BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP008D01 381 bp,

Length=342
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009779573.1|  PREDICTED: uncharacterized protein LOC104228746    141   8e-40   Nicotiana sylvestris
ref|XP_009618096.1|  PREDICTED: uncharacterized protein LOC104110334    140   1e-39   Nicotiana tomentosiformis
ref|XP_006351789.1|  PREDICTED: uncharacterized protein LOC102583636    137   2e-38   Solanum tuberosum [potatoes]
ref|XP_004230636.1|  PREDICTED: uncharacterized protein LOC101245002    135   3e-37   Solanum lycopersicum
ref|XP_011087880.1|  PREDICTED: uncharacterized protein LOC105169221    133   1e-36   Sesamum indicum [beniseed]
ref|XP_007200439.1|  hypothetical protein PRUPE_ppa012787mg             132   2e-36   Prunus persica
ref|XP_008237183.1|  PREDICTED: tropomyosin                             132   2e-36   Prunus mume [ume]
ref|XP_004136872.1|  PREDICTED: uncharacterized protein LOC101218756    131   3e-36   Cucumis sativus [cucumbers]
gb|EYU18485.1|  hypothetical protein MIMGU_mgv1a015418mg                130   1e-35   Erythranthe guttata [common monkey flower]
gb|EPS63433.1|  hypothetical protein M569_11351                         125   2e-33   Genlisea aurea
ref|XP_002265916.2|  PREDICTED: uncharacterized protein LOC100241703    120   7e-32   Vitis vinifera
emb|CDX84501.1|  BnaC03g49990D                                          120   9e-32   Brassica napus [oilseed rape]
gb|KCW56997.1|  hypothetical protein EUGRSUZ_I02667                     118   2e-31   Eucalyptus grandis [rose gum]
gb|KJB47205.1|  hypothetical protein B456_008G015400                    120   2e-31   Gossypium raimondii
gb|KHG00871.1|  Arginine biosynthesis bifunctional ArgJ                 119   3e-31   Gossypium arboreum [tree cotton]
gb|KJB47206.1|  hypothetical protein B456_008G015400                    118   5e-31   Gossypium raimondii
ref|XP_009372183.1|  PREDICTED: uncharacterized protein LOC103961365    118   7e-31   Pyrus x bretschneideri [bai li]
ref|XP_008372559.1|  PREDICTED: tropomyosin-like                        118   8e-31   Malus domestica [apple tree]
ref|XP_004288660.1|  PREDICTED: uncharacterized protein LOC101296327    118   9e-31   Fragaria vesca subsp. vesca
ref|XP_010030042.1|  PREDICTED: uncharacterized protein LOC104419909    117   1e-30   Eucalyptus grandis [rose gum]
ref|XP_008382564.1|  PREDICTED: tropomyosin-like                        117   2e-30   Malus domestica [apple tree]
ref|XP_010094162.1|  hypothetical protein L484_017206                   116   3e-30   Morus notabilis
ref|XP_007042974.1|  Dbj:BAA96220.1                                     115   6e-30   Theobroma cacao [chocolate]
ref|XP_008372568.1|  PREDICTED: uncharacterized protein LOC103435...    115   8e-30   Malus domestica [apple tree]
ref|XP_010258013.1|  PREDICTED: uncharacterized protein LOC104597921    114   2e-29   Nelumbo nucifera [Indian lotus]
ref|XP_008372565.1|  PREDICTED: uncharacterized protein LOC103435...    114   4e-29   
ref|XP_008372564.1|  PREDICTED: uncharacterized protein LOC103435...    114   6e-29   Malus domestica [apple tree]
ref|XP_009358984.1|  PREDICTED: uncharacterized protein LOC103949596    113   7e-29   Pyrus x bretschneideri [bai li]
ref|XP_002530267.1|  conserved hypothetical protein                     112   1e-28   Ricinus communis
emb|CDY18721.1|  BnaA09g06740D                                          111   4e-28   Brassica napus [oilseed rape]
ref|XP_006845889.1|  hypothetical protein AMTR_s00154p00087720          111   4e-28   Amborella trichopoda
ref|NP_201223.1|  uncharacterized protein                               110   6e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010520965.1|  PREDICTED: uncharacterized protein LOC104799966    110   6e-28   Tarenaya hassleriana [spider flower]
emb|CDX81215.1|  BnaC09g06260D                                          110   7e-28   Brassica napus [oilseed rape]
gb|KDP25845.1|  hypothetical protein JCGZ_22875                         110   7e-28   Jatropha curcas
ref|XP_011044729.1|  PREDICTED: uncharacterized protein LOC105139...    110   8e-28   Populus euphratica
ref|XP_010484189.1|  PREDICTED: uncharacterized protein LOC104762571    110   9e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010444348.1|  PREDICTED: uncharacterized protein LOC104727050    110   1e-27   Camelina sativa [gold-of-pleasure]
ref|XP_011044728.1|  PREDICTED: uncharacterized protein LOC105139...    110   1e-27   Populus euphratica
ref|XP_009112121.1|  PREDICTED: uncharacterized protein LOC103837517    109   2e-27   Brassica rapa
ref|XP_006394188.1|  hypothetical protein EUTSA_v10005060mg             109   2e-27   Eutrema salsugineum
ref|XP_010461470.1|  PREDICTED: uncharacterized protein LOC104742194    108   3e-27   Camelina sativa [gold-of-pleasure]
gb|KFK28102.1|  hypothetical protein AALP_AA8G472800                    108   4e-27   Arabis alpina [alpine rockcress]
ref|XP_006281242.1|  hypothetical protein CARUB_v10027285mg             108   5e-27   Capsella rubella
ref|XP_002864885.1|  hypothetical protein ARALYDRAFT_919722             108   5e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_002321368.1|  hypothetical protein POPTR_0015s00800g             107   8e-27   Populus trichocarpa [western balsam poplar]
ref|XP_010690481.1|  PREDICTED: uncharacterized protein LOC104904...    107   1e-26   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|AAM62887.1|  unknown                                                 107   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010690482.1|  PREDICTED: uncharacterized protein LOC104904...    106   3e-26   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|KDO40741.1|  hypothetical protein CISIN_1g031305mg                   105   3e-26   Citrus sinensis [Valencia orange]
ref|XP_011043705.1|  PREDICTED: uncharacterized protein LOC105139082    105   5e-26   Populus euphratica
gb|KDO40742.1|  hypothetical protein CISIN_1g031305mg                   105   5e-26   Citrus sinensis [Valencia orange]
ref|XP_006487654.1|  PREDICTED: tropomyosin-like isoform X1             105   7e-26   Citrus sinensis [Valencia orange]
gb|KDO40740.1|  hypothetical protein CISIN_1g031305mg                   105   9e-26   Citrus sinensis [Valencia orange]
gb|KDO40739.1|  hypothetical protein CISIN_1g031305mg                   105   1e-25   Citrus sinensis [Valencia orange]
ref|XP_011092419.1|  PREDICTED: uncharacterized protein LOC105172602    105   1e-25   Sesamum indicum [beniseed]
gb|KHN39222.1|  hypothetical protein glysoja_028027                     104   1e-25   Glycine soja [wild soybean]
ref|XP_006423897.1|  hypothetical protein CICLE_v10029442mg             104   1e-25   Citrus clementina
ref|XP_006487655.1|  PREDICTED: tropomyosin-like isoform X2             103   2e-25   
ref|XP_006423898.1|  hypothetical protein CICLE_v10029442mg             104   2e-25   Citrus clementina
ref|XP_002317807.2|  hypothetical protein POPTR_0012s02910g             105   4e-25   Populus trichocarpa [western balsam poplar]
ref|XP_009150491.1|  PREDICTED: myosin heavy chain, muscle              103   5e-25   Brassica rapa
ref|XP_010939192.1|  PREDICTED: uncharacterized protein LOC105058098    102   6e-25   Elaeis guineensis
ref|XP_004504787.1|  PREDICTED: uncharacterized protein LOC101494197    100   4e-24   Cicer arietinum [garbanzo]
ref|XP_003524738.2|  PREDICTED: uncharacterized protein LOC100804...    101   4e-24   Glycine max [soybeans]
gb|KEH31227.1|  SKIP interacting protein                              99.4    1e-23   Medicago truncatula
ref|XP_003531035.1|  PREDICTED: uncharacterized protein LOC100779456  98.6    3e-23   Glycine max [soybeans]
ref|XP_009394775.1|  PREDICTED: uncharacterized protein LOC103980189  98.2    5e-23   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADE75769.1|  unknown                                               98.2    7e-23   Picea sitchensis
ref|XP_007159096.1|  hypothetical protein PHAVU_002G208400g           97.8    1e-22   Phaseolus vulgaris [French bean]
ref|XP_008785611.1|  PREDICTED: uncharacterized protein LOC103704198  97.1    1e-22   Phoenix dactylifera
ref|XP_008455213.1|  PREDICTED: uncharacterized protein LOC103495430  95.9    2e-22   Cucumis melo [Oriental melon]
gb|KHN32568.1|  hypothetical protein glysoja_047900                   94.4    9e-22   Glycine soja [wild soybean]
ref|XP_004962943.1|  PREDICTED: uncharacterized protein LOC101774171  94.4    2e-21   Setaria italica
ref|XP_009394316.1|  PREDICTED: uncharacterized protein LOC103979826  93.6    3e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001168817.1|  hypothetical protein                             94.0    4e-21   Zea mays [maize]
gb|ACG26932.1|  hypothetical protein                                  93.6    4e-21   Zea mays [maize]
ref|XP_002443220.1|  hypothetical protein SORBIDRAFT_08g015570        93.6    5e-21   Sorghum bicolor [broomcorn]
ref|XP_008672642.1|  PREDICTED: uncharacterized protein LOC100278...  93.6    6e-21   Zea mays [maize]
ref|NP_001145064.1|  uncharacterized protein LOC100278260             93.2    6e-21   Zea mays [maize]
gb|EMS46364.1|  hypothetical protein TRIUR3_27207                     94.0    9e-21   Triticum urartu
dbj|BAJ89520.1|  predicted protein                                    92.4    1e-20   Hordeum vulgare subsp. vulgare [barley]
ref|XP_003576107.1|  PREDICTED: uncharacterized protein LOC100823803  91.3    3e-20   Brachypodium distachyon [annual false brome]
ref|XP_006664576.1|  PREDICTED: myosin-7B-like                        79.7    3e-16   Oryza brachyantha
emb|CDO97456.1|  unnamed protein product                              79.3    4e-16   Coffea canephora [robusta coffee]
gb|EEE53261.1|  hypothetical protein OsJ_36194                        79.7    6e-16   Oryza sativa Japonica Group [Japonica rice]
gb|ACA64832.1|  SKIP interacting protein 15                           79.3    7e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_002981396.1|  hypothetical protein SELMODRAFT_114499           75.5    2e-14   Selaginella moellendorffii
ref|XP_008672643.1|  PREDICTED: uncharacterized protein LOC100278...  75.9    2e-14   Zea mays [maize]
ref|XP_001779944.1|  predicted protein                                71.2    6e-13   Physcomitrella patens
ref|XP_002969920.1|  hypothetical protein SELMODRAFT_170924           71.2    7e-13   Selaginella moellendorffii
ref|NP_001066826.2|  Os12g0502100                                     67.8    2e-11   
ref|XP_009394773.1|  PREDICTED: mitochondrial substrate carrier f...  66.6    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGT16664.1|  hypothetical protein SHCRBa_107_F16_F_190             65.5    7e-10   Saccharum hybrid cultivar R570
gb|ABA98637.1|  expressed protein                                     62.4    1e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EAY83218.1|  hypothetical protein OsI_38427                        59.7    2e-08   Oryza sativa Indica Group [Indian rice]



>ref|XP_009779573.1| PREDICTED: uncharacterized protein LOC104228746 [Nicotiana sylvestris]
Length=155

 Score =   141 bits (355),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 99/107 (93%), Gaps = 1/107 (1%)
 Frame = +3

Query  24   MEEKGK-GSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  200
            MEEKGK GSERW+AAI N SEMA NLDSLQKLL+KKAVYVDEDT++KA L SEQART+KV
Sbjct  1    MEEKGKVGSERWSAAIGNLSEMASNLDSLQKLLVKKAVYVDEDTFAKASLTSEQARTLKV  60

Query  201  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            LEQRV+TLERELD+AISAAA ARTEKRQAEAAQK AEL+AQEIT+EL
Sbjct  61   LEQRVQTLERELDNAISAAAHARTEKRQAEAAQKVAELRAQEITREL  107



>ref|XP_009618096.1| PREDICTED: uncharacterized protein LOC104110334 [Nicotiana tomentosiformis]
Length=155

 Score =   140 bits (354),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 1/84 (1%)
 Frame = +3

Query  24   MEEKGK-GSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  200
            MEEKGK GSERW+AAI N SEMA NLDSLQKLL+KKAVYVDEDT++KA L SEQARTIKV
Sbjct  1    MEEKGKVGSERWSAAIGNLSEMASNLDSLQKLLVKKAVYVDEDTFAKASLTSEQARTIKV  60

Query  201  LEQRVETLERELDSAISAAARART  272
            LEQRV+TLERELD+AISAAA ART
Sbjct  61   LEQRVQTLERELDNAISAAAHART  84



>ref|XP_006351789.1| PREDICTED: uncharacterized protein LOC102583636 [Solanum tuberosum]
Length=155

 Score =   137 bits (346),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 76/84 (90%), Gaps = 1/84 (1%)
 Frame = +3

Query  24   MEEKGK-GSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  200
            MEEKGK GSERW+AAI N SEM  NLDSLQKLL+KKAV+VD+DT++KA L SEQARTIKV
Sbjct  1    MEEKGKRGSERWSAAIGNLSEMTSNLDSLQKLLVKKAVFVDDDTFAKASLTSEQARTIKV  60

Query  201  LEQRVETLERELDSAISAAARART  272
            LEQRVETLERELD+AISAAA ART
Sbjct  61   LEQRVETLERELDNAISAAAHART  84



>ref|XP_004230636.1| PREDICTED: uncharacterized protein LOC101245002 [Solanum lycopersicum]
Length=155

 Score =   135 bits (339),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 96/107 (90%), Gaps = 1/107 (1%)
 Frame = +3

Query  24   MEEKGK-GSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  200
            MEEKGK GSERW+AAI N SEM  NL+SLQKLL+KKAV+VD+DT++K  L SEQARTIKV
Sbjct  1    MEEKGKVGSERWSAAIGNLSEMTSNLNSLQKLLVKKAVFVDDDTFAKVSLTSEQARTIKV  60

Query  201  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            LEQRV+TLERELD+AISAAA ARTEKRQ E AQKAAEL+AQE+TKEL
Sbjct  61   LEQRVQTLERELDNAISAAAHARTEKRQVEVAQKAAELRAQEVTKEL  107



>ref|XP_011087880.1| PREDICTED: uncharacterized protein LOC105169221 [Sesamum indicum]
Length=156

 Score =   133 bits (334),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  30   EKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQ  209
            EKGK SERWTAAIAN +EM+ NLDSLQKLLIKK+VYVD++T++KA L SEQARTIKVLEQ
Sbjct  7    EKGKVSERWTAAIANLTEMSSNLDSLQKLLIKKSVYVDDETFAKASLSSEQARTIKVLEQ  66

Query  210  RVETLERELDSAISAAARART  272
            RVETLERELD+AIS AA ART
Sbjct  67   RVETLERELDAAISGAAHART  87



>ref|XP_007200439.1| hypothetical protein PRUPE_ppa012787mg [Prunus persica]
 gb|EMJ01638.1| hypothetical protein PRUPE_ppa012787mg [Prunus persica]
Length=154

 Score =   132 bits (333),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  24   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  203
            ME+KGKG+ERW  AI+N +EM+ NL+SLQKLL+KKAV+VDE+T++KA L SEQARTIKVL
Sbjct  1    MEDKGKGNERWNGAISNLTEMSFNLESLQKLLLKKAVFVDEETFAKASLCSEQARTIKVL  60

Query  204  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            EQRVETLERELD+AI+AAAR R+EKRQAEAA+KAAEL AQE+TKEL
Sbjct  61   EQRVETLERELDAAITAAARVRSEKRQAEAAEKAAELHAQEVTKEL  106



>ref|XP_008237183.1| PREDICTED: tropomyosin [Prunus mume]
Length=154

 Score =   132 bits (333),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  24   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  203
            ME+KGKG+ERW  AI+N +EM+ NL+SLQKLL+KKAV+VDE+T++KA L SEQARTIKVL
Sbjct  1    MEDKGKGNERWNGAISNLTEMSFNLESLQKLLLKKAVFVDEETFAKASLCSEQARTIKVL  60

Query  204  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            EQRVETLERELD+AI+AAAR R+EKRQAEAA+KAAEL AQE+TKEL
Sbjct  61   EQRVETLERELDAAITAAARVRSEKRQAEAAEKAAELHAQEVTKEL  106



>ref|XP_004136872.1| PREDICTED: uncharacterized protein LOC101218756 [Cucumis sativus]
 ref|XP_004155445.1| PREDICTED: uncharacterized protein LOC101224157 [Cucumis sativus]
 gb|KGN43713.1| hypothetical protein Csa_7G062790 [Cucumis sativus]
Length=148

 Score =   131 bits (330),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  24   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  203
            ME+KGKG++RW+ A+AN +EM  NLDSLQKLL+KKAVYVD++T+++A L SEQARTIKVL
Sbjct  1    MEDKGKGTDRWSGAVANLTEMTSNLDSLQKLLLKKAVYVDDETFARASLCSEQARTIKVL  60

Query  204  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            EQRVETLERELD+AI++AA AR+EKRQAEAAQ+AAE+  QE+TKEL
Sbjct  61   EQRVETLERELDAAITSAAHARSEKRQAEAAQRAAEVHVQEVTKEL  106



>gb|EYU18485.1| hypothetical protein MIMGU_mgv1a015418mg [Erythranthe guttata]
Length=158

 Score =   130 bits (328),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  30   EKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQ  209
            EK K  ERWTAAIAN +E A NLDSLQ+LLIKKAVYVD DT++KA L SEQARTIKVLEQ
Sbjct  7    EKEKDGERWTAAIANLTETASNLDSLQRLLIKKAVYVDGDTFAKASLSSEQARTIKVLEQ  66

Query  210  RVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            RVETLER+LD+AISAAARARTEKRQAE AQKAAEL+A EITKEL
Sbjct  67   RVETLERKLDNAISAAARARTEKRQAEGAQKAAELRALEITKEL  110



>gb|EPS63433.1| hypothetical protein M569_11351 [Genlisea aurea]
Length=160

 Score =   125 bits (314),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +3

Query  27   EEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLE  206
            EEK KG ERWTAAI+N + M+ N+DSLQKLL+KKAVYVD++T++KA L +EQARTIKVLE
Sbjct  5    EEKAKGDERWTAAISNLAGMSSNIDSLQKLLLKKAVYVDDETFAKASLAAEQARTIKVLE  64

Query  207  QRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
             RVE LE+ELD+AIS AARAR EKRQA+AAQKAAEL+AQEITKEL
Sbjct  65   SRVENLEKELDAAISGAARARAEKRQADAAQKAAELRAQEITKEL  109



>ref|XP_002265916.2| PREDICTED: uncharacterized protein LOC100241703 [Vitis vinifera]
 emb|CBI29477.3| unnamed protein product [Vitis vinifera]
Length=156

 Score =   120 bits (302),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  24   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  203
            MEEKGKGSERW+AAI N SEM  NL+SLQKLL+KKAV+VDE+T++KA L SEQAR IKVL
Sbjct  1    MEEKGKGSERWSAAIGNLSEMTSNLESLQKLLLKKAVFVDEETFAKASLSSEQARIIKVL  60

Query  204  EQRVETLERELD  239
            EQRVETLERELD
Sbjct  61   EQRVETLERELD  72



>emb|CDX84501.1| BnaC03g49990D [Brassica napus]
Length=158

 Score =   120 bits (302),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 97/107 (91%), Gaps = 1/107 (1%)
 Frame = +3

Query  24   MEEKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  200
            MEE+  GSE RW  ++ N +EMA NLDSLQKLL+KKAV+V+EDT+++A L+SEQARTIKV
Sbjct  1    MEEQIGGSEDRWKGSLENITEMASNLDSLQKLLLKKAVFVEEDTFARASLVSEQARTIKV  60

Query  201  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            LEQRV+TLERELD+AI++AA AR+EKRQAE++QKAAEL+AQE+TKEL
Sbjct  61   LEQRVQTLERELDAAITSAAHARSEKRQAESSQKAAELRAQEVTKEL  107



>gb|KCW56997.1| hypothetical protein EUGRSUZ_I02667 [Eucalyptus grandis]
Length=112

 Score =   118 bits (295),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  24   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  203
            MEEKGKGSERW  AIAN +EM+ NL+SLQKLL+KKAV+VDE+T+++A L +EQARTIK+L
Sbjct  1    MEEKGKGSERWGGAIANLTEMSSNLESLQKLLLKKAVFVDEETFARASLTAEQARTIKIL  60

Query  204  EQRVETLERELD  239
            +QRVETLERELD
Sbjct  61   QQRVETLERELD  72



>gb|KJB47205.1| hypothetical protein B456_008G015400 [Gossypium raimondii]
Length=170

 Score =   120 bits (300),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 101/110 (92%), Gaps = 3/110 (3%)
 Frame = +3

Query  21   IMEE--KGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQART  191
            IME+  KGKGSE RWT AIAN +EMA NLDSLQKLL+KKAV+VDEDT++KA L SEQART
Sbjct  12   IMEQEVKGKGSEERWTGAIANLTEMASNLDSLQKLLLKKAVFVDEDTFAKASLTSEQART  71

Query  192  IKVLEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            IKVLEQRVETLERE+D+AI+AAA AR+EKRQAEAAQKAAEL+AQE+TKEL
Sbjct  72   IKVLEQRVETLEREVDAAITAAASARSEKRQAEAAQKAAELRAQEVTKEL  121



>gb|KHG00871.1| Arginine biosynthesis bifunctional ArgJ [Gossypium arboreum]
Length=170

 Score =   119 bits (299),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 68/76 (89%), Gaps = 3/76 (4%)
 Frame = +3

Query  21   IMEE--KGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQART  191
            IME+  KGKGSE RWT AIAN +EMA NLDSLQKLL+KKAV+VDEDT++KA L SEQART
Sbjct  12   IMEQEVKGKGSEERWTGAIANLTEMASNLDSLQKLLLKKAVFVDEDTFAKASLTSEQART  71

Query  192  IKVLEQRVETLERELD  239
            IKVLEQRVETLERE+D
Sbjct  72   IKVLEQRVETLEREVD  87



>gb|KJB47206.1| hypothetical protein B456_008G015400 [Gossypium raimondii]
Length=157

 Score =   118 bits (296),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 97/104 (93%), Gaps = 1/104 (1%)
 Frame = +3

Query  33   KGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQ  209
            KGKGSE RWT AIAN +EMA NLDSLQKLL+KKAV+VDEDT++KA L SEQARTIKVLEQ
Sbjct  6    KGKGSEERWTGAIANLTEMASNLDSLQKLLLKKAVFVDEDTFAKASLTSEQARTIKVLEQ  65

Query  210  RVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            RVETLERE+D+AI+AAA AR+EKRQAEAAQKAAEL+AQE+TKEL
Sbjct  66   RVETLEREVDAAITAAASARSEKRQAEAAQKAAELRAQEVTKEL  109



>ref|XP_009372183.1| PREDICTED: uncharacterized protein LOC103961365 [Pyrus x bretschneideri]
 ref|XP_009334260.1| PREDICTED: uncharacterized protein LOC103927087 [Pyrus x bretschneideri]
Length=152

 Score =   118 bits (295),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  24   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  203
            ME+KGKGSERW  AI N +EMA NL+SLQKLL+KKAV+V+E+T++KA L SEQARTIKVL
Sbjct  1    MEDKGKGSERWNGAIGNLTEMAFNLESLQKLLLKKAVFVEEETFAKASLCSEQARTIKVL  60

Query  204  EQRVETLERELD  239
            EQRVETLERELD
Sbjct  61   EQRVETLERELD  72



>ref|XP_008372559.1| PREDICTED: tropomyosin-like [Malus domestica]
 ref|XP_008372560.1| PREDICTED: tropomyosin-like [Malus domestica]
Length=156

 Score =   118 bits (295),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  24   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  203
            ME+KGKGSERW  AI N +EMA NL+SLQKLL+KKAV+V+E+T++KA L SEQARTIKVL
Sbjct  1    MEDKGKGSERWNGAIGNLTEMAFNLESLQKLLLKKAVFVEEETFAKASLCSEQARTIKVL  60

Query  204  EQRVETLERELD  239
            EQRVETLERELD
Sbjct  61   EQRVETLERELD  72



>ref|XP_004288660.1| PREDICTED: uncharacterized protein LOC101296327 [Fragaria vesca 
subsp. vesca]
Length=154

 Score =   118 bits (295),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  24   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  203
            ME+KGKGSER+  AIAN +EMA NL+SLQKLL+KKAV+VDE+T++KA L SEQARTIKVL
Sbjct  1    MEDKGKGSERFGGAIANLTEMALNLESLQKLLLKKAVFVDEETFTKASLCSEQARTIKVL  60

Query  204  EQRVETLERELD  239
            EQRVETLERELD
Sbjct  61   EQRVETLERELD  72



>ref|XP_010030042.1| PREDICTED: uncharacterized protein LOC104419909 [Eucalyptus grandis]
 gb|KCW56996.1| hypothetical protein EUGRSUZ_I02667 [Eucalyptus grandis]
Length=154

 Score =   117 bits (294),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  24   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  203
            MEEKGKGSERW  AIAN +EM+ NL+SLQKLL+KKAV+VDE+T+++A L +EQARTIK+L
Sbjct  1    MEEKGKGSERWGGAIANLTEMSSNLESLQKLLLKKAVFVDEETFARASLTAEQARTIKIL  60

Query  204  EQRVETLERELD  239
            +QRVETLERELD
Sbjct  61   QQRVETLERELD  72



>ref|XP_008382564.1| PREDICTED: tropomyosin-like [Malus domestica]
Length=152

 Score =   117 bits (293),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  24   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  203
            ME+KGKGSERW  A+ N +EMA NL+SLQKLL+KKAV+V+E+T++KA L SEQARTIKVL
Sbjct  1    MEDKGKGSERWNGALGNLTEMAFNLESLQKLLLKKAVFVEEETFAKASLCSEQARTIKVL  60

Query  204  EQRVETLERELD  239
            EQRVETLERELD
Sbjct  61   EQRVETLERELD  72



>ref|XP_010094162.1| hypothetical protein L484_017206 [Morus notabilis]
 gb|EXB55295.1| hypothetical protein L484_017206 [Morus notabilis]
Length=154

 Score =   116 bits (291),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  24   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  203
            ME+K KGSERW  AI N +EM+ NL+SLQKLL+KKAV+VDE+T++KA L SEQARTIKVL
Sbjct  1    MEDKNKGSERWNGAITNLTEMSSNLESLQKLLLKKAVFVDEETFAKASLSSEQARTIKVL  60

Query  204  EQRVETLERELD  239
            EQRVETLERELD
Sbjct  61   EQRVETLERELD  72



>ref|XP_007042974.1| Dbj:BAA96220.1 [Theobroma cacao]
 gb|EOX98805.1| Dbj:BAA96220.1 [Theobroma cacao]
Length=156

 Score =   115 bits (289),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +3

Query  27   EEKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  203
            +EKGKGSE RW  AIAN +EMA NLDSLQKLL+KKAV+VDEDT++KA L SEQARTIKVL
Sbjct  3    QEKGKGSEERWGGAIANLTEMALNLDSLQKLLLKKAVFVDEDTFAKASLTSEQARTIKVL  62

Query  204  EQRVETLERELD  239
            EQRVETLERE+D
Sbjct  63   EQRVETLEREVD  74



>ref|XP_008372568.1| PREDICTED: uncharacterized protein LOC103435913 isoform X3 [Malus 
domestica]
 ref|XP_008346226.1| PREDICTED: uncharacterized protein LOC103409188 isoform X3 [Malus 
domestica]
Length=156

 Score =   115 bits (288),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  24   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  203
            ME+KGKGSERW  AI N +EMA NL+SLQKLL+KKAV+V+E+T++KA L SEQARTIKVL
Sbjct  1    MEDKGKGSERWNGAIGNLTEMAFNLESLQKLLLKKAVFVEEETFAKASLCSEQARTIKVL  60

Query  204  EQRVETLERELD  239
            EQRVETLE ELD
Sbjct  61   EQRVETLEGELD  72



>ref|XP_010258013.1| PREDICTED: uncharacterized protein LOC104597921 [Nelumbo nucifera]
Length=154

 Score =   114 bits (285),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  24   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  203
            MEEK KG+ERW+A+I N SEM  NLDSLQKLL+KKAV+VDE+T++KA L SEQAR IK L
Sbjct  1    MEEKEKGNERWSASIVNLSEMGANLDSLQKLLMKKAVFVDEETFAKASLSSEQARIIKAL  60

Query  204  EQRVETLERELD  239
            EQRVETLERELD
Sbjct  61   EQRVETLERELD  72



>ref|XP_008372565.1| PREDICTED: uncharacterized protein LOC103435913 isoform X2 [Malus 
domestica]
 ref|XP_008372566.1| PREDICTED: uncharacterized protein LOC103435913 isoform X2 [Malus 
domestica]
 ref|XP_008372567.1| PREDICTED: uncharacterized protein LOC103435913 isoform X2 [Malus 
domestica]
 ref|XP_008346221.1| PREDICTED: uncharacterized protein LOC103409188 isoform X2 [Malus 
domestica]
 ref|XP_008346223.1| PREDICTED: uncharacterized protein LOC103409188 isoform X2 [Malus 
domestica]
 ref|XP_008346224.1| PREDICTED: uncharacterized protein LOC103409188 isoform X2 [Malus 
domestica]
 ref|XP_008346225.1| PREDICTED: uncharacterized protein LOC103409188 isoform X2 [Malus 
domestica]
Length=181

 Score =   114 bits (285),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  24   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  203
            ME+KGKGSERW  AI N +EMA NL+SLQKLL+KKAV+V+E+T++KA L SEQARTIKVL
Sbjct  26   MEDKGKGSERWNGAIGNLTEMAFNLESLQKLLLKKAVFVEEETFAKASLCSEQARTIKVL  85

Query  204  EQRVETLERELD  239
            EQRVETLE ELD
Sbjct  86   EQRVETLEGELD  97



>ref|XP_008372564.1| PREDICTED: uncharacterized protein LOC103435913 isoform X1 [Malus 
domestica]
 ref|XP_008346218.1| PREDICTED: uncharacterized protein LOC103409188 isoform X1 [Malus 
domestica]
 ref|XP_008346219.1| PREDICTED: uncharacterized protein LOC103409188 isoform X1 [Malus 
domestica]
 ref|XP_008346220.1| PREDICTED: uncharacterized protein LOC103409188 isoform X1 [Malus 
domestica]
Length=205

 Score =   114 bits (286),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  24   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  203
            ME+KGKGSERW  AI N +EMA NL+SLQKLL+KKAV+V+E+T++KA L SEQARTIKVL
Sbjct  50   MEDKGKGSERWNGAIGNLTEMAFNLESLQKLLLKKAVFVEEETFAKASLCSEQARTIKVL  109

Query  204  EQRVETLERELD  239
            EQRVETLE ELD
Sbjct  110  EQRVETLEGELD  121



>ref|XP_009358984.1| PREDICTED: uncharacterized protein LOC103949596 [Pyrus x bretschneideri]
 ref|XP_009358985.1| PREDICTED: uncharacterized protein LOC103949596 [Pyrus x bretschneideri]
 ref|XP_009358986.1| PREDICTED: uncharacterized protein LOC103949596 [Pyrus x bretschneideri]
Length=156

 Score =   113 bits (282),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  24   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  203
            ME+K KGSERW  AI N +EMA NL+SLQKLL+KKAV+V+E+T++KA L SEQARTIKVL
Sbjct  1    MEDKRKGSERWNGAIGNLTEMAFNLESLQKLLLKKAVFVEEETFAKASLCSEQARTIKVL  60

Query  204  EQRVETLERELD  239
            EQRVE+LERELD
Sbjct  61   EQRVESLERELD  72



>ref|XP_002530267.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32107.1| conserved hypothetical protein [Ricinus communis]
Length=154

 Score =   112 bits (281),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  24   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  203
            M++   G ERW  AIAN +EMA NLDSL KLLIKKAV+VDEDT++KA L SEQARTIKVL
Sbjct  1    MDKGSSGGERWKGAIANITEMASNLDSLHKLLIKKAVFVDEDTFAKASLTSEQARTIKVL  60

Query  204  EQRVETLERELD  239
            EQRV+TLERELD
Sbjct  61   EQRVDTLERELD  72



>emb|CDY18721.1| BnaA09g06740D [Brassica napus]
Length=158

 Score =   111 bits (277),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 95/107 (89%), Gaps = 1/107 (1%)
 Frame = +3

Query  24   MEEKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  200
            MEE+  GSE RW  ++ N +EMA NLDSLQKLL+KKAV+V+EDT+S+A L+SEQARTIKV
Sbjct  1    MEEQMGGSEDRWKGSLENITEMASNLDSLQKLLLKKAVFVEEDTFSRASLVSEQARTIKV  60

Query  201  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            LEQRV+TLERELD+AI+AAA AR+EKRQAE++QKAAE +A E+TKEL
Sbjct  61   LEQRVQTLERELDAAITAAAHARSEKRQAESSQKAAESRAHEVTKEL  107



>ref|XP_006845889.1| hypothetical protein AMTR_s00154p00087720 [Amborella trichopoda]
 gb|ERN07564.1| hypothetical protein AMTR_s00154p00087720 [Amborella trichopoda]
Length=156

 Score =   111 bits (277),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 71/89 (80%), Gaps = 4/89 (4%)
 Frame = +3

Query  6    REHQLIMEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQA  185
            RE Q++    GKGSERW AA+ N  EM+  LDSLQKLL+ KAVY+DE+ +++A + ++Q 
Sbjct  4    REGQVV----GKGSERWKAALVNVGEMSATLDSLQKLLLTKAVYLDEEAFAQASINADQT  59

Query  186  RTIKVLEQRVETLERELDSAISAAARART  272
            RTIK LEQRV TLE+ELDSAI+AAARAR+
Sbjct  60   RTIKALEQRVATLEKELDSAITAAARARS  88



>ref|NP_201223.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB09849.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL07069.1| unknown protein [Arabidopsis thaliana]
 gb|AAM45070.1| unknown protein [Arabidopsis thaliana]
 gb|AED97851.1| uncharacterized protein AT5G64180 [Arabidopsis thaliana]
Length=158

 Score =   110 bits (276),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 96/107 (90%), Gaps = 1/107 (1%)
 Frame = +3

Query  24   MEEKGKGS-ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  200
            MEE+  GS ERW  ++ N +EMA NLDSLQKLL+KKAV+V+EDT+S+A L+SEQARTIKV
Sbjct  1    MEEQFGGSDERWKGSLENITEMASNLDSLQKLLLKKAVFVEEDTFSRASLVSEQARTIKV  60

Query  201  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            LEQRV+TLERELD+AI+AAA AR+EKRQAE++QKAAE +AQ++TKEL
Sbjct  61   LEQRVQTLERELDAAITAAAHARSEKRQAESSQKAAESRAQDVTKEL  107



>ref|XP_010520965.1| PREDICTED: uncharacterized protein LOC104799966 [Tarenaya hassleriana]
Length=153

 Score =   110 bits (276),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 97/107 (91%), Gaps = 1/107 (1%)
 Frame = +3

Query  24   MEEKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  200
            MEE+ +GSE RW  ++ N +EMA NLDSLQKLL+KKAV+V+ED ++KA L+SEQARTIKV
Sbjct  1    MEEQSRGSEERWRGSLENLTEMASNLDSLQKLLLKKAVFVEEDAFAKASLVSEQARTIKV  60

Query  201  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            LEQRVETLERELD+AI+AAA AR+EKRQAEAAQKAAEL+AQE+TKEL
Sbjct  61   LEQRVETLERELDAAITAAAHARSEKRQAEAAQKAAELRAQEVTKEL  107



>emb|CDX81215.1| BnaC09g06260D [Brassica napus]
Length=158

 Score =   110 bits (275),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 94/107 (88%), Gaps = 1/107 (1%)
 Frame = +3

Query  24   MEEKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  200
            MEE+  GSE RW  ++ N +EMA NLDSLQKLL+KKAV+V+EDT+S+A L+SEQARTIKV
Sbjct  1    MEEQMGGSEDRWRGSLENITEMASNLDSLQKLLLKKAVFVEEDTFSRASLVSEQARTIKV  60

Query  201  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            LEQRV+TLERELD+AI+AAA AR+EKRQAE++QK AE +A E+TKEL
Sbjct  61   LEQRVQTLERELDAAITAAAHARSEKRQAESSQKTAETRALEVTKEL  107



>gb|KDP25845.1| hypothetical protein JCGZ_22875 [Jatropha curcas]
Length=167

 Score =   110 bits (276),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 63/76 (83%), Gaps = 4/76 (5%)
 Frame = +3

Query  24   MEEKGKGS----ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQART  191
            MEEK K      ERW  AIAN +EMA NLDSLQKLL+KKAV+VDE+T++KA L SEQART
Sbjct  1    MEEKDKNKVSSEERWKGAIANLTEMASNLDSLQKLLLKKAVFVDEETFAKASLSSEQART  60

Query  192  IKVLEQRVETLERELD  239
            IKVLEQRVETLERELD
Sbjct  61   IKVLEQRVETLERELD  76



>ref|XP_011044729.1| PREDICTED: uncharacterized protein LOC105139817 isoform X2 [Populus 
euphratica]
 ref|XP_011012586.1| PREDICTED: uncharacterized protein LOC105116801 isoform X2 [Populus 
euphratica]
Length=135

 Score =   110 bits (274),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 64/77 (83%), Gaps = 5/77 (6%)
 Frame = +3

Query  24   MEEKGKGS-----ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQAR  188
            MEEK KGS     ERW  AIAN +EM  NL+SLQKLL+KKAV+V+E+T+SKA L SEQAR
Sbjct  1    MEEKEKGSKGGSEERWKGAIANLTEMTSNLESLQKLLLKKAVFVNEETFSKASLTSEQAR  60

Query  189  TIKVLEQRVETLERELD  239
            +IKVLEQRVETLERELD
Sbjct  61   SIKVLEQRVETLERELD  77



>ref|XP_010484189.1| PREDICTED: uncharacterized protein LOC104762571 [Camelina sativa]
Length=151

 Score =   110 bits (274),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 95/107 (89%), Gaps = 1/107 (1%)
 Frame = +3

Query  24   MEEKGKGS-ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  200
            MEE+  GS ERW  ++ N +EMA NLDSLQKLL+KKAV+V+EDT+S+A L+SEQARTIKV
Sbjct  1    MEEQIGGSDERWKGSLENITEMASNLDSLQKLLLKKAVFVEEDTFSRASLVSEQARTIKV  60

Query  201  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            LEQRV+TLERELD+AI+AAA AR+EKRQAE++QKAAE +A E+TKEL
Sbjct  61   LEQRVQTLERELDAAITAAAHARSEKRQAESSQKAAESRALEVTKEL  107



>ref|XP_010444348.1| PREDICTED: uncharacterized protein LOC104727050 [Camelina sativa]
Length=158

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 95/107 (89%), Gaps = 1/107 (1%)
 Frame = +3

Query  24   MEEKGKGS-ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  200
            MEE+  GS ERW  ++ N +EMA NLDSLQKLL+KKAV+V+EDT+S+A L+SEQARTIKV
Sbjct  1    MEEQIGGSDERWKGSLENITEMASNLDSLQKLLLKKAVFVEEDTFSRASLVSEQARTIKV  60

Query  201  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            LEQRV+TLERELD+AI+AAA AR+EKRQAE++QKAAE +A E+TKEL
Sbjct  61   LEQRVQTLERELDAAITAAAHARSEKRQAESSQKAAESRALEVTKEL  107



>ref|XP_011044728.1| PREDICTED: uncharacterized protein LOC105139817 isoform X1 [Populus 
euphratica]
 ref|XP_011012585.1| PREDICTED: uncharacterized protein LOC105116801 isoform X1 [Populus 
euphratica]
Length=161

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 64/77 (83%), Gaps = 5/77 (6%)
 Frame = +3

Query  24   MEEKGKGS-----ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQAR  188
            MEEK KGS     ERW  AIAN +EM  NL+SLQKLL+KKAV+V+E+T+SKA L SEQAR
Sbjct  1    MEEKEKGSKGGSEERWKGAIANLTEMTSNLESLQKLLLKKAVFVNEETFSKASLTSEQAR  60

Query  189  TIKVLEQRVETLERELD  239
            +IKVLEQRVETLERELD
Sbjct  61   SIKVLEQRVETLERELD  77



>ref|XP_009112121.1| PREDICTED: uncharacterized protein LOC103837517 [Brassica rapa]
Length=158

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 95/107 (89%), Gaps = 1/107 (1%)
 Frame = +3

Query  24   MEEKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  200
            MEE+  GSE RW  ++ N +EMA NLDSLQKLL+KKAV+V+EDT+S+A L+S+QARTIKV
Sbjct  1    MEEQMGGSEDRWKGSLENITEMASNLDSLQKLLLKKAVFVEEDTFSRASLVSDQARTIKV  60

Query  201  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            LEQRV+TLERELD+AI+AAA AR+EKRQAE++QKAAE +A E+TKEL
Sbjct  61   LEQRVQTLERELDAAITAAAHARSEKRQAESSQKAAESRAHEVTKEL  107



>ref|XP_006394188.1| hypothetical protein EUTSA_v10005060mg [Eutrema salsugineum]
 gb|ESQ31474.1| hypothetical protein EUTSA_v10005060mg [Eutrema salsugineum]
Length=158

 Score =   109 bits (272),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 96/107 (90%), Gaps = 1/107 (1%)
 Frame = +3

Query  24   MEEKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  200
            MEE+  GSE RW  ++ N +EMA NLDSLQKLL+KKAV+V+EDT+++A L+SEQARTIKV
Sbjct  1    MEEQIGGSEDRWKGSLENITEMASNLDSLQKLLLKKAVFVEEDTFARASLVSEQARTIKV  60

Query  201  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            LEQRV+TLERELD+AI+AAA AR+EKRQAE++QKAAE +AQE+TKEL
Sbjct  61   LEQRVQTLERELDAAITAAAHARSEKRQAESSQKAAESRAQEVTKEL  107



>ref|XP_010461470.1| PREDICTED: uncharacterized protein LOC104742194 [Camelina sativa]
Length=158

 Score =   108 bits (271),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 95/107 (89%), Gaps = 1/107 (1%)
 Frame = +3

Query  24   MEEKGKGS-ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  200
            MEE+  GS ERW  ++ N +EMA NLDSLQKLL+KKAV+V+EDT+S+A L+SEQ+RTIKV
Sbjct  1    MEEQIGGSDERWKGSLENITEMASNLDSLQKLLLKKAVFVEEDTFSRASLVSEQSRTIKV  60

Query  201  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            LEQRV+TLERELD+AI+AAA AR+EKRQAE++QKAAE +A E+TKEL
Sbjct  61   LEQRVQTLERELDAAITAAAHARSEKRQAESSQKAAESRALEVTKEL  107



>gb|KFK28102.1| hypothetical protein AALP_AA8G472800 [Arabis alpina]
Length=158

 Score =   108 bits (270),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 95/107 (89%), Gaps = 1/107 (1%)
 Frame = +3

Query  24   MEEKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  200
            M+E+  GSE RW  +I N +EM+ NLDSLQKLL+KKAV+V+EDT+S+A L+SEQARTIKV
Sbjct  1    MDEQIGGSEDRWKGSIDNITEMSSNLDSLQKLLLKKAVFVEEDTFSRASLVSEQARTIKV  60

Query  201  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            LEQRV+TLERELD+AI+AAA AR+EKRQAE++QKAAE +A E+TKEL
Sbjct  61   LEQRVQTLERELDAAITAAAHARSEKRQAESSQKAAESRALEVTKEL  107



>ref|XP_006281242.1| hypothetical protein CARUB_v10027285mg [Capsella rubella]
 gb|EOA14140.1| hypothetical protein CARUB_v10027285mg [Capsella rubella]
Length=158

 Score =   108 bits (270),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 96/107 (90%), Gaps = 1/107 (1%)
 Frame = +3

Query  24   MEEKGKGS-ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  200
            MEE+ +GS ERW  ++ N +EMA NLDSLQKL++KKAV+V+EDT+++A L+SEQARTIKV
Sbjct  1    MEEQIEGSDERWKGSLENITEMASNLDSLQKLILKKAVFVEEDTFTRASLVSEQARTIKV  60

Query  201  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            LEQRV+TLERELD+AI+AAA AR+EKRQAE++QKAAE +A E+TKEL
Sbjct  61   LEQRVQTLERELDAAITAAAHARSEKRQAESSQKAAESRALEVTKEL  107



>ref|XP_002864885.1| hypothetical protein ARALYDRAFT_919722 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41144.1| hypothetical protein ARALYDRAFT_919722 [Arabidopsis lyrata subsp. 
lyrata]
Length=158

 Score =   108 bits (270),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 96/107 (90%), Gaps = 1/107 (1%)
 Frame = +3

Query  24   MEEKGKGS-ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  200
            MEE+  GS ERW  ++ N +EMA NLDSLQKLL+KKAV+V+EDT+++A L+SEQARTIK+
Sbjct  1    MEEQIGGSDERWKGSLENITEMASNLDSLQKLLLKKAVFVEEDTFARASLVSEQARTIKI  60

Query  201  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            LEQRV+TLERELD+AI+AAA AR+EKRQAE++QKAAE +AQE+TKEL
Sbjct  61   LEQRVQTLERELDAAITAAAHARSEKRQAESSQKAAESRAQEVTKEL  107



>ref|XP_002321368.1| hypothetical protein POPTR_0015s00800g [Populus trichocarpa]
 gb|EEF05495.1| hypothetical protein POPTR_0015s00800g [Populus trichocarpa]
Length=159

 Score =   107 bits (268),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 63/77 (82%), Gaps = 5/77 (6%)
 Frame = +3

Query  24   MEEKGKGS-----ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQAR  188
            MEEK KGS     ERW  AIAN + M  NLDSLQKLL+KKAV+V+E+T+SKA L SEQAR
Sbjct  1    MEEKEKGSKGGSEERWKGAIANLTGMTLNLDSLQKLLLKKAVFVNEETFSKASLTSEQAR  60

Query  189  TIKVLEQRVETLERELD  239
            +IKVLEQRVETLERELD
Sbjct  61   SIKVLEQRVETLERELD  77



>ref|XP_010690481.1| PREDICTED: uncharacterized protein LOC104904010 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=162

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +3

Query  30   EKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQ  209
            EKGK +ERW  AIAN +EM+GNL+SL+KLL+KKAV+VDEDT++KA L S QARTIKVLEQ
Sbjct  5    EKGKTNERWDTAIANLTEMSGNLESLEKLLLKKAVFVDEDTFNKASLASHQARTIKVLEQ  64

Query  210  RVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            RVETLERELD++I+AAA AR+EKRQAEAAQKAAEL+ QEITKEL
Sbjct  65   RVETLERELDASITAAAHARSEKRQAEAAQKAAELRTQEITKEL  108



>gb|AAM62887.1| unknown [Arabidopsis thaliana]
Length=158

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 95/107 (89%), Gaps = 1/107 (1%)
 Frame = +3

Query  24   MEEKGKGS-ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  200
            MEE+  GS ERW  ++ N +EMA NLDSLQKLL+KKAV+V+EDT+S+A L+SEQARTIKV
Sbjct  1    MEEQFGGSDERWKGSLENITEMASNLDSLQKLLLKKAVFVEEDTFSRASLVSEQARTIKV  60

Query  201  LEQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            LE RV+TLERELD+AI+AAA AR+EKRQAE++QKAAE +AQE+TKEL
Sbjct  61   LELRVQTLERELDAAITAAAHARSEKRQAESSQKAAESRAQEVTKEL  107



>ref|XP_010690482.1| PREDICTED: uncharacterized protein LOC104904010 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=145

 Score =   106 bits (264),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +3

Query  30   EKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQ  209
            EKGK +ERW  AIAN +EM+GNL+SL+KLL+KKAV+VDEDT++KA L S QARTIKVLEQ
Sbjct  5    EKGKTNERWDTAIANLTEMSGNLESLEKLLLKKAVFVDEDTFNKASLASHQARTIKVLEQ  64

Query  210  RVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            RVETLERELD++I+AAA AR+EKRQAEAAQKAAEL+ QEITKEL
Sbjct  65   RVETLERELDASITAAAHARSEKRQAEAAQKAAELRTQEITKEL  108



>gb|KDO40741.1| hypothetical protein CISIN_1g031305mg [Citrus sinensis]
Length=122

 Score =   105 bits (261),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 94/105 (90%), Gaps = 1/105 (1%)
 Frame = +3

Query  30   EKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLE  206
            +K KGSE RW  AIAN +EM+ NL+SLQ LL+KKAV+VD+DT++KA L SEQ+RTIKVLE
Sbjct  10   QKMKGSEERWRGAIANLTEMSSNLESLQSLLLKKAVFVDDDTFAKASLSSEQSRTIKVLE  69

Query  207  QRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            QRVETLERELD+AI+AAA AR EKRQAEAAQKAAEL+AQEITKEL
Sbjct  70   QRVETLERELDAAITAAAHARLEKRQAEAAQKAAELRAQEITKEL  114



>ref|XP_011043705.1| PREDICTED: uncharacterized protein LOC105139082 [Populus euphratica]
Length=159

 Score =   105 bits (263),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +3

Query  33   KGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQR  212
            KG   ERW  A+ N +EM  NLDSL+KLL+KKAV+VD++T+SKA L SEQARTIKVLEQR
Sbjct  9    KGGSEERWKGAVDNLTEMTSNLDSLEKLLLKKAVFVDDETFSKASLTSEQARTIKVLEQR  68

Query  213  VETLERELD  239
            VETLERELD
Sbjct  69   VETLERELD  77



>gb|KDO40742.1| hypothetical protein CISIN_1g031305mg [Citrus sinensis]
Length=143

 Score =   105 bits (262),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 94/105 (90%), Gaps = 1/105 (1%)
 Frame = +3

Query  30   EKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLE  206
            +K KGSE RW  AIAN +EM+ NL+SLQ LL+KKAV+VD+DT++KA L SEQ+RTIKVLE
Sbjct  10   QKMKGSEERWRGAIANLTEMSSNLESLQSLLLKKAVFVDDDTFAKASLSSEQSRTIKVLE  69

Query  207  QRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            QRVETLERELD+AI+AAA AR EKRQAEAAQKAAEL+AQEITKEL
Sbjct  70   QRVETLERELDAAITAAAHARLEKRQAEAAQKAAELRAQEITKEL  114



>ref|XP_006487654.1| PREDICTED: tropomyosin-like isoform X1 [Citrus sinensis]
Length=162

 Score =   105 bits (262),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 94/105 (90%), Gaps = 1/105 (1%)
 Frame = +3

Query  30   EKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLE  206
            +K KGSE RW  AIAN +EM+ NL+SLQ LL+KKAV+VD+DT++KA L SEQ+RTIKVLE
Sbjct  10   QKMKGSEERWRGAIANLTEMSSNLESLQSLLLKKAVFVDDDTFTKASLSSEQSRTIKVLE  69

Query  207  QRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            QRVETLERELD+AI+AAA AR EKRQAEAAQKAAEL+AQEITKEL
Sbjct  70   QRVETLERELDAAITAAAHARLEKRQAEAAQKAAELRAQEITKEL  114



>gb|KDO40740.1| hypothetical protein CISIN_1g031305mg [Citrus sinensis]
Length=162

 Score =   105 bits (262),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 94/105 (90%), Gaps = 1/105 (1%)
 Frame = +3

Query  30   EKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLE  206
            +K KGSE RW  AIAN +EM+ NL+SLQ LL+KKAV+VD+DT++KA L SEQ+RTIKVLE
Sbjct  10   QKMKGSEERWRGAIANLTEMSSNLESLQSLLLKKAVFVDDDTFAKASLSSEQSRTIKVLE  69

Query  207  QRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            QRVETLERELD+AI+AAA AR EKRQAEAAQKAAEL+AQEITKEL
Sbjct  70   QRVETLERELDAAITAAAHARLEKRQAEAAQKAAELRAQEITKEL  114



>gb|KDO40739.1| hypothetical protein CISIN_1g031305mg [Citrus sinensis]
Length=161

 Score =   105 bits (261),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 94/105 (90%), Gaps = 1/105 (1%)
 Frame = +3

Query  30   EKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLE  206
            +K KGSE RW  AIAN +EM+ NL+SLQ LL+KKAV+VD+DT++KA L SEQ+RTIKVLE
Sbjct  10   QKMKGSEERWRGAIANLTEMSSNLESLQSLLLKKAVFVDDDTFAKASLSSEQSRTIKVLE  69

Query  207  QRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            QRVETLERELD+AI+AAA AR EKRQAEAAQKAAEL+AQEITKEL
Sbjct  70   QRVETLERELDAAITAAAHARLEKRQAEAAQKAAELRAQEITKEL  114



>ref|XP_011092419.1| PREDICTED: uncharacterized protein LOC105172602 [Sesamum indicum]
 ref|XP_011092420.1| PREDICTED: uncharacterized protein LOC105172602 [Sesamum indicum]
 ref|XP_011092421.1| PREDICTED: uncharacterized protein LOC105172602 [Sesamum indicum]
Length=173

 Score =   105 bits (262),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +3

Query  30   EKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQ  209
            EK K   RW A+IAN +EMA NLDSL KLLIKK VYVD +T++KA L SEQARTIK LEQ
Sbjct  22   EKAKAGGRWPASIANLTEMASNLDSLNKLLIKKVVYVDNETFAKASLSSEQARTIKALEQ  81

Query  210  RVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            RVETLERELD+AISAAARARTEKRQAEAAQKAAEL+ QEITKEL
Sbjct  82   RVETLERELDAAISAAARARTEKRQAEAAQKAAELRQQEITKEL  125



>gb|KHN39222.1| hypothetical protein glysoja_028027 [Glycine soja]
Length=142

 Score =   104 bits (259),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 69/83 (83%), Gaps = 2/83 (2%)
 Frame = +3

Query  24   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  203
            M E  KG ERW+ A+ N +EMA NLDSLQKLL+ KAV+VD+DT+SKA L ++QAR+IK+L
Sbjct  7    MGESEKG-ERWSGAMTNLTEMASNLDSLQKLLLTKAVFVDDDTFSKASLAADQARSIKLL  65

Query  204  EQRVETLERELDSAI-SAAARAR  269
             QRV+TLERE+D+AI SA +RA+
Sbjct  66   HQRVQTLEREVDAAIKSAESRAQ  88



>ref|XP_006423897.1| hypothetical protein CICLE_v10029442mg [Citrus clementina]
 gb|ESR37137.1| hypothetical protein CICLE_v10029442mg [Citrus clementina]
Length=143

 Score =   104 bits (259),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 93/105 (89%), Gaps = 1/105 (1%)
 Frame = +3

Query  30   EKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLE  206
            +K KGSE RW  AIAN  EM+ NL+SLQ LL+KKAV+VD+DT++KA L SEQ+RTIKVLE
Sbjct  10   QKMKGSEERWRGAIANLMEMSSNLESLQSLLLKKAVFVDDDTFAKASLSSEQSRTIKVLE  69

Query  207  QRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            QRVETLERELD+AI+AAA AR EKRQAEAAQKAAEL+AQEITKEL
Sbjct  70   QRVETLERELDAAITAAAHARLEKRQAEAAQKAAELRAQEITKEL  114



>ref|XP_006487655.1| PREDICTED: tropomyosin-like isoform X2 [Citrus sinensis]
Length=145

 Score =   103 bits (258),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 94/105 (90%), Gaps = 1/105 (1%)
 Frame = +3

Query  30   EKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLE  206
            +K KGSE RW  AIAN +EM+ NL+SLQ LL+KKAV+VD+DT++KA L SEQ+RTIKVLE
Sbjct  10   QKMKGSEERWRGAIANLTEMSSNLESLQSLLLKKAVFVDDDTFTKASLSSEQSRTIKVLE  69

Query  207  QRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            QRVETLERELD+AI+AAA AR EKRQAEAAQKAAEL+AQEITKEL
Sbjct  70   QRVETLERELDAAITAAAHARLEKRQAEAAQKAAELRAQEITKEL  114



>ref|XP_006423898.1| hypothetical protein CICLE_v10029442mg [Citrus clementina]
 gb|ESR37138.1| hypothetical protein CICLE_v10029442mg [Citrus clementina]
Length=162

 Score =   104 bits (259),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 93/105 (89%), Gaps = 1/105 (1%)
 Frame = +3

Query  30   EKGKGSE-RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLE  206
            +K KGSE RW  AIAN  EM+ NL+SLQ LL+KKAV+VD+DT++KA L SEQ+RTIKVLE
Sbjct  10   QKMKGSEERWRGAIANLMEMSSNLESLQSLLLKKAVFVDDDTFAKASLSSEQSRTIKVLE  69

Query  207  QRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            QRVETLERELD+AI+AAA AR EKRQAEAAQKAAEL+AQEITKEL
Sbjct  70   QRVETLERELDAAITAAAHARLEKRQAEAAQKAAELRAQEITKEL  114



>ref|XP_002317807.2| hypothetical protein POPTR_0012s02910g [Populus trichocarpa]
 gb|EEE96027.2| hypothetical protein POPTR_0012s02910g [Populus trichocarpa]
Length=217

 Score =   105 bits (261),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = +3

Query  33   KGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQR  212
            KG   ERW  A+ N +EM  NLDSLQKLL+KKAV+VD++T+SKA L SEQARTIKVLEQR
Sbjct  67   KGGSEERWKGAVDNLTEMTSNLDSLQKLLVKKAVFVDDETFSKASLTSEQARTIKVLEQR  126

Query  213  VETLERELD  239
            VETLER LD
Sbjct  127  VETLERGLD  135



>ref|XP_009150491.1| PREDICTED: myosin heavy chain, muscle [Brassica rapa]
 emb|CDY43797.1| BnaA06g23330D [Brassica napus]
Length=158

 Score =   103 bits (257),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +3

Query  27   EEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLE  206
            EE G   +RW  ++ N +EMA NLDSLQKLL+KKAV+V+EDT+++A L+SEQ R IKVLE
Sbjct  3    EEIGGREDRWKGSLENITEMASNLDSLQKLLLKKAVFVEEDTFARASLVSEQGRAIKVLE  62

Query  207  QRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            QRV+TLERELD+AI+AAA AR+EKR AE++QKAAE +AQE+TKEL
Sbjct  63   QRVQTLERELDAAITAAAHARSEKRHAESSQKAAESRAQEVTKEL  107



>ref|XP_010939192.1| PREDICTED: uncharacterized protein LOC105058098 [Elaeis guineensis]
Length=144

 Score =   102 bits (255),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 59/72 (82%), Gaps = 1/72 (1%)
 Frame = +3

Query  24   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  203
            M EK  G ERW AAI N +EM  NL+SLQKLL KKAV+VD+DT++KA L ++QARTIK L
Sbjct  1    MAEKA-GGERWKAAIVNVTEMGANLESLQKLLAKKAVFVDDDTFAKASLTADQARTIKAL  59

Query  204  EQRVETLERELD  239
            EQRVETLERELD
Sbjct  60   EQRVETLERELD  71



>ref|XP_004504787.1| PREDICTED: uncharacterized protein LOC101494197 [Cicer arietinum]
Length=153

 Score =   100 bits (250),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 61/72 (85%), Gaps = 1/72 (1%)
 Frame = +3

Query  24   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  203
            M+EK KG ERW+ A+ N SEM  NL+SLQK+L+ KAV+VD+DT++KA L ++QARTIK+L
Sbjct  1    MDEKVKG-ERWSGAMTNLSEMGANLESLQKILLTKAVFVDDDTFAKASLAADQARTIKLL  59

Query  204  EQRVETLERELD  239
            EQRV TLERELD
Sbjct  60   EQRVHTLERELD  71



>ref|XP_003524738.2| PREDICTED: uncharacterized protein LOC100804902 isoform 1 [Glycine 
max]
Length=166

 Score =   101 bits (251),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 61/72 (85%), Gaps = 1/72 (1%)
 Frame = +3

Query  24   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  203
            M E  KG ERW+ A+ N +EMA NLDSLQKLL+ KAV+VD+DT+SKA L ++QARTIK+L
Sbjct  14   MGENEKG-ERWSGAMTNLTEMASNLDSLQKLLLTKAVFVDDDTFSKASLAADQARTIKLL  72

Query  204  EQRVETLERELD  239
            +QRV+TLERE+D
Sbjct  73   QQRVQTLEREVD  84



>gb|KEH31227.1| SKIP interacting protein [Medicago truncatula]
Length=147

 Score = 99.4 bits (246),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 60/72 (83%), Gaps = 1/72 (1%)
 Frame = +3

Query  24   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  203
            M+   KG ERW+ A+ N SEM+ NL+SLQKLL+ KAV+VD+DT+SKA L ++QARTIK+L
Sbjct  1    MDSDSKG-ERWSGAMTNLSEMSSNLESLQKLLLTKAVFVDDDTFSKASLAADQARTIKLL  59

Query  204  EQRVETLERELD  239
            +QRV TLERELD
Sbjct  60   DQRVHTLERELD  71



>ref|XP_003531035.1| PREDICTED: uncharacterized protein LOC100779456 [Glycine max]
Length=159

 Score = 98.6 bits (244),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 60/72 (83%), Gaps = 1/72 (1%)
 Frame = +3

Query  24   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  203
            M E  KG ERW+ A+ N +EMA NLDSLQKLL+ KAV+VD+DT+SKA L ++QAR+IK+L
Sbjct  7    MGESEKG-ERWSGAMTNLTEMASNLDSLQKLLLTKAVFVDDDTFSKASLAADQARSIKLL  65

Query  204  EQRVETLERELD  239
             QRV+TLERE+D
Sbjct  66   HQRVQTLEREVD  77



>ref|XP_009394775.1| PREDICTED: uncharacterized protein LOC103980189 [Musa acuminata 
subsp. malaccensis]
Length=156

 Score = 98.2 bits (243),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  48   ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETLE  227
            ERW AAI N SEM  NLD++QKL+ KKAV+VDE+T+ KA LISEQ RTIKVLE RVE LE
Sbjct  12   ERWKAAIMNLSEMGANLDAMQKLMAKKAVFVDEETFVKASLISEQGRTIKVLEHRVEALE  71

Query  228  RELD  239
            +ELD
Sbjct  72   KELD  75



>gb|ADE75769.1| unknown [Picea sitchensis]
Length=176

 Score = 98.2 bits (243),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 62/80 (78%), Gaps = 1/80 (1%)
 Frame = +3

Query  36   GKG-SERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQR  212
            G G SERW AAI N SEM   LDSLQKLL++KAVYVDE+ +++A   S QAR    LE+R
Sbjct  20   GNGASERWNAAIGNLSEMGSTLDSLQKLLLQKAVYVDEEAFAQASANSVQARNAVALERR  79

Query  213  VETLERELDSAISAAARART  272
            V+TLERELD+AI+A+A ART
Sbjct  80   VKTLERELDAAITASACART  99



>ref|XP_007159096.1| hypothetical protein PHAVU_002G208400g [Phaseolus vulgaris]
 gb|ESW31090.1| hypothetical protein PHAVU_002G208400g [Phaseolus vulgaris]
Length=171

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +3

Query  18   LIMEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIK  197
            ++M  + +  ERW+ A+ N +EM+ NL+SLQKLL+ KAV+VD+DT+SKA L ++QAR+IK
Sbjct  16   MMMTGENEKGERWSGAMTNLTEMSSNLESLQKLLLTKAVFVDDDTFSKASLTADQARSIK  75

Query  198  VLEQRVETLERELD  239
            +L+QRVETLERE+D
Sbjct  76   LLQQRVETLEREVD  89



>ref|XP_008785611.1| PREDICTED: uncharacterized protein LOC103704198 [Phoenix dactylifera]
Length=156

 Score = 97.1 bits (240),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +3

Query  48   ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETLE  227
            ERW A I N +EM  NL+SLQKLL KKAV+VD+DT++KA L ++QARTIK LEQRVE+LE
Sbjct  11   ERWKATIVNVTEMGANLESLQKLLAKKAVFVDDDTFAKASLTADQARTIKALEQRVESLE  70

Query  228  RELD  239
            RELD
Sbjct  71   RELD  74



>ref|XP_008455213.1| PREDICTED: uncharacterized protein LOC103495430 [Cucumis melo]
Length=148

 Score = 95.9 bits (237),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +3

Query  24   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  203
            ME+KGKG++RW+ A+AN +EM  NLD LQKLL+KKAVYVD++T+++A L SEQARTIKVL
Sbjct  1    MEDKGKGTDRWSGAVANLTEMTSNLDLLQKLLLKKAVYVDDETFARASLCSEQARTIKVL  60

Query  204  EQRVETLERELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
            EQRVETLERELD+AI+AAA AR+EKRQAEAAQ+AAE+  QE+TKEL
Sbjct  61   EQRVETLERELDAAITAAAHARSEKRQAEAAQRAAEVHVQEVTKEL  106



>gb|KHN32568.1| hypothetical protein glysoja_047900 [Glycine soja]
Length=136

 Score = 94.4 bits (233),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 59/69 (86%), Gaps = 4/69 (6%)
 Frame = +3

Query  66   IANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETLERELDSA  245
            + N +EMA NLDSLQKLL+ KAV+VD+DT+SKA L ++QARTIK+L+QRV+TLERE+D  
Sbjct  1    MTNLTEMASNLDSLQKLLLTKAVFVDDDTFSKASLAADQARTIKLLQQRVQTLEREVD--  58

Query  246  ISAAARART  272
              AAARAR+
Sbjct  59   --AAARARS  65



>ref|XP_004962943.1| PREDICTED: uncharacterized protein LOC101774171 [Setaria italica]
Length=193

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +3

Query  48   ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETLE  227
            ERW+AAI N  E+  N+D LQKLL +KAV+VD+D +SKA L ++QARTIKVL+QRV++LE
Sbjct  41   ERWSAAIGNLGELGANVDGLQKLLARKAVFVDDDIFSKASLAADQARTIKVLDQRVQSLE  100

Query  228  RELD  239
            RELD
Sbjct  101  RELD  104



>ref|XP_009394316.1| PREDICTED: uncharacterized protein LOC103979826 [Musa acuminata 
subsp. malaccensis]
Length=160

 Score = 93.6 bits (231),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   RWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETLER  230
            RW AA+ N SE+  N++SLQK+L+KKAV+VDE+T++KA L SEQ RTIK LEQRVE LER
Sbjct  17   RWKAALVNISEIGTNVESLQKILVKKAVFVDEETFAKASLTSEQGRTIKALEQRVEALER  76

Query  231  ELD  239
            ELD
Sbjct  77   ELD  79



>ref|NP_001168817.1| hypothetical protein [Zea mays]
 gb|ACN30779.1| unknown [Zea mays]
 gb|AFW56390.1| hypothetical protein ZEAMMB73_105006 [Zea mays]
Length=187

 Score = 94.0 bits (232),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +3

Query  48   ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETLE  227
            ERW+AAI N  E+  N+D+LQK+L +KAV+VD+D +SKA L ++QARTIKVL+QRV++LE
Sbjct  42   ERWSAAIGNLGELGANVDALQKMLGRKAVFVDDDIFSKASLAADQARTIKVLDQRVQSLE  101

Query  228  RELD  239
            RELD
Sbjct  102  RELD  105



>gb|ACG26932.1| hypothetical protein [Zea mays]
Length=186

 Score = 93.6 bits (231),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +3

Query  48   ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETLE  227
            +RW+AAI N  E+  N+D+LQKLL +KAV+VD+D +SKA L ++QARTIKVL+QRV++LE
Sbjct  41   DRWSAAIGNLGELGANVDALQKLLGRKAVFVDDDIFSKASLAADQARTIKVLDQRVQSLE  100

Query  228  RELD  239
            RELD
Sbjct  101  RELD  104



>ref|XP_002443220.1| hypothetical protein SORBIDRAFT_08g015570 [Sorghum bicolor]
 gb|EES17058.1| hypothetical protein SORBIDRAFT_08g015570 [Sorghum bicolor]
Length=191

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +3

Query  48   ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETLE  227
            ERW+AAI N  E+  N+D+LQKLL +KAV+VD+D +SKA L ++QARTIKVL+QRV++LE
Sbjct  39   ERWSAAIGNLGELGANVDALQKLLGRKAVFVDDDIFSKASLAADQARTIKVLDQRVQSLE  98

Query  228  RELD  239
            RELD
Sbjct  99   RELD  102



>ref|XP_008672642.1| PREDICTED: uncharacterized protein LOC100278260 isoform X1 [Zea 
mays]
 tpg|DAA55403.1| TPA: hypothetical protein ZEAMMB73_575352 [Zea mays]
Length=192

 Score = 93.6 bits (231),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +3

Query  45   SERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETL  224
             +RW AAI N  E+  N+D+LQKLL +KAV+VD+D +SKA L ++QARTIKVL+QRV++L
Sbjct  42   GDRWCAAIGNLGELGANVDALQKLLGRKAVFVDDDIFSKASLAADQARTIKVLDQRVQSL  101

Query  225  ERELD  239
            ERELD
Sbjct  102  ERELD  106



>ref|NP_001145064.1| uncharacterized protein LOC100278260 [Zea mays]
 gb|ACG44746.1| hypothetical protein [Zea mays]
 tpg|DAA55402.1| TPA: hypothetical protein ZEAMMB73_575352 [Zea mays]
Length=188

 Score = 93.2 bits (230),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +3

Query  45   SERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETL  224
             +RW AAI N  E+  N+D+LQKLL +KAV+VD+D +SKA L ++QARTIKVL+QRV++L
Sbjct  42   GDRWCAAIGNLGELGANVDALQKLLGRKAVFVDDDIFSKASLAADQARTIKVLDQRVQSL  101

Query  225  ERELD  239
            ERELD
Sbjct  102  ERELD  106



>gb|EMS46364.1| hypothetical protein TRIUR3_27207 [Triticum urartu]
Length=237

 Score = 94.0 bits (232),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +3

Query  45   SERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETL  224
             ERW AAI N  E+  N++SLQKLL +KAV+VD+D +SKA L SEQAR+IK+L+QRV++L
Sbjct  25   GERWGAAIGNLGELGANVESLQKLLARKAVFVDDDVFSKASLASEQARSIKILDQRVQSL  84

Query  225  ERELD  239
            ERELD
Sbjct  85   ERELD  89



>dbj|BAJ89520.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=171

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +3

Query  48   ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETLE  227
            ERW AAI N  E+  N++SLQKLL +KAV+VDED +SKA L SEQAR+IK+L+QRV++LE
Sbjct  26   ERWGAAIGNLGELGANVESLQKLLARKAVFVDEDVFSKASLASEQARSIKILDQRVQSLE  85

Query  228  RELDSAISAAARARTekrqaeaaqkaaelqaqeITKEL  341
             ELD+AISAAARARTEKRQAEAAQ+AAEL+AQE+TKEL
Sbjct  86   HELDAAISAAARARTEKRQAEAAQRAAELRAQEVTKEL  123



>ref|XP_003576107.1| PREDICTED: uncharacterized protein LOC100823803 [Brachypodium 
distachyon]
Length=178

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +3

Query  45   SERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETL  224
             ERW AAI N  E+  N++SLQKLL +KAV+VDED +SKA L +EQ R+IK+LEQRV +L
Sbjct  32   GERWGAAIGNLGELGANVESLQKLLARKAVFVDEDVFSKASLAAEQTRSIKILEQRVLSL  91

Query  225  ERELD  239
            ERELD
Sbjct  92   ERELD  96



>ref|XP_006664576.1| PREDICTED: myosin-7B-like, partial [Oryza brachyantha]
Length=139

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +3

Query  69   ANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETLERELD  239
             N +E+  N+++LQKL+ KKAV+VDED +SKA L ++QARTIK+L+QRV++LERELD
Sbjct  1    GNLTELGANVEALQKLMAKKAVFVDEDIFSKASLAADQARTIKILDQRVQSLERELD  57



>emb|CDO97456.1| unnamed protein product [Coffea canephora]
Length=135

 Score = 79.3 bits (194),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 46/70 (66%), Gaps = 20/70 (29%)
 Frame = +3

Query  30   EKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQ  209
            EK KGSERWTAAI N SE+A NLDSLQKLL+KKAVY                    VLEQ
Sbjct  7    EKAKGSERWTAAITNLSEIAANLDSLQKLLMKKAVY--------------------VLEQ  46

Query  210  RVETLERELD  239
            RVETLERELD
Sbjct  47   RVETLERELD  56



>gb|EEE53261.1| hypothetical protein OsJ_36194 [Oryza sativa Japonica Group]
Length=173

 Score = 79.7 bits (195),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +3

Query  66   IANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETLERELD  239
            + N +E+  N+ +LQ+LL KKAV+VDED +SKA L ++QARTIK+L+QRV++LERELD
Sbjct  34   VGNLTELGANVAALQRLLAKKAVFVDEDIFSKASLAADQARTIKILDQRVQSLERELD  91



>gb|ACA64832.1| SKIP interacting protein 15 [Oryza sativa]
Length=173

 Score = 79.3 bits (194),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +3

Query  66   IANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVETLERELD  239
            + N +E+  N+ +LQ+LL KKAV+VDED +SKA L ++QARTIK+L+QRV++LERELD
Sbjct  34   VGNLTELGANVAALQRLLAKKAVFVDEDIFSKASLAADQARTIKILDQRVQSLERELD  91



>ref|XP_002981396.1| hypothetical protein SELMODRAFT_114499 [Selaginella moellendorffii]
 gb|EFJ17584.1| hypothetical protein SELMODRAFT_114499 [Selaginella moellendorffii]
Length=160

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +3

Query  42   GSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVET  221
            GS+RW+AA++N S++ G ++SL  LL+ KAVY+DE+ +  A   + Q+R     E+R+  
Sbjct  20   GSDRWSAALSNVSQIGGVVESLSGLLLHKAVYMDEEAFGHAASNARQSRNAVAQERRIRA  79

Query  222  LERELDSAISAAARART  272
            LE+ELDSAI+AA +AR 
Sbjct  80   LEKELDSAIAAARQARV  96



>ref|XP_008672643.1| PREDICTED: uncharacterized protein LOC100278260 isoform X2 [Zea 
mays]
Length=191

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 50/68 (74%), Gaps = 2/68 (3%)
 Frame = +3

Query  45   SERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVE--  218
             +RW AAI N  E+  N+D+LQKLL +KAV+VD+D +SKA L ++QARTIKV  Q ++  
Sbjct  42   GDRWCAAIGNLGELGANVDALQKLLGRKAVFVDDDIFSKASLAADQARTIKVPSQILQHR  101

Query  219  TLERELDS  242
            T+ER  +S
Sbjct  102  TIERGGES  109



>ref|XP_001779944.1| predicted protein [Physcomitrella patens]
 gb|EDQ55261.1| predicted protein [Physcomitrella patens]
Length=165

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = +3

Query  42   GSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVET  221
             S+R+ AA+AN ++M  +L+SLQ +L +KAVY+DED ++ A  +S Q+RT+K  E+R++ 
Sbjct  19   ASDRFAAALANVNDMGQSLESLQSML-RKAVYLDEDVFANASAVSNQSRTLKAQERRIKA  77

Query  222  LERELD  239
            LERELD
Sbjct  78   LERELD  83



>ref|XP_002969920.1| hypothetical protein SELMODRAFT_170924 [Selaginella moellendorffii]
 gb|EFJ29044.1| hypothetical protein SELMODRAFT_170924 [Selaginella moellendorffii]
Length=160

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  42   GSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVLEQRVET  221
            GS+RW+AA++N S++   ++SL   L+ KAVY+DE+ +  A   + Q+R+    E+R+  
Sbjct  20   GSDRWSAALSNVSQIGDVVESLSGFLLHKAVYMDEEAFGHAASNARQSRSAVAQERRIRA  79

Query  222  LERELDSAISAAARART  272
            LE+ELDSAI+AA +AR 
Sbjct  80   LEKELDSAIAAARQARV  96



>ref|NP_001066826.2| Os12g0502100 [Oryza sativa Japonica Group]
 dbj|BAF29845.2| Os12g0502100 [Oryza sativa Japonica Group]
Length=188

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 22/80 (28%)
 Frame = +3

Query  66   IANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV---------------  200
            + N +E+  N+ +LQ+LL KKAV+VDED +SKA L ++QARTIKV               
Sbjct  34   VGNLTELGANVAALQRLLAKKAVFVDEDIFSKASLAADQARTIKVILLCFALLVAGAPDS  93

Query  201  -------LEQRVETLERELD  239
                   L+QRV++LERELD
Sbjct  94   PPIPSPILDQRVQSLERELD  113



>ref|XP_009394773.1| PREDICTED: mitochondrial substrate carrier family protein E [Musa 
acuminata subsp. malaccensis]
Length=388

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 38/67 (57%), Positives = 44/67 (66%), Gaps = 10/67 (15%)
 Frame = +3

Query  24   MEEKGKGSERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  203
            M EKG G           SEM  N DS+QKLL KKAV+VD++ ++KA LISEQARTIKVL
Sbjct  1    MAEKGGGD----------SEMGANPDSMQKLLAKKAVFVDKEPFAKASLISEQARTIKVL  50

Query  204  EQRVETL  224
            E   E L
Sbjct  51   EHGREFL  57



>gb|AGT16664.1| hypothetical protein SHCRBa_107_F16_F_190 [Saccharum hybrid cultivar 
R570]
Length=504

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +3

Query  48   ERWTAAIANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV  200
            E+W+A I N  E++ N+D+LQKLL +KA++VD+D +SKA L ++QARTIK+
Sbjct  79   EQWSAPIGNLGELSANVDALQKLLRRKAIFVDDDIFSKASLAADQARTIKM  129



>gb|ABA98637.1| expressed protein [Oryza sativa Japonica Group]
Length=208

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 49/93 (53%), Gaps = 35/93 (38%)
 Frame = +3

Query  66   IANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKV---------------  200
            + N +E+  N+ +LQ+LL KKAV+VDED +SKA L ++QARTIKV               
Sbjct  34   VGNLTELGANVAALQRLLAKKAVFVDEDIFSKASLAADQARTIKVILLCFALLVAGAPDS  93

Query  201  --------------------LEQRVETLERELD  239
                                L+QRV++LERELD
Sbjct  94   PPIPSPVSSAMLFCQLVDLILDQRVQSLERELD  126



>gb|EAY83218.1| hypothetical protein OsI_38427 [Oryza sativa Indica Group]
Length=242

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +3

Query  66   IANFSEMAGNLDSLQKLLIKKAVYVDEDTYSKAYLISEQARTIKVL  203
            + N +E+  N+ +LQ+LL KKAV+VDED +SKA L ++QARTIKV+
Sbjct  34   VGNLTELGANVAALQRLLAKKAVFVDEDIFSKASLAADQARTIKVI  79



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556620951360