLSVLDEVG  169

Query  559  SL  564
             +
Sbjct  170  EM  171



>gb|KCW65100.1| hypothetical protein EUGRSUZ_G02605 [Eucalyptus grandis]
Length=257

 Score =   137 bits (344),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W SPF LRV WAL++KG++YE + ED+ NK+ LL Q NPV+ KVPVL+HNG+
Sbjct  3    EEVKLFKTWSSPFPLRVAWALQLKGIQYESVLEDLSNKSNLLLQYNPVYKKVPVLLHNGR  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            P+ ESL+ILEY+DETWK  PLLP DPY RA ARFWA F + K++
Sbjct  63   PISESLIILEYVDETWKQYPLLPQDPYARAMARFWAKFGDDKVI  106


 Score = 49.3 bits (116),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  385  LCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVASL  564
            +  +GK+QE+ +  A E ++KLE EL GK+FF G+  GYL++ +GW+A+ + +FEEV+SL
Sbjct  146  VTDEGKEQEAVLAEASEHLQKLEEELRGKKFFRGDNIGYLDIALGWLANLVRVFEEVSSL  205



>ref|XP_006410006.1| hypothetical protein EUTSA_v10017660mg [Eutrema salsugineum]
 gb|ESQ51459.1| hypothetical protein EUTSA_v10017660mg [Eutrema salsugineum]
Length=223

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 90/110 (82%), Gaps = 2/110 (2%)
 Frame = +3

Query  42   MAAEEGL-KVVGFWVSPFVLRVKWALRMKGLEYEYIEEDI-FNKTPLLSQLNPVHAKVPV  215
            MA  EG+ K++GFW SPF  RV+ AL++KG+ YEY+EED+  NK+PLL +LNPVH KVPV
Sbjct  1    MAENEGVVKLLGFWASPFSRRVEMALKLKGVPYEYLEEDLPNNKSPLLLELNPVHKKVPV  60

Query  216  LVHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            LVHNGK LPES LILEYID+TW+ NP+LP DPY+++ ARFWA F + +++
Sbjct  61   LVHNGKILPESHLILEYIDKTWQSNPILPQDPYQKSMARFWAKFVDEQVI  110



>ref|XP_008438211.1| PREDICTED: probable glutathione S-transferase [Cucumis melo]
Length=222

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE LK+   W SPF LR+ WAL++KG+EY+ + ED+ NK+PLL + NP++ KVPVLVH G
Sbjct  2    EEELKLFRTWSSPFPLRIVWALKLKGIEYDTVYEDLANKSPLLLEYNPIYKKVPVLVHGG  61

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTR  377
            KP+ ESL+ILEYI+ETWK NPLLP DPY+RA ARFWA F + K+L+  +
Sbjct  62   KPIAESLVILEYIEETWKQNPLLPQDPYQRAVARFWAKFGDDKVLESIK  110



>ref|XP_008346194.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
Length=222

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 84/119 (71%), Gaps = 0/119 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +KV+GFW SP+V RV WAL +KG++YEY+EEDIFNKT LL + NPVH KVPV VH GK
Sbjct  2    EEVKVIGFWTSPYVYRVIWALNLKGIKYEYLEEDIFNKTDLLLRHNPVHKKVPVFVHGGK  61

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETAR  410
             + ES++ILEYIDETW  N LLP DP+ RA ARFW  F + K  +  R       E AR
Sbjct  62   TIAESMIILEYIDETWPQNALLPNDPHARAVARFWTKFGDDKKQNFIRFYKSVGEELAR  120



>ref|XP_010693951.1| PREDICTED: glutathione S-transferase U7-like [Beta vulgaris subsp. 
vulgaris]
Length=221

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = +3

Query  57   GLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKP  236
            G+K+ G W SPF +RV+ AL++KG+EYE++EED+ +K+  L++ NP+H KVPVL+H+GK 
Sbjct  2    GVKIYGTWASPFSMRVEIALQIKGIEYEFVEEDLLHKSDELAKYNPIHKKVPVLIHDGKV  61

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETARKC  416
            + ESL+ILEYIDETWK NP+LP D Y++A+ARFWA F + K+    R + + + E + K 
Sbjct  62   MVESLVILEYIDETWKANPILPTDAYQKAQARFWAKFVDDKVTPLVRSALMSEGEESEKA  121



>gb|ADB11328.1| tau class glutathione transferase GSTU46 [Populus trichocarpa]
Length=223

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   GLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKP  236
             +K++G + S F  RV+WAL++KG++YEY+E+D+FNK+PLL + NPVH KVPVLVH+ KP
Sbjct  4    AVKLIGSYTSLFCTRVEWALKLKGVQYEYVEDDVFNKSPLLLKHNPVHKKVPVLVHDDKP  63

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPT  374
            +PESL+IL+YIDETW  N LLP D YERA A FWA F E K L  T
Sbjct  64   IPESLVILQYIDETWNDNNLLPQDSYERAMAHFWAKFTEEKCLMET  109



>gb|ACU20730.1| unknown [Glycine max]
Length=139

 Score =   140 bits (353),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 87/109 (80%), Gaps = 1/109 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M +EE +K++ F+ SPF  RV+WAL+++G+EYEYIE+DIF K+ LL +LNPVH KVPV V
Sbjct  1    MGSEE-VKLLSFFASPFGKRVEWALKLEGVEYEYIEQDIFKKSNLLLELNPVHKKVPVPV  59

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILD  368
            H  KP+ ES +I+EY+DETWK  PLLP DPY+RA ARFWA  AE K++D
Sbjct  60   HAQKPIAESFVIVEYVDETWKQCPLLPQDPYQRALARFWAYSAEQKLID  108



>ref|XP_008240197.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=225

 Score =   135 bits (341),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            EG+K++    S F  R++WAL++KG+EYEYIEED+ NK+P+L + NPVH KVPV VH+ +
Sbjct  2    EGVKLIATTQSLFCTRIEWALKLKGVEYEYIEEDLRNKSPILLKYNPVHKKVPVFVHDDR  61

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
             + ESL+ILEYIDETWK +PLLP D Y+RA ARFWA FA+ K++
Sbjct  62   AIAESLVILEYIDETWKEHPLLPQDSYDRAIARFWAKFADEKVV  105


 Score = 50.1 bits (118),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  388  CSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVASL  564
             ++G+++E+A+ SA+E++  LE ++ GK+FFGGE+ GYL+L +GW+ H L   EE   +
Sbjct  114  AAEGEEKETAIESALESLAYLEKQIEGKKFFGGEEIGYLDLALGWIPHWLNTMEEAGGM  172



>emb|CBI16040.3| unnamed protein product [Vitis vinifera]
Length=353

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +3

Query  27   ITVVIMAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAK  206
            I++      E +K+ G W SPF  R++ AL++KG+++EYIEE++ NK+P L + NPVH K
Sbjct  125  ISLQTATMAEEVKLFGTWASPFSRRIEVALKLKGVQFEYIEENLSNKSPALLKYNPVHKK  184

Query  207  VPVLVHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
            +PVLVHNGKP+ ESL+ILEYIDETWKHNP+LP DPYE+A ARFWA + + K+
Sbjct  185  IPVLVHNGKPVAESLVILEYIDETWKHNPILPTDPYEKAMARFWAKYMDDKL  236



>ref|XP_002523997.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF38365.1| glutathione s-transferase, putative [Ricinus communis]
Length=216

 Score =   132 bits (333),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +3

Query  84   SPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPLPESLLILE  263
            SPF LRV WAL++KG+ YE IEED+ NK+PLL Q NP++ KVPVLVH+GKP+ ESL+ILE
Sbjct  13   SPFGLRVVWALKLKGIRYESIEEDLSNKSPLLLQYNPIYKKVPVLVHDGKPVVESLIILE  72

Query  264  YIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            YI+ETW+ +PLLPA PY+RA A FWA F + K+L
Sbjct  73   YIEETWQQSPLLPAHPYQRAMAHFWAKFGDDKVL  106


 Score = 53.5 bits (127),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +1

Query  382  ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVAS  561
                KGK+QE A+  A+E ++ LE EL GK+FFGGEK G+++L  GW+A+ L + EEV  
Sbjct  112  VFIKKGKEQEDAIPEALENLKILEEELRGKKFFGGEKIGFVDLAFGWLANTLSVLEEVVG  171

Query  562  L  564
            L
Sbjct  172  L  172



>ref|XP_007145574.1| hypothetical protein PHAVU_007G250000g [Phaseolus vulgaris]
 gb|ESW17568.1| hypothetical protein PHAVU_007G250000g [Phaseolus vulgaris]
Length=225

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +3

Query  99   RVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPLPESLLILEYIDET  278
            RV+WALR+KG+EYEY++E++ NK+PLL Q NPVH KVPV +HN  PLPESL+ILEYIDET
Sbjct  18   RVEWALRIKGVEYEYLQENLANKSPLLLQSNPVHKKVPVFLHNHNPLPESLVILEYIDET  77

Query  279  WKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETARKC  416
            WK NPLLP DPY+RA+ARFWA F + K+L    G+TV + E   K 
Sbjct  78   WKDNPLLPLDPYQRAQARFWARFIDEKVLYGVWGATVAEGEEKGKA  123



>ref|NP_180503.1| glutathione S-transferase tau 7 [Arabidopsis thaliana]
 sp|Q9ZW24.1|GSTU7_ARATH RecName: Full=Glutathione S-transferase U7; Short=AtGSTU7; AltName: 
Full=GST class-tau member 7; AltName: Full=Glutathione 
S-transferase 25 [Arabidopsis thaliana]
 gb|AAG30137.1|AF288188_1 glutathione S-transferase [Arabidopsis thaliana]
 gb|AAC95196.1| putative glutathione S-transferase [Arabidopsis thaliana]
 gb|AAK74037.1| At2g29420/F16P2.20 [Arabidopsis thaliana]
 gb|AAL06974.1| At2g29420/F16P2.20 [Arabidopsis thaliana]
 gb|AAM64426.1| putative glutathione S-transferase [Arabidopsis thaliana]
 gb|AEC08252.1| glutathione S-transferase tau 7 [Arabidopsis thaliana]
Length=227

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +3

Query  45   AAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVH  224
            +  E +K++G W SPF  R++ AL +KG+ YE++E+DI NK+ LL QLNPVH  +PVLVH
Sbjct  5    SNSEEVKLLGMWASPFSRRIEIALTLKGVSYEFLEQDITNKSSLLLQLNPVHKMIPVLVH  64

Query  225  NGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
            NGKP+ ESL+ILEYIDETW+ NP+LP DPYER  ARFW+ F + +I
Sbjct  65   NGKPISESLVILEYIDETWRDNPILPQDPYERTMARFWSKFVDEQI  110



>gb|AFK35732.1| unknown [Lotus japonicus]
Length=222

 Score =   134 bits (338),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M ++E ++++ F +SP   RV+WAL++KG+++EY+EEDIFNK+ LL ++NPVH KVPVLV
Sbjct  1    MGSQE-VQLLNFLLSPVGRRVEWALKLKGVDFEYVEEDIFNKSNLLLEMNPVHKKVPVLV  59

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
            H  KP+ ESL+ILEYIDE WK  PLLP  PYERA ARFWA  A+ K+
Sbjct  60   HGHKPIAESLIILEYIDEIWKQYPLLPLHPYERAHARFWANLADEKL  106


 Score = 51.2 bits (121),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  385  LCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVASL  564
            + S G +QE  V    E MEKLE E+ GK+FFGG+  GYL+LV+GW+   LP++EEV S+
Sbjct  115  MRSSGDEQEKRVKEVREVMEKLEEEILGKKFFGGDNIGYLDLVLGWIPCWLPVWEEVGSM  174



>gb|KFK44227.1| hypothetical protein AALP_AA1G231100 [Arabis alpina]
Length=224

 Score =   142 bits (358),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA +E +K++G W SPF  R++ AL++KG+ Y+Y+EE + NK+PLL  LNP+H KVPVLV
Sbjct  1    MAEKEEVKLLGIWASPFSRRIEMALKLKGIAYDYVEESLDNKSPLLLALNPIHKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRE  401
            HNGK + ES ++LEYIDETWKHNP+LP DPY+R++ARF+A   + +I +    S     +
Sbjct  61   HNGKAILESHVVLEYIDETWKHNPILPQDPYDRSKARFFAKLVDEQIFNAGFVSMTKAEQ  120

Query  402  TARK  413
              R+
Sbjct  121  QGRE  124



>gb|KHN48021.1| Putative glutathione S-transferase [Glycine soja]
Length=285

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M +EE +K++ F+ SPF  RV+WAL++KG+EYEYIE+DIF K+ LL +LNPVH KVPVLV
Sbjct  1    MGSEE-VKLLSFFASPFGKRVEWALKLKGVEYEYIEQDIFKKSNLLLELNPVHKKVPVLV  59

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILD  368
            H  KP+ ES +I+EY+DETWK  PLLP DPY+RA ARFWA  AE K++D
Sbjct  60   HAQKPIAESFVIVEYVDETWKQCPLLPQDPYQRALARFWAYSAEQKLID  108


 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 50/78 (64%), Gaps = 9/78 (12%)
 Frame = +1

Query  358  RFWTPPGE---------ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW    E         A+C+ G  Q++AV    E MEK+E E+ GK+FFGG+  GYL++
Sbjct  96   RFWAYSAEQKLIDAAWIAMCTSGDDQQNAVKVGRELMEKIEEEIKGKKFFGGDNIGYLDI  155

Query  511  VVGWVAHNLPIFEEVASL  564
             +GW+++ +P++EEV S+
Sbjct  156  ALGWISYWIPVWEEVGSM  173



>emb|CDX97882.1| BnaC04g40570D [Brassica napus]
Length=224

 Score =   142 bits (358),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 92/126 (73%), Gaps = 8/126 (6%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++GFW+SPF  RV+ AL++KG+ YEY+EE++  K+PLL +LNPVH KVPVLVHN 
Sbjct  5    EERVKLLGFWISPFSRRVEMALKLKGVPYEYLEEELPKKSPLLLELNPVHKKVPVLVHND  64

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL--------DPTRGST  386
            K L ES +ILEYID+TW +NP+LP DPYERA ARFWA F + +IL         P +G  
Sbjct  65   KILSESHVILEYIDQTWSNNPILPQDPYERATARFWAKFVDEQILPAGFMPLVKPEKGIE  124

Query  387  VFQRET  404
            V   ET
Sbjct  125  VAIEET  130



>ref|XP_009141004.1| PREDICTED: glutathione S-transferase U4 [Brassica rapa]
Length=224

 Score =   142 bits (358),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++GFW SPF  RV+ AL+ KG+ YEY+E+DIFNK+ LL +LNPV   VPVLVH G
Sbjct  5    EEDVKLLGFWASPFSRRVEIALKFKGVSYEYLEQDIFNKSALLLELNPVFKMVPVLVHKG  64

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
            K L ESLLILEYID+TWK+NP+LP DPYE+A AR WA F + ++
Sbjct  65   KILAESLLILEYIDQTWKNNPILPQDPYEKAMARLWAKFVDEQV  108



>ref|XP_010661155.1| PREDICTED: probable glutathione S-transferase isoform X2 [Vitis 
vinifera]
Length=225

 Score =   142 bits (358),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W +PF LR+ WAL++KG+EYE I ED++NK+P L Q NP H KVPVLVHNGK
Sbjct  3    EEVKLFRTWSTPFALRIVWALKIKGVEYETIFEDLYNKSPSLLQYNPAHKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            P+ ES +ILEYIDETWK  PLLP DPYERA ARFWA F + K+ 
Sbjct  63   PISESYVILEYIDETWKETPLLPEDPYERAMARFWAKFGDDKVF  106


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 49/79 (62%), Gaps = 10/79 (13%)
 Frame = +1

Query  358  RFWTPPGE----------ALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLN  507
            RFW   G+              +GK+QE A+  AME ++ LE EL GK+FFGGE+ G+++
Sbjct  95   RFWAKFGDDKVFTSIFWGVFVKEGKEQEEAMVEAMENLQFLEEELRGKKFFGGERIGFVD  154

Query  508  LVVGWVAHNLPIFEEVASL  564
            L +GW+A+ + I E+VA L
Sbjct  155  LALGWLANLISILEDVAGL  173



>ref|XP_010243637.1| PREDICTED: probable glutathione S-transferase [Nelumbo nucifera]
Length=220

 Score =   142 bits (358),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+ G W SPFV RV WAL++KG+EYEYIEED+ NK+ LL + NPVH KVPVLVHNGKP+
Sbjct  4    VKLFGNWSSPFVYRVIWALKLKGVEYEYIEEDLSNKSELLLKYNPVHKKVPVLVHNGKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTR--GSTVFQRETARK  413
             ESL+ILEYIDETW  +PLLP D   RA ARFWA FAE K +   R   S   ++E A+K
Sbjct  64   AESLVILEYIDETWPEHPLLPKDAQLRAEARFWAKFAEDKGICIWRFFSSVGEEQEKAKK  123

Query  414  CS  419
             S
Sbjct  124  ES  125



>ref|XP_007026863.1| Tau class glutathione transferase GSTU45 [Theobroma cacao]
 gb|EOY07365.1| Tau class glutathione transferase GSTU45 [Theobroma cacao]
Length=228

 Score =   142 bits (358),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 92/121 (76%), Gaps = 2/121 (2%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIF-NKTPLLSQLNPVHAKVPVLVHNG  230
            E +KV G W SPF  RV+ AL++KG++YEYIEED+  NK+PLL + NPVH K+PVL+HNG
Sbjct  3    EEVKVFGAWGSPFSRRVELALQLKGVQYEYIEEDVLKNKSPLLLKYNPVHKKIPVLLHNG  62

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETAR  410
            KP+ ESL+ILEYI+ETWK NP+LP DPY++A ARFWA F + K L P      + +E+ R
Sbjct  63   KPIAESLVILEYIEETWKGNPILPEDPYDKAMARFWANFVDEKCL-PVLRKAGWSQESER  121

Query  411  K  413
            +
Sbjct  122  E  122



>ref|XP_002281843.2| PREDICTED: glutathione S-transferase U7 [Vitis vinifera]
Length=230

 Score =   142 bits (358),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +3

Query  27   ITVVIMAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAK  206
            I++      E +K+ G W S F  R++ AL++KG+++EYIEE++ NK+P L + NP+H K
Sbjct  4    ISLQTETMAEEVKLFGTWASVFSRRIEVALKLKGVQFEYIEENLSNKSPALLKYNPLHKK  63

Query  207  VPVLVHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            +PVLVHNGKP+ ESL+ILEYIDETWKHNP+LP DPYE+A ARFWA + + K+L
Sbjct  64   IPVLVHNGKPVAESLVILEYIDETWKHNPILPTDPYEKAMARFWAKYMDDKLL  116



>emb|CDP21862.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   142 bits (358),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W S + LR+ WAL++KG+EYE I ED+ NK+P L Q NP+H KVPVLVH+GK
Sbjct  3    EEVKLFRTWSSGYALRIVWALKLKGIEYETIFEDLTNKSPSLLQYNPIHGKVPVLVHDGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            P+ ESL+ILEY+DETWKHNPLLP DPYE++ ARFWA F + K++
Sbjct  63   PVCESLVILEYVDETWKHNPLLPQDPYEKSMARFWANFGDDKLM  106



>ref|XP_006373657.1| hypothetical protein POPTR_0016s02350g [Populus trichocarpa]
 gb|ERP51454.1| hypothetical protein POPTR_0016s02350g [Populus trichocarpa]
Length=225

 Score =   142 bits (358),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +KV   W SPF LRV WAL++KG+E++ I ED+ NK+PLL Q NP+H KVPVLVHNGK
Sbjct  3    EEVKVFRTWSSPFALRVIWALKLKGVEFDTIYEDLSNKSPLLLQYNPIHKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
             + ESL+ILEYIDETWK NPLLP DP+++A ARFWA F + K+L
Sbjct  63   VICESLVILEYIDETWKQNPLLPEDPHQQANARFWAKFGDDKVL  106



>emb|CAN62219.1| hypothetical protein VITISV_042912 [Vitis vinifera]
Length=221

 Score =   142 bits (357),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +++ G W S F  RV+ ALR+KG+++EY+EED++NK+P L + NPVH K+PVL+HNG PL
Sbjct  5    VQLFGVWGSFFGRRVEVALRLKGVQFEYVEEDLYNKSPSLLKYNPVHKKIPVLLHNGNPL  64

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
             ESL+ILEYIDETWKHNP+ P DPYERARARFWA F + K+
Sbjct  65   AESLVILEYIDETWKHNPIFPKDPYERARARFWAKFIDEKL  105



>emb|CDY53373.1| BnaC04g54530D [Brassica napus]
Length=224

 Score =   142 bits (358),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 87/109 (80%), Gaps = 1/109 (1%)
 Frame = +3

Query  42   MAAEEG-LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVL  218
            MA  EG +K++G W SPF  RV+ AL++KG+ YEY+EE + NK+PLL +LNP+H KVPVL
Sbjct  1    MAENEGKVKLLGCWASPFSRRVEMALKLKGIPYEYLEEALPNKSPLLLELNPIHKKVPVL  60

Query  219  VHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            VHN K LPES LILEYID+TW +NP+LP DPYE+A ARFWA F + +IL
Sbjct  61   VHNDKILPESHLILEYIDQTWSNNPILPQDPYEKAMARFWAKFIDEQIL  109



>ref|XP_007016280.1| Glutathione S-transferase tau 7, putative [Theobroma cacao]
 gb|EOY33899.1| Glutathione S-transferase tau 7, putative [Theobroma cacao]
Length=221

 Score =   142 bits (357),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+ G W SPF  RV+ AL++KG+ YEYIEED+ NK+P L + NP+H KVP+LVH  K
Sbjct  3    EEVKLFGMWASPFSRRVELALKLKGIPYEYIEEDLSNKSPSLLKYNPIHKKVPLLVHKEK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            PL ESL+ILEY+DETWK+NP+LP DPYERA ARFWA F + K+L
Sbjct  63   PLAESLVILEYLDETWKNNPILPQDPYERAMARFWAKFIDEKLL  106



>ref|XP_002520477.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF41890.1| glutathione s-transferase, putative [Ricinus communis]
Length=223

 Score =   142 bits (357),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 85/119 (71%), Gaps = 3/119 (3%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++G W SPF  RV+ ALR+KG++YEY EED+ NK  LL + NPVH K+PVLVHNGK
Sbjct  3    EEVKLMGMWASPFSRRVEMALRLKGIQYEYTEEDLRNKGELLLKYNPVHKKIPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDP---TRGSTVFQRE  401
             + ESL+ILEYIDETW+ NP +P DPY RA  RFW  F E KIL     TR +   +RE
Sbjct  63   TVAESLVILEYIDETWQDNPNMPKDPYNRAMTRFWVNFVEEKILQAAYKTRTAEGEERE  121



>ref|XP_007208953.1| hypothetical protein PRUPE_ppb016836mg [Prunus persica]
 gb|EMJ10152.1| hypothetical protein PRUPE_ppb016836mg [Prunus persica]
Length=232

 Score =   142 bits (358),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 90/128 (70%), Gaps = 1/128 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M  E+ L + G W+SP+  RV+ AL+ KG+ +E++EED+ NK+PLL + NPVH KVPVLV
Sbjct  1    MEEEKKLTLHGLWISPYSKRVELALKTKGIPFEFVEEDLMNKSPLLLKYNPVHKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNP-LLPADPYERARARFWAGFAEFKILDPTRGSTVFQR  398
            HNGKP+ ESL+ILEYIDETWK  P LLP DPY+RAR RFWA F + ++ +  + +     
Sbjct  61   HNGKPIVESLIILEYIDETWKTGPRLLPEDPYKRARVRFWASFVDQQVFESLKLAFTSDG  120

Query  399  ETARKCSK  422
            E   K  K
Sbjct  121  EVQEKAIK  128



>gb|AFK34634.1| unknown [Lotus japonicus]
Length=222

 Score =   134 bits (336),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M ++E ++++ F +SP   RV+WAL++KG+++EY+EEDIFNK+ LL ++NPVH KVPVLV
Sbjct  1    MGSQE-VQLLNFLLSPVGRRVEWALKLKGVDFEYVEEDIFNKSNLLLEMNPVHKKVPVLV  59

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
            H  KP+ ESL+ILEYIDE WK  PLLP  PYERA ARFWA  A+ K+
Sbjct  60   HGHKPIVESLIILEYIDEIWKQYPLLPLHPYERAHARFWANLADEKL  106


 Score = 51.2 bits (121),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  385  LCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVASL  564
            + S G +QE  V    E MEKLE E+ GK+FFGG+  GYL+LV+GW+   LP++EEV S+
Sbjct  115  MRSSGDEQEKRVKEVREVMEKLEEEILGKKFFGGDNIGYLDLVLGWIPCWLPVWEEVGSM  174



>ref|XP_010921338.1| PREDICTED: glutathione transferase GST 23-like [Elaeis guineensis]
Length=231

 Score =   142 bits (358),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 91/130 (70%), Gaps = 2/130 (2%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            M +   +K+ G W SP V RV+WAL++KG+EYEYIEED+ NK+  L + NP++ +VPVL+
Sbjct  1    MVSGGEVKLFGMWASPAVRRVEWALKIKGIEYEYIEEDLSNKSTSLLEYNPINKQVPVLL  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRE  401
            H GKP+ ESL+++EYIDE WKHNP+LP DPYER +ARFWA + E +  D      V+  E
Sbjct  61   HKGKPIVESLVMIEYIDEVWKHNPILPEDPYERTKARFWATYGEGECRDAV--GKVYFTE  118

Query  402  TARKCSKLSH  431
               K + + H
Sbjct  119  GEEKENAIKH  128


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (62%), Gaps = 9/78 (12%)
 Frame = +1

Query  358  RFWTPPGEALC---------SKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW   GE  C         ++G+++E+A+    + +  L+ EL GK+FFGGE  G+ +L
Sbjct  97   RFWATYGEGECRDAVGKVYFTEGEEKENAIKHLEDTVRVLDEELKGKKFFGGENIGFSDL  156

Query  511  VVGWVAHNLPIFEEVASL  564
            V+GW+A  LP+ EEVAS 
Sbjct  157  VLGWMAFWLPVAEEVASF  174



>gb|ABW81136.1| GST36 [Capsella rubella]
Length=220

 Score =   142 bits (357),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++GFW SPF  RV+ AL++KG+ Y+Y+E+DI NK+PLL QLNPV+ KVPVLVH GK
Sbjct  6    EDVKLLGFWASPFTRRVEMALKLKGVPYDYLEQDIVNKSPLLLQLNPVYKKVPVLVHKGK  65

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGF  347
             +PES LILEYID+TWK NP+LP DPYE+A A FWA F
Sbjct  66   HIPESHLILEYIDQTWKQNPILPQDPYEKAMALFWAKF  103



>ref|XP_006409999.1| hypothetical protein EUTSA_v10017210mg [Eutrema salsugineum]
 gb|ESQ51452.1| hypothetical protein EUTSA_v10017210mg [Eutrema salsugineum]
Length=225

 Score =   142 bits (357),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G W SPF  R++ AL +KG+ Y++ E+DI NK+PLL QLNPVH  +PVLVHNGKP+
Sbjct  8    VKLLGMWASPFSRRIEIALTLKGVPYDFSEQDITNKSPLLLQLNPVHKMIPVLVHNGKPI  67

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
             ESL+ILEYID+TW++NP+LP DPYERA ARFWA F + +I 
Sbjct  68   SESLVILEYIDDTWQNNPILPQDPYERAMARFWAKFVDEQIC  109



>ref|XP_004983860.1| PREDICTED: probable glutathione S-transferase GSTU6-like isoform 
X2 [Setaria italica]
Length=232

 Score =   142 bits (357),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 92/132 (70%), Gaps = 6/132 (5%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA  + LK++G W SPFVLRVK AL +KGL YEY+EED+ NK+ LL + NPVH KVPVL+
Sbjct  1    MAGGDDLKLLGMWASPFVLRVKLALSLKGLSYEYVEEDLRNKSELLLKSNPVHNKVPVLI  60

Query  222  HNGKPLPESLLILEYIDETWKHN--PLLPADPYERARARFWAGFAEFKI----LDPTRGS  383
            H+GKP+ ES +IL+YIDE +     PLLPADPYERA ARFWA + + K+    L  +RG 
Sbjct  61   HDGKPVCESSVILQYIDEAFAGTGPPLLPADPYERAIARFWAAYIDDKVRNKSLKASRGK  120

Query  384  TVFQRETARKCS  419
            T   R    K S
Sbjct  121  TEEDRAEGMKQS  132



>ref|XP_007034532.1| Glutathione S-transferase tau 7 [Theobroma cacao]
 gb|EOY05458.1| Glutathione S-transferase tau 7 [Theobroma cacao]
Length=231

 Score =   142 bits (357),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+ GFW SPF  RV WAL++KG+EYEYIEED+ NK+ LL + NPV+ K+PVLVH GKP+
Sbjct  4    VKLHGFWASPFSHRVIWALKIKGVEYEYIEEDLSNKSELLLKYNPVYKKIPVLVHGGKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFK  359
             ESL+ILEY++ETW  NPLLP+DPYERA ARFW  F E K
Sbjct  64   AESLVILEYVEETWPENPLLPSDPYERAMARFWIQFVEDK  103



>emb|CAN73676.1| hypothetical protein VITISV_001111 [Vitis vinifera]
Length=220

 Score =   141 bits (356),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+ G W S F  R++ AL++KG+++EYIEE++ NK+P L + NP+H K+PVLVHNGK
Sbjct  3    EEVKLFGTWASVFSRRIEVALKLKGVQFEYIEENLSNKSPALLKYNPLHKKIPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            P+ ESL+ILEYIDETWKHNP+LP DPYE+A ARFWA + + K+L
Sbjct  63   PVAESLVILEYIDETWKHNPILPTDPYEKAMARFWAKYMDDKLL  106



>ref|XP_002321502.2| hypothetical protein POPTR_0015s04200g [Populus trichocarpa]
 gb|EEF05629.2| hypothetical protein POPTR_0015s04200g [Populus trichocarpa]
Length=223

 Score =   142 bits (357),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   GLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKP  236
             +K++G + S F  RV+WAL++KG++YEY+E+D+FNK+PLL + NPVH KVPVLVH+ KP
Sbjct  4    AVKLIGSYTSLFCTRVEWALKLKGVQYEYVEDDVFNKSPLLLKHNPVHKKVPVLVHDDKP  63

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPT  374
            +PESL+IL+YIDETW  N LLP D YERA A FWA F + K L  T
Sbjct  64   IPESLVILQYIDETWNDNNLLPQDSYERAMAHFWAKFTDEKCLMQT  109



>ref|XP_006420234.1| hypothetical protein CICLE_v10005809mg [Citrus clementina]
 gb|ESR33474.1| hypothetical protein CICLE_v10005809mg [Citrus clementina]
Length=227

 Score =   142 bits (357),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 89/127 (70%), Gaps = 2/127 (2%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA E  +K++G W SPFV RVK AL++KG+ YEY EED FNK+P L + NP+H KVPVL+
Sbjct  1    MATE--VKLLGIWPSPFVFRVKVALQLKGVGYEYFEEDPFNKSPKLLESNPIHKKVPVLI  58

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRE  401
            H GKP+ ESL ILEYI+ETW++NPLLP DPYERA  RFWA F +    +    + + + E
Sbjct  59   HGGKPINESLTILEYIEETWQNNPLLPQDPYERATVRFWAKFVDDLFWNKAFAAFIAKGE  118

Query  402  TARKCSK  422
               K  K
Sbjct  119  AKEKIEK  125



>ref|XP_009369409.1| PREDICTED: glutathione S-transferase U9-like [Pyrus x bretschneideri]
Length=228

 Score =   142 bits (357),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 99/142 (70%), Gaps = 10/142 (7%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA E  + + G W SP+V RV+ AL++KG+ YEY+EED+ NK+PLL +LNPVH KVPVLV
Sbjct  1    MAEENKVTLHGMWASPYVKRVELALKLKGIPYEYVEEDLKNKSPLLLKLNPVHQKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAE------FKILDPTRGS  383
            HNGKP+ ESL+ILEYIDETWK   LLP DPY+R++ RF+AGF +        +L+ TRG 
Sbjct  61   HNGKPIFESLVILEYIDETWKTR-LLPQDPYKRSQVRFYAGFMQHVFESMVSVLE-TRGQ  118

Query  384  TVFQ--RETARKCSKLSHGSHG  443
               +  +E + K + L  G  G
Sbjct  119  AQEKAIKEVSEKLNLLEEGLKG  140



>ref|XP_002275539.1| PREDICTED: glutathione S-transferase U8 [Vitis vinifera]
Length=221

 Score =   141 bits (356),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++G W SPF  RV+ AL++KG++YEYIE D+ NK+PLL + NPVH KVPVL+HNGK
Sbjct  3    EEVKLIGVWGSPFSRRVEIALKLKGVQYEYIEVDLTNKSPLLLKSNPVHKKVPVLLHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            P+ ESL+ILEYIDETWK NP+LP  PY+RA ARFWA + + K L
Sbjct  63   PIAESLVILEYIDETWKANPILPQHPYDRAMARFWAKYIDEKCL  106



>ref|XP_007218360.1| hypothetical protein PRUPE_ppa011115mg [Prunus persica]
 gb|EMJ19559.1| hypothetical protein PRUPE_ppa011115mg [Prunus persica]
Length=223

 Score =   141 bits (356),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+   W SPF LR+ WAL++KG+ YE I ED+ NK+PLL Q NP+H KVPVLVHNGKP+
Sbjct  4    VKLFRTWSSPFALRIVWALKLKGVPYETIYEDLSNKSPLLLQYNPIHKKVPVLVHNGKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFK  359
             ESL+ILEYIDETWK NPLLP DP ERA ARFWA F + K
Sbjct  64   AESLVILEYIDETWKENPLLPEDPLERAAARFWAKFGDEK  103


 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 47/78 (60%), Gaps = 9/78 (12%)
 Frame = +1

Query  358  RFWTPPG---------EALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW   G         E+  ++GK+QE A+  A E ++ LE EL GK+FFGGEK G  ++
Sbjct  94   RFWAKFGDEKAVPSIWESFTNEGKEQEEAIVKAKENLKYLEEELKGKKFFGGEKLGLADI  153

Query  511  VVGWVAHNLPIFEEVASL  564
             +G +AH   +FEEVA +
Sbjct  154  ALGLLAHYESVFEEVAGM  171



>ref|XP_010042776.1| PREDICTED: glutathione S-transferase U8-like [Eucalyptus grandis]
Length=224

 Score =   141 bits (356),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 83/104 (80%), Gaps = 1/104 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIF-NKTPLLSQLNPVHAKVPVLVHNG  230
            E LK++G W S F  RV+  L++KG+EYEY+EED+F NK+ LL Q NPVH KVPVLVHNG
Sbjct  3    EELKLLGAWGSSFSRRVEIVLKIKGVEYEYLEEDVFQNKSDLLLQYNPVHKKVPVLVHNG  62

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
            KP+ ESL+ILEYIDETWK NP+LP DPYERA ARFWA F + K 
Sbjct  63   KPIAESLVILEYIDETWKDNPILPRDPYERAMARFWAKFLDEKC  106



>gb|KHG20964.1| Glutathione S-transferase U7 -like protein [Gossypium arboreum]
Length=225

 Score =   142 bits (357),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 81/101 (80%), Gaps = 1/101 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDI-FNKTPLLSQLNPVHAKVPVLVHNGKP  236
            +K+ GFW SPF  RV WAL++KG+EYEYIEED+ +NK+ LL Q NPVH K+PVLVH GKP
Sbjct  4    VKLFGFWPSPFSRRVIWALKLKGVEYEYIEEDLPYNKSDLLLQYNPVHKKIPVLVHGGKP  63

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFK  359
            + ESL+ILEYIDE W HNPLLP D YER+ ARFWA F E K
Sbjct  64   IAESLVILEYIDEVWPHNPLLPKDAYERSVARFWAKFIEEK  104



>ref|XP_006489767.1| PREDICTED: glutathione transferase GST 23-like [Citrus sinensis]
Length=185

 Score =   140 bits (353),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 89/121 (74%), Gaps = 0/121 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++GFW SP V RV WAL++KG+E+E IEEDIFNK+  L +LNPVH KVPVLVH+ K +
Sbjct  5    VKLLGFWSSPPVFRVVWALKLKGVEFENIEEDIFNKSTRLLELNPVHKKVPVLVHDDKVI  64

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETARKCS  419
             +S +ILEYID TW+H+PLLP DPYE A ARFWA FA  K+L+    +   + E  +K  
Sbjct  65   VDSFVILEYIDVTWQHDPLLPQDPYETAMARFWAKFAYEKLLESAYKAMWSKGEEKQKTM  124

Query  420  K  422
            K
Sbjct  125  K  125



>gb|AAP04395.1| glutathione S-transferase U1, partial [Nicotiana benthamiana]
Length=119

 Score =   138 bits (348),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G  +SPF  RV+WAL +KG+EYE+IEED+ NK+PLL + NPVH K+PVL+HNGKP+
Sbjct  4    VKLLGVSLSPFSRRVEWALNIKGVEYEFIEEDLQNKSPLLLESNPVHKKIPVLIHNGKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQR  398
             ES++ILEYIDET++   +LP DPYERA ARFWA F + K +  T G  +F +
Sbjct  64   SESMVILEYIDETFEGPSILPKDPYERALARFWANFLDVKCIT-TIGKALFGK  115



>ref|XP_010469954.1| PREDICTED: glutathione S-transferase U5 [Camelina sativa]
Length=224

 Score =   141 bits (356),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA  E +K++G W SPF  R++ AL++KG++Y+Y+EE + NK+ LL  LNPVH KVPVLV
Sbjct  1    MAETEEVKLLGIWASPFSRRIEMALKLKGIKYDYVEEKLENKSSLLLALNPVHKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRE  401
            HNGK + ESL+ILEYIDETW HNP+LP DPYER++ARF+A   + +I++    S     E
Sbjct  61   HNGKTILESLVILEYIDETWPHNPILPQDPYERSKARFFAKLIDEQIINVGFVSMAKADE  120

Query  402  TARK  413
              R+
Sbjct  121  KGRE  124



>ref|XP_010037768.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW49501.1| hypothetical protein EUGRSUZ_K03019 [Eucalyptus grandis]
Length=224

 Score =   141 bits (356),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIF-NKTPLLSQLNPVHAKVPVLVHNG  230
            E LK++G W S F  RV+ AL++KG+EYEY+EED+F NK+ LL Q NPVH KVPVLVHNG
Sbjct  3    EELKLLGAWGSSFSRRVEIALKIKGVEYEYLEEDVFQNKSDLLLQYNPVHKKVPVLVHNG  62

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
            KP+ ESL+IL+YIDETWK NP+LP DPYERA ARFWA F + K 
Sbjct  63   KPIAESLVILKYIDETWKDNPILPRDPYERAMARFWAKFLDEKC  106



>ref|XP_011000484.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=223

 Score =   141 bits (356),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 89/127 (70%), Gaps = 0/127 (0%)
 Frame = +3

Query  57   GLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKP  236
             +K++G + S F  RV+WAL++KG++YEY+E+D+FNK+PLL + NPVH KVPVLVH+ KP
Sbjct  4    AVKLIGSYTSLFCTRVEWALKLKGVQYEYVEDDVFNKSPLLLEHNPVHKKVPVLVHDDKP  63

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETARKC  416
            +PESL+IL+YIDETW  N LLP D YER  A FWA F + K L  T  +   + E   K 
Sbjct  64   IPESLIILQYIDETWNDNNLLPQDSYERTMAHFWAKFTDEKCLMETFTAAYKEGEEKEKA  123

Query  417  SKLSHGS  437
             + +  S
Sbjct  124  IESAQES  130



>gb|ABW81132.1| GST40 [Capsella rubella]
Length=225

 Score =   141 bits (356),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++GFW SPF  RV+ AL++KG+ YEY+EED+ NKT LL +LNPVH KVPVLVHN 
Sbjct  5    EESVKLLGFWGSPFSRRVEMALKLKGVPYEYLEEDLPNKTSLLLELNPVHKKVPVLVHND  64

Query  231  KPLPESLLILEYIDETWK-HNPLLPADPYERARARFWAGFAEFKIL  365
            K LPES LI+EYID+TWK +NP+LP DPY++A ARFWA F + +IL
Sbjct  65   KVLPESHLIIEYIDQTWKNNNPILPQDPYDKAMARFWAKFIDEQIL  110



>ref|XP_006660720.1| PREDICTED: glutathione transferase GST 23-like [Oryza brachyantha]
Length=222

 Score =   141 bits (356),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHN  227
            A++G+KV G W SP  +R +WALR+KG++YEYI+ED+ NK+  L + NPV  KVPVLVH+
Sbjct  2    ADKGVKVFGMWASPMAIRAEWALRLKGVDYEYIDEDLANKSEALLRYNPVTEKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKI  362
            GKPL ES +I+EYIDE WK   P++PADP+ERA+ARFWA FAE K 
Sbjct  62   GKPLAESTVIVEYIDEAWKDGYPIMPADPFERAQARFWARFAEEKC  107


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 40/75 (53%), Gaps = 9/75 (12%)
 Frame = +1

Query  358  RFWTPPGEALC---------SKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW    E  C         + G+ Q   V  A + ++ LE  L GK FFGG+  GYL++
Sbjct  97   RFWARFAEEKCNAALYPIFMTTGEAQSKLVQEAQQCLKTLETALEGKTFFGGDAFGYLDI  156

Query  511  VVGWVAHNLPIFEEV  555
            V GW A+ LPI EEV
Sbjct  157  VTGWYAYWLPIIEEV  171



>ref|XP_004299656.1| PREDICTED: probable glutathione S-transferase [Fragaria vesca 
subsp. vesca]
Length=227

 Score =   131 bits (329),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 83/113 (73%), Gaps = 1/113 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W S F LR+ WAL++K + Y+ I ED+ NK+PLL Q NP+H  +PVLVHNGK
Sbjct  2    EEVKLFRTWTSSFSLRIVWALKLKDVPYDTIFEDLSNKSPLLLQYNPIHKAIPVLVHNGK  61

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVF  392
            P+ ESL+ILEYI+ETWK NPLLP DP++RA ARF A F + K++ P+    VF
Sbjct  62   PIAESLVILEYIEETWKQNPLLPQDPHDRATARFLAKFGDDKVM-PSIVDAVF  113


 Score = 53.1 bits (126),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  379  EALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVA  558
            +A+ S+GK+QE A+  A E +  LEAEL GK++FGGE+ G+ ++  GW+AH+L + EEV 
Sbjct  110  DAVFSEGKEQEEAIAKAKENLNYLEAELKGKKYFGGERIGFADIAQGWLAHSLKVLEEVT  169

Query  559  S  561
            +
Sbjct  170  N  170



>ref|XP_006373996.1| hypothetical protein POPTR_0016s12610g [Populus trichocarpa]
 gb|ERP51793.1| hypothetical protein POPTR_0016s12610g [Populus trichocarpa]
Length=220

 Score =   141 bits (355),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+ GFW SPF  RV WAL++KG+EYEYIEED+ NK+ LL + NP++ K+PVLVH+GKP+
Sbjct  4    VKLHGFWSSPFSCRVIWALKLKGVEYEYIEEDLLNKSELLLKYNPIYKKIPVLVHDGKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILD  368
             ESL+ILEYI+ETW  NPLLP DPY+RA ARFW  +   K  D
Sbjct  64   AESLVILEYIEETWPENPLLPRDPYDRAMARFWIQYGATKCAD  106



>emb|CDP09302.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   141 bits (355),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W SP+ LR+ WAL++KG+EYE I ED+ NK+P L Q NP H KVPVLV +GK
Sbjct  3    EEVKLFRTWSSPYALRIVWALKLKGIEYETIFEDLTNKSPSLLQYNPTHGKVPVLVRDGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            P+ ESL+ILEY+DETWKHNPLLP DPYE++ ARFWA F + K++
Sbjct  63   PVCESLVILEYVDETWKHNPLLPQDPYEKSMARFWANFGDDKLM  106



>ref|XP_010269443.1| PREDICTED: probable glutathione S-transferase [Nelumbo nucifera]
Length=221

 Score =   141 bits (355),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 89/125 (71%), Gaps = 3/125 (2%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+ G W S +V RV WAL++KG+EYEYIEED+ NK+ LL + NPVH KVPVL H+GKP+
Sbjct  4    VKLFGLWXSXYVYRVIWALKLKGIEYEYIEEDLSNKSELLLKYNPVHKKVPVLAHDGKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFK---ILDPTRGSTVFQRETAR  410
             ESL+ILEYIDETW  NPLLP D  +RA ARFWA FAE K    +   R S   Q +  +
Sbjct  64   AESLVILEYIDETWPENPLLPKDAEQRAAARFWAKFAEDKGACFMTFFRSSGEEQEKARK  123

Query  411  KCSKL  425
            +C ++
Sbjct  124  ECLEM  128



>emb|CDY40167.1| BnaC04g13950D [Brassica napus]
Length=224

 Score =   141 bits (355),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA +E +K++G W SPF  R++ AL++KG+ YEY+EE +  K+PLL  LNP+H KVPVLV
Sbjct  1    MAEKEEVKLLGIWASPFSRRIEMALKLKGVPYEYVEEILEKKSPLLLALNPIHKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRE  401
            HNGK + ES +ILEYIDETWKHNPLLP DPYER++ARF A   + +I+     S     E
Sbjct  61   HNGKTILESQVILEYIDETWKHNPLLPQDPYERSKARFLAKLVDEQIITAGFVSMARADE  120

Query  402  TARK  413
              R+
Sbjct  121  KGRE  124



>ref|XP_008232147.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=224

 Score =   141 bits (355),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+   W SPF LR+ WAL++KG+ YE I ED+ NK+PLL Q NP+H KVPVLVHNGKP+
Sbjct  4    VKLFRTWSSPFALRIVWALKLKGVPYETIYEDLSNKSPLLLQYNPIHKKVPVLVHNGKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
             ES ++LEYIDETWK NPLLP DP ERA ARFWA F + K+L
Sbjct  64   VESFVVLEYIDETWKENPLLPEDPLERAAARFWAKFGDDKVL  105



>ref|XP_007026865.1| Tau class glutathione transferase GSTU45 [Theobroma cacao]
 gb|EOY07367.1| Tau class glutathione transferase GSTU45 [Theobroma cacao]
Length=220

 Score =   141 bits (355),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 85/105 (81%), Gaps = 1/105 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIF-NKTPLLSQLNPVHAKVPVLVHNG  230
            E +KV G W SPF  RV+ AL++KG++YEYIEED+  NK+PLL + NPVH KVPVL+HNG
Sbjct  3    EEVKVFGAWGSPFSRRVELALQLKGVQYEYIEEDVHKNKSPLLLKYNPVHKKVPVLLHNG  62

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            KP+ ESL+ILEYI+ETWK NP+LP DPY+RA ARFWA F + K L
Sbjct  63   KPIAESLVILEYIEETWKGNPILPEDPYDRAMARFWAKFIDEKCL  107



>gb|KHG11259.1| Glutathione transferase GST 23 [Gossypium arboreum]
Length=223

 Score =   141 bits (355),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 90/133 (68%), Gaps = 3/133 (2%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+ G W SP+  RV WAL++KG+ YEYIEED+ NK+PLL Q NP+H KVPVL+H+GKP+
Sbjct  4    VKLFGAWTSPYCYRVIWALKLKGIPYEYIEEDLSNKSPLLLQYNPIHEKVPVLLHDGKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFK---ILDPTRGSTVFQRETAR  410
             ES +IL YIDE W  NPLLPADP+ERA A FW  FA+ K   I    R     Q+  A+
Sbjct  64   CESTVILRYIDEVWPQNPLLPADPHERAVALFWIKFADDKSPLISKLYRTDGEEQKAVAK  123

Query  411  KCSKLSHGSHGEA  449
            +C ++     G A
Sbjct  124  ECFEMLEVVEGHA  136



>ref|XP_002520473.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF41886.1| glutathione s-transferase, putative [Ricinus communis]
Length=242

 Score =   141 bits (356),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 88/120 (73%), Gaps = 0/120 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E ++++G W SPF  R + AL++KG++YEYIEED+ NK+PLL + NPV+ K+PVLVH GK
Sbjct  26   EEVQLIGMWASPFNCRAQLALKLKGVQYEYIEEDLSNKSPLLLKYNPVYKKIPVLVHKGK  85

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETARK  413
            P+ ESL+ILEYI+ETWK+NP++P D Y  A ARFWA FA+  IL     S+  + E   K
Sbjct  86   PISESLVILEYIEETWKNNPIMPQDSYSTAIARFWANFADENILQTAIKSSKAKGEEREK  145



>emb|CDX97887.1| BnaC04g40520D [Brassica napus]
Length=225

 Score =   141 bits (355),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++G W SPF  RV+ AL +KGL YE+ E+DI NK+PLL Q NPVH  +PVL+HNGK
Sbjct  6    EEVKLLGMWASPFSRRVEIALTLKGLPYEFSEQDIANKSPLLLQSNPVHKMIPVLLHNGK  65

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKI  362
            P+ ESL+ILEYIDETW++NP+LP DPY+RA ARFWA F + +I
Sbjct  66   PISESLVILEYIDETWQNNPILPQDPYDRAIARFWARFVDEQI  108



>ref|XP_010243636.1| PREDICTED: probable glutathione S-transferase [Nelumbo nucifera]
Length=221

 Score =   141 bits (355),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 88/123 (72%), Gaps = 8/123 (7%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+ G W S +V RV WAL++KG+EYEYIEED+ NK+ LL + NPVH KVPVL H+GKP+
Sbjct  4    VKLFGLWASSYVYRVIWALKLKGIEYEYIEEDLSNKSELLLKYNPVHKKVPVLAHDGKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAE-----FKILDPTRGSTVFQRET  404
             ESL+ILEYIDETW  NPLLP D  +RA ARFWA FA+     F     +RG    ++E 
Sbjct  64   AESLVILEYIDETWPENPLLPKDAEQRAAARFWAKFADDKATCFMSFFCSRGE---EQEK  120

Query  405  ARK  413
            ARK
Sbjct  121  ARK  123



>ref|XP_009789711.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
Length=219

 Score =   141 bits (355),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 92/125 (74%), Gaps = 1/125 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G  +SPF  RV+WAL++KG+EYE+IEED+ NK+PLL Q NP+H K+PVL+HNGKP+
Sbjct  4    VKLLGVSLSPFSRRVEWALKIKGVEYEFIEEDLQNKSPLLLQSNPIHKKIPVLIHNGKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPTRGSTVFQRETARKCS  419
             ES++ILEYIDET++   +LP DPYERA ARFWA F + K +  T G  +F +      +
Sbjct  64   SESMIILEYIDETFEGPSILPKDPYERALARFWANFLDVKCI-TTIGKALFGKGEESDKA  122

Query  420  KLSHG  434
            K   G
Sbjct  123  KEECG  127



>ref|XP_002521517.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF40788.1| glutathione s-transferase, putative [Ricinus communis]
Length=236

 Score =   141 bits (356),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +3

Query  39   IMAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVL  218
            + A +E +K+ G W SPFV RV+ AL++KG+ YE +EED+ NK+ LL ++NPV+ K+PVL
Sbjct  1    MAAGQEEVKLFGGWYSPFVYRVEVALKIKGIPYEVVEEDVTNKSKLLLKVNPVYKKIPVL  60

Query  219  VHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGF  347
             HNGK + ESLLILEYIDETWKHNP+LP DPYE+A ARFWA F
Sbjct  61   FHNGKSICESLLILEYIDETWKHNPILPQDPYEKAMARFWAHF  103



>ref|XP_007220010.1| hypothetical protein PRUPE_ppb024827mg [Prunus persica]
 gb|EMJ21209.1| hypothetical protein PRUPE_ppb024827mg [Prunus persica]
Length=224

 Score =   141 bits (355),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+   W SPF LR+ WAL++KG+ YE I ED+ NK+PLL Q NP+H KVPVLVHNGKP+
Sbjct  4    VKLFRTWSSPFALRIVWALKLKGVPYETIYEDLSNKSPLLLQYNPIHKKVPVLVHNGKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
             ES ++LEYIDETWK NPLLP DP ERA ARFWA F + K+L
Sbjct  64   VESFVVLEYIDETWKENPLLPEDPLERAAARFWAKFGDDKVL  105


 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 48/79 (61%), Gaps = 10/79 (13%)
 Frame = +1

Query  358  RFWTPPG---------EALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNL  510
            RFW   G         E+  S GK+QE A+  A E ++ LE EL GK+FFGGEK G++++
Sbjct  94   RFWAKFGDDKVLPSIWESFTSDGKEQEEAIVKAKENLKYLEEELKGKKFFGGEKLGFVDI  153

Query  511  VVGWVA-HNLPIFEEVASL  564
             +GW+A +   +FE+V  +
Sbjct  154  ALGWLAQYESSVFEDVTGM  172



>ref|XP_002467617.1| hypothetical protein SORBIDRAFT_01g030980 [Sorghum bicolor]
 gb|EER94615.1| hypothetical protein SORBIDRAFT_01g030980 [Sorghum bicolor]
Length=239

 Score =   141 bits (356),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 92/131 (70%), Gaps = 7/131 (5%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIF-NKTPLLSQLNPVHAKVPVL  218
            MA  + LK++G W SPFVLRVK AL +KGL YEY+EEDIF  K+ LL + NPVH KVPVL
Sbjct  1    MAGGDELKLLGMWASPFVLRVKLALSIKGLSYEYVEEDIFGGKSELLLKSNPVHNKVPVL  60

Query  219  VHNGKPLPESLLILEYIDETWKHN--PLLPADPYERARARFWAGFAEFKIL----DPTRG  380
            +HNGKP+ ESL+IL+YIDE +      LLPADPYERA ARFWA + + K+L      +RG
Sbjct  61   IHNGKPVCESLIILQYIDEAFAGTGPTLLPADPYERAVARFWAAYIDDKVLAAWMQASRG  120

Query  381  STVFQRETARK  413
             T   +   RK
Sbjct  121  KTEEDKAEGRK  131



>ref|XP_004160429.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
Length=224

 Score =   132 bits (333),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G   S F +RV+WAL++KG+E+EYI ED+ NK+ LL + NPVH K+PV +HN K +
Sbjct  4    VKIIGSAGSLFCIRVEWALKLKGIEFEYIVEDLRNKSELLLKSNPVHKKIPVFLHNDKAI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
             ESLLI+EYIDETWK NP+LP DPY+RA ARFWA F + K L
Sbjct  64   SESLLIIEYIDETWKENPILPEDPYDRANARFWAKFLDEKGL  105


 Score = 51.2 bits (121),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +1

Query  379  EALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVA  558
            EA  ++G+++E AV +A++ +  L+ E+ GK+FFGGE+ GYL+L  GW+ H L + +EV 
Sbjct  110  EACQAEGEEKEKAVEAAIQNLALLDKEIQGKKFFGGEQIGYLDLAAGWICHWLNVLDEVG  169

Query  559  SL  564
             +
Sbjct  170  EM  171



>ref|XP_004137330.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
 gb|KGN63854.1| hypothetical protein Csa_1G024860 [Cucumis sativus]
Length=224

 Score =   132 bits (333),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G   S F +RV+WAL++KG+E+EYI ED+ NK+ LL + NPVH K+PV +HN K +
Sbjct  4    VKIIGSAGSLFCIRVEWALKLKGIEFEYIVEDLRNKSELLLKSNPVHKKIPVFLHNDKAI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
             ESLLI+EYIDETWK NP+LP DPY+RA ARFWA F + K L
Sbjct  64   SESLLIIEYIDETWKENPILPEDPYDRANARFWAKFLDEKGL  105


 Score = 51.2 bits (121),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +1

Query  379  EALCSKGKQQESAVNSameamekleaelNGKQFFGGEKTGYLNLVVGWVAHNLPIFEEVA  558
            EA  ++G+++E AV +A++ +  L+ E+ GK+FFGGE+ GYL+L  GW+ H L + +EV 
Sbjct  110  EACQAEGEEKEKAVEAAIQNLALLDKEIQGKKFFGGEQIGYLDLAAGWICHWLNVLDEVG  169

Query  559  SL  564
             +
Sbjct  170  EM  171



>gb|KJB27950.1| hypothetical protein B456_005G038200 [Gossypium raimondii]
Length=225

 Score =   141 bits (355),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 80/99 (81%), Gaps = 1/99 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDI-FNKTPLLSQLNPVHAKVPVLVHNGKP  236
            +K+ GFW SPF  RV WAL++KG+EYEYIEED+ +NK+ LL Q NPVH K+PVLVH GKP
Sbjct  4    VKLFGFWASPFSRRVIWALKLKGVEYEYIEEDLPYNKSDLLLQYNPVHKKIPVLVHGGKP  63

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAE  353
            + ESL+ILEYIDE W HNPLLP D YER+ ARFWA F +
Sbjct  64   IVESLVILEYIDEVWPHNPLLPKDAYERSVARFWAKFIQ  102



>ref|XP_004983859.1| PREDICTED: probable glutathione S-transferase GSTU6-like isoform 
X1 [Setaria italica]
Length=232

 Score =   141 bits (355),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 92/132 (70%), Gaps = 6/132 (5%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLV  221
            MA  + LK++G W SPFVLRVK AL +KGL YEY+EED+ NK+ LL + NPVH KVPVL+
Sbjct  1    MAGGDDLKLLGMWASPFVLRVKLALSLKGLSYEYVEEDLRNKSELLLKSNPVHNKVPVLI  60

Query  222  HNGKPLPESLLILEYIDETWKHN--PLLPADPYERARARFWAGFAEFKIL----DPTRGS  383
            H+GKP+ ES +IL+YIDE +     PLLPADPYERA ARFWA + + K+L      +RG 
Sbjct  61   HDGKPVCESSVILQYIDEAFAGTGPPLLPADPYERAIARFWAAYIDDKMLAAWTQASRGK  120

Query  384  TVFQRETARKCS  419
            T   R    K S
Sbjct  121  TEEDRAEGMKQS  132



>emb|CDP19810.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   141 bits (355),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W S + LR+ WAL++KG+EYE I ED+ NK+P L Q NP H KVPVLVH+GK
Sbjct  3    EEVKLFRTWSSRYSLRIVWALKLKGIEYETIFEDLTNKSPSLLQYNPTHGKVPVLVHDGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKIL  365
            P+ ESL+ILEY+DETWKHNPLLP DPYE++ ARFWA F + K++
Sbjct  63   PVCESLVILEYVDETWKHNPLLPQDPYEKSMARFWANFGDDKLM  106



>ref|XP_006852814.1| hypothetical protein AMTR_s00033p00172070 [Amborella trichopoda]
 gb|ERN14281.1| hypothetical protein AMTR_s00033p00172070 [Amborella trichopoda]
Length=234

 Score =   141 bits (355),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 89/123 (72%), Gaps = 3/123 (2%)
 Frame = +3

Query  36   VIMAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFNKTPLLSQLNPVHAKVPV  215
            + MA    +K++G W S + +R++ AL++KG+ YEYI+ED+ NK+PLL QLNP+H KVPV
Sbjct  1    MTMATSGEVKIIGLWASSYCVRIEVALKLKGISYEYIDEDLSNKSPLLLQLNPIHKKVPV  60

Query  216  LVHNGKPLPESLLILEYIDETWKHNP-LLPADPYERARARFWAGFAEFKILDPTRGSTVF  392
            L+HNGK + ESL+ILEYIDETW   P LLP DPYERA  RFWA F + K+     G T+F
Sbjct  61   LLHNGKTIAESLIILEYIDETWPDLPALLPKDPYERALLRFWANFFDSKL--SGSGRTIF  118

Query  393  QRE  401
              E
Sbjct  119  ITE  121



>ref|XP_010939723.1| PREDICTED: glutathione transferase GST 23-like [Elaeis guineensis]
Length=222

 Score =   140 bits (354),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 87/107 (81%), Gaps = 2/107 (2%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIFN-KTPLLSQLNPVHAKVPVLVH  224
            AE+G+K+ G W SP  LRV+WAL++KG+EYEY+EED+F+ K+  L + NPV  K+PVLVH
Sbjct  2    AEKGVKLFGMWCSPIALRVEWALKLKGVEYEYVEEDLFHKKSEELLRYNPVTKKIPVLVH  61

Query  225  NGKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKI  362
            +GKPL ESL+I+EY+DE WK   P++P DPYERA+ARFWA FAE KI
Sbjct  62   DGKPLAESLVIVEYVDEVWKDGFPIMPKDPYERAQARFWAKFAEDKI  108



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920