BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP008E05 637 bp,:PolyA

Length=601
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009779573.1|  PREDICTED: uncharacterized protein LOC104228746    219   4e-69   Nicotiana sylvestris
ref|XP_009618096.1|  PREDICTED: uncharacterized protein LOC104110334    218   1e-68   Nicotiana tomentosiformis
ref|XP_006351789.1|  PREDICTED: uncharacterized protein LOC102583636    214   3e-67   Solanum tuberosum [potatoes]
ref|XP_007200439.1|  hypothetical protein PRUPE_ppa012787mg             213   2e-66   Prunus persica
ref|XP_004230636.1|  PREDICTED: uncharacterized protein LOC101245002    212   2e-66   Solanum lycopersicum
ref|XP_008237183.1|  PREDICTED: tropomyosin                             211   1e-65   Prunus mume [ume]
ref|XP_011087880.1|  PREDICTED: uncharacterized protein LOC105169221    208   9e-65   Sesamum indicum [beniseed]
gb|EYU18485.1|  hypothetical protein MIMGU_mgv1a015418mg                206   7e-64   Erythranthe guttata [common monkey flower]
ref|XP_004136872.1|  PREDICTED: uncharacterized protein LOC101218756    203   1e-62   Cucumis sativus [cucumbers]
gb|KJB47205.1|  hypothetical protein B456_008G015400                    199   9e-61   Gossypium raimondii
gb|KHG00871.1|  Arginine biosynthesis bifunctional ArgJ                 196   8e-60   Gossypium arboreum [tree cotton]
ref|XP_010094162.1|  hypothetical protein L484_017206                   194   5e-59   Morus notabilis
gb|EPS63433.1|  hypothetical protein M569_11351                         193   9e-59   Genlisea aurea
ref|XP_009372183.1|  PREDICTED: uncharacterized protein LOC103961365    191   4e-58   Pyrus x bretschneideri [bai li]
ref|XP_002265916.2|  PREDICTED: uncharacterized protein LOC100241703    191   5e-58   Vitis vinifera
ref|XP_008372559.1|  PREDICTED: tropomyosin-like                        191   6e-58   Malus domestica [apple tree]
gb|KJB47206.1|  hypothetical protein B456_008G015400                    191   9e-58   Gossypium raimondii
ref|XP_008372568.1|  PREDICTED: uncharacterized protein LOC103435...    189   2e-57   Malus domestica [apple tree]
ref|XP_007042974.1|  Dbj:BAA96220.1                                     189   2e-57   Theobroma cacao [chocolate]
ref|XP_004288660.1|  PREDICTED: uncharacterized protein LOC101296327    189   4e-57   Fragaria vesca subsp. vesca
ref|XP_008382564.1|  PREDICTED: tropomyosin-like                        188   6e-57   Malus domestica [apple tree]
ref|XP_010030042.1|  PREDICTED: uncharacterized protein LOC104419909    188   7e-57   Eucalyptus grandis [rose gum]
ref|XP_008372565.1|  PREDICTED: uncharacterized protein LOC103435...    188   2e-56   
ref|XP_008372564.1|  PREDICTED: uncharacterized protein LOC103435...    188   3e-56   Malus domestica [apple tree]
emb|CDX84501.1|  BnaC03g49990D                                          186   4e-56   Brassica napus [oilseed rape]
ref|XP_002530267.1|  conserved hypothetical protein                     186   6e-56   Ricinus communis
gb|KDP25845.1|  hypothetical protein JCGZ_22875                         186   1e-55   Jatropha curcas
ref|XP_009358984.1|  PREDICTED: uncharacterized protein LOC103949596    184   2e-55   Pyrus x bretschneideri [bai li]
ref|XP_006487654.1|  PREDICTED: tropomyosin-like isoform X1             183   8e-55   Citrus sinensis [Valencia orange]
gb|KDO40740.1|  hypothetical protein CISIN_1g031305mg                   183   9e-55   Citrus sinensis [Valencia orange]
ref|XP_011092419.1|  PREDICTED: uncharacterized protein LOC105172602    182   2e-54   Sesamum indicum [beniseed]
ref|XP_006423898.1|  hypothetical protein CICLE_v10029442mg             182   3e-54   Citrus clementina
ref|XP_011043705.1|  PREDICTED: uncharacterized protein LOC105139082    181   4e-54   Populus euphratica
ref|XP_011044728.1|  PREDICTED: uncharacterized protein LOC105139...    181   7e-54   Populus euphratica
ref|XP_010258013.1|  PREDICTED: uncharacterized protein LOC104597921    179   2e-53   Nelumbo nucifera [Indian lotus]
ref|XP_002317807.2|  hypothetical protein POPTR_0012s02910g             181   3e-53   Populus trichocarpa [western balsam poplar]
ref|NP_201223.1|  uncharacterized protein                               178   7e-53   Arabidopsis thaliana [mouse-ear cress]
emb|CDY18721.1|  BnaA09g06740D                                          177   1e-52   Brassica napus [oilseed rape]
emb|CDX81215.1|  BnaC09g06260D                                          177   1e-52   Brassica napus [oilseed rape]
ref|XP_010484189.1|  PREDICTED: uncharacterized protein LOC104762571    177   2e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010444348.1|  PREDICTED: uncharacterized protein LOC104727050    177   3e-52   Camelina sativa [gold-of-pleasure]
ref|XP_009112121.1|  PREDICTED: uncharacterized protein LOC103837517    176   3e-52   Brassica rapa
ref|XP_010520965.1|  PREDICTED: uncharacterized protein LOC104799966    176   4e-52   Tarenaya hassleriana [spider flower]
gb|KDO40739.1|  hypothetical protein CISIN_1g031305mg                   176   6e-52   Citrus sinensis [Valencia orange]
ref|XP_010461470.1|  PREDICTED: uncharacterized protein LOC104742194    176   6e-52   Camelina sativa [gold-of-pleasure]
ref|XP_006394188.1|  hypothetical protein EUTSA_v10005060mg             176   6e-52   Eutrema salsugineum
ref|XP_010690481.1|  PREDICTED: uncharacterized protein LOC104904...    176   7e-52   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_006845889.1|  hypothetical protein AMTR_s00154p00087720          175   1e-51   Amborella trichopoda
ref|XP_006281242.1|  hypothetical protein CARUB_v10027285mg             175   1e-51   Capsella rubella
gb|AAM62887.1|  unknown                                                 175   1e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002321368.1|  hypothetical protein POPTR_0015s00800g             174   2e-51   Populus trichocarpa [western balsam poplar]
gb|KFK28102.1|  hypothetical protein AALP_AA8G472800                    174   4e-51   Arabis alpina [alpine rockcress]
ref|XP_002864885.1|  hypothetical protein ARALYDRAFT_919722             174   4e-51   Arabidopsis lyrata subsp. lyrata
ref|XP_004504787.1|  PREDICTED: uncharacterized protein LOC101494197    169   2e-49   Cicer arietinum [garbanzo]
gb|KHN39222.1|  hypothetical protein glysoja_028027                     168   4e-49   Glycine soja [wild soybean]
ref|XP_009150491.1|  PREDICTED: myosin heavy chain, muscle              169   4e-49   Brassica rapa
gb|KEH31227.1|  SKIP interacting protein                                167   8e-49   Medicago truncatula
ref|XP_008455213.1|  PREDICTED: uncharacterized protein LOC103495430    167   1e-48   Cucumis melo [Oriental melon]
ref|XP_003524738.2|  PREDICTED: uncharacterized protein LOC100804...    167   2e-48   Glycine max [soybeans]
ref|XP_003531035.1|  PREDICTED: uncharacterized protein LOC100779456    165   1e-47   Glycine max [soybeans]
gb|KHN32568.1|  hypothetical protein glysoja_047900                     163   2e-47   Glycine soja [wild soybean]
ref|XP_007159096.1|  hypothetical protein PHAVU_002G208400g             163   8e-47   Phaseolus vulgaris [French bean]
ref|XP_008785611.1|  PREDICTED: uncharacterized protein LOC103704198    160   6e-46   Phoenix dactylifera
ref|XP_010939192.1|  PREDICTED: uncharacterized protein LOC105058098    160   7e-46   Elaeis guineensis
gb|ADE75769.1|  unknown                                                 154   2e-43   Picea sitchensis
ref|XP_003576107.1|  PREDICTED: uncharacterized protein LOC100823803    154   3e-43   Brachypodium distachyon [annual false brome]
ref|NP_001168817.1|  hypothetical protein                               153   1e-42   Zea mays [maize]
dbj|BAJ89520.1|  predicted protein                                      152   2e-42   Hordeum vulgare subsp. vulgare [barley]
emb|CDO97456.1|  unnamed protein product                                150   2e-42   Coffea canephora [robusta coffee]
ref|XP_004962943.1|  PREDICTED: uncharacterized protein LOC101774171    151   6e-42   Setaria italica
ref|XP_002443220.1|  hypothetical protein SORBIDRAFT_08g015570          150   2e-41   Sorghum bicolor [broomcorn]
ref|XP_009394775.1|  PREDICTED: uncharacterized protein LOC103980189    149   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACG26932.1|  hypothetical protein                                    144   2e-39   Zea mays [maize]
ref|NP_001145064.1|  uncharacterized protein LOC100278260               144   2e-39   Zea mays [maize]
ref|XP_009394316.1|  PREDICTED: uncharacterized protein LOC103979826    141   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS46364.1|  hypothetical protein TRIUR3_27207                       141   2e-37   Triticum urartu
ref|XP_006664576.1|  PREDICTED: myosin-7B-like                          137   2e-37   Oryza brachyantha
gb|ACA64832.1|  SKIP interacting protein 15                             137   6e-37   Oryza sativa Indica Group [Indian rice]
gb|EEE53261.1|  hypothetical protein OsJ_36194                          137   7e-37   Oryza sativa Japonica Group [Japonica rice]
gb|KCW56997.1|  hypothetical protein EUGRSUZ_I02667                     125   7e-33   Eucalyptus grandis [rose gum]
ref|XP_002981396.1|  hypothetical protein SELMODRAFT_114499             122   3e-31   Selaginella moellendorffii
gb|ABA98637.1|  expressed protein                                       120   8e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002969920.1|  hypothetical protein SELMODRAFT_170924             117   2e-29   Selaginella moellendorffii
ref|XP_011044729.1|  PREDICTED: uncharacterized protein LOC105139...    113   4e-28   Populus euphratica
gb|KDO40741.1|  hypothetical protein CISIN_1g031305mg                   113   4e-28   Citrus sinensis [Valencia orange]
gb|KDO40742.1|  hypothetical protein CISIN_1g031305mg                   113   6e-28   Citrus sinensis [Valencia orange]
ref|XP_006423897.1|  hypothetical protein CICLE_v10029442mg             112   1e-27   Citrus clementina
ref|XP_001779944.1|  predicted protein                                  112   2e-27   Physcomitrella patens
ref|XP_010690482.1|  PREDICTED: uncharacterized protein LOC104904...    112   2e-27   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_006487655.1|  PREDICTED: tropomyosin-like isoform X2             111   3e-27   
ref|NP_001066826.2|  Os12g0502100                                       109   5e-26   
ref|XP_008672642.1|  PREDICTED: uncharacterized protein LOC100278...  94.7    2e-20   Zea mays [maize]
gb|EAY83218.1|  hypothetical protein OsI_38427                        86.3    6e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_008672643.1|  PREDICTED: uncharacterized protein LOC100278...  76.6    8e-14   Zea mays [maize]
ref|XP_009394773.1|  PREDICTED: mitochondrial substrate carrier f...  68.6    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGT16664.1|  hypothetical protein SHCRBa_107_F16_F_190             67.4    8e-10   Saccharum hybrid cultivar R570



>ref|XP_009779573.1| PREDICTED: uncharacterized protein LOC104228746 [Nicotiana sylvestris]
Length=155

 Score =   219 bits (559),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 142/152 (93%), Gaps = 1/152 (1%)
 Frame = +2

Query  26   MEEKGK-GSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  202
            MEEKGK GSERW+AAI N SEMA NLDSLQKLL+KKAVYVDEDT++KA L SEQART+KV
Sbjct  1    MEEKGKVGSERWSAAIGNLSEMASNLDSLQKLLVKKAVYVDEDTFAKASLTSEQARTLKV  60

Query  203  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEE  382
            LEQRV+TLERELD+AISAAA ARTEKRQAEAAQK AEL+AQEIT+ELENTT+VF LHMEE
Sbjct  61   LEQRVQTLERELDNAISAAAHARTEKRQAEAAQKVAELRAQEITRELENTTRVFELHMEE  120

Query  383  LRAKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            LRAKQ+EI+KRDKEIKLLEAIIQTLGG+ SHS
Sbjct  121  LRAKQEEISKRDKEIKLLEAIIQTLGGKGSHS  152



>ref|XP_009618096.1| PREDICTED: uncharacterized protein LOC104110334 [Nicotiana tomentosiformis]
Length=155

 Score =   218 bits (556),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 143/152 (94%), Gaps = 1/152 (1%)
 Frame = +2

Query  26   MEEKGK-GSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  202
            MEEKGK GSERW+AAI N SEMA NLDSLQKLL+KKAVYVDEDT++KA L SEQARTIKV
Sbjct  1    MEEKGKVGSERWSAAIGNLSEMASNLDSLQKLLVKKAVYVDEDTFAKASLTSEQARTIKV  60

Query  203  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEE  382
            LEQRV+TLERELD+AISAAA ARTEKRQAEAAQKAAEL+AQE+T+ELENTT+VF LHMEE
Sbjct  61   LEQRVQTLERELDNAISAAAHARTEKRQAEAAQKAAELRAQEVTRELENTTRVFELHMEE  120

Query  383  LRAKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            LRAKQ+EI+KRDKEIKLLEAIIQTLGG+ SHS
Sbjct  121  LRAKQEEISKRDKEIKLLEAIIQTLGGKGSHS  152



>ref|XP_006351789.1| PREDICTED: uncharacterized protein LOC102583636 [Solanum tuberosum]
Length=155

 Score =   214 bits (546),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 143/155 (92%), Gaps = 1/155 (1%)
 Frame = +2

Query  26   MEEKGK-GSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  202
            MEEKGK GSERW+AAI N SEM  NLDSLQKLL+KKAV+VD+DT++KA L SEQARTIKV
Sbjct  1    MEEKGKRGSERWSAAIGNLSEMTSNLDSLQKLLVKKAVFVDDDTFAKASLTSEQARTIKV  60

Query  203  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEE  382
            LEQRVETLERELD+AISAAA ARTEKRQAEAAQKAAEL+AQE+T+ELENTT+VF LHMEE
Sbjct  61   LEQRVETLERELDNAISAAAHARTEKRQAEAAQKAAELRAQEVTRELENTTRVFELHMEE  120

Query  383  LRAKQDEIAKRDKEIKLLEAIIQTLGGRDSHSIDD  487
            LRAKQ EI+KRDKEIKLLEAIIQTLGG+ SHS D+
Sbjct  121  LRAKQLEISKRDKEIKLLEAIIQTLGGKGSHSSDE  155



>ref|XP_007200439.1| hypothetical protein PRUPE_ppa012787mg [Prunus persica]
 gb|EMJ01638.1| hypothetical protein PRUPE_ppa012787mg [Prunus persica]
Length=154

 Score =   213 bits (541),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +2

Query  26   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  205
            ME+KGKG+ERW  AI+N +EM+ NL+SLQKLL+KKAV+VDE+T++KA L SEQARTIKVL
Sbjct  1    MEDKGKGNERWNGAISNLTEMSFNLESLQKLLLKKAVFVDEETFAKASLCSEQARTIKVL  60

Query  206  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEEL  385
            EQRVETLERELD+AI+AAAR R+EKRQAEAA+KAAEL AQE+TKELENT+KVF LHMEEL
Sbjct  61   EQRVETLERELDAAITAAARVRSEKRQAEAAEKAAELHAQEVTKELENTSKVFELHMEEL  120

Query  386  RAKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            RAKQ+EIAKRDKEIKLLEAIIQTLGG++SHS
Sbjct  121  RAKQEEIAKRDKEIKLLEAIIQTLGGKESHS  151



>ref|XP_004230636.1| PREDICTED: uncharacterized protein LOC101245002 [Solanum lycopersicum]
Length=155

 Score =   212 bits (540),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 141/155 (91%), Gaps = 1/155 (1%)
 Frame = +2

Query  26   MEEKGK-GSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  202
            MEEKGK GSERW+AAI N SEM  NL+SLQKLL+KKAV+VD+DT++K  L SEQARTIKV
Sbjct  1    MEEKGKVGSERWSAAIGNLSEMTSNLNSLQKLLVKKAVFVDDDTFAKVSLTSEQARTIKV  60

Query  203  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEE  382
            LEQRV+TLERELD+AISAAA ARTEKRQ E AQKAAEL+AQE+TKELENTT+VF LHMEE
Sbjct  61   LEQRVQTLERELDNAISAAAHARTEKRQVEVAQKAAELRAQEVTKELENTTRVFELHMEE  120

Query  383  LRAKQDEIAKRDKEIKLLEAIIQTLGGRDSHSIDD  487
            LRAKQ+EI+KRDKEIKLLEAIIQTLGG+ S+S D+
Sbjct  121  LRAKQEEISKRDKEIKLLEAIIQTLGGKGSNSSDE  155



>ref|XP_008237183.1| PREDICTED: tropomyosin [Prunus mume]
Length=154

 Score =   211 bits (536),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = +2

Query  26   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  205
            ME+KGKG+ERW  AI+N +EM+ NL+SLQKLL+KKAV+VDE+T++KA L SEQARTIKVL
Sbjct  1    MEDKGKGNERWNGAISNLTEMSFNLESLQKLLLKKAVFVDEETFAKASLCSEQARTIKVL  60

Query  206  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEEL  385
            EQRVETLERELD+AI+AAAR R+EKRQAEAA+KAAEL AQE+TKELENT+KVF LHMEEL
Sbjct  61   EQRVETLERELDAAITAAARVRSEKRQAEAAEKAAELHAQEVTKELENTSKVFELHMEEL  120

Query  386  RAKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            RAKQ+EI KRDKEIKLLEAIIQTLGG++SHS
Sbjct  121  RAKQEEIVKRDKEIKLLEAIIQTLGGKESHS  151



>ref|XP_011087880.1| PREDICTED: uncharacterized protein LOC105169221 [Sesamum indicum]
Length=156

 Score =   208 bits (530),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = +2

Query  32   EKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQ  211
            EKGK SERWTAAIAN +EM+ NLDSLQKLLIKK+VYVD++T++KA L SEQARTIKVLEQ
Sbjct  7    EKGKVSERWTAAIANLTEMSSNLDSLQKLLIKKSVYVDDETFAKASLSSEQARTIKVLEQ  66

Query  212  RVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELRA  391
            RVETLERELD+AIS AA ARTEKRQAEA QKAAELQAQEI KELENT+KVF LHMEELRA
Sbjct  67   RVETLERELDAAISGAAHARTEKRQAEALQKAAELQAQEILKELENTSKVFDLHMEELRA  126

Query  392  KQDEIAKRDKEIKLLEAIIQTLGGRDS  472
            KQ+EI+KRDKEIKLLEAIIQTLGGR+S
Sbjct  127  KQEEISKRDKEIKLLEAIIQTLGGRES  153



>gb|EYU18485.1| hypothetical protein MIMGU_mgv1a015418mg [Erythranthe guttata]
Length=158

 Score =   206 bits (524),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = +2

Query  32   EKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQ  211
            EK K  ERWTAAIAN +E A NLDSLQ+LLIKKAVYVD DT++KA L SEQARTIKVLEQ
Sbjct  7    EKEKDGERWTAAIANLTETASNLDSLQRLLIKKAVYVDGDTFAKASLSSEQARTIKVLEQ  66

Query  212  RVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELRA  391
            RVETLER+LD+AISAAARARTEKRQAE AQKAAEL+A EITKELENTTKVF LHMEELRA
Sbjct  67   RVETLERKLDNAISAAARARTEKRQAEGAQKAAELRALEITKELENTTKVFELHMEELRA  126

Query  392  KQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            KQ+EI KRDKEIKLLEAIIQTLGGR S S
Sbjct  127  KQEEILKRDKEIKLLEAIIQTLGGRGSLS  155



>ref|XP_004136872.1| PREDICTED: uncharacterized protein LOC101218756 [Cucumis sativus]
 ref|XP_004155445.1| PREDICTED: uncharacterized protein LOC101224157 [Cucumis sativus]
 gb|KGN43713.1| hypothetical protein Csa_7G062790 [Cucumis sativus]
Length=148

 Score =   203 bits (516),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +2

Query  26   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  205
            ME+KGKG++RW+ A+AN +EM  NLDSLQKLL+KKAVYVD++T+++A L SEQARTIKVL
Sbjct  1    MEDKGKGTDRWSGAVANLTEMTSNLDSLQKLLLKKAVYVDDETFARASLCSEQARTIKVL  60

Query  206  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEEL  385
            EQRVETLERELD+AI++AA AR+EKRQAEAAQ+AAE+  QE+TKELENTTKVF LHM+EL
Sbjct  61   EQRVETLERELDAAITSAAHARSEKRQAEAAQRAAEVHVQEVTKELENTTKVFQLHMDEL  120

Query  386  RAKQDEIAKRDKEIKLLEAIIQTLGGRD  469
            RAKQ+EI KRDK+IKLLEAIIQTLGGR+
Sbjct  121  RAKQEEINKRDKDIKLLEAIIQTLGGRE  148



>gb|KJB47205.1| hypothetical protein B456_008G015400 [Gossypium raimondii]
Length=170

 Score =   199 bits (505),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 144/155 (93%), Gaps = 3/155 (2%)
 Frame = +2

Query  23   IMEE--KGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQART  193
            IME+  KGKGSE RWT AIAN +EMA NLDSLQKLL+KKAV+VDEDT++KA L SEQART
Sbjct  12   IMEQEVKGKGSEERWTGAIANLTEMASNLDSLQKLLLKKAVFVDEDTFAKASLTSEQART  71

Query  194  IKVLEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALH  373
            IKVLEQRVETLERE+D+AI+AAA AR+EKRQAEAAQKAAEL+AQE+TKELENTTKVF LH
Sbjct  72   IKVLEQRVETLEREVDAAITAAASARSEKRQAEAAQKAAELRAQEVTKELENTTKVFELH  131

Query  374  MEELRAKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            MEELRAKQ+EI+KRDKEIKLLEAIIQTLGG+DS S
Sbjct  132  MEELRAKQEEISKRDKEIKLLEAIIQTLGGKDSRS  166



>gb|KHG00871.1| Arginine biosynthesis bifunctional ArgJ [Gossypium arboreum]
Length=170

 Score =   196 bits (499),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 145/155 (94%), Gaps = 3/155 (2%)
 Frame = +2

Query  23   IMEE--KGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQART  193
            IME+  KGKGSE RWT AIAN +EMA NLDSLQKLL+KKAV+VDEDT++KA L SEQART
Sbjct  12   IMEQEVKGKGSEERWTGAIANLTEMASNLDSLQKLLLKKAVFVDEDTFAKASLTSEQART  71

Query  194  IKVLEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALH  373
            IKVLEQRVETLERE+D+AI+AAARAR+EKRQAEAAQKAAEL+AQE+TKELENTTKVF LH
Sbjct  72   IKVLEQRVETLEREVDAAITAAARARSEKRQAEAAQKAAELRAQEVTKELENTTKVFELH  131

Query  374  MEELRAKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            MEELRAKQ+EI+KRDKEIKLLEAIIQTLGG+DS S
Sbjct  132  MEELRAKQEEISKRDKEIKLLEAIIQTLGGKDSRS  166



>ref|XP_010094162.1| hypothetical protein L484_017206 [Morus notabilis]
 gb|EXB55295.1| hypothetical protein L484_017206 [Morus notabilis]
Length=154

 Score =   194 bits (492),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +2

Query  26   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  205
            ME+K KGSERW  AI N +EM+ NL+SLQKLL+KKAV+VDE+T++KA L SEQARTIKVL
Sbjct  1    MEDKNKGSERWNGAITNLTEMSSNLESLQKLLLKKAVFVDEETFAKASLSSEQARTIKVL  60

Query  206  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEEL  385
            EQRVETLERELD+AI+AAARAR+EKRQAEA QKAAEL+A E+TKELENTTKVF LHMEEL
Sbjct  61   EQRVETLERELDAAITAAARARSEKRQAEAVQKAAELRALEVTKELENTTKVFELHMEEL  120

Query  386  RAKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            RAKQ+EI+KRDKEIKLLEAIIQTLGG +SHS
Sbjct  121  RAKQEEISKRDKEIKLLEAIIQTLGGTESHS  151



>gb|EPS63433.1| hypothetical protein M569_11351 [Genlisea aurea]
Length=160

 Score =   193 bits (491),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = +2

Query  29   EEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLE  208
            EEK KG ERWTAAI+N + M+ N+DSLQKLL+KKAVYVD++T++KA L +EQARTIKVLE
Sbjct  5    EEKAKGDERWTAAISNLAGMSSNIDSLQKLLLKKAVYVDDETFAKASLAAEQARTIKVLE  64

Query  209  QRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELR  388
             RVE LE+ELD+AIS AARAR EKRQA+AAQKAAEL+AQEITKELENTTKVF +HMEELR
Sbjct  65   SRVENLEKELDAAISGAARARAEKRQADAAQKAAELRAQEITKELENTTKVFEVHMEELR  124

Query  389  AKQDEIAKRDKEIKLLEAIIQTLGGRDSHSIDD*N  493
             KQ+EI+KRDKEIKLLEAIIQTLG   S + +  N
Sbjct  125  MKQEEISKRDKEIKLLEAIIQTLGSSSSPARNSRN  159



>ref|XP_009372183.1| PREDICTED: uncharacterized protein LOC103961365 [Pyrus x bretschneideri]
 ref|XP_009334260.1| PREDICTED: uncharacterized protein LOC103927087 [Pyrus x bretschneideri]
Length=152

 Score =   191 bits (486),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +2

Query  26   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  205
            ME+KGKGSERW  AI N +EMA NL+SLQKLL+KKAV+V+E+T++KA L SEQARTIKVL
Sbjct  1    MEDKGKGSERWNGAIGNLTEMAFNLESLQKLLLKKAVFVEEETFAKASLCSEQARTIKVL  60

Query  206  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEEL  385
            EQRVETLERELD+AI+AAARAR EKRQAEAA+KAAEL AQE+TKELENT+KVF LHMEEL
Sbjct  61   EQRVETLERELDAAITAAARARAEKRQAEAAEKAAELHAQEVTKELENTSKVFELHMEEL  120

Query  386  RAKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            RAKQ+EIAKRDKEIKLLEAIIQTLGG++S S
Sbjct  121  RAKQEEIAKRDKEIKLLEAIIQTLGGKESSS  151



>ref|XP_002265916.2| PREDICTED: uncharacterized protein LOC100241703 [Vitis vinifera]
 emb|CBI29477.3| unnamed protein product [Vitis vinifera]
Length=156

 Score =   191 bits (485),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +2

Query  26   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  205
            MEEKGKGSERW+AAI N SEM  NL+SLQKLL+KKAV+VDE+T++KA L SEQAR IKVL
Sbjct  1    MEEKGKGSERWSAAIGNLSEMTSNLESLQKLLLKKAVFVDEETFAKASLSSEQARIIKVL  60

Query  206  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEEL  385
            EQRVETLERELD+AI+AAARAR+EKRQAEAAQKAAEL++QEIT+ELENTTKVF LHMEEL
Sbjct  61   EQRVETLERELDAAITAAARARSEKRQAEAAQKAAELRSQEITRELENTTKVFELHMEEL  120

Query  386  RAKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            RAKQ EIAKRD +IK+LEAIIQTLGG++S S
Sbjct  121  RAKQQEIAKRDSDIKVLEAIIQTLGGKESSS  151



>ref|XP_008372559.1| PREDICTED: tropomyosin-like [Malus domestica]
 ref|XP_008372560.1| PREDICTED: tropomyosin-like [Malus domestica]
Length=156

 Score =   191 bits (485),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +2

Query  26   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  205
            ME+KGKGSERW  AI N +EMA NL+SLQKLL+KKAV+V+E+T++KA L SEQARTIKVL
Sbjct  1    MEDKGKGSERWNGAIGNLTEMAFNLESLQKLLLKKAVFVEEETFAKASLCSEQARTIKVL  60

Query  206  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEEL  385
            EQRVETLERELD+AI+AAARAR EKRQAEAA+KAAEL AQE+TKELENT+KVF LHMEEL
Sbjct  61   EQRVETLERELDAAITAAARARAEKRQAEAAEKAAELHAQEVTKELENTSKVFELHMEEL  120

Query  386  RAKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            RAKQ+EIAKRDKEIKLLEAIIQTLGG++S S
Sbjct  121  RAKQEEIAKRDKEIKLLEAIIQTLGGKESSS  151



>gb|KJB47206.1| hypothetical protein B456_008G015400 [Gossypium raimondii]
Length=157

 Score =   191 bits (484),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 140/151 (93%), Gaps = 2/151 (1%)
 Frame = +2

Query  29   EEKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  205
            E KGKGSE RWT AIAN +EMA NLDSLQKLL+KKAV+VDEDT++KA L SEQARTIKVL
Sbjct  4    EVKGKGSEERWTGAIANLTEMASNLDSLQKLLLKKAVFVDEDTFAKASLTSEQARTIKVL  63

Query  206  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEEL  385
            EQRVETLERE+D+AI+AAA AR+EKRQAEAAQKAAEL+AQE+TKELENTT +F LHMEEL
Sbjct  64   EQRVETLEREVDAAITAAASARSEKRQAEAAQKAAELRAQEVTKELENTT-IFELHMEEL  122

Query  386  RAKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            RAKQ+EI+KRDKEIKLLEAIIQTLGG+DS S
Sbjct  123  RAKQEEISKRDKEIKLLEAIIQTLGGKDSRS  153



>ref|XP_008372568.1| PREDICTED: uncharacterized protein LOC103435913 isoform X3 [Malus 
domestica]
 ref|XP_008346226.1| PREDICTED: uncharacterized protein LOC103409188 isoform X3 [Malus 
domestica]
Length=156

 Score =   189 bits (481),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +2

Query  26   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  205
            ME+KGKGSERW  AI N +EMA NL+SLQKLL+KKAV+V+E+T++KA L SEQARTIKVL
Sbjct  1    MEDKGKGSERWNGAIGNLTEMAFNLESLQKLLLKKAVFVEEETFAKASLCSEQARTIKVL  60

Query  206  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEEL  385
            EQRVETLE ELD+AI+AAARAR EKRQA AA+KAAEL AQE+TKELENT+KVF LHMEEL
Sbjct  61   EQRVETLEGELDAAITAAARARXEKRQAGAAEKAAELHAQEVTKELENTSKVFELHMEEL  120

Query  386  RAKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            RAKQ+EIAKRDKEIKLLEAIIQTLGG++S S
Sbjct  121  RAKQEEIAKRDKEIKLLEAIIQTLGGKESSS  151



>ref|XP_007042974.1| Dbj:BAA96220.1 [Theobroma cacao]
 gb|EOX98805.1| Dbj:BAA96220.1 [Theobroma cacao]
Length=156

 Score =   189 bits (481),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 141/151 (93%), Gaps = 1/151 (1%)
 Frame = +2

Query  29   EEKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  205
            +EKGKGSE RW  AIAN +EMA NLDSLQKLL+KKAV+VDEDT++KA L SEQARTIKVL
Sbjct  3    QEKGKGSEERWGGAIANLTEMALNLDSLQKLLLKKAVFVDEDTFAKASLTSEQARTIKVL  62

Query  206  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEEL  385
            EQRVETLERE+D+AI+AAARAR+EKRQAEAAQKAAEL+AQE+TKELENTTKVF LH EEL
Sbjct  63   EQRVETLEREVDAAITAAARARSEKRQAEAAQKAAELRAQEVTKELENTTKVFELHTEEL  122

Query  386  RAKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            RAKQ+EI+KRDKEIKLLEAIIQTLGG+DS S
Sbjct  123  RAKQEEISKRDKEIKLLEAIIQTLGGKDSRS  153



>ref|XP_004288660.1| PREDICTED: uncharacterized protein LOC101296327 [Fragaria vesca 
subsp. vesca]
Length=154

 Score =   189 bits (479),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +2

Query  26   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  205
            ME+KGKGSER+  AIAN +EMA NL+SLQKLL+KKAV+VDE+T++KA L SEQARTIKVL
Sbjct  1    MEDKGKGSERFGGAIANLTEMALNLESLQKLLLKKAVFVDEETFTKASLCSEQARTIKVL  60

Query  206  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEEL  385
            EQRVETLERELD+AI+AAARAR+EKRQAEAA+KAAEL+AQE+TKELENT+KVF LHMEEL
Sbjct  61   EQRVETLERELDAAITAAARARSEKRQAEAAEKAAELRAQEVTKELENTSKVFELHMEEL  120

Query  386  RAKQDEIAKRDKEIKLLEAIIQTLGGRDSH  475
            RAKQ EI+KRDK+IKLLEAIIQTLGG ++H
Sbjct  121  RAKQQEISKRDKDIKLLEAIIQTLGGNEAH  150



>ref|XP_008382564.1| PREDICTED: tropomyosin-like [Malus domestica]
Length=152

 Score =   188 bits (478),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +2

Query  26   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  205
            ME+KGKGSERW  A+ N +EMA NL+SLQKLL+KKAV+V+E+T++KA L SEQARTIKVL
Sbjct  1    MEDKGKGSERWNGALGNLTEMAFNLESLQKLLLKKAVFVEEETFAKASLCSEQARTIKVL  60

Query  206  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEEL  385
            EQRVETLERELD+AI+AAARAR EKRQAEAA+KAAEL AQE+TKELENT+KVF LHMEEL
Sbjct  61   EQRVETLERELDAAITAAARARAEKRQAEAAEKAAELHAQEVTKELENTSKVFELHMEEL  120

Query  386  RAKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            RAKQ+EIAKRDKEIKLLE IIQTLGG++S S
Sbjct  121  RAKQEEIAKRDKEIKLLETIIQTLGGKESSS  151



>ref|XP_010030042.1| PREDICTED: uncharacterized protein LOC104419909 [Eucalyptus grandis]
 gb|KCW56996.1| hypothetical protein EUGRSUZ_I02667 [Eucalyptus grandis]
Length=154

 Score =   188 bits (478),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +2

Query  26   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  205
            MEEKGKGSERW  AIAN +EM+ NL+SLQKLL+KKAV+VDE+T+++A L +EQARTIK+L
Sbjct  1    MEEKGKGSERWGGAIANLTEMSSNLESLQKLLLKKAVFVDEETFARASLTAEQARTIKIL  60

Query  206  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEEL  385
            +QRVETLERELD+AI+AAARAR+EKRQAE AQKAAEL+ QEIT+ELENTTKVF LHMEEL
Sbjct  61   QQRVETLERELDAAITAAARARSEKRQAETAQKAAELRTQEITRELENTTKVFELHMEEL  120

Query  386  RAKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            RAKQ+EI KRD++IKLLEAIIQTLGG+ S S
Sbjct  121  RAKQEEIDKRDRDIKLLEAIIQTLGGKGSSS  151



>ref|XP_008372565.1| PREDICTED: uncharacterized protein LOC103435913 isoform X2 [Malus 
domestica]
 ref|XP_008372566.1| PREDICTED: uncharacterized protein LOC103435913 isoform X2 [Malus 
domestica]
 ref|XP_008372567.1| PREDICTED: uncharacterized protein LOC103435913 isoform X2 [Malus 
domestica]
 ref|XP_008346221.1| PREDICTED: uncharacterized protein LOC103409188 isoform X2 [Malus 
domestica]
 ref|XP_008346223.1| PREDICTED: uncharacterized protein LOC103409188 isoform X2 [Malus 
domestica]
 ref|XP_008346224.1| PREDICTED: uncharacterized protein LOC103409188 isoform X2 [Malus 
domestica]
 ref|XP_008346225.1| PREDICTED: uncharacterized protein LOC103409188 isoform X2 [Malus 
domestica]
Length=181

 Score =   188 bits (477),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +2

Query  26   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  205
            ME+KGKGSERW  AI N +EMA NL+SLQKLL+KKAV+V+E+T++KA L SEQARTIKVL
Sbjct  26   MEDKGKGSERWNGAIGNLTEMAFNLESLQKLLLKKAVFVEEETFAKASLCSEQARTIKVL  85

Query  206  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEEL  385
            EQRVETLE ELD+AI+AAARAR EKRQA AA+KAAEL AQE+TKELENT+KVF LHMEEL
Sbjct  86   EQRVETLEGELDAAITAAARARXEKRQAGAAEKAAELHAQEVTKELENTSKVFELHMEEL  145

Query  386  RAKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            RAKQ+EIAKRDKEIKLLEAIIQTLGG++S S
Sbjct  146  RAKQEEIAKRDKEIKLLEAIIQTLGGKESSS  176



>ref|XP_008372564.1| PREDICTED: uncharacterized protein LOC103435913 isoform X1 [Malus 
domestica]
 ref|XP_008346218.1| PREDICTED: uncharacterized protein LOC103409188 isoform X1 [Malus 
domestica]
 ref|XP_008346219.1| PREDICTED: uncharacterized protein LOC103409188 isoform X1 [Malus 
domestica]
 ref|XP_008346220.1| PREDICTED: uncharacterized protein LOC103409188 isoform X1 [Malus 
domestica]
Length=205

 Score =   188 bits (478),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +2

Query  26   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  205
            ME+KGKGSERW  AI N +EMA NL+SLQKLL+KKAV+V+E+T++KA L SEQARTIKVL
Sbjct  50   MEDKGKGSERWNGAIGNLTEMAFNLESLQKLLLKKAVFVEEETFAKASLCSEQARTIKVL  109

Query  206  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEEL  385
            EQRVETLE ELD+AI+AAARAR EKRQA AA+KAAEL AQE+TKELENT+KVF LHMEEL
Sbjct  110  EQRVETLEGELDAAITAAARARXEKRQAGAAEKAAELHAQEVTKELENTSKVFELHMEEL  169

Query  386  RAKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            RAKQ+EIAKRDKEIKLLEAIIQTLGG++S S
Sbjct  170  RAKQEEIAKRDKEIKLLEAIIQTLGGKESSS  200



>emb|CDX84501.1| BnaC03g49990D [Brassica napus]
Length=158

 Score =   186 bits (473),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 135/149 (91%), Gaps = 1/149 (1%)
 Frame = +2

Query  26   MEEKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  202
            MEE+  GSE RW  ++ N +EMA NLDSLQKLL+KKAV+V+EDT+++A L+SEQARTIKV
Sbjct  1    MEEQIGGSEDRWKGSLENITEMASNLDSLQKLLLKKAVFVEEDTFARASLVSEQARTIKV  60

Query  203  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEE  382
            LEQRV+TLERELD+AI++AA AR+EKRQAE++QKAAEL+AQE+TKELENTTKVF LHMEE
Sbjct  61   LEQRVQTLERELDAAITSAAHARSEKRQAESSQKAAELRAQEVTKELENTTKVFKLHMEE  120

Query  383  LRAKQDEIAKRDKEIKLLEAIIQTLGGRD  469
            LR  Q++I+KRD EIKLLE+IIQTLGG++
Sbjct  121  LRGMQEQISKRDNEIKLLESIIQTLGGKE  149



>ref|XP_002530267.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32107.1| conserved hypothetical protein [Ricinus communis]
Length=154

 Score =   186 bits (472),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  26   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  205
            M++   G ERW  AIAN +EMA NLDSL KLLIKKAV+VDEDT++KA L SEQARTIKVL
Sbjct  1    MDKGSSGGERWKGAIANITEMASNLDSLHKLLIKKAVFVDEDTFAKASLTSEQARTIKVL  60

Query  206  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEEL  385
            EQRV+TLERELD+AISAAARAR EKRQAEAAQKAAEL+ QEIT+ELENTTKVF LHMEEL
Sbjct  61   EQRVDTLERELDAAISAAARARAEKRQAEAAQKAAELRQQEITRELENTTKVFELHMEEL  120

Query  386  RAKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            RAKQDEI+KRD EIKLLEAIIQTLGG++ HS
Sbjct  121  RAKQDEISKRDNEIKLLEAIIQTLGGKELHS  151



>gb|KDP25845.1| hypothetical protein JCGZ_22875 [Jatropha curcas]
Length=167

 Score =   186 bits (471),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 141/158 (89%), Gaps = 4/158 (3%)
 Frame = +2

Query  26   MEEKGKGS----ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQART  193
            MEEK K      ERW  AIAN +EMA NLDSLQKLL+KKAV+VDE+T++KA L SEQART
Sbjct  1    MEEKDKNKVSSEERWKGAIANLTEMASNLDSLQKLLLKKAVFVDEETFAKASLSSEQART  60

Query  194  IKVLEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALH  373
            IKVLEQRVETLERELD+AISAAARAR EKRQAEAAQKAAEL+AQEIT+ELENTTKVF LH
Sbjct  61   IKVLEQRVETLERELDAAISAAARARAEKRQAEAAQKAAELRAQEITRELENTTKVFELH  120

Query  374  MEELRAKQDEIAKRDKEIKLLEAIIQTLGGRDSHSIDD  487
            MEELRAKQ+EI+KRD EIKLLEAIIQTLGG++SHS ++
Sbjct  121  MEELRAKQEEISKRDNEIKLLEAIIQTLGGKESHSSNE  158



>ref|XP_009358984.1| PREDICTED: uncharacterized protein LOC103949596 [Pyrus x bretschneideri]
 ref|XP_009358985.1| PREDICTED: uncharacterized protein LOC103949596 [Pyrus x bretschneideri]
 ref|XP_009358986.1| PREDICTED: uncharacterized protein LOC103949596 [Pyrus x bretschneideri]
Length=156

 Score =   184 bits (468),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +2

Query  26   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  205
            ME+K KGSERW  AI N +EMA NL+SLQKLL+KKAV+V+E+T++KA L SEQARTIKVL
Sbjct  1    MEDKRKGSERWNGAIGNLTEMAFNLESLQKLLLKKAVFVEEETFAKASLCSEQARTIKVL  60

Query  206  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEEL  385
            EQRVE+LERELD+AI+AAARAR EKRQAEAA+KAAEL AQE+T+ELENT+KVF LHMEEL
Sbjct  61   EQRVESLERELDAAITAAARARAEKRQAEAAEKAAELHAQEVTEELENTSKVFELHMEEL  120

Query  386  RAKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            RAKQ+EIAKRDKEIKLLEAIIQTLGG++S S
Sbjct  121  RAKQEEIAKRDKEIKLLEAIIQTLGGKESSS  151



>ref|XP_006487654.1| PREDICTED: tropomyosin-like isoform X1 [Citrus sinensis]
Length=162

 Score =   183 bits (465),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 137/150 (91%), Gaps = 1/150 (1%)
 Frame = +2

Query  32   EKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLE  208
            +K KGSE RW  AIAN +EM+ NL+SLQ LL+KKAV+VD+DT++KA L SEQ+RTIKVLE
Sbjct  10   QKMKGSEERWRGAIANLTEMSSNLESLQSLLLKKAVFVDDDTFTKASLSSEQSRTIKVLE  69

Query  209  QRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELR  388
            QRVETLERELD+AI+AAA AR EKRQAEAAQKAAEL+AQEITKELENTTKVF LHMEELR
Sbjct  70   QRVETLERELDAAITAAAHARLEKRQAEAAQKAAELRAQEITKELENTTKVFELHMEELR  129

Query  389  AKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            AKQ+EI+KRDKEIKLLEAIIQTLG ++SHS
Sbjct  130  AKQEEISKRDKEIKLLEAIIQTLGAKESHS  159



>gb|KDO40740.1| hypothetical protein CISIN_1g031305mg [Citrus sinensis]
Length=162

 Score =   183 bits (464),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 137/150 (91%), Gaps = 1/150 (1%)
 Frame = +2

Query  32   EKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLE  208
            +K KGSE RW  AIAN +EM+ NL+SLQ LL+KKAV+VD+DT++KA L SEQ+RTIKVLE
Sbjct  10   QKMKGSEERWRGAIANLTEMSSNLESLQSLLLKKAVFVDDDTFAKASLSSEQSRTIKVLE  69

Query  209  QRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELR  388
            QRVETLERELD+AI+AAA AR EKRQAEAAQKAAEL+AQEITKELENTTKVF LHMEELR
Sbjct  70   QRVETLERELDAAITAAAHARLEKRQAEAAQKAAELRAQEITKELENTTKVFELHMEELR  129

Query  389  AKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            AKQ+EI+KRDKEIKLLEAIIQTLG ++SHS
Sbjct  130  AKQEEISKRDKEIKLLEAIIQTLGAKESHS  159



>ref|XP_011092419.1| PREDICTED: uncharacterized protein LOC105172602 [Sesamum indicum]
 ref|XP_011092420.1| PREDICTED: uncharacterized protein LOC105172602 [Sesamum indicum]
 ref|XP_011092421.1| PREDICTED: uncharacterized protein LOC105172602 [Sesamum indicum]
Length=173

 Score =   182 bits (463),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = +2

Query  32   EKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQ  211
            EK K   RW A+IAN +EMA NLDSL KLLIKK VYVD +T++KA L SEQARTIK LEQ
Sbjct  22   EKAKAGGRWPASIANLTEMASNLDSLNKLLIKKVVYVDNETFAKASLSSEQARTIKALEQ  81

Query  212  RVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELRA  391
            RVETLERELD+AISAAARARTEKRQAEAAQKAAEL+ QEITKELENTTKVF LHMEELRA
Sbjct  82   RVETLERELDAAISAAARARTEKRQAEAAQKAAELRQQEITKELENTTKVFELHMEELRA  141

Query  392  KQDEIAKRDKEIKLLEAIIQTLGGRDSHSID  484
            KQ EI+KRDKEIKLLE+IIQTLGGR+S S D
Sbjct  142  KQQEISKRDKEIKLLESIIQTLGGRESISAD  172



>ref|XP_006423898.1| hypothetical protein CICLE_v10029442mg [Citrus clementina]
 gb|ESR37138.1| hypothetical protein CICLE_v10029442mg [Citrus clementina]
Length=162

 Score =   182 bits (461),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 136/150 (91%), Gaps = 1/150 (1%)
 Frame = +2

Query  32   EKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLE  208
            +K KGSE RW  AIAN  EM+ NL+SLQ LL+KKAV+VD+DT++KA L SEQ+RTIKVLE
Sbjct  10   QKMKGSEERWRGAIANLMEMSSNLESLQSLLLKKAVFVDDDTFAKASLSSEQSRTIKVLE  69

Query  209  QRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELR  388
            QRVETLERELD+AI+AAA AR EKRQAEAAQKAAEL+AQEITKELENTTKVF LHMEELR
Sbjct  70   QRVETLERELDAAITAAAHARLEKRQAEAAQKAAELRAQEITKELENTTKVFELHMEELR  129

Query  389  AKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            AKQ+EI+KRDKEIKLLEAIIQTLG ++SHS
Sbjct  130  AKQEEISKRDKEIKLLEAIIQTLGAKESHS  159



>ref|XP_011043705.1| PREDICTED: uncharacterized protein LOC105139082 [Populus euphratica]
Length=159

 Score =   181 bits (460),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +2

Query  35   KGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQR  214
            KG   ERW  A+ N +EM  NLDSL+KLL+KKAV+VD++T+SKA L SEQARTIKVLEQR
Sbjct  9    KGGSEERWKGAVDNLTEMTSNLDSLEKLLLKKAVFVDDETFSKASLTSEQARTIKVLEQR  68

Query  215  VETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELRAK  394
            VETLERELD+AISA+ARAR EKRQAEAAQKAAEL+AQEIT+ELENTTKVF LHMEELRAK
Sbjct  69   VETLERELDAAISASARARAEKRQAEAAQKAAELRAQEITRELENTTKVFELHMEELRAK  128

Query  395  QDEIAKRDKEIKLLEAIIQTLGGRDSHSID  484
            QDEI+KRD +IKLLEAIIQTLGG++SHS++
Sbjct  129  QDEISKRDGDIKLLEAIIQTLGGKESHSLN  158



>ref|XP_011044728.1| PREDICTED: uncharacterized protein LOC105139817 isoform X1 [Populus 
euphratica]
 ref|XP_011012585.1| PREDICTED: uncharacterized protein LOC105116801 isoform X1 [Populus 
euphratica]
Length=161

 Score =   181 bits (458),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 138/156 (88%), Gaps = 5/156 (3%)
 Frame = +2

Query  26   MEEKGKGS-----ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQAR  190
            MEEK KGS     ERW  AIAN +EM  NL+SLQKLL+KKAV+V+E+T+SKA L SEQAR
Sbjct  1    MEEKEKGSKGGSEERWKGAIANLTEMTSNLESLQKLLLKKAVFVNEETFSKASLTSEQAR  60

Query  191  TIKVLEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFAL  370
            +IKVLEQRVETLERELD+AISAAA AR EKRQAEAAQK AEL+AQEIT+ELE+TTKVF L
Sbjct  61   SIKVLEQRVETLERELDAAISAAAHARAEKRQAEAAQKDAELRAQEITRELESTTKVFEL  120

Query  371  HMEELRAKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            HMEELRAKQ+EI+KRD+EIKLLEAIIQTLGG++S S
Sbjct  121  HMEELRAKQEEISKRDREIKLLEAIIQTLGGKESRS  156



>ref|XP_010258013.1| PREDICTED: uncharacterized protein LOC104597921 [Nelumbo nucifera]
Length=154

 Score =   179 bits (455),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = +2

Query  26   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  205
            MEEK KG+ERW+A+I N SEM  NLDSLQKLL+KKAV+VDE+T++KA L SEQAR IK L
Sbjct  1    MEEKEKGNERWSASIVNLSEMGANLDSLQKLLMKKAVFVDEETFAKASLSSEQARIIKAL  60

Query  206  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEEL  385
            EQRVETLERELD+AI+AAA AR+EKRQAEAAQKAAEL AQE+T+E+ENTTKVF LHMEEL
Sbjct  61   EQRVETLERELDAAITAAAHARSEKRQAEAAQKAAELHAQEVTREIENTTKVFQLHMEEL  120

Query  386  RAKQDEIAKRDKEIKLLEAIIQTLGGRDS  472
            RAKQ+EI KR+ +IK+LEAIIQTLGG+ S
Sbjct  121  RAKQEEIYKRESDIKVLEAIIQTLGGKGS  149



>ref|XP_002317807.2| hypothetical protein POPTR_0012s02910g [Populus trichocarpa]
 gb|EEE96027.2| hypothetical protein POPTR_0012s02910g [Populus trichocarpa]
Length=217

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +2

Query  35   KGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQR  214
            KG   ERW  A+ N +EM  NLDSLQKLL+KKAV+VD++T+SKA L SEQARTIKVLEQR
Sbjct  67   KGGSEERWKGAVDNLTEMTSNLDSLQKLLVKKAVFVDDETFSKASLTSEQARTIKVLEQR  126

Query  215  VETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELRAK  394
            VETLER LD+AISAAARAR EKRQAEAAQKAAEL+AQEIT+ELENTTKVF LHMEELRAK
Sbjct  127  VETLERGLDAAISAAARARAEKRQAEAAQKAAELRAQEITRELENTTKVFELHMEELRAK  186

Query  395  QDEIAKRDKEIKLLEAIIQTLGGRDSHSID  484
            QDEI+KRD +IKLLEAIIQTLGG++SHS++
Sbjct  187  QDEISKRDGDIKLLEAIIQTLGGKESHSLN  216



>ref|NP_201223.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB09849.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL07069.1| unknown protein [Arabidopsis thaliana]
 gb|AAM45070.1| unknown protein [Arabidopsis thaliana]
 gb|AED97851.1| uncharacterized protein AT5G64180 [Arabidopsis thaliana]
Length=158

 Score =   178 bits (451),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 136/157 (87%), Gaps = 1/157 (1%)
 Frame = +2

Query  26   MEEKGKGS-ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  202
            MEE+  GS ERW  ++ N +EMA NLDSLQKLL+KKAV+V+EDT+S+A L+SEQARTIKV
Sbjct  1    MEEQFGGSDERWKGSLENITEMASNLDSLQKLLLKKAVFVEEDTFSRASLVSEQARTIKV  60

Query  203  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEE  382
            LEQRV+TLERELD+AI+AAA AR+EKRQAE++QKAAE +AQ++TKELENTTKVF LHMEE
Sbjct  61   LEQRVQTLERELDAAITAAAHARSEKRQAESSQKAAESRAQDVTKELENTTKVFKLHMEE  120

Query  383  LRAKQDEIAKRDKEIKLLEAIIQTLGGRDSHSIDD*N  493
            LR  Q++I+KRD EIKLLEAIIQTLGG++     D N
Sbjct  121  LRGMQEQISKRDNEIKLLEAIIQTLGGKERLGKSDVN  157



>emb|CDY18721.1| BnaA09g06740D [Brassica napus]
Length=158

 Score =   177 bits (450),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = +2

Query  26   MEEKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  202
            MEE+  GSE RW  ++ N +EMA NLDSLQKLL+KKAV+V+EDT+S+A L+SEQARTIKV
Sbjct  1    MEEQMGGSEDRWKGSLENITEMASNLDSLQKLLLKKAVFVEEDTFSRASLVSEQARTIKV  60

Query  203  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEE  382
            LEQRV+TLERELD+AI+AAA AR+EKRQAE++QKAAE +A E+TKELENTTKVF LHMEE
Sbjct  61   LEQRVQTLERELDAAITAAAHARSEKRQAESSQKAAESRAHEVTKELENTTKVFKLHMEE  120

Query  383  LRAKQDEIAKRDKEIKLLEAIIQTLGGRD  469
            LR  Q++I+KRD EIKLLEAIIQTLGG++
Sbjct  121  LRGMQEQISKRDNEIKLLEAIIQTLGGKE  149



>emb|CDX81215.1| BnaC09g06260D [Brassica napus]
Length=158

 Score =   177 bits (449),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 132/149 (89%), Gaps = 1/149 (1%)
 Frame = +2

Query  26   MEEKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  202
            MEE+  GSE RW  ++ N +EMA NLDSLQKLL+KKAV+V+EDT+S+A L+SEQARTIKV
Sbjct  1    MEEQMGGSEDRWRGSLENITEMASNLDSLQKLLLKKAVFVEEDTFSRASLVSEQARTIKV  60

Query  203  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEE  382
            LEQRV+TLERELD+AI+AAA AR+EKRQAE++QK AE +A E+TKELENTTKVF LHMEE
Sbjct  61   LEQRVQTLERELDAAITAAAHARSEKRQAESSQKTAETRALEVTKELENTTKVFKLHMEE  120

Query  383  LRAKQDEIAKRDKEIKLLEAIIQTLGGRD  469
            LR  Q++I+KRD EIKLLEAIIQTLGG++
Sbjct  121  LRGMQEQISKRDNEIKLLEAIIQTLGGKE  149



>ref|XP_010484189.1| PREDICTED: uncharacterized protein LOC104762571 [Camelina sativa]
Length=151

 Score =   177 bits (448),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = +2

Query  26   MEEKGKGS-ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  202
            MEE+  GS ERW  ++ N +EMA NLDSLQKLL+KKAV+V+EDT+S+A L+SEQARTIKV
Sbjct  1    MEEQIGGSDERWKGSLENITEMASNLDSLQKLLLKKAVFVEEDTFSRASLVSEQARTIKV  60

Query  203  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEE  382
            LEQRV+TLERELD+AI+AAA AR+EKRQAE++QKAAE +A E+TKELENTTKVF LHMEE
Sbjct  61   LEQRVQTLERELDAAITAAAHARSEKRQAESSQKAAESRALEVTKELENTTKVFKLHMEE  120

Query  383  LRAKQDEIAKRDKEIKLLEAIIQTLGGRD  469
            LR  Q++I+KRD EIKLLEAIIQTLGG++
Sbjct  121  LRGMQEQISKRDNEIKLLEAIIQTLGGKE  149



>ref|XP_010444348.1| PREDICTED: uncharacterized protein LOC104727050 [Camelina sativa]
Length=158

 Score =   177 bits (448),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = +2

Query  26   MEEKGKGS-ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  202
            MEE+  GS ERW  ++ N +EMA NLDSLQKLL+KKAV+V+EDT+S+A L+SEQARTIKV
Sbjct  1    MEEQIGGSDERWKGSLENITEMASNLDSLQKLLLKKAVFVEEDTFSRASLVSEQARTIKV  60

Query  203  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEE  382
            LEQRV+TLERELD+AI+AAA AR+EKRQAE++QKAAE +A E+TKELENTTKVF LHMEE
Sbjct  61   LEQRVQTLERELDAAITAAAHARSEKRQAESSQKAAESRALEVTKELENTTKVFKLHMEE  120

Query  383  LRAKQDEIAKRDKEIKLLEAIIQTLGGRD  469
            LR  Q++I+KRD EIKLLEAIIQTLGG++
Sbjct  121  LRGMQEQISKRDNEIKLLEAIIQTLGGKE  149



>ref|XP_009112121.1| PREDICTED: uncharacterized protein LOC103837517 [Brassica rapa]
Length=158

 Score =   176 bits (447),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = +2

Query  26   MEEKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  202
            MEE+  GSE RW  ++ N +EMA NLDSLQKLL+KKAV+V+EDT+S+A L+S+QARTIKV
Sbjct  1    MEEQMGGSEDRWKGSLENITEMASNLDSLQKLLLKKAVFVEEDTFSRASLVSDQARTIKV  60

Query  203  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEE  382
            LEQRV+TLERELD+AI+AAA AR+EKRQAE++QKAAE +A E+TKELENTTKVF LHMEE
Sbjct  61   LEQRVQTLERELDAAITAAAHARSEKRQAESSQKAAESRAHEVTKELENTTKVFKLHMEE  120

Query  383  LRAKQDEIAKRDKEIKLLEAIIQTLGGRD  469
            LR  Q++I+KRD EIKLLEAIIQTLGG++
Sbjct  121  LRGMQEQISKRDNEIKLLEAIIQTLGGKE  149



>ref|XP_010520965.1| PREDICTED: uncharacterized protein LOC104799966 [Tarenaya hassleriana]
Length=153

 Score =   176 bits (446),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 134/148 (91%), Gaps = 1/148 (1%)
 Frame = +2

Query  26   MEEKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  202
            MEE+ +GSE RW  ++ N +EMA NLDSLQKLL+KKAV+V+ED ++KA L+SEQARTIKV
Sbjct  1    MEEQSRGSEERWRGSLENLTEMASNLDSLQKLLLKKAVFVEEDAFAKASLVSEQARTIKV  60

Query  203  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEE  382
            LEQRVETLERELD+AI+AAA AR+EKRQAEAAQKAAEL+AQE+TKELENTTKVF LHMEE
Sbjct  61   LEQRVETLERELDAAITAAAHARSEKRQAEAAQKAAELRAQEVTKELENTTKVFKLHMEE  120

Query  383  LRAKQDEIAKRDKEIKLLEAIIQTLGGR  466
            L+  Q++IAKRD EIKLLEAIIQTLGG+
Sbjct  121  LKGMQEQIAKRDNEIKLLEAIIQTLGGK  148



>gb|KDO40739.1| hypothetical protein CISIN_1g031305mg [Citrus sinensis]
Length=161

 Score =   176 bits (446),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 136/150 (91%), Gaps = 2/150 (1%)
 Frame = +2

Query  32   EKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLE  208
            +K KGSE RW  AIAN +EM+ NL+SLQ LL+KKAV+VD+DT++KA L SEQ+RTIKVLE
Sbjct  10   QKMKGSEERWRGAIANLTEMSSNLESLQSLLLKKAVFVDDDTFAKASLSSEQSRTIKVLE  69

Query  209  QRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELR  388
            QRVETLERELD+AI+AAA AR EKRQAEAAQKAAEL+AQEITKELENTT +F LHMEELR
Sbjct  70   QRVETLERELDAAITAAAHARLEKRQAEAAQKAAELRAQEITKELENTT-IFELHMEELR  128

Query  389  AKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            AKQ+EI+KRDKEIKLLEAIIQTLG ++SHS
Sbjct  129  AKQEEISKRDKEIKLLEAIIQTLGAKESHS  158



>ref|XP_010461470.1| PREDICTED: uncharacterized protein LOC104742194 [Camelina sativa]
Length=158

 Score =   176 bits (445),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = +2

Query  26   MEEKGKGS-ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  202
            MEE+  GS ERW  ++ N +EMA NLDSLQKLL+KKAV+V+EDT+S+A L+SEQ+RTIKV
Sbjct  1    MEEQIGGSDERWKGSLENITEMASNLDSLQKLLLKKAVFVEEDTFSRASLVSEQSRTIKV  60

Query  203  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEE  382
            LEQRV+TLERELD+AI+AAA AR+EKRQAE++QKAAE +A E+TKELENTTKVF LHMEE
Sbjct  61   LEQRVQTLERELDAAITAAAHARSEKRQAESSQKAAESRALEVTKELENTTKVFKLHMEE  120

Query  383  LRAKQDEIAKRDKEIKLLEAIIQTLGGRD  469
            LR  Q++I+KRD EIKLLEAIIQTLGG++
Sbjct  121  LRGMQEQISKRDNEIKLLEAIIQTLGGKE  149



>ref|XP_006394188.1| hypothetical protein EUTSA_v10005060mg [Eutrema salsugineum]
 gb|ESQ31474.1| hypothetical protein EUTSA_v10005060mg [Eutrema salsugineum]
Length=158

 Score =   176 bits (445),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 134/149 (90%), Gaps = 1/149 (1%)
 Frame = +2

Query  26   MEEKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  202
            MEE+  GSE RW  ++ N +EMA NLDSLQKLL+KKAV+V+EDT+++A L+SEQARTIKV
Sbjct  1    MEEQIGGSEDRWKGSLENITEMASNLDSLQKLLLKKAVFVEEDTFARASLVSEQARTIKV  60

Query  203  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEE  382
            LEQRV+TLERELD+AI+AAA AR+EKRQAE++QKAAE +AQE+TKELENTTKVF LHMEE
Sbjct  61   LEQRVQTLERELDAAITAAAHARSEKRQAESSQKAAESRAQEVTKELENTTKVFKLHMEE  120

Query  383  LRAKQDEIAKRDKEIKLLEAIIQTLGGRD  469
            LR  Q++I+KRD EIKLLEAIIQTLGG++
Sbjct  121  LRGMQEQISKRDNEIKLLEAIIQTLGGKE  149



>ref|XP_010690481.1| PREDICTED: uncharacterized protein LOC104904010 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=162

 Score =   176 bits (445),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +2

Query  32   EKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQ  211
            EKGK +ERW  AIAN +EM+GNL+SL+KLL+KKAV+VDEDT++KA L S QARTIKVLEQ
Sbjct  5    EKGKTNERWDTAIANLTEMSGNLESLEKLLLKKAVFVDEDTFNKASLASHQARTIKVLEQ  64

Query  212  RVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELRA  391
            RVETLERELD++I+AAA AR+EKRQAEAAQKAAEL+ QEITKELENT+KVF LHM+ELRA
Sbjct  65   RVETLERELDASITAAAHARSEKRQAEAAQKAAELRTQEITKELENTSKVFELHMQELRA  124

Query  392  KQDEIAKRDKEIKLLEAIIQTLGGR  466
            KQ+EI+KRD +IKLLEAIIQTLGG+
Sbjct  125  KQEEISKRDNDIKLLEAIIQTLGGK  149



>ref|XP_006845889.1| hypothetical protein AMTR_s00154p00087720 [Amborella trichopoda]
 gb|ERN07564.1| hypothetical protein AMTR_s00154p00087720 [Amborella trichopoda]
Length=156

 Score =   175 bits (443),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 132/159 (83%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    SKREHQLIMEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISE  181
             +RE Q++    GKGSERW AA+ N  EM+  LDSLQKLL+ KAVY+DE+ +++A + ++
Sbjct  2    GEREGQVV----GKGSERWKAALVNVGEMSATLDSLQKLLLTKAVYLDEEAFAQASINAD  57

Query  182  QARTIKVLEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKV  361
            Q RTIK LEQRV TLE+ELDSAI+AAARAR+EKR AEA Q+AAEL+AQE+ +ELENT++V
Sbjct  58   QTRTIKALEQRVATLEKELDSAITAAARARSEKRLAEAGQRAAELRAQEVMRELENTSQV  117

Query  362  FALHMEELRAKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            F LHMEELR KQ+EI+KRD +IK+LEAIIQTLGG++  S
Sbjct  118  FKLHMEELRLKQEEISKRDSDIKVLEAIIQTLGGKECMS  156



>ref|XP_006281242.1| hypothetical protein CARUB_v10027285mg [Capsella rubella]
 gb|EOA14140.1| hypothetical protein CARUB_v10027285mg [Capsella rubella]
Length=158

 Score =   175 bits (443),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 134/149 (90%), Gaps = 1/149 (1%)
 Frame = +2

Query  26   MEEKGKGS-ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  202
            MEE+ +GS ERW  ++ N +EMA NLDSLQKL++KKAV+V+EDT+++A L+SEQARTIKV
Sbjct  1    MEEQIEGSDERWKGSLENITEMASNLDSLQKLILKKAVFVEEDTFTRASLVSEQARTIKV  60

Query  203  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEE  382
            LEQRV+TLERELD+AI+AAA AR+EKRQAE++QKAAE +A E+TKELENTTKVF LHMEE
Sbjct  61   LEQRVQTLERELDAAITAAAHARSEKRQAESSQKAAESRALEVTKELENTTKVFKLHMEE  120

Query  383  LRAKQDEIAKRDKEIKLLEAIIQTLGGRD  469
            LR  Q++I+KRD EIKLLEAIIQTLGG++
Sbjct  121  LRGMQEQISKRDNEIKLLEAIIQTLGGKE  149



>gb|AAM62887.1| unknown [Arabidopsis thaliana]
Length=158

 Score =   175 bits (443),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 135/157 (86%), Gaps = 1/157 (1%)
 Frame = +2

Query  26   MEEKGKGS-ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  202
            MEE+  GS ERW  ++ N +EMA NLDSLQKLL+KKAV+V+EDT+S+A L+SEQARTIKV
Sbjct  1    MEEQFGGSDERWKGSLENITEMASNLDSLQKLLLKKAVFVEEDTFSRASLVSEQARTIKV  60

Query  203  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEE  382
            LE RV+TLERELD+AI+AAA AR+EKRQAE++QKAAE +AQE+TKELENTTKVF LHMEE
Sbjct  61   LELRVQTLERELDAAITAAAHARSEKRQAESSQKAAESRAQEVTKELENTTKVFKLHMEE  120

Query  383  LRAKQDEIAKRDKEIKLLEAIIQTLGGRDSHSIDD*N  493
            LR  Q++I+KRD EIKLLEAIIQTLGG++     D N
Sbjct  121  LRGMQEQISKRDNEIKLLEAIIQTLGGKERLGKSDVN  157



>ref|XP_002321368.1| hypothetical protein POPTR_0015s00800g [Populus trichocarpa]
 gb|EEF05495.1| hypothetical protein POPTR_0015s00800g [Populus trichocarpa]
Length=159

 Score =   174 bits (441),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 136/156 (87%), Gaps = 5/156 (3%)
 Frame = +2

Query  26   MEEKGKGS-----ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQAR  190
            MEEK KGS     ERW  AIAN + M  NLDSLQKLL+KKAV+V+E+T+SKA L SEQAR
Sbjct  1    MEEKEKGSKGGSEERWKGAIANLTGMTLNLDSLQKLLLKKAVFVNEETFSKASLTSEQAR  60

Query  191  TIKVLEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFAL  370
            +IKVLEQRVETLERELD+AISAAA AR EKRQAEAAQK AEL+AQEIT+ELE+TTKVF L
Sbjct  61   SIKVLEQRVETLERELDAAISAAAHARAEKRQAEAAQKDAELRAQEITRELESTTKVFEL  120

Query  371  HMEELRAKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            HMEELRAKQ+EI+KR+ +IKLLEAIIQTLGG++S S
Sbjct  121  HMEELRAKQEEISKRESDIKLLEAIIQTLGGKESRS  156



>gb|KFK28102.1| hypothetical protein AALP_AA8G472800 [Arabis alpina]
Length=158

 Score =   174 bits (440),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = +2

Query  26   MEEKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  202
            M+E+  GSE RW  +I N +EM+ NLDSLQKLL+KKAV+V+EDT+S+A L+SEQARTIKV
Sbjct  1    MDEQIGGSEDRWKGSIDNITEMSSNLDSLQKLLLKKAVFVEEDTFSRASLVSEQARTIKV  60

Query  203  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEE  382
            LEQRV+TLERELD+AI+AAA AR+EKRQAE++QKAAE +A E+TKELENTTKVF LHMEE
Sbjct  61   LEQRVQTLERELDAAITAAAHARSEKRQAESSQKAAESRALEVTKELENTTKVFKLHMEE  120

Query  383  LRAKQDEIAKRDKEIKLLEAIIQTLGGRD  469
            LR  Q++I+KRD EIKLLEAIIQT+GG++
Sbjct  121  LRGMQEQISKRDNEIKLLEAIIQTVGGKE  149



>ref|XP_002864885.1| hypothetical protein ARALYDRAFT_919722 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41144.1| hypothetical protein ARALYDRAFT_919722 [Arabidopsis lyrata subsp. 
lyrata]
Length=158

 Score =   174 bits (440),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = +2

Query  26   MEEKGKGS-ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  202
            MEE+  GS ERW  ++ N +EMA NLDSLQKLL+KKAV+V+EDT+++A L+SEQARTIK+
Sbjct  1    MEEQIGGSDERWKGSLENITEMASNLDSLQKLLLKKAVFVEEDTFARASLVSEQARTIKI  60

Query  203  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEE  382
            LEQRV+TLERELD+AI+AAA AR+EKRQAE++QKAAE +AQE+TKELENTTKVF LHMEE
Sbjct  61   LEQRVQTLERELDAAITAAAHARSEKRQAESSQKAAESRAQEVTKELENTTKVFKLHMEE  120

Query  383  LRAKQDEIAKRDKEIKLLEAIIQTLGGRD  469
            LR  Q++I KRD EIKLLEAIIQTLGG++
Sbjct  121  LRGMQEQIFKRDNEIKLLEAIIQTLGGKE  149



>ref|XP_004504787.1| PREDICTED: uncharacterized protein LOC101494197 [Cicer arietinum]
Length=153

 Score =   169 bits (428),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 136/151 (90%), Gaps = 1/151 (1%)
 Frame = +2

Query  26   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  205
            M+EK KG ERW+ A+ N SEM  NL+SLQK+L+ KAV+VD+DT++KA L ++QARTIK+L
Sbjct  1    MDEKVKG-ERWSGAMTNLSEMGANLESLQKILLTKAVFVDDDTFAKASLAADQARTIKLL  59

Query  206  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEEL  385
            EQRV TLERELD+AISAAARAR+EKRQAE++QK+AEL+AQE+TKELENTTKVF LHMEEL
Sbjct  60   EQRVHTLERELDAAISAAARARSEKRQAESSQKSAELRAQEVTKELENTTKVFELHMEEL  119

Query  386  RAKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            R+KQ+EI KRD +IKLLEAIIQTLGG++S S
Sbjct  120  RSKQEEITKRDNDIKLLEAIIQTLGGKESIS  150



>gb|KHN39222.1| hypothetical protein glysoja_028027 [Glycine soja]
Length=142

 Score =   168 bits (425),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 116/152 (76%), Gaps = 20/152 (13%)
 Frame = +2

Query  26   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  205
            M E  KG ERW+ A+ N +EMA NLDSLQKLL+ KAV+VD+DT+SKA L ++QAR+IK+L
Sbjct  7    MGESEKG-ERWSGAMTNLTEMASNLDSLQKLLLTKAVFVDDDTFSKASLAADQARSIKLL  65

Query  206  EQRVETLERELDSAI-SAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEE  382
             QRV+TLERE+D+AI SA +RA+                  ++T ELENTTKVF LHMEE
Sbjct  66   HQRVQTLEREVDAAIKSAESRAQ------------------QLTAELENTTKVFELHMEE  107

Query  383  LRAKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            LRAKQ+EI KRD++IKLLEAII+TLGG++S S
Sbjct  108  LRAKQEEIEKRDEDIKLLEAIIRTLGGKESLS  139



>ref|XP_009150491.1| PREDICTED: myosin heavy chain, muscle [Brassica rapa]
 emb|CDY43797.1| BnaA06g23330D [Brassica napus]
Length=158

 Score =   169 bits (427),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = +2

Query  29   EEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLE  208
            EE G   +RW  ++ N +EMA NLDSLQKLL+KKAV+V+EDT+++A L+SEQ R IKVLE
Sbjct  3    EEIGGREDRWKGSLENITEMASNLDSLQKLLLKKAVFVEEDTFARASLVSEQGRAIKVLE  62

Query  209  QRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELR  388
            QRV+TLERELD+AI+AAA AR+EKR AE++QKAAE +AQE+TKELENTTKVF LHMEELR
Sbjct  63   QRVQTLERELDAAITAAAHARSEKRHAESSQKAAESRAQEVTKELENTTKVFKLHMEELR  122

Query  389  AKQDEIAKRDKEIKLLEAIIQTLGGRD  469
              Q++I+KRD EIKLLE+IIQTLGG++
Sbjct  123  GMQEQISKRDNEIKLLESIIQTLGGKE  149



>gb|KEH31227.1| SKIP interacting protein [Medicago truncatula]
Length=147

 Score =   167 bits (424),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 132/148 (89%), Gaps = 1/148 (1%)
 Frame = +2

Query  26   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  205
            M+   KG ERW+ A+ N SEM+ NL+SLQKLL+ KAV+VD+DT+SKA L ++QARTIK+L
Sbjct  1    MDSDSKG-ERWSGAMTNLSEMSSNLESLQKLLLTKAVFVDDDTFSKASLAADQARTIKLL  59

Query  206  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEEL  385
            +QRV TLERELD+AI+AAARAR+EKRQAEA+QKAAEL+A E+TKELENTTKVF LHMEEL
Sbjct  60   DQRVHTLERELDAAITAAARARSEKRQAEASQKAAELRALEVTKELENTTKVFELHMEEL  119

Query  386  RAKQDEIAKRDKEIKLLEAIIQTLGGRD  469
            RAKQ+EI KRD +IKLLEAIIQTLGG++
Sbjct  120  RAKQEEITKRDNDIKLLEAIIQTLGGKE  147



>ref|XP_008455213.1| PREDICTED: uncharacterized protein LOC103495430 [Cucumis melo]
Length=148

 Score =   167 bits (423),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +2

Query  26   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  205
            ME+KGKG++RW+ A+AN +EM  NLD LQKLL+KKAVYVD++T+++A L SEQARTIKVL
Sbjct  1    MEDKGKGTDRWSGAVANLTEMTSNLDLLQKLLLKKAVYVDDETFARASLCSEQARTIKVL  60

Query  206  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEEL  385
            EQRVETLERELD+AI+AAA AR+EKRQAEAAQ+AAE+  QE+TKELENTTKVF LHM+EL
Sbjct  61   EQRVETLERELDAAITAAAHARSEKRQAEAAQRAAEVHVQEVTKELENTTKVFQLHMDEL  120

Query  386  RAKQDEIAKRDKEIKLLEAIIQTLGGRD  469
            RAKQ+EI KRDK+IKLLEAIIQTLGGR+
Sbjct  121  RAKQEEINKRDKDIKLLEAIIQTLGGRE  148



>ref|XP_003524738.2| PREDICTED: uncharacterized protein LOC100804902 isoform 1 [Glycine 
max]
Length=166

 Score =   167 bits (422),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 133/151 (88%), Gaps = 1/151 (1%)
 Frame = +2

Query  26   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  205
            M E  KG ERW+ A+ N +EMA NLDSLQKLL+ KAV+VD+DT+SKA L ++QARTIK+L
Sbjct  14   MGENEKG-ERWSGAMTNLTEMASNLDSLQKLLLTKAVFVDDDTFSKASLAADQARTIKLL  72

Query  206  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEEL  385
            +QRV+TLERE+D+AI+ AARAR+EKRQAEAAQK+AE +A ++T ELENTTKVF LHMEEL
Sbjct  73   QQRVQTLEREVDAAITTAARARSEKRQAEAAQKSAESRAHQLTAELENTTKVFELHMEEL  132

Query  386  RAKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            RAKQ+EI KRD++IKLLEAII+TLGG++S S
Sbjct  133  RAKQEEIEKRDEDIKLLEAIIRTLGGKESLS  163



>ref|XP_003531035.1| PREDICTED: uncharacterized protein LOC100779456 [Glycine max]
Length=159

 Score =   165 bits (417),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 134/151 (89%), Gaps = 1/151 (1%)
 Frame = +2

Query  26   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  205
            M E  KG ERW+ A+ N +EMA NLDSLQKLL+ KAV+VD+DT+SKA L ++QAR+IK+L
Sbjct  7    MGESEKG-ERWSGAMTNLTEMASNLDSLQKLLLTKAVFVDDDTFSKASLAADQARSIKLL  65

Query  206  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEEL  385
             QRV+TLERE+D+AI+AAARAR+EKRQAEAAQK+AE +AQ++T ELENTTKVF LHMEEL
Sbjct  66   HQRVQTLEREVDAAITAAARARSEKRQAEAAQKSAESRAQQLTAELENTTKVFELHMEEL  125

Query  386  RAKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            RAKQ+EI KRD++IKLLEAII+TLGG++S S
Sbjct  126  RAKQEEIEKRDEDIKLLEAIIRTLGGKESLS  156



>gb|KHN32568.1| hypothetical protein glysoja_047900 [Glycine soja]
Length=136

 Score =   163 bits (413),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 121/137 (88%), Gaps = 4/137 (3%)
 Frame = +2

Query  68   IANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETLERELDSA  247
            + N +EMA NLDSLQKLL+ KAV+VD+DT+SKA L ++QARTIK+L+QRV+TLERE+D  
Sbjct  1    MTNLTEMASNLDSLQKLLLTKAVFVDDDTFSKASLAADQARTIKLLQQRVQTLEREVD--  58

Query  248  ISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELRAKQDEIAKRDKEI  427
              AAARAR+EKRQAEAAQK+AE +A ++T ELENTTKVF LHMEELRAKQ+EI KRD++I
Sbjct  59   --AAARARSEKRQAEAAQKSAESRAHQLTAELENTTKVFELHMEELRAKQEEIEKRDEDI  116

Query  428  KLLEAIIQTLGGRDSHS  478
            KLLEAII+TLGG++S S
Sbjct  117  KLLEAIIRTLGGKESLS  133



>ref|XP_007159096.1| hypothetical protein PHAVU_002G208400g [Phaseolus vulgaris]
 gb|ESW31090.1| hypothetical protein PHAVU_002G208400g [Phaseolus vulgaris]
Length=171

 Score =   163 bits (412),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 137/156 (88%), Gaps = 1/156 (1%)
 Frame = +2

Query  11   EHQLIMEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQAR  190
            E  ++  E  KG ERW+ A+ N +EM+ NL+SLQKLL+ KAV+VD+DT+SKA L ++QAR
Sbjct  14   ETMMMTGENEKG-ERWSGAMTNLTEMSSNLESLQKLLLTKAVFVDDDTFSKASLTADQAR  72

Query  191  TIKVLEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFAL  370
            +IK+L+QRVETLERE+D+AI+AAARAR+EKRQAEAAQKAAE +AQ++T ELENTTKVF L
Sbjct  73   SIKLLQQRVETLEREVDAAITAAARARSEKRQAEAAQKAAESRAQQLTAELENTTKVFEL  132

Query  371  HMEELRAKQDEIAKRDKEIKLLEAIIQTLGGRDSHS  478
            HMEELRAKQ+EI KRD++IKLLEAII+TLGG++S S
Sbjct  133  HMEELRAKQEEIEKRDEDIKLLEAIIRTLGGKESLS  168



>ref|XP_008785611.1| PREDICTED: uncharacterized protein LOC103704198 [Phoenix dactylifera]
Length=156

 Score =   160 bits (405),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +2

Query  50   ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETLE  229
            ERW A I N +EM  NL+SLQKLL KKAV+VD+DT++KA L ++QARTIK LEQRVE+LE
Sbjct  11   ERWKATIVNVTEMGANLESLQKLLAKKAVFVDDDTFAKASLTADQARTIKALEQRVESLE  70

Query  230  RELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELRAKQDEIA  409
            RELD+AI+AAARAR+EKRQAEAAQ++AEL AQE+T+ELENT+KVF LHMEELRAKQ+EI+
Sbjct  71   RELDAAIAAAARARSEKRQAEAAQRSAELHAQEVTRELENTSKVFKLHMEELRAKQEEIS  130

Query  410  KRDKEIKLLEAIIQTLGGRDSHSIDD  487
            K+D EIK+LEAIIQTL   DS + DD
Sbjct  131  KKDSEIKVLEAIIQTLSRNDSIAGDD  156



>ref|XP_010939192.1| PREDICTED: uncharacterized protein LOC105058098 [Elaeis guineensis]
Length=144

 Score =   160 bits (404),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 129/144 (90%), Gaps = 1/144 (1%)
 Frame = +2

Query  26   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  205
            M EK  G ERW AAI N +EM  NL+SLQKLL KKAV+VD+DT++KA L ++QARTIK L
Sbjct  1    MAEKA-GGERWKAAIVNVTEMGANLESLQKLLAKKAVFVDDDTFAKASLTADQARTIKAL  59

Query  206  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEEL  385
            EQRVETLERELD+AI+AAARAR+EKRQAEAAQ+AAEL+AQE+T+ELENT+KVF LHMEEL
Sbjct  60   EQRVETLERELDAAIAAAARARSEKRQAEAAQRAAELRAQEVTRELENTSKVFKLHMEEL  119

Query  386  RAKQDEIAKRDKEIKLLEAIIQTL  457
            RAKQ+EI+K+D EIK+LEAIIQTL
Sbjct  120  RAKQEEISKKDGEIKVLEAIIQTL  143



>gb|ADE75769.1| unknown [Picea sitchensis]
Length=176

 Score =   154 bits (389),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 121/154 (79%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    SKREHQLIME-EKGKG-SERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLI  175
             K+EHQ       G G SERW AAI N SEM   LDSLQKLL++KAVYVDE+ +++A   
Sbjct  7    GKKEHQHAPGVGMGNGASERWNAAIGNLSEMGSTLDSLQKLLLQKAVYVDEEAFAQASAN  66

Query  176  SEQARTIKVLEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTT  355
            S QAR    LE+RV+TLERELD+AI+A+A ARTEKRQAEAAQ+AAE + QE+ KELENTT
Sbjct  67   SVQARNAVALERRVKTLERELDAAITASACARTEKRQAEAAQRAAEARTQEVLKELENTT  126

Query  356  KVFALHMEELRAKQDEIAKRDKEIKLLEAIIQTL  457
            K+F LH+EELR K +EIAK+D EIK+L+AIIQTL
Sbjct  127  KIFELHIEELRTKHEEIAKKDGEIKVLQAIIQTL  160



>ref|XP_003576107.1| PREDICTED: uncharacterized protein LOC100823803 [Brachypodium 
distachyon]
Length=178

 Score =   154 bits (389),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  47   SERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETL  226
             ERW AAI N  E+  N++SLQKLL +KAV+VDED +SKA L +EQ R+IK+LEQRV +L
Sbjct  32   GERWGAAIGNLGELGANVESLQKLLARKAVFVDEDVFSKASLAAEQTRSIKILEQRVLSL  91

Query  227  ERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELRAKQDEI  406
            ERELD+AISAA+RARTEKRQAEAAQ+AAEL+AQE+TKELENT +VF LHMEELRAKQDEI
Sbjct  92   ERELDAAISAASRARTEKRQAEAAQRAAELRAQEVTKELENTARVFQLHMEELRAKQDEI  151

Query  407  AKRDKEIKLLEAIIQTLGGRDS  472
            AKRD +IK+LEAII+TL  +D+
Sbjct  152  AKRDSDIKVLEAIIRTLSSKDN  173



>ref|NP_001168817.1| hypothetical protein [Zea mays]
 gb|ACN30779.1| unknown [Zea mays]
 gb|AFW56390.1| hypothetical protein ZEAMMB73_105006 [Zea mays]
Length=187

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +2

Query  50   ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETLE  229
            ERW+AAI N  E+  N+D+LQK+L +KAV+VD+D +SKA L ++QARTIKVL+QRV++LE
Sbjct  42   ERWSAAIGNLGELGANVDALQKMLGRKAVFVDDDIFSKASLAADQARTIKVLDQRVQSLE  101

Query  230  RELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELRAKQDEIA  409
            RELD+AISAAARART+KRQAEAAQ+AAEL+ QE+TKELENT +VF LHMEELR KQ+EIA
Sbjct  102  RELDAAISAAARARTDKRQAEAAQRAAELRTQEVTKELENTARVFQLHMEELRLKQEEIA  161

Query  410  KRDKEIKLLEAIIQTLGGRD  469
            K+D +IK+LEAII+TLG +D
Sbjct  162  KKDSDIKVLEAIIRTLGSKD  181



>dbj|BAJ89520.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=171

 Score =   152 bits (383),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +2

Query  50   ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETLE  229
            ERW AAI N  E+  N++SLQKLL +KAV+VDED +SKA L SEQAR+IK+L+QRV++LE
Sbjct  26   ERWGAAIGNLGELGANVESLQKLLARKAVFVDEDVFSKASLASEQARSIKILDQRVQSLE  85

Query  230  RELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELRAKQDEIA  409
             ELD+AISAAARARTEKRQAEAAQ+AAEL+AQE+TKELENT +VF LHMEELRAKQ+EIA
Sbjct  86   HELDAAISAAARARTEKRQAEAAQRAAELRAQEVTKELENTARVFQLHMEELRAKQEEIA  145

Query  410  KRDKEIKLLEAIIQTLGGRD  469
            KRD +IK+LEAII+TL  ++
Sbjct  146  KRDSDIKVLEAIIRTLSSKE  165



>emb|CDO97456.1| unnamed protein product [Coffea canephora]
Length=135

 Score =   150 bits (379),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 119/147 (81%), Gaps = 20/147 (14%)
 Frame = +2

Query  32   EKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQ  211
            EK KGSERWTAAI N SE+A NLDSLQKLL+KKAVYV                    LEQ
Sbjct  7    EKAKGSERWTAAITNLSEIAANLDSLQKLLMKKAVYV--------------------LEQ  46

Query  212  RVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELRA  391
            RVETLERELD+AISAAARAR EKRQAEAAQKAAEL+A E+T+ELENTTKVF LHMEELRA
Sbjct  47   RVETLERELDAAISAAARARNEKRQAEAAQKAAELRALEVTRELENTTKVFELHMEELRA  106

Query  392  KQDEIAKRDKEIKLLEAIIQTLGGRDS  472
            KQ+EI+KRD EIKLLEAIIQTLGGR+S
Sbjct  107  KQEEISKRDNEIKLLEAIIQTLGGRES  133



>ref|XP_004962943.1| PREDICTED: uncharacterized protein LOC101774171 [Setaria italica]
Length=193

 Score =   151 bits (381),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +2

Query  50   ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETLE  229
            ERW+AAI N  E+  N+D LQKLL +KAV+VD+D +SKA L ++QARTIKVL+QRV++LE
Sbjct  41   ERWSAAIGNLGELGANVDGLQKLLARKAVFVDDDIFSKASLAADQARTIKVLDQRVQSLE  100

Query  230  RELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELRAKQDEIA  409
            RELD+AISAAARARTEKRQAEA Q+AAEL+AQE+TKELENT +VF LHMEELR KQ+EIA
Sbjct  101  RELDAAISAAARARTEKRQAEAGQRAAELRAQEVTKELENTARVFELHMEELRLKQEEIA  160

Query  410  KRDKEIKLLEAIIQTLGGRD  469
            K+D +IK+LEAII+TL  +D
Sbjct  161  KKDSDIKVLEAIIRTLSSKD  180



>ref|XP_002443220.1| hypothetical protein SORBIDRAFT_08g015570 [Sorghum bicolor]
 gb|EES17058.1| hypothetical protein SORBIDRAFT_08g015570 [Sorghum bicolor]
Length=191

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +2

Query  50   ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETLE  229
            ERW+AAI N  E+  N+D+LQKLL +KAV+VD+D +SKA L ++QARTIKVL+QRV++LE
Sbjct  39   ERWSAAIGNLGELGANVDALQKLLGRKAVFVDDDIFSKASLAADQARTIKVLDQRVQSLE  98

Query  230  RELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELRAKQDEIA  409
            RELD+AISAAARARTEKRQAEAAQ+AAEL+ QE+TKELENT +VF LHMEELR KQ+EIA
Sbjct  99   RELDAAISAAARARTEKRQAEAAQRAAELRTQEVTKELENTARVFELHMEELRLKQEEIA  158

Query  410  KRDKEIKLLEAIIQTLGGRD  469
            K+D +IK+LEAII+TL  +D
Sbjct  159  KKDSDIKVLEAIIRTLSSKD  178



>ref|XP_009394775.1| PREDICTED: uncharacterized protein LOC103980189 [Musa acuminata 
subsp. malaccensis]
Length=156

 Score =   149 bits (375),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 124/143 (87%), Gaps = 2/143 (1%)
 Frame = +2

Query  50   ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETLE  229
            ERW AAI N SEM  NLD++QKL+ KKAV+VDE+T+ KA LISEQ RTIKVLE RVE LE
Sbjct  12   ERWKAAIMNLSEMGANLDAMQKLMAKKAVFVDEETFVKASLISEQGRTIKVLEHRVEALE  71

Query  230  RELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELRAKQDEIA  409
            +ELD+AI+AAARAR++KRQAEAAQ+AAEL AQ++T+ELENTT VF LHMEELR++++EI+
Sbjct  72   KELDAAIAAAARARSDKRQAEAAQRAAELHAQDLTRELENTTNVFKLHMEELRSQKEEIS  131

Query  410  KRDKEIKLLEAIIQTL--GGRDS  472
            K++ EIKLLEAIIQT+   G DS
Sbjct  132  KKESEIKLLEAIIQTISKNGVDS  154



>gb|ACG26932.1| hypothetical protein [Zea mays]
Length=186

 Score =   144 bits (364),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +2

Query  50   ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETLE  229
            +RW+AAI N  E+  N+D+LQKLL +KAV+VD+D +SKA L ++QARTIKVL+QRV++LE
Sbjct  41   DRWSAAIGNLGELGANVDALQKLLGRKAVFVDDDIFSKASLAADQARTIKVLDQRVQSLE  100

Query  230  RELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELRAKQDEIA  409
            RELD+AISAAARAR EKRQAEAAQ+AAEL+ +E+T+ELENT +VF LHMEELR KQ++IA
Sbjct  101  RELDAAISAAARARAEKRQAEAAQRAAELRTREVTEELENTARVFELHMEELRLKQEDIA  160

Query  410  KRDKEIKLLEAIIQTLGGRD  469
            K+D +IK+LEAII+TL  +D
Sbjct  161  KKDSDIKVLEAIIRTLSSKD  180



>ref|NP_001145064.1| uncharacterized protein LOC100278260 [Zea mays]
 gb|ACG44746.1| hypothetical protein [Zea mays]
 tpg|DAA55402.1| TPA: hypothetical protein ZEAMMB73_575352 [Zea mays]
Length=188

 Score =   144 bits (363),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +2

Query  50   ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETLE  229
            +RW AAI N  E+  N+D+LQKLL +KAV+VD+D +SKA L ++QARTIKVL+QRV++LE
Sbjct  43   DRWCAAIGNLGELGANVDALQKLLGRKAVFVDDDIFSKASLAADQARTIKVLDQRVQSLE  102

Query  230  RELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELRAKQDEIA  409
            RELD+AISAAARAR EKRQAEAAQ+AAEL+ +E+T+ELENT +VF LHMEELR KQ++IA
Sbjct  103  RELDAAISAAARARVEKRQAEAAQRAAELRTREVTEELENTARVFELHMEELRLKQEDIA  162

Query  410  KRDKEIKLLEAIIQTLGGRD  469
            K+D +IK+LEAII+TL  +D
Sbjct  163  KKDSDIKVLEAIIRTLSSKD  182



>ref|XP_009394316.1| PREDICTED: uncharacterized protein LOC103979826 [Musa acuminata 
subsp. malaccensis]
Length=160

 Score =   141 bits (356),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = +2

Query  53   RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETLER  232
            RW AA+ N SE+  N++SLQK+L+KKAV+VDE+T++KA L SEQ RTIK LEQRVE LER
Sbjct  17   RWKAALVNISEIGTNVESLQKILVKKAVFVDEETFAKASLTSEQGRTIKALEQRVEALER  76

Query  233  ELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELRAKQDEIAK  412
            ELD+AI+AAARARTEKRQAEAAQ+AAEL+A+++T+ELENTT VF LHMEELR++++EI+K
Sbjct  77   ELDAAIAAAARARTEKRQAEAAQRAAELRAKDLTRELENTTNVFKLHMEELRSQKEEISK  136

Query  413  RDKEIKLLEAIIQTLGGRDSHSID  484
            +  EIK+LEA + TL   D+ + D
Sbjct  137  KQSEIKVLEATVLTLSRNDTSAED  160



>gb|EMS46364.1| hypothetical protein TRIUR3_27207 [Triticum urartu]
Length=237

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 121/152 (80%), Gaps = 8/152 (5%)
 Frame = +2

Query  47   SERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETL  226
             ERW AAI N  E+  N++SLQKLL +KAV+VD+D +SKA L SEQAR+IK+L+QRV++L
Sbjct  25   GERWGAAIGNLGELGANVESLQKLLARKAVFVDDDVFSKASLASEQARSIKILDQRVQSL  84

Query  227  ERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELRAKQDEI  406
            ERELD+AISAAARARTEKRQAEAAQ+AAEL AQE+TKELENT +VF LHMEELRAKQ+EI
Sbjct  85   ERELDAAISAAARARTEKRQAEAAQRAAELHAQEVTKELENTARVFQLHMEELRAKQEEI  144

Query  407  AKRDKEIKLL--------EAIIQTLGGRDSHS  478
            AKRD +IK +        E  ++ L  RD  S
Sbjct  145  AKRDSDIKWMCYAFLGTKEVAMEKLEARDKPS  176



>ref|XP_006664576.1| PREDICTED: myosin-7B-like, partial [Oryza brachyantha]
Length=139

 Score =   137 bits (346),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +2

Query  71   ANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETLERELDSAI  250
             N +E+  N+++LQKL+ KKAV+VDED +SKA L ++QARTIK+L+QRV++LERELD+AI
Sbjct  1    GNLTELGANVEALQKLMAKKAVFVDEDIFSKASLAADQARTIKILDQRVQSLERELDAAI  60

Query  251  SAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELRAKQDEIAKRDKEIK  430
            SAAARARTEKRQAEAAQ+AAEL+AQE+TKELENT KVF LHMEELRAKQ+EIAK++ +IK
Sbjct  61   SAAARARTEKRQAEAAQRAAELRAQEVTKELENTAKVFKLHMEELRAKQEEIAKKESDIK  120

Query  431  LLEAIIQTLGGRDSHSIDD  487
            +LEAII+TL  +D     D
Sbjct  121  VLEAIIRTLSNKDDGGSSD  139



>gb|ACA64832.1| SKIP interacting protein 15 [Oryza sativa]
Length=173

 Score =   137 bits (346),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +2

Query  68   IANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETLERELDSA  247
            + N +E+  N+ +LQ+LL KKAV+VDED +SKA L ++QARTIK+L+QRV++LERELD+A
Sbjct  34   VGNLTELGANVAALQRLLAKKAVFVDEDIFSKASLAADQARTIKILDQRVQSLERELDAA  93

Query  248  ISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELRAKQDEIAKRDKEI  427
            ISAAARARTEKRQAEAAQ+AAEL+AQE+TKELENT KVF LHMEELRAKQ+EIAK++ +I
Sbjct  94   ISAAARARTEKRQAEAAQRAAELRAQEVTKELENTAKVFQLHMEELRAKQEEIAKKESDI  153

Query  428  KLLEAIIQTLGGRD  469
            K+LEAII+TL  +D
Sbjct  154  KVLEAIIRTLSNKD  167



>gb|EEE53261.1| hypothetical protein OsJ_36194 [Oryza sativa Japonica Group]
Length=173

 Score =   137 bits (346),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +2

Query  68   IANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETLERELDSA  247
            + N +E+  N+ +LQ+LL KKAV+VDED +SKA L ++QARTIK+L+QRV++LERELD+A
Sbjct  34   VGNLTELGANVAALQRLLAKKAVFVDEDIFSKASLAADQARTIKILDQRVQSLERELDAA  93

Query  248  ISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELRAKQDEIAKRDKEI  427
            ISAAARARTEKRQAEAAQ+AAEL+AQE+TKELENT KVF LHMEELRAKQ+EIAK++ +I
Sbjct  94   ISAAARARTEKRQAEAAQRAAELRAQEVTKELENTAKVFKLHMEELRAKQEEIAKKESDI  153

Query  428  KLLEAIIQTLGGRD  469
            K+LEAII+TL  +D
Sbjct  154  KVLEAIIRTLSNKD  167



>gb|KCW56997.1| hypothetical protein EUGRSUZ_I02667 [Eucalyptus grandis]
Length=112

 Score =   125 bits (314),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +2

Query  26   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  205
            MEEKGKGSERW  AIAN +EM+ NL+SLQKLL+KKAV+VDE+T+++A L +EQARTIK+L
Sbjct  1    MEEKGKGSERWGGAIANLTEMSSNLESLQKLLLKKAVFVDEETFARASLTAEQARTIKIL  60

Query  206  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKV  361
            +QRVETLERELD+AI+AAARAR+EKRQAE AQKAAEL+ QEIT+ELENTT +
Sbjct  61   QQRVETLERELDAAITAAARARSEKRQAETAQKAAELRTQEITRELENTTSI  112



>ref|XP_002981396.1| hypothetical protein SELMODRAFT_114499 [Selaginella moellendorffii]
 gb|EFJ17584.1| hypothetical protein SELMODRAFT_114499 [Selaginella moellendorffii]
Length=160

 Score =   122 bits (306),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 106/138 (77%), Gaps = 0/138 (0%)
 Frame = +2

Query  44   GSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVET  223
            GS+RW+AA++N S++ G ++SL  LL+ KAVY+DE+ +  A   + Q+R     E+R+  
Sbjct  20   GSDRWSAALSNVSQIGGVVESLSGLLLHKAVYMDEEAFGHAASNARQSRNAVAQERRIRA  79

Query  224  LERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELRAKQDE  403
            LE+ELDSAI+AA +AR EK++AE+ Q+AAE   QE+ +ELENTTKVF LH+EE R K+++
Sbjct  80   LEKELDSAIAAARQARVEKKRAESLQRAAEAHCQEVLQELENTTKVFKLHLEEFRKKEED  139

Query  404  IAKRDKEIKLLEAIIQTL  457
            + ++D EI++L+AIIQT+
Sbjct  140  LTRKDSEIQVLKAIIQTM  157



>gb|ABA98637.1| expressed protein [Oryza sativa Japonica Group]
Length=208

 Score =   120 bits (300),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 120/169 (71%), Gaps = 35/169 (21%)
 Frame = +2

Query  68   IANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV---------------  202
            + N +E+  N+ +LQ+LL KKAV+VDED +SKA L ++QARTIKV               
Sbjct  34   VGNLTELGANVAALQRLLAKKAVFVDEDIFSKASLAADQARTIKVILLCFALLVAGAPDS  93

Query  203  --------------------LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqa  322
                                L+QRV++LERELD+AISAAARARTEKRQAEAAQ+AAEL+A
Sbjct  94   PPIPSPVSSAMLFCQLVDLILDQRVQSLERELDAAISAAARARTEKRQAEAAQRAAELRA  153

Query  323  qeITKELENTTKVFALHMEELRAKQDEIAKRDKEIKLLEAIIQTLGGRD  469
            QE+TKELENT KVF LHMEELRAKQ+EIAK++ +IK+LEAII+TL  +D
Sbjct  154  QEVTKELENTAKVFKLHMEELRAKQEEIAKKESDIKVLEAIIRTLSNKD  202



>ref|XP_002969920.1| hypothetical protein SELMODRAFT_170924 [Selaginella moellendorffii]
 gb|EFJ29044.1| hypothetical protein SELMODRAFT_170924 [Selaginella moellendorffii]
Length=160

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = +2

Query  44   GSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVET  223
            GS+RW+AA++N S++   ++SL   L+ KAVY+DE+ +  A   + Q+R+    E+R+  
Sbjct  20   GSDRWSAALSNVSQIGDVVESLSGFLLHKAVYMDEEAFGHAASNARQSRSAVAQERRIRA  79

Query  224  LERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELRAKQDE  403
            LE+ELDSAI+AA +AR EK++AE+ Q+AAE   QE+ +ELENTTKVF LH+EE R K+++
Sbjct  80   LEKELDSAIAAARQARVEKKRAESLQRAAEAHCQEVLQELENTTKVFKLHLEEFRKKEED  139

Query  404  IAKRDKEIKLLEAIIQTL  457
            + ++D EI++L+AIIQT+
Sbjct  140  LTRKDSEIQVLKAIIQTM  157



>ref|XP_011044729.1| PREDICTED: uncharacterized protein LOC105139817 isoform X2 [Populus 
euphratica]
 ref|XP_011012586.1| PREDICTED: uncharacterized protein LOC105116801 isoform X2 [Populus 
euphratica]
Length=135

 Score =   113 bits (283),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 107/131 (82%), Gaps = 10/131 (8%)
 Frame = +2

Query  26   MEEKGKGS-----ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQAR  190
            MEEK KGS     ERW  AIAN +EM  NL+SLQKLL+KKAV+V+E+T+SKA L SEQAR
Sbjct  1    MEEKEKGSKGGSEERWKGAIANLTEMTSNLESLQKLLLKKAVFVNEETFSKASLTSEQAR  60

Query  191  TIKVLEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKV---  361
            +IKVLEQRVETLERELD+AISAAA AR EKRQAEAAQK AEL+AQEIT+ELE+TT +   
Sbjct  61   SIKVLEQRVETLERELDAAISAAAHARAEKRQAEAAQKDAELRAQEITRELESTTSMPTV  120

Query  362  --FALHMEELR  388
              F L++ E++
Sbjct  121  SSFQLYICEIK  131



>gb|KDO40741.1| hypothetical protein CISIN_1g031305mg [Citrus sinensis]
Length=122

 Score =   113 bits (282),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = +2

Query  32   EKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLE  208
            +K KGSE RW  AIAN +EM+ NL+SLQ LL+KKAV+VD+DT++KA L SEQ+RTIKVLE
Sbjct  10   QKMKGSEERWRGAIANLTEMSSNLESLQSLLLKKAVFVDDDTFAKASLSSEQSRTIKVLE  69

Query  209  QRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTT  355
            QRVETLERELD+AI+AAA AR EKRQAEAAQKAAEL+AQEITKELENTT
Sbjct  70   QRVETLERELDAAITAAAHARLEKRQAEAAQKAAELRAQEITKELENTT  118



>gb|KDO40742.1| hypothetical protein CISIN_1g031305mg [Citrus sinensis]
Length=143

 Score =   113 bits (283),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = +2

Query  32   EKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLE  208
            +K KGSE RW  AIAN +EM+ NL+SLQ LL+KKAV+VD+DT++KA L SEQ+RTIKVLE
Sbjct  10   QKMKGSEERWRGAIANLTEMSSNLESLQSLLLKKAVFVDDDTFAKASLSSEQSRTIKVLE  69

Query  209  QRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTT  355
            QRVETLERELD+AI+AAA AR EKRQAEAAQKAAEL+AQEITKELENTT
Sbjct  70   QRVETLERELDAAITAAAHARLEKRQAEAAQKAAELRAQEITKELENTT  118



>ref|XP_006423897.1| hypothetical protein CICLE_v10029442mg [Citrus clementina]
 gb|ESR37137.1| hypothetical protein CICLE_v10029442mg [Citrus clementina]
Length=143

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = +2

Query  32   EKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLE  208
            +K KGSE RW  AIAN  EM+ NL+SLQ LL+KKAV+VD+DT++KA L SEQ+RTIKVLE
Sbjct  10   QKMKGSEERWRGAIANLMEMSSNLESLQSLLLKKAVFVDDDTFAKASLSSEQSRTIKVLE  69

Query  209  QRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTT  355
            QRVETLERELD+AI+AAA AR EKRQAEAAQKAAEL+AQEITKELENTT
Sbjct  70   QRVETLERELDAAITAAAHARLEKRQAEAAQKAAELRAQEITKELENTT  118



>ref|XP_001779944.1| predicted protein [Physcomitrella patens]
 gb|EDQ55261.1| predicted protein [Physcomitrella patens]
Length=165

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 110/137 (80%), Gaps = 1/137 (1%)
 Frame = +2

Query  47   SERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETL  226
            S+R+ AA+AN ++M  +L+SLQ +L +KAVY+DED ++ A  +S Q+RT+K  E+R++ L
Sbjct  20   SDRFAAALANVNDMGQSLESLQSML-RKAVYLDEDVFANASAVSNQSRTLKAQERRIKAL  78

Query  227  ERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKVFALHMEELRAKQDEI  406
            ERELD+AI+AA  AR EK+QAEA Q+AAE + QE+ +ELENT  VF LH EELRAKQ+E+
Sbjct  79   ERELDAAIAAAGHARAEKKQAEAGQRAAEARVQEVLRELENTAVVFKLHAEELRAKQEEV  138

Query  407  AKRDKEIKLLEAIIQTL  457
             K+++EI++L+AII TL
Sbjct  139  GKKNEEIQVLKAIIDTL  155



>ref|XP_010690482.1| PREDICTED: uncharacterized protein LOC104904010 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=145

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +2

Query  32   EKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQ  211
            EKGK +ERW  AIAN +EM+GNL+SL+KLL+KKAV+VDEDT++KA L S QARTIKVLEQ
Sbjct  5    EKGKTNERWDTAIANLTEMSGNLESLEKLLLKKAVFVDEDTFNKASLASHQARTIKVLEQ  64

Query  212  RVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTT  355
            RVETLERELD++I+AAA AR+EKRQAEAAQKAAEL+ QEITKELENT+
Sbjct  65   RVETLERELDASITAAAHARSEKRQAEAAQKAAELRTQEITKELENTS  112



>ref|XP_006487655.1| PREDICTED: tropomyosin-like isoform X2 [Citrus sinensis]
Length=145

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = +2

Query  32   EKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLE  208
            +K KGSE RW  AIAN +EM+ NL+SLQ LL+KKAV+VD+DT++KA L SEQ+RTIKVLE
Sbjct  10   QKMKGSEERWRGAIANLTEMSSNLESLQSLLLKKAVFVDDDTFTKASLSSEQSRTIKVLE  69

Query  209  QRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTT  355
            QRVETLERELD+AI+AAA AR EKRQAEAAQKAAEL+AQEITKELENTT
Sbjct  70   QRVETLERELDAAITAAAHARLEKRQAEAAQKAAELRAQEITKELENTT  118



>ref|NP_001066826.2| Os12g0502100 [Oryza sativa Japonica Group]
 dbj|BAF29845.2| Os12g0502100 [Oryza sativa Japonica Group]
Length=188

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 109/143 (76%), Gaps = 22/143 (15%)
 Frame = +2

Query  68   IANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV---------------  202
            + N +E+  N+ +LQ+LL KKAV+VDED +SKA L ++QARTIKV               
Sbjct  34   VGNLTELGANVAALQRLLAKKAVFVDEDIFSKASLAADQARTIKVILLCFALLVAGAPDS  93

Query  203  -------LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKV  361
                   L+QRV++LERELD+AISAAARARTEKRQAEAAQ+AAEL+AQE+TKELENT KV
Sbjct  94   PPIPSPILDQRVQSLERELDAAISAAARARTEKRQAEAAQRAAELRAQEVTKELENTAKV  153

Query  362  FALHMEELRAKQDEIAKRDKEIK  430
            F LHMEELRAKQ+EIAK++ +IK
Sbjct  154  FKLHMEELRAKQEEIAKKESDIK  176



>ref|XP_008672642.1| PREDICTED: uncharacterized protein LOC100278260 isoform X1 [Zea 
mays]
 tpg|DAA55403.1| TPA: hypothetical protein ZEAMMB73_575352 [Zea mays]
Length=192

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +2

Query  47   SERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETL  226
             +RW AAI N  E+  N+D+LQKLL +KAV+VD+D +SKA L ++QARTIKVL+QRV++L
Sbjct  42   GDRWCAAIGNLGELGANVDALQKLLGRKAVFVDDDIFSKASLAADQARTIKVLDQRVQSL  101

Query  227  ERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELENTTKV  361
            ERELD+AISAAARAR EKRQAEAAQ+AAEL+ +E+T+ELENT  +
Sbjct  102  ERELDAAISAAARARVEKRQAEAAQRAAELRTREVTEELENTASM  146



>gb|EAY83218.1| hypothetical protein OsI_38427 [Oryza sativa Indica Group]
Length=242

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 91/101 (90%), Gaps = 2/101 (2%)
 Frame = +2

Query  167  YLISEQARTIKVLEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKELE  346
            +++SE   TI  L+QRV++LERELD+AISAAARARTEKRQAEAAQ+AAEL+AQE+TKELE
Sbjct  138  HVLSELPNTI--LDQRVQSLERELDAAISAAARARTEKRQAEAAQRAAELRAQEVTKELE  195

Query  347  NTTKVFALHMEELRAKQDEIAKRDKEIKLLEAIIQTLGGRD  469
            NT KVF LHMEELRAKQ+EIAK++ +IK+LEAII+TL  +D
Sbjct  196  NTAKVFQLHMEELRAKQEEIAKKESDIKVLEAIIRTLSNKD  236


 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +2

Query  68   IANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  205
            + N +E+  N+ +LQ+LL KKAV+VDED +SKA L ++QARTIKV+
Sbjct  34   VGNLTELGANVAALQRLLAKKAVFVDEDIFSKASLAADQARTIKVI  79



>ref|XP_008672643.1| PREDICTED: uncharacterized protein LOC100278260 isoform X2 [Zea 
mays]
Length=191

 Score = 76.6 bits (187),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 50/68 (74%), Gaps = 2/68 (3%)
 Frame = +2

Query  47   SERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVE--  220
             +RW AAI N  E+  N+D+LQKLL +KAV+VD+D +SKA L ++QARTIKV  Q ++  
Sbjct  42   GDRWCAAIGNLGELGANVDALQKLLGRKAVFVDDDIFSKASLAADQARTIKVPSQILQHR  101

Query  221  TLERELDS  244
            T+ER  +S
Sbjct  102  TIERGGES  109



>ref|XP_009394773.1| PREDICTED: mitochondrial substrate carrier family protein E [Musa 
acuminata subsp. malaccensis]
Length=388

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 45/76 (59%), Gaps = 10/76 (13%)
 Frame = +2

Query  26   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  205
            M EKG G           SEM  N DS+QKLL KKAV+VD++ ++KA LISEQARTIKVL
Sbjct  1    MAEKGGGD----------SEMGANPDSMQKLLAKKAVFVDKEPFAKASLISEQARTIKVL  50

Query  206  EQRVETLERELDSAIS  253
            E   E L   L     
Sbjct  51   EHGREFLWGALAGGFG  66



>gb|AGT16664.1| hypothetical protein SHCRBa_107_F16_F_190 [Saccharum hybrid cultivar 
R570]
Length=504

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  47   SERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  202
             E+W+A I N  E++ N+D+LQKLL +KA++VD+D +SKA L ++QARTIK+
Sbjct  78   GEQWSAPIGNLGELSANVDALQKLLRRKAIFVDDDIFSKASLAADQARTIKM  129



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 788578232940