BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP008E04 496 bp,

Length=496
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009590328.1|  PREDICTED: SUN domain-containing protein 3-like    100   1e-21   Nicotiana tomentosiformis
ref|XP_006347692.1|  PREDICTED: SUN domain-containing protein 2-like  99.0    3e-21   Solanum tuberosum [potatoes]
ref|XP_004230055.1|  PREDICTED: SUN domain-containing protein 3-like  93.2    5e-19   Solanum lycopersicum
ref|XP_009801788.1|  PREDICTED: SUN domain-containing protein 3-like  90.9    3e-18   Nicotiana sylvestris
ref|XP_009355068.1|  PREDICTED: SUN domain-containing protein 2-like  86.7    8e-17   Pyrus x bretschneideri [bai li]
gb|KDP20591.1|  hypothetical protein JCGZ_04204                       87.0    8e-17   Jatropha curcas
ref|XP_008231751.1|  PREDICTED: LOW QUALITY PROTEIN: SUN domain-c...  86.7    9e-17   Prunus mume [ume]
ref|XP_007218978.1|  hypothetical protein PRUPE_ppa003932mg           86.7    1e-16   Prunus persica
ref|XP_007133549.1|  hypothetical protein PHAVU_011G188500g           80.5    2e-14   Phaseolus vulgaris [French bean]
ref|XP_008346159.1|  PREDICTED: SUN domain-containing protein 3       80.1    2e-14   Malus domestica [apple tree]
ref|XP_002523394.1|  conserved hypothetical protein                   78.2    1e-13   Ricinus communis
ref|XP_011046489.1|  PREDICTED: nuclear migration and anchoring p...  75.9    5e-13   Populus euphratica
gb|KDO53802.1|  hypothetical protein CISIN_1g044738mg                 72.8    4e-12   Citrus sinensis [Valencia orange]
ref|XP_006432531.1|  hypothetical protein CICLE_v10001582mg           72.8    4e-12   Citrus clementina
ref|XP_011086123.1|  PREDICTED: SUN domain-containing protein 2-like  72.4    7e-12   Sesamum indicum [beniseed]
ref|XP_006471288.1|  PREDICTED: SUN domain-containing protein 2-like  72.4    9e-12   Citrus sinensis [Valencia orange]
ref|XP_008456648.1|  PREDICTED: SUN domain-containing protein 2       71.6    2e-11   Cucumis melo [Oriental melon]
ref|XP_010091304.1|  hypothetical protein L484_012197                 71.6    2e-11   Morus notabilis
ref|XP_007010671.1|  SAD1/UNC-84 domain protein 2, putative           70.5    4e-11   Theobroma cacao [chocolate]
gb|EYU26915.1|  hypothetical protein MIMGU_mgv1a006568mg              69.3    8e-11   Erythranthe guttata [common monkey flower]
gb|KHG18959.1|  SUN domain-containing 1                               69.3    9e-11   Gossypium arboreum [tree cotton]
ref|XP_004172097.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  68.6    2e-10   
ref|XP_004140926.1|  PREDICTED: uncharacterized protein LOC101214156  68.6    2e-10   Cucumis sativus [cucumbers]
gb|KJB75044.1|  hypothetical protein B456_012G020700                  68.2    2e-10   Gossypium raimondii
ref|XP_010276886.1|  PREDICTED: SUN domain-containing protein 3-like  67.0    5e-10   Nelumbo nucifera [Indian lotus]
ref|XP_004511152.1|  PREDICTED: SUN domain-containing protein 1-like  67.0    6e-10   Cicer arietinum [garbanzo]
ref|XP_009339239.1|  PREDICTED: SUN domain-containing protein 3-like  65.1    3e-09   Pyrus x bretschneideri [bai li]
ref|XP_010694883.1|  PREDICTED: SUN domain-containing protein 3       64.3    5e-09   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|KJB67806.1|  hypothetical protein B456_010G212200                  63.5    9e-09   Gossypium raimondii
gb|KHG26525.1|  SUN domain-containing 2                               63.5    1e-08   Gossypium arboreum [tree cotton]
gb|KCW50612.1|  hypothetical protein EUGRSUZ_J00319                   62.0    2e-08   Eucalyptus grandis [rose gum]
gb|EPS70209.1|  hypothetical protein M569_04554                       62.0    2e-08   Genlisea aurea
ref|XP_010031348.1|  PREDICTED: SUN domain-containing protein 3       62.0    3e-08   Eucalyptus grandis [rose gum]
ref|XP_008375408.1|  PREDICTED: SUN domain-containing protein 2-l...  60.1    1e-07   Malus domestica [apple tree]
ref|XP_008375409.1|  PREDICTED: SUN domain-containing protein 2-l...  60.1    1e-07   Malus domestica [apple tree]
ref|XP_003628099.1|  SUN domain-containing protein                    59.7    2e-07   Medicago truncatula
ref|XP_002265646.1|  PREDICTED: SUN domain-containing protein 3-like  57.8    6e-07   Vitis vinifera
ref|XP_003546680.1|  PREDICTED: SUN domain-containing protein 1-l...  57.4    9e-07   
ref|XP_002315397.2|  hypothetical protein POPTR_0010s25420g           57.4    1e-06   Populus trichocarpa [western balsam poplar]
emb|CAN63550.1|  hypothetical protein VITISV_043049                   57.0    1e-06   Vitis vinifera
ref|XP_008356832.1|  PREDICTED: SUN domain-containing protein 2-like  54.7    7e-06   Malus domestica [apple tree]
ref|XP_004306444.1|  PREDICTED: SUN domain-containing protein 2       54.3    9e-06   Fragaria vesca subsp. vesca
ref|XP_003542777.1|  PREDICTED: SUN domain-containing protein 1-like  52.4    4e-05   Glycine max [soybeans]
ref|XP_009417884.1|  PREDICTED: SUN domain-containing protein 3-like  52.0    5e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002873180.1|  hypothetical protein ARALYDRAFT_908391           50.8    1e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_008804985.1|  PREDICTED: SUN domain-containing protein 1-like  48.1    8e-04   



>ref|XP_009590328.1| PREDICTED: SUN domain-containing protein 3-like [Nicotiana tomentosiformis]
Length=463

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 116/169 (69%), Gaps = 23/169 (14%)
 Frame = +3

Query  9    VSITANPSSVATRRRTAVEKRQPaaldiaesnlaaaaaaaavaSPSTGNDKHAAGDAAIK  188
            VSITANP+S +TRRR AVEK+QP+ALD+A+SNLA AAAAAA    ST N           
Sbjct  6    VSITANPASGSTRRR-AVEKKQPSALDLADSNLATAAAAAAADPISTPN-----------  53

Query  189  DLSQHSIRTETRDAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEKP------RWLTVVS  350
                 S R++ RDAIQ V+KPLPN+N    S+RRA  +  ++  +KP      RWLTVVS
Sbjct  54   ----ISFRSDGRDAIQVVKKPLPNTNAPTSSTRRASGSAAAAAAKKPSKPPKPRWLTVVS  109

Query  351  IFTKNFCLLLIIVGLIQMVRRIFFDSGSRN-ADGLTVISDDFEGKVAEL  494
            +FTKN  LLL++VGLIQMVRR+  +S + N +DGL VIS DFEGK AE+
Sbjct  110  VFTKNLLLLLVLVGLIQMVRRLVMNSNNVNDSDGLAVISGDFEGKFAEM  158



>ref|XP_006347692.1| PREDICTED: SUN domain-containing protein 2-like [Solanum tuberosum]
Length=463

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 116/168 (69%), Gaps = 22/168 (13%)
 Frame = +3

Query  9    VSITANPSSVATRRRTAVEKRQPaaldiaesnlaaaaaaaavaSP-STGNDKHAAGDAAI  185
            VSI+ANP++ +TRRR AVEK+QP ALD+A+SNLA A AAAA A P ST N          
Sbjct  6    VSISANPATASTRRR-AVEKKQPTALDLADSNLATATAAAAAADPISTPN----------  54

Query  186  KDLSQHSIRTETRDAIQAVRKPLPNSNGAAPSSRR----AGTTKKSSKPEKPRWLTVVSI  353
                  S R+++RDAIQ V+K LP++N    S+RR    A   KK +K  KPRWLTVVS+
Sbjct  55   -----VSYRSDSRDAIQVVKKTLPHTNVPTSSTRRPSGTASAVKKHTKTPKPRWLTVVSV  109

Query  354  FTKNFCLLLIIVGLIQMVRRIFFDS-GSRNADGLTVISDDFEGKVAEL  494
             TKN  L+++++GL+QMVRR+  +S  + ++DGL+VIS DF+GK AE+
Sbjct  110  VTKNLLLVIVLIGLVQMVRRLVANSYQTSDSDGLSVISGDFDGKFAEM  157



>ref|XP_004230055.1| PREDICTED: SUN domain-containing protein 3-like [Solanum lycopersicum]
Length=468

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 114/167 (68%), Gaps = 15/167 (9%)
 Frame = +3

Query  9    VSITANPSSVATRRRTAVEKRQPaaldiaesnlaaaaaaaavaSPSTGNDKHAAGDAAIK  188
            VSI+ANP++ +TRRR AVEK+QP ALD+A+SNLA A AAAA A+ +  +           
Sbjct  6    VSISANPATASTRRR-AVEKKQPTALDLADSNLATATAAAAAAAAAAADPISTP------  58

Query  189  DLSQHSIRTETRDAIQAVRKPLPNSNGAAPSSRR----AGTTKKSSKPEKPRWLTVVSIF  356
                 S R+++RDAIQ V+K LP++N    S+RR    A   KK +K  KPRWLTVVS+ 
Sbjct  59   ---NVSYRSDSRDAIQVVKKTLPHTNVPTSSTRRPSGSASAVKKHTKTPKPRWLTVVSVV  115

Query  357  TKNFCLLLIIVGLIQMVRRIFFDS-GSRNADGLTVISDDFEGKVAEL  494
            TKN  L+++++GL+QMVRR+  +S  + ++DGL VIS DF+GK AE+
Sbjct  116  TKNLLLVIVLIGLVQMVRRLVGNSYQTSDSDGLAVISGDFDGKFAEM  162



>ref|XP_009801788.1| PREDICTED: SUN domain-containing protein 3-like [Nicotiana sylvestris]
Length=459

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 106/168 (63%), Gaps = 25/168 (15%)
 Frame = +3

Query  9    VSITANPSSVATRRRTAVEKRQPaaldiaesnlaaaaaaaavaS-PSTGNDKHAAGDAAI  185
            VSITANP+S + RRR AVEK+QP+ L  +    AAAAAAA   S P+             
Sbjct  6    VSITANPASGSARRR-AVEKKQPSDLADSNLATAAAAAAADPISTPNI------------  52

Query  186  KDLSQHSIRTETRDAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEKP----RWLTVVSI  353
                  S R++ RDAIQ V+KPLPN+N    S+RRA  +  ++K        RWLTVVS+
Sbjct  53   ------SFRSDGRDAIQVVKKPLPNTNAPTSSTRRASGSAAAAKKPSKPPKPRWLTVVSV  106

Query  354  FTKNFCLLLIIVGLIQMVRRIFFDSGSRN-ADGLTVISDDFEGKVAEL  494
            FTKN  LLL++VGLIQMVRR+  +S + N +DGL VIS DFEGK AE+
Sbjct  107  FTKNLLLLLVLVGLIQMVRRLVMNSNNVNDSDGLAVISGDFEGKFAEM  154



>ref|XP_009355068.1| PREDICTED: SUN domain-containing protein 2-like [Pyrus x bretschneideri]
Length=454

 Score = 86.7 bits (213),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 90/165 (55%), Gaps = 26/165 (16%)
 Frame = +3

Query  9    VSITANPSSVATRRRTAVEKRQPaaldiaesnlaaaaaaaavaSPSTGNDKHAAGDAAI-  185
            VSITANP++   R   AV+K+              +      A P T    H A D A  
Sbjct  6    VSITANPATTRRRPVVAVDKKS-------------SNIELVSAEPQT----HKADDTATN  48

Query  186  -KDLSQHSIRTE-TRDAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEKPRWLTVVSIFT  359
             KDLS HSIR E   D     +K  PNS  + PSSRR+  T  ++ P KPRW+TV+ IF+
Sbjct  49   SKDLSHHSIRGEPGLDRSAQPKKTGPNSTISPPSSRRSRKTL-AADP-KPRWVTVLRIFS  106

Query  360  KNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
            KNF LL++I+GL Q+VRR+   SG     G+ +   D EG++AE+
Sbjct  107  KNFILLVLILGLFQIVRRLALGSGV----GVPMAFTDLEGRIAEV  147



>gb|KDP20591.1| hypothetical protein JCGZ_04204 [Jatropha curcas]
Length=471

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 73/122 (60%), Gaps = 15/122 (12%)
 Frame = +3

Query  153  NDKHAAGDAAIKDLSQHSIRTE------TRDAIQAVRKPLPNSNGAAPSSRRAGTTKKSS  314
            NDK  A  +  KDLS HSIR E      T+D  Q  +  + NS  +   SR     K  +
Sbjct  49   NDKLVASHS--KDLSHHSIRGEAVLERSTKDTTQVKKNAMVNSTISPRRSR-----KMVA  101

Query  315  KPEKPRWLTVVSIFTKNFCLLLIIVGLIQMVRRIFFDSGSRNADGLT--VISDDFEGKVA  488
            KPEKP W TVVS+FTKNF LLL+++GL+QM+RR+   SG  ++   T  + + +FE ++A
Sbjct  102  KPEKPMWQTVVSVFTKNFFLLLVLIGLVQMIRRLAMKSGDYHSISGTAQIGASEFESRIA  161

Query  489  EL  494
            E+
Sbjct  162  EV  163



>ref|XP_008231751.1| PREDICTED: LOW QUALITY PROTEIN: SUN domain-containing protein 
2-like [Prunus mume]
Length=444

 Score = 86.7 bits (213),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 88/165 (53%), Gaps = 26/165 (16%)
 Frame = +3

Query  9    VSITANPSSVATRRRT--AVEKRQPaaldiaesnlaaaaaaaavaSPSTGNDKHAAGDAA  182
            VSITANP++  TRRRT  AVEK+      ++                    D  A   A 
Sbjct  6    VSITANPATT-TRRRTVVAVEKKSTNIELVSAEKA----------------DGKAETGAN  48

Query  183  IKDLSQHSIRTE-TRDAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEKPRWLTVVSIFT  359
             KDLS HSIR E   D     +K  PNS  + PS+RR  + +  +    PRW+TV+ IF 
Sbjct  49   SKDLSHHSIRGEPGLDRSAHGKKTAPNSTISPPSNRR--SRRSVAVDPNPRWVTVLRIFA  106

Query  360  KNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
            KNF LLL++VGL Q+VRR+   SG    DG+ +   + EG++AE+
Sbjct  107  KNFILLLLVVGLFQIVRRLALRSG----DGVPMAFSELEGRIAEV  147



>ref|XP_007218978.1| hypothetical protein PRUPE_ppa003932mg [Prunus persica]
 gb|EMJ20177.1| hypothetical protein PRUPE_ppa003932mg [Prunus persica]
Length=539

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 90/165 (55%), Gaps = 26/165 (16%)
 Frame = +3

Query  9    VSITANPSSVATRRRT--AVEKRQPaaldiaesnlaaaaaaaavaSPSTGNDKHAAGDAA  182
            VSITANP++  TRRRT  AVEK+               +    + S    + K   G  +
Sbjct  88   VSITANPAT-TTRRRTVVAVEKK---------------STNIELVSAEKADGKAETGGNS  131

Query  183  IKDLSQHSIRTE-TRDAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEKPRWLTVVSIFT  359
             KDLS HSIR E   D     +K  PNS  + PS+RR  + +  +    PRW+TV+ IF 
Sbjct  132  -KDLSHHSIRGEPGLDRSAHGKKTGPNSTISPPSNRR--SRRSVAVDPNPRWVTVLRIFA  188

Query  360  KNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
            KNF LLL+IVGL Q+VRR+   SG    DG+ +   D EG++AE+
Sbjct  189  KNFILLLLIVGLFQIVRRLALRSG----DGVPMAFSDLEGRIAEV  229



>ref|XP_007133549.1| hypothetical protein PHAVU_011G188500g [Phaseolus vulgaris]
 gb|ESW05543.1| hypothetical protein PHAVU_011G188500g [Phaseolus vulgaris]
Length=465

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 68/125 (54%), Gaps = 10/125 (8%)
 Frame = +3

Query  138  SPSTGNDKHAAGDAAIKDLSQHSIRTET------RDAIQAVRKPLPNSNGAAPSSRRAGT  299
            SP+       A  A  +DLS HSIR E       RD   A +      N  +  +RRA  
Sbjct  41   SPTFATSGEGAAGAG-RDLSHHSIRGEALLDRIPRDLTPAKKVVGAGGNSLSVPTRRA--  97

Query  300  TKKSSKPEKPRWLTVVSIFTKNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEG  479
             K S K EKPRWLTVVSIF KN  L +++ GL+Q+ RR+   SG   A G   +S +FEG
Sbjct  98   RKSSVKAEKPRWLTVVSIFGKNLVLFVVLAGLVQLFRRVALKSGDGEAGGYAGLS-EFEG  156

Query  480  KVAEL  494
            +++++
Sbjct  157  RISDV  161



>ref|XP_008346159.1| PREDICTED: SUN domain-containing protein 3 [Malus domestica]
 ref|XP_008344465.1| PREDICTED: SUN domain-containing protein 3-like [Malus domestica]
Length=454

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 89/165 (54%), Gaps = 26/165 (16%)
 Frame = +3

Query  9    VSITANPSSVATRRRTAVEKRQPaaldiaesnlaaaaaaaavaSPSTGNDKHAAGDAAI-  185
            VSITANP++  TRRR  V             +  ++      A P T    H A D A  
Sbjct  6    VSITANPAT--TRRRPVV-----------AFDKKSSNIELVSAEPQT----HKADDTATN  48

Query  186  -KDLSQHSIRTE-TRDAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEKPRWLTVVSIFT  359
             KDLS +SIR E   D     +K  PNS  + PSSRR+  T  ++ P KPRW+TV+ +F 
Sbjct  49   SKDLSHYSIRGEPALDRSAQPKKTGPNSTISPPSSRRSRKTL-AADP-KPRWVTVLRVFF  106

Query  360  KNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
            KNF LL++I+GL Q+VRR+   SG     G+ +   D EG++ E+
Sbjct  107  KNFILLVLILGLFQIVRRLALGSGV----GVPMAFSDLEGRIXEV  147



>ref|XP_002523394.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38973.1| conserved hypothetical protein [Ricinus communis]
Length=471

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 86/169 (51%), Gaps = 19/169 (11%)
 Frame = +3

Query  9    VSITANPSSVATRRRTAV--EKRQPaaldiaesnlaaaaaaaavaSPSTGNDKHAAGDAA  182
            VSITANP   A RRR  V  EK+      I      A       A+   GN+K  +  + 
Sbjct  6    VSITANP---AARRRPVVAGEKKSNNNNSIELLGSEAQFNGGGPANVIMGNEKLLSSQS-  61

Query  183  IKDLSQHSIRTETRDAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEKPRWLTVVSIFTK  362
             KDLS HSI  E +D   A  K       +  S  R   TK   +  KPRWLTV SIFTK
Sbjct  62   -KDLSHHSI-LERKDVTTAQLKK------STISPHRRTRTKVVPEKSKPRWLTVASIFTK  113

Query  363  NFCLLLIIVGLIQMVRRIFFDSGS-----RNADGLTVISDDFEGKVAEL  494
            NF LLL+++GL+QMVRR+  +S S      ++  +   S + E ++AE+
Sbjct  114  NFALLLVLIGLVQMVRRLALNSSSSGDVNYSSSQMAAFSSESEARIAEV  162



>ref|XP_011046489.1| PREDICTED: nuclear migration and anchoring protein unc-84 [Populus 
euphratica]
Length=456

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 80/164 (49%), Gaps = 21/164 (13%)
 Frame = +3

Query  9    VSITANPSSVATRRRTAVEKRQPaaldiaesnlaaaaaaaavaSPSTGNDKHAAGDAAIK  188
            VSITANP+S   R     +K+ P+                       G  K     A  +
Sbjct  6    VSITANPASARRRPVVVSDKKSPSNNIELVVPNEQQIN-------GGGGGKANVTAATSR  58

Query  189  DLSQHSIRTETRDAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEKPRWLTVVSIFTKNF  368
            DLS HSI   T   +Q V+K       +  S RRA       K EKPRW+ VVS+FTKNF
Sbjct  59   DLSHHSILERTVKDLQ-VKK-----TSSTISPRRA------RKVEKPRWMKVVSVFTKNF  106

Query  369  CLLLIIVGLIQMVRRIFFDSGSRNAD--GLTVISDDFEGKVAEL  494
             LLL++ GL+QMVR++   SG   +   G  +   +F+G++AE+
Sbjct  107  MLLLVLAGLVQMVRKLAVKSGGIESASVGTQMGLSEFDGRIAEM  150



>gb|KDO53802.1| hypothetical protein CISIN_1g044738mg, partial [Citrus sinensis]
Length=347

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 74/119 (62%), Gaps = 13/119 (11%)
 Frame = +3

Query  150  GNDKHAAGDAAIKDLSQHSIRTET---RDAIQAVRKP-LPNSNGAAPSSRRAGTTKKSSK  317
            G+DK  A  A  KDLS+HSIR E    +D +  V+K  L NS  +   SR     K S K
Sbjct  44   GDDKPTA--AQSKDLSRHSIRGEAVVDKDTLVQVKKSGLANSTVSPRRSR-----KSSPK  96

Query  318  PEKPRWLTVVSIFTKNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
            PEKPRW TVVSIFTKNF LL+ ++GL QM+RR++  SG  ++ G  +   +FE ++ E+
Sbjct  97   PEKPRWATVVSIFTKNFLLLVAVLGLGQMIRRVYLKSG--DSAGAELGFSEFERRITEV  153



>ref|XP_006432531.1| hypothetical protein CICLE_v10001582mg [Citrus clementina]
 gb|ESR45771.1| hypothetical protein CICLE_v10001582mg [Citrus clementina]
Length=366

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 73/119 (61%), Gaps = 13/119 (11%)
 Frame = +3

Query  150  GNDKHAAGDAAIKDLSQHSIRTET---RDAIQAVRKP-LPNSNGAAPSSRRAGTTKKSSK  317
            G+DK  A  A  KDLS HSIR E    +D +  V+K  L NS  +   SR     K S K
Sbjct  44   GDDKPTA--AQSKDLSHHSIRGEAVVDKDTLVQVKKSGLANSTVSPRRSR-----KSSPK  96

Query  318  PEKPRWLTVVSIFTKNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
            PEKPRW TVVSIFTKNF LL+ ++GL QM+RR++  SG  ++ G  +   +FE ++ E+
Sbjct  97   PEKPRWATVVSIFTKNFLLLVAVLGLGQMIRRVYLKSG--DSAGAELGFSEFERRITEV  153



>ref|XP_011086123.1| PREDICTED: SUN domain-containing protein 2-like [Sesamum indicum]
 ref|XP_011086132.1| PREDICTED: SUN domain-containing protein 2-like [Sesamum indicum]
Length=435

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 51/75 (68%), Gaps = 4/75 (5%)
 Frame = +3

Query  270  AAPSSRRAGTTKKSSKPEKPRWLTVVSIFTKNFCLLLIIVGLIQMVRRIFFDSGSRNADG  449
            A   S+++G  +KS+KP   RWLT VSI TKN  LL++I+G +QM+R +  +SG    D 
Sbjct  65   AQTQSKKSGLARKSTKP---RWLTAVSILTKNLALLVVILGFVQMIRWVVLNSGPDTRD-  120

Query  450  LTVISDDFEGKVAEL  494
             +VIS DF+G+ AE+
Sbjct  121  FSVISGDFDGRFAEV  135



>ref|XP_006471288.1| PREDICTED: SUN domain-containing protein 2-like [Citrus sinensis]
Length=461

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 73/119 (61%), Gaps = 13/119 (11%)
 Frame = +3

Query  150  GNDKHAAGDAAIKDLSQHSIRTET---RDAIQAVRKP-LPNSNGAAPSSRRAGTTKKSSK  317
            G+DK  A  A  KDLS HSIR E    +D +  V+K  L NS  +   SR     K S K
Sbjct  44   GDDKPTA--AQSKDLSHHSIRGEAVVDKDTLVQVKKSGLANSTVSPRRSR-----KSSPK  96

Query  318  PEKPRWLTVVSIFTKNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
            PEKPRW TVVSIFTKNF LL+ ++GL QM+RR++  SG  ++ G  +   +FE ++ E+
Sbjct  97   PEKPRWATVVSIFTKNFLLLVAVLGLGQMIRRVYLKSG--DSAGAELGFSEFERRITEV  153



>ref|XP_008456648.1| PREDICTED: SUN domain-containing protein 2 [Cucumis melo]
Length=470

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 96/170 (56%), Gaps = 20/170 (12%)
 Frame = +3

Query  9    VSITANPSSVATRRR--TAVEKRQPaaldiaesnlaaaaaaaavaSPSTGNDKHAAGDAA  182
            VSITANP   ATRRR   A EK+  +   +A   +   +  A + +    +DK A G+  
Sbjct  6    VSITANP---ATRRRPVLASEKKGASFELLATDGVNPLSNTATLGTGGAADDKVAGGNG-  61

Query  183  IKDLSQHSIRTE------TRDAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEKPRWLTV  344
             +D+S HSIR E      +RD IQ ++K + NS  +   SR+  T     KPEKPRW+T+
Sbjct  62   -RDMSHHSIRGEVVLERSSRDPIQ-IKKAVANSTISPRRSRKVVT-----KPEKPRWVTI  114

Query  345  VSIFTKNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
            VS+ TKN  LLL+++GL QMVR++   SG          S + EG++AE+
Sbjct  115  VSVLTKNGVLLLVLLGLAQMVRKLALKSGEGEVGNQMGFS-EVEGRIAEV  163



>ref|XP_010091304.1| hypothetical protein L484_012197 [Morus notabilis]
 gb|EXB44278.1| hypothetical protein L484_012197 [Morus notabilis]
Length=459

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 100/171 (58%), Gaps = 34/171 (20%)
 Frame = +3

Query  9    VSITANPSSVATRRRT--AVEKRQPaaldiaesnlaaaaaaaavaSPSTGNDKHAAGDAA  182
            VSITANP   ATRRRT  AVEK+    L  AE                 G+DK  A +  
Sbjct  6    VSITANP---ATRRRTVVAVEKKSSVELVAAEPQFK------------AGDDKSVAANG-  49

Query  183  IKDLSQHSIRTE------TRDAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEKPRWLTV  344
             +DLS HSIR +      +RDA+  V+K   NS  + PS+RR   ++K     KPRWLTV
Sbjct  50   -RDLSNHSIRGDAVLERSSRDAV-PVKKTAANSTVSPPSNRR---SRKPVAAPKPRWLTV  104

Query  345  VSIFTKNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVIS-DDFEGKVAEL  494
            +S+FTKNF LL+++VGL+Q+VRR+      R++DG    +  DFEG++AE+
Sbjct  105  LSVFTKNFVLLVLLVGLVQIVRRLAL----RSSDGGGPFALSDFEGRIAEV  151



>ref|XP_007010671.1| SAD1/UNC-84 domain protein 2, putative [Theobroma cacao]
 gb|EOY19481.1| SAD1/UNC-84 domain protein 2, putative [Theobroma cacao]
Length=466

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 95/165 (58%), Gaps = 14/165 (8%)
 Frame = +3

Query  9    VSITANPSSVATRRRTAVEKRQPaaldiaesnlaaaaaaaavaSPSTGNDKHAAGDAAI-  185
            VSI+A P++VA RR   V +++        S++    A       + G+DK  A  AA  
Sbjct  6    VSISATPAAVARRRPVVVGEKK--------SSIELLTAEPNPNGVNIGDDKAGAAAAAGH  57

Query  186  -KDLSQHSIRTE-TRDAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEKPRWLTVVSIFT  359
             +DLS HS+R E ++D +QA +  L  ++ A     R G   K+   EKPRWLTVVSIF 
Sbjct  58   SRDLSHHSVRGEASKDTVQARKSALGQNSNATLRRTRKGVANKT---EKPRWLTVVSIFI  114

Query  360  KNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
            KN  LLL++VGL+Q++RR+   +G  +  G  +   +FEG+VAE+
Sbjct  115  KNLVLLLVLVGLVQIIRRLALKTGEVSGVGTQMELTEFEGRVAEV  159



>gb|EYU26915.1| hypothetical protein MIMGU_mgv1a006568mg [Erythranthe guttata]
Length=439

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 79/162 (49%), Gaps = 29/162 (18%)
 Frame = +3

Query  9    VSITANPSSVATRRRTAVEKRQPaaldiaesnlaaaaaaaavaSPSTGNDKHAAGDAAIK  188
            VSIT N     T RR AVEK                       +P  G    AA  AA+ 
Sbjct  6    VSITGNQG--PTTRRRAVEK-----------------------NPQDGGSDFAA--AAVT  38

Query  189  DLSQHSIRTETRDAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEKPRWLTVVSIFTKNF  368
            +      R    +A  A+ +     N  AP + ++  +  S K  KPRWLTVVSI TKN 
Sbjct  39   ESENKHGRLSASEAAAAILRD-ARKNPPAPPTIQSKKSGSSRKSTKPRWLTVVSIITKNL  97

Query  369  CLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
             L ++++G +QM+R +  +SG  + D L+VIS DF+GK +E+
Sbjct  98   ALAVVLLGFVQMIRWMVMNSG-HDVDNLSVISGDFDGKFSEV  138



>gb|KHG18959.1| SUN domain-containing 1 [Gossypium arboreum]
Length=463

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 90/164 (55%), Gaps = 15/164 (9%)
 Frame = +3

Query  9    VSITANPSSVATRRRTAVEKRQPaaldiaesnlaaaaaaaavaSPSTGNDKHAAGDAAIK  188
            +SI+ANP+ V+ RRR       P  L   +SN  +  A       + G DK A G A  +
Sbjct  6    LSISANPA-VSARRR-------PVLLAENKSNFESLPAEPNPNGVNVGEDK-ATGAANSR  56

Query  189  DLSQHSIRTET-RDAIQAVRKPLPNSNGAAPSSR-RAGTTKKSSKPEKPRWLTVVSIFTK  362
            DL  HS+R E  +D+ QA RK     N   P  R R G   K+   EKPRW TVVSIF K
Sbjct  57   DLGHHSVRAEALKDSGQA-RKVTVAQNSNVPLRRTRKGVVNKT---EKPRWQTVVSIFIK  112

Query  363  NFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
            N  LLL++ GL+QMVRR+   SG  +  G  V   +FEG+VAE+
Sbjct  113  NLVLLLVLAGLVQMVRRLALKSGEVSRAGTEVSLTEFEGRVAEV  156



>ref|XP_004172097.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101214156 
[Cucumis sativus]
Length=471

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 95/170 (56%), Gaps = 20/170 (12%)
 Frame = +3

Query  9    VSITANPSSVATRRR--TAVEKRQPaaldiaesnlaaaaaaaavaSPSTGNDKHAAGDAA  182
            VSITANP   ATRRR   A EK+  +   +A   L   +  A + +    +DK A  +  
Sbjct  6    VSITANP---ATRRRPVLASEKKGASFELLATDGLNPLSNTATLGTVGAADDKLAGANG-  61

Query  183  IKDLSQHSIRTE------TRDAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEKPRWLTV  344
             +D+S HSIR E      +RD IQ ++K + NS  +   SR+  T     KPEKPRW+T+
Sbjct  62   -RDMSHHSIRGEVVLERSSRDPIQ-IKKAVANSTISPRRSRKVIT-----KPEKPRWVTI  114

Query  345  VSIFTKNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
            VS+ TKN  LLL+++GL QMVR++   SG          S + EG++AE+
Sbjct  115  VSVLTKNGVLLLVLLGLAQMVRKLALKSGEGEVGNQMGFS-EVEGRIAEV  163



>ref|XP_004140926.1| PREDICTED: uncharacterized protein LOC101214156 [Cucumis sativus]
 gb|KGN46072.1| hypothetical protein Csa_6G051490 [Cucumis sativus]
Length=471

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 95/170 (56%), Gaps = 20/170 (12%)
 Frame = +3

Query  9    VSITANPSSVATRRR--TAVEKRQPaaldiaesnlaaaaaaaavaSPSTGNDKHAAGDAA  182
            VSITANP   ATRRR   A EK+  +   +A   L   +  A + +    +DK A  +  
Sbjct  6    VSITANP---ATRRRPVLASEKKGASFELLATDGLNPLSNTATLGTVGAADDKLAGANG-  61

Query  183  IKDLSQHSIRTE------TRDAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEKPRWLTV  344
             +D+S HSIR E      +RD IQ ++K + NS  +   SR+  T     KPEKPRW+T+
Sbjct  62   -RDMSHHSIRGEVVLERSSRDPIQ-IKKAVANSTISPRRSRKVIT-----KPEKPRWVTI  114

Query  345  VSIFTKNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
            VS+ TKN  LLL+++GL QMVR++   SG          S + EG++AE+
Sbjct  115  VSVLTKNGVLLLVLLGLAQMVRKLALKSGEGEVGNQMGFS-EVEGRIAEV  163



>gb|KJB75044.1| hypothetical protein B456_012G020700 [Gossypium raimondii]
Length=463

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 86/163 (53%), Gaps = 13/163 (8%)
 Frame = +3

Query  9    VSITANPSSVATRRRTAVEKRQPaaldiaesnlaaaaaaaavaSPSTGNDKHAAGDAAIK  188
            +SI+ANP+ V+ RRR       P  L   +SN  +  A       + G DK A G A  +
Sbjct  6    LSISANPA-VSARRR-------PVLLAENKSNFESLPAEPNPNGVNVGEDK-ATGAANSR  56

Query  189  DLSQHSIRTETRDAIQAVRKPLPNSNGAAPSSR-RAGTTKKSSKPEKPRWLTVVSIFTKN  365
            DLS HS+R E        RK     N   P  R R G   K+   EKPRW TVVSIF KN
Sbjct  57   DLSHHSVRGEALKDFGQARKVTVAQNSNVPLRRTRKGVVNKT---EKPRWQTVVSIFIKN  113

Query  366  FCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
              LLL++ GL+Q++RR+   SG  +  G  V   +FEG+VAE+
Sbjct  114  LVLLLVLAGLVQIIRRLALKSGEVSRAGTEVSLTEFEGRVAEV  156



>ref|XP_010276886.1| PREDICTED: SUN domain-containing protein 3-like [Nelumbo nucifera]
 ref|XP_010276887.1| PREDICTED: SUN domain-containing protein 3-like [Nelumbo nucifera]
Length=455

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 76/124 (61%), Gaps = 24/124 (19%)
 Frame = +3

Query  147  TGNDKHAAGDAAIKDLSQHSIRTET-----RDAIQAVRKPLPNSNGAAPSSRRAGTTKKS  311
            TG++K   G    KDLS HSIR ET     +D +Q+ R    N   +  S RR  T K  
Sbjct  53   TGDEKGGNG----KDLS-HSIRGETVLEKPKDLLQSKR----NLVNSTVSPRR--TRKVV  101

Query  312  SKPEKPRWLTVVSIFTKNFCLLLIIVGLIQMVRRIFF---DSGSRNADGLTVISDDFEGK  482
             KPEKPRW+TVVSIFTKNF LLL+++GL+QM+R++     +SG   A  L     DFEG+
Sbjct  102  LKPEKPRWMTVVSIFTKNFVLLLVLLGLVQMIRKLALKNENSGIPQAGAL-----DFEGR  156

Query  483  VAEL  494
            VAE+
Sbjct  157  VAEV  160



>ref|XP_004511152.1| PREDICTED: SUN domain-containing protein 1-like [Cicer arietinum]
Length=468

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 59/112 (53%), Gaps = 7/112 (6%)
 Frame = +3

Query  165  AAGDAAIKDLSQHSIRTET--RDAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEKPRWL  338
            AAG+   +DLS HSIR E      +    K     N  A + RR    K + K +KPRWL
Sbjct  57   AAGNG--RDLSHHSIRGEAVLSKELAPATKRTAGGNSTAVTPRR--VKKSNGKSDKPRWL  112

Query  339  TVVSIFTKNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
            TV  IF K F LL ++ GL+Q+ R    +S      G   +S ++EG+++E+
Sbjct  113  TVARIFAKQFVLLAMLAGLVQLFRWYVLNSSEGVVGGFAELS-EYEGRISEV  163



>ref|XP_009339239.1| PREDICTED: SUN domain-containing protein 3-like [Pyrus x bretschneideri]
Length=453

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 88/167 (53%), Gaps = 30/167 (18%)
 Frame = +3

Query  9    VSITANPSSVATRRR--TAVEKRQPaaldiaesnlaaaaaaaavaSPSTGNDKHAAGDAA  182
            VSITANP  V TRRR   AV+K+              +      A P T    H A D A
Sbjct  6    VSITANP--VTTRRRHVVAVDKK-------------TSNIELVSAEPQT----HKADDTA  46

Query  183  I--KDLSQHSIRTE-TRDAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEKPRWLTVVSI  353
               KDLS HSIR E   D     +K  PNS  + PS+RR+  T  +    KPRW+TV+ I
Sbjct  47   TNSKDLSHHSIRGEPGLDRSAQPKKTGPNSTISPPSNRRSRKTLDADP--KPRWVTVLRI  104

Query  354  FTKNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
            F+KN  LL++IVGL Q+VRR+    G     G+ +   D EG++AE+
Sbjct  105  FSKNLILLVLIVGLFQIVRRLALGPGV----GVPMAFSDLEGRIAEV  147



>ref|XP_010694883.1| PREDICTED: SUN domain-containing protein 3 [Beta vulgaris subsp. 
vulgaris]
Length=459

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 62/116 (53%), Gaps = 8/116 (7%)
 Frame = +3

Query  150  GNDKHAAGDAAIKDLSQHSIRTETRDAIQAVRKP---LPNSNGAAPSSRRAGTTKKSSKP  320
            G DK  +GD   KDLS HSIR E     ++  K    LPNSN A   SR        +K 
Sbjct  43   GGDKVTSGD---KDLS-HSIRGEAVVLERSKEKKSSQLPNSN-APIRSRNRKAVATPNKH  97

Query  321  EKPRWLTVVSIFTKNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVA  488
             +PRW TV+S+  KN  LL +IVG +QM+R+   + G+   +G  +     EG++A
Sbjct  98   SRPRWRTVLSVIIKNLLLLFVIVGGVQMIRKSVVNYGNVGGEGNLMGFSYMEGRIA  153



>gb|KJB67806.1| hypothetical protein B456_010G212200 [Gossypium raimondii]
Length=470

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 89/165 (54%), Gaps = 12/165 (7%)
 Frame = +3

Query  9    VSITANPSSVATRRRTAVEKRQPaaldiaesnlaaaaaaaavaSPSTGNDKHAAGDAAIK  188
            VSITANP++   RRR+ V  ++     +     A         + +      A G A  +
Sbjct  6    VSITANPAAATPRRRSLVADKRSNIEALVVDPNATGVNLVEDKAAAA-----AVGTAGYR  60

Query  189  -DLSQHSIRTE-TRDAIQAVRKPL-PNSNGAAPSSRRAGTTKKSSKPEKPRWLTVVSIFT  359
             DLS  S R E ++D++QA R  +  NSNG+   SR+       +K EKPRW T VSIF 
Sbjct  61   RDLSHDSGRAEPSKDSLQAKRVVVGQNSNGSLRRSRKGAV----NKAEKPRWSTAVSIFA  116

Query  360  KNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
            KN  LLL++VGL Q++RR+   SG  ++ G      +FEG+VAE+
Sbjct  117  KNLALLLVLVGLAQIIRRLALKSGDVSSVGTHAGLTEFEGRVAEV  161



>gb|KHG26525.1| SUN domain-containing 2 [Gossypium arboreum]
Length=470

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 88/165 (53%), Gaps = 12/165 (7%)
 Frame = +3

Query  9    VSITANPSSVATRRRTAVEKRQPaaldiaesnlaaaaaaaavaSPSTGNDKHAAGDAAIK  188
            VSITANP++V  RRR+ V  ++     +     A         + +      A G A  +
Sbjct  6    VSITANPAAVTPRRRSVVADKRSNIEALVADPNATGVNLVEDKAAAA-----AVGTAGYR  60

Query  189  -DLSQHSIRTE-TRDAIQAVRKPL-PNSNGAAPSSRRAGTTKKSSKPEKPRWLTVVSIFT  359
             DLS  S R E ++D++Q  R  +  NSNG    SR+       +K EKPRW T VSIF 
Sbjct  61   RDLSHDSGRAEPSKDSLQGKRVVVGQNSNGPLRRSRKGAV----NKAEKPRWSTAVSIFA  116

Query  360  KNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
            KN  LLL++VGL Q++RR+   SG  ++ G      +FEG+VAE+
Sbjct  117  KNLALLLVLVGLAQIIRRLALKSGDVSSVGTHTGLTEFEGRVAEV  161



>gb|KCW50612.1| hypothetical protein EUGRSUZ_J00319 [Eucalyptus grandis]
Length=355

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 89/162 (55%), Gaps = 23/162 (14%)
 Frame = +3

Query  9    VSITANPSSVATRRRTAVEKRQPaaldiaesnlaaaaaaaavaSPSTGNDKHAAGDAAIK  188
            VSITANP+S   RRR  V         + +    A        + +  +D+  +G++  K
Sbjct  6    VSITANPAS--ARRRPVV---------LGDKKSGANIELVPADNGANADDRAVSGNS--K  52

Query  189  DLSQHSIRTETRDAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEKPRWLTVVSIFTKNF  368
            DLS HSIR      + AV+K L NS     S RRA   K   + EKPRWLTVVS+FTKN 
Sbjct  53   DLSHHSIRGGEAKDLAAVKKALGNST---ISPRRA--RKVVPRAEKPRWLTVVSVFTKNV  107

Query  369  CLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
             LL++++GL+Q+VRR+     S  + G      DFEG++AE+
Sbjct  108  LLLVVLLGLVQLVRRL-----SMGSSGSVAEFTDFEGRIAEV  144



>gb|EPS70209.1| hypothetical protein M569_04554, partial [Genlisea aurea]
Length=342

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 42/60 (70%), Gaps = 3/60 (5%)
 Frame = +3

Query  315  KPEKPRWLTVVSIFTKNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
            K +KPRWLTV+S+ TKN  L+ +++G  Q++RR+   SG R  + +++IS D EGK  EL
Sbjct  1    KLKKPRWLTVISVLTKNLALIFVLLGFFQIIRRMI--SG-REMEDMSLISGDVEGKFYEL  57



>ref|XP_010031348.1| PREDICTED: SUN domain-containing protein 3 [Eucalyptus grandis]
 gb|KCW50611.1| hypothetical protein EUGRSUZ_J00319 [Eucalyptus grandis]
Length=451

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 89/162 (55%), Gaps = 23/162 (14%)
 Frame = +3

Query  9    VSITANPSSVATRRRTAVEKRQPaaldiaesnlaaaaaaaavaSPSTGNDKHAAGDAAIK  188
            VSITANP+S   RRR  V         + +    A        + +  +D+  +G++  K
Sbjct  6    VSITANPAS--ARRRPVV---------LGDKKSGANIELVPADNGANADDRAVSGNS--K  52

Query  189  DLSQHSIRTETRDAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEKPRWLTVVSIFTKNF  368
            DLS HSIR      + AV+K L NS     S RRA   K   + EKPRWLTVVS+FTKN 
Sbjct  53   DLSHHSIRGGEAKDLAAVKKALGNST---ISPRRA--RKVVPRAEKPRWLTVVSVFTKNV  107

Query  369  CLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
             LL++++GL+Q+VRR+     S  + G      DFEG++AE+
Sbjct  108  LLLVVLLGLVQLVRRL-----SMGSSGSVAEFTDFEGRIAEV  144



>ref|XP_008375408.1| PREDICTED: SUN domain-containing protein 2-like isoform X1 [Malus 
domestica]
Length=453

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 84/165 (51%), Gaps = 26/165 (16%)
 Frame = +3

Query  9    VSITANPSSVATRRRTAVEKRQPaaldiaesnlaaaaaaaavaSPSTGNDKHAAGDAAI-  185
            VSITANP++   R   AV+K+              +      A P T    H A D A  
Sbjct  6    VSITANPATTRRRHVVAVDKK-------------TSNIELVSAEPQT----HKADDTATN  48

Query  186  -KDLSQHSIRTE-TRDAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEKPRWLTVVSIFT  359
             KDLS HSIR E   D     +K  PNS  + PS+RR+  T  +    KPRW+TV+ I +
Sbjct  49   SKDLSHHSIRGEPGLDRSAQPKKTGPNSTISPPSNRRSRKTLDADP--KPRWVTVLRIVS  106

Query  360  KNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
            KN  LL++IVGL Q+VRR+    G      + +   D EG++AE+
Sbjct  107  KNLILLVLIVGLFQIVRRLALGPGV----AVPMAFSDLEGRIAEV  147



>ref|XP_008375409.1| PREDICTED: SUN domain-containing protein 2-like isoform X2 [Malus 
domestica]
Length=453

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 84/165 (51%), Gaps = 26/165 (16%)
 Frame = +3

Query  9    VSITANPSSVATRRRTAVEKRQPaaldiaesnlaaaaaaaavaSPSTGNDKHAAGDAAI-  185
            VSITANP++   R   AV+K+              +      A P T    H A D A  
Sbjct  6    VSITANPATTRRRHVVAVDKK-------------TSNIELVSAEPQT----HKADDTATN  48

Query  186  -KDLSQHSIRTE-TRDAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEKPRWLTVVSIFT  359
             KDLS HSIR E   D     +K  PNS  + PS+RR+  T  +    KPRW+TV+ I +
Sbjct  49   SKDLSHHSIRGEPGLDRSAQPKKTGPNSTISPPSNRRSRKTLDADP--KPRWVTVLRIVS  106

Query  360  KNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
            KN  LL++IVGL Q+VRR+    G      + +   D EG++AE+
Sbjct  107  KNLILLVLIVGLFQIVRRLALGPGV----AVPMAFSDLEGRIAEV  147



>ref|XP_003628099.1| SUN domain-containing protein [Medicago truncatula]
 gb|AET02575.1| Sad1/UNC-like protein [Medicago truncatula]
Length=462

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 54/93 (58%), Gaps = 7/93 (8%)
 Frame = +3

Query  138  SPST-GNDKHAAGDAAIKDLSQHSIRTETRDAIQAVR-KPLPNSNGAAPSSRRAGTTKKS  311
            SP+T G+ K+ +     +DLS HSIR+   DAI +    P         S+RR    K  
Sbjct  41   SPNTAGDGKNPSTAGNGRDLSHHSIRS---DAILSKDLAPATKRVAGGDSTRR--VRKNG  95

Query  312  SKPEKPRWLTVVSIFTKNFCLLLIIVGLIQMVR  410
             K EK +W+TV  IF KNF LL+++VGL+Q++R
Sbjct  96   GKSEKQKWVTVARIFAKNFGLLVMVVGLVQLIR  128



>ref|XP_002265646.1| PREDICTED: SUN domain-containing protein 3-like [Vitis vinifera]
Length=462

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 89/167 (53%), Gaps = 23/167 (14%)
 Frame = +3

Query  9    VSITANPSSVATRRRTAVEKRQPaaldiaesnlaaaaaaaavaSPSTGNDKHAAGDAAIK  188
            VSITAN  + A RR   + +++P    ++     +            G DK   G    K
Sbjct  6    VSITAN--TAARRRPVVIGEKKPNIELLSGDAGVSQFNGI------AGEDKLTGGGG--K  55

Query  189  DLSQHSIRTET-----RDAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEKPRWLTVVSI  353
            DLS HSIR ET     ++ +Q ++K   N   AA   RR  T K  SK E+PRW+T VSI
Sbjct  56   DLS-HSIRGETILERSKEVVQ-IKKTSAN---AATEPRR--TRKVVSKSERPRWVTAVSI  108

Query  354  FTKNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
            FTKN  LL++I+GL+QM+R++   S   +   L  +  DFE ++AE+
Sbjct  109  FTKNLVLLVVILGLVQMIRKLALKSADSSGGSLVAVP-DFERRIAEV  154



>ref|XP_003546680.1| PREDICTED: SUN domain-containing protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006598048.1| PREDICTED: SUN domain-containing protein 1-like isoform X2 [Glycine 
max]
 ref|XP_006598049.1| PREDICTED: SUN domain-containing protein 1-like isoform X3 [Glycine 
max]
Length=462

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 69/116 (59%), Gaps = 12/116 (10%)
 Frame = +3

Query  168  AGDAAI-KDLSQHSIRTET------RDAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEK  326
            +GD A  +DLS HS+R E       RD   A +    NS+   P  RRA   K S+K EK
Sbjct  47   SGDGATGRDLSHHSVRGEALLDRTPRDLAPAKKVAGGNSSSVPP--RRA--RKLSAKAEK  102

Query  327  PRWLTVVSIFTKNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
            PRWLT+VSIF KN  LL+++ GL+Q++ R+   SG   A G    S +FEG+++++
Sbjct  103  PRWLTLVSIFGKNMVLLVVLAGLVQLIWRMSLKSGDGMAGGYVGFS-EFEGRISDV  157



>ref|XP_002315397.2| hypothetical protein POPTR_0010s25420g [Populus trichocarpa]
 gb|EEF01568.2| hypothetical protein POPTR_0010s25420g [Populus trichocarpa]
Length=457

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 82/164 (50%), Gaps = 20/164 (12%)
 Frame = +3

Query  9    VSITANPSSVATRRRTAVEKRQPaaldiaesnlaaaaaaaavaSPSTGNDKHAAGDAAIK  188
            VSITANP+S   R     +K+ P+                   +   G  K     AA +
Sbjct  6    VSITANPASARRRPVVVSDKKSPSNNIELVVPSEQQI------NGGGGGGKAKVTAAASR  59

Query  189  DLSQHSIRTETRDAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEKPRWLTVVSIFTKNF  368
            DLS HSI   T   +Q V+K       +  S RRA       K EKPRW+ VVS+FTKNF
Sbjct  60   DLSHHSILERTVKDLQ-VKK-----TSSTISPRRA------RKVEKPRWMKVVSVFTKNF  107

Query  369  CLLLIIVGLIQMVRRIFFDSGSRNAD--GLTVISDDFEGKVAEL  494
             LLL++ GL+QMVR++   SG   +   G  +   +F+G++AE+
Sbjct  108  VLLLVLAGLVQMVRKLAVKSGGIESASVGTQMGLSEFDGRIAEM  151



>emb|CAN63550.1| hypothetical protein VITISV_043049 [Vitis vinifera]
Length=640

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 90/167 (54%), Gaps = 23/167 (14%)
 Frame = +3

Query  9    VSITANPSSVATRRRTAVEKRQPaaldiaesnlaaaaaaaavaSPSTGNDKHAAGDAAIK  188
            VSITAN  + A RR   + +++P    ++     +        +   G +K   G    K
Sbjct  6    VSITAN--TAARRRPVVIGEKKPNIELLSGDAGVSQF------NGIAGEBKLTGGGG--K  55

Query  189  DLSQHSIRTET-----RDAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEKPRWLTVVSI  353
            DLS HSIR ET     ++ +Q ++K   N   AA   RR  T K  SK E+PRW+T VSI
Sbjct  56   DLS-HSIRGETILERSKEVVQ-IKKTSAN---AATEPRR--TRKVVSKSERPRWVTAVSI  108

Query  354  FTKNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
            FTKN  LL++I+GL+QM+R++   S   +   L  +  DFE ++AE+
Sbjct  109  FTKNLVLLVVILGLVQMIRKLALKSADSSGGSLVAVP-DFERRIAEV  154



>ref|XP_008356832.1| PREDICTED: SUN domain-containing protein 2-like, partial [Malus 
domestica]
Length=442

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 65/114 (57%), Gaps = 9/114 (8%)
 Frame = +3

Query  162  HAAGDAAI--KDLSQHSIRTE-TRDAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEKPR  332
            H A D A   KDLS HSIR E   D     +K  PNS  + PS+RR+  T  +    KPR
Sbjct  29   HKADDTATNSKDLSHHSIRGEPGLDRSAQPKKTGPNSTISPPSNRRSRKTLDADP--KPR  86

Query  333  WLTVVSIFTKNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
            W+TV+ I +KN  LL++IVGL Q+VRR+    G      + +   D EG++AE+
Sbjct  87   WVTVLRIVSKNLILLVLIVGLFQIVRRLALGPGV----AVPMAFSDLEGRIAEV  136



>ref|XP_004306444.1| PREDICTED: SUN domain-containing protein 2 [Fragaria vesca subsp. 
vesca]
Length=447

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 80/165 (48%), Gaps = 25/165 (15%)
 Frame = +3

Query  9    VSITANPSSVATRRRT--AVEKRQPaaldiaesnlaaaaaaaavaSPSTGNDKHAAGDAA  182
            VSITA P+   TRRR+  AVEKR           ++A   +     P+  N++       
Sbjct  6    VSITATPT---TRRRSVVAVEKRS-----ANIELVSAEPQSQRADDPTAPNNR-------  50

Query  183  IKDLSQHSIRTETR-DAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEKPRWLTVVSIFT  359
              DLS  S+R+ET  D     R+    S  + PS RR+ + K  +   +PRWL ++ IF 
Sbjct  51   --DLSHQSVRSETAVDRSAQTRRTAVTSTVSPPSGRRS-SRKALAGTHRPRWLRLLRIFG  107

Query  360  KNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
            K   LL+ + GL Q++ R+ +   +      T    D EG++AE+
Sbjct  108  KWLGLLVFVGGLGQILTRLAYGPSAAGPMAFT----DLEGRIAEV  148



>ref|XP_003542777.1| PREDICTED: SUN domain-containing protein 1-like [Glycine max]
Length=464

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 69/116 (59%), Gaps = 10/116 (9%)
 Frame = +3

Query  168  AGDAAI-KDLSQHSIRTET------RDAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEK  326
            +GD A  +DLS HSIR E       RD   A +      N A+   RR  T K ++K EK
Sbjct  47   SGDGATGRDLSHHSIRGEALLDRAPRDLTPAKKVAGAGPNSASGPPRR--TRKPAAKSEK  104

Query  327  PRWLTVVSIFTKNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
            PRWLT+VSIF KN  LL+++ GL+Q++RR+   SG   A G    S +FEG+++++
Sbjct  105  PRWLTLVSIFGKNLVLLVVLAGLVQLIRRMSLKSGDAAAGGFAGFS-EFEGRISDV  159



>ref|XP_009417884.1| PREDICTED: SUN domain-containing protein 3-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009417885.1| PREDICTED: SUN domain-containing protein 3-like [Musa acuminata 
subsp. malaccensis]
Length=467

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 56/107 (52%), Gaps = 12/107 (11%)
 Frame = +3

Query  186  KDLSQHSIRTET----RDAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEKPRWLTVVSI  353
            KDLS H+IR E+    R     ++K L  S+  +P  ++A     + KP K +W TV+S+
Sbjct  60   KDLS-HTIRGESVIERRKDYSQLKKRLIASSTGSPRHKKA-----APKPGKSKWQTVISV  113

Query  354  FTKNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
             TKN  LL ++V L Q + R  F  G      L     D+E +++E+
Sbjct  114  LTKNCLLLAVLVWLGQTIWRWSFSIGDNANSSLAAF--DYESRISEV  158



>ref|XP_002873180.1| hypothetical protein ARALYDRAFT_908391 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49439.1| hypothetical protein ARALYDRAFT_908391 [Arabidopsis lyrata subsp. 
lyrata]
Length=476

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  315  KPEKPRWLTVVSIFTKNFCLLLIIVGLIQMVRRIFF  422
            KPEK RW TVV IF K    LLIIVGLIQ+ R++  
Sbjct  99   KPEKARWKTVVRIFAKQLGALLIIVGLIQLTRKMIL  134



>ref|XP_008804985.1| PREDICTED: SUN domain-containing protein 1-like [Phoenix dactylifera]
Length=374

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 63/108 (58%), Gaps = 14/108 (13%)
 Frame = +3

Query  186  KDLSQHSIRTET-----RDAIQAVRKPLPNSNGAAPSSRRAGTTKKSSKPEKPRWLTVVS  350
            KDLS H+IR E+     +D  Q ++K L  S+  +P  ++A       KP+K +W TV+S
Sbjct  58   KDLS-HTIRGESLLDRSKDLSQ-LKKELIASSTISPRRKKAIL-----KPQKLKWQTVLS  110

Query  351  IFTKNFCLLLIIVGLIQMVRRIFFDSGSRNADGLTVISDDFEGKVAEL  494
            I TKNF LL +++ L Q V R + DS   N +     + D++G+++E+
Sbjct  111  ILTKNFMLLAVLLWLGQTVWR-WTDSIRDNTNS-PFSALDYDGRISEV  156



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552737873190