BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP008C09 352 bp,

Length=333
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011075483.1|  PREDICTED: 40S ribosomal protein S9-2              182   2e-55   Sesamum indicum [beniseed]
ref|NP_001275235.1|  uncharacterized protein LOC102577830               182   2e-55   Solanum tuberosum [potatoes]
ref|XP_004135180.1|  PREDICTED: 40S ribosomal protein S9-2-like         181   6e-55   Cucumis sativus [cucumbers]
ref|XP_010256989.1|  PREDICTED: 40S ribosomal protein S9-2-like         181   7e-55   Nelumbo nucifera [Indian lotus]
gb|KCW56192.1|  hypothetical protein EUGRSUZ_I01938                     179   9e-55   Eucalyptus grandis [rose gum]
ref|XP_004228395.1|  PREDICTED: 40S ribosomal protein S9-2              181   9e-55   Solanum lycopersicum
ref|XP_004238784.1|  PREDICTED: 40S ribosomal protein S9-2              180   1e-54   Solanum lycopersicum
gb|KCW87774.1|  hypothetical protein EUGRSUZ_A00153                     178   1e-54   Eucalyptus grandis [rose gum]
ref|XP_010037164.1|  PREDICTED: 40S ribosomal protein S9-2-like         180   1e-54   Eucalyptus grandis [rose gum]
ref|XP_010029297.1|  PREDICTED: 40S ribosomal protein S9-2              180   1e-54   Eucalyptus grandis [rose gum]
ref|XP_011085760.1|  PREDICTED: 40S ribosomal protein S9-2-like         180   2e-54   Sesamum indicum [beniseed]
ref|XP_002517490.1|  40S ribosomal protein S9, putative                 180   2e-54   Ricinus communis
emb|CDP02222.1|  unnamed protein product                                180   2e-54   Coffea canephora [robusta coffee]
ref|XP_011098613.1|  PREDICTED: 40S ribosomal protein S9-2              179   2e-54   Sesamum indicum [beniseed]
ref|XP_010029477.1|  PREDICTED: 40S ribosomal protein S9-2              179   2e-54   Eucalyptus grandis [rose gum]
ref|XP_010091216.1|  40S ribosomal protein S9-2                         179   2e-54   Morus notabilis
ref|XP_009627396.1|  PREDICTED: 40S ribosomal protein S9-2              179   3e-54   Nicotiana tomentosiformis
gb|KCW56189.1|  hypothetical protein EUGRSUZ_I01938                     178   3e-54   Eucalyptus grandis [rose gum]
gb|KDP31233.1|  hypothetical protein JCGZ_11609                         179   3e-54   Jatropha curcas
ref|XP_009600364.1|  PREDICTED: 40S ribosomal protein S9-2-like         179   4e-54   Nicotiana tomentosiformis
ref|XP_002283256.1|  PREDICTED: 40S ribosomal protein S9-2              179   4e-54   Vitis vinifera
gb|KDP41175.1|  hypothetical protein JCGZ_15582                         179   4e-54   Jatropha curcas
ref|XP_009604777.1|  PREDICTED: 40S ribosomal protein S9-2-like         179   4e-54   Nicotiana tomentosiformis
gb|EPS73776.1|  hypothetical protein M569_00980                         179   5e-54   Genlisea aurea
ref|NP_001274868.1|  40S ribosomal protein S9-2-like                    179   5e-54   Solanum tuberosum [potatoes]
gb|EYU22431.1|  hypothetical protein MIMGU_mgv1a014214mg                179   6e-54   Erythranthe guttata [common monkey flower]
ref|XP_007209623.1|  hypothetical protein PRUPE_ppa011764mg             179   6e-54   Prunus persica
ref|XP_009598709.1|  PREDICTED: 40S ribosomal protein S9-2-like         178   6e-54   Nicotiana tomentosiformis
ref|XP_009778292.1|  PREDICTED: 40S ribosomal protein S9-2              178   7e-54   Nicotiana sylvestris
ref|XP_002276284.1|  PREDICTED: 40S ribosomal protein S9-2              178   9e-54   Vitis vinifera
ref|XP_009798560.1|  PREDICTED: 40S ribosomal protein S9-2-like         178   9e-54   Nicotiana sylvestris
ref|XP_009779308.1|  PREDICTED: 40S ribosomal protein S9-2-like         178   1e-53   Nicotiana sylvestris
ref|XP_006367430.1|  PREDICTED: 40S ribosomal protein S9-2-like i...    177   1e-53   Solanum tuberosum [potatoes]
gb|EYU34659.1|  hypothetical protein MIMGU_mgv1a014209mg                177   1e-53   Erythranthe guttata [common monkey flower]
ref|XP_004299381.1|  PREDICTED: 40S ribosomal protein S9-2-like         177   2e-53   Fragaria vesca subsp. vesca
ref|XP_002511557.1|  40S ribosomal protein S9, putative                 177   2e-53   Ricinus communis
ref|XP_010242426.1|  PREDICTED: 40S ribosomal protein S9-2              177   3e-53   Nelumbo nucifera [Indian lotus]
tpg|DAA55417.1|  TPA: hypothetical protein ZEAMMB73_005048              176   4e-53   Zea mays [maize]
ref|XP_003577383.1|  PREDICTED: 40S ribosomal protein S9-2-like         176   6e-53   Brachypodium distachyon [annual false brome]
ref|XP_006367431.1|  PREDICTED: 40S ribosomal protein S9-2-like i...    176   7e-53   Solanum tuberosum [potatoes]
ref|XP_002522398.1|  40S ribosomal protein S9, putative                 176   7e-53   Ricinus communis
gb|ABQ32300.1|  putative 40S ribosomal protein S9                       176   7e-53   Artemisia annua [sweet Annie]
ref|XP_002317362.1|  hypothetical protein POPTR_0011s09670g             176   8e-53   Populus trichocarpa [western balsam poplar]
gb|ABF94049.1|  40S ribosomal protein S9, putative, expressed           174   9e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003576178.1|  PREDICTED: 40S ribosomal protein S9-2-like         175   1e-52   Brachypodium distachyon [annual false brome]
gb|ABA94598.1|  40S ribosomal protein S9, putative, expressed           174   1e-52   Oryza sativa Japonica Group [Japonica rice]
emb|CDP00311.1|  unnamed protein product                                175   1e-52   Coffea canephora [robusta coffee]
emb|CAG47084.1|  40S ribosomal protein S9                               175   1e-52   Catharanthus roseus [chatas]
ref|NP_001278530.1|  40S ribosomal protein S9                           175   1e-52   Zea mays [maize]
gb|EYU28732.1|  hypothetical protein MIMGU_mgv1a014218mg                175   2e-52   Erythranthe guttata [common monkey flower]
ref|XP_007138197.1|  hypothetical protein PHAVU_009G188600g             175   2e-52   Phaseolus vulgaris [French bean]
gb|AFK46709.1|  unknown                                                 175   2e-52   Lotus japonicus
gb|ABK21901.1|  unknown                                                 175   2e-52   Picea sitchensis
ref|XP_004499428.1|  PREDICTED: 40S ribosomal protein S9-2-like         175   2e-52   Cicer arietinum [garbanzo]
ref|XP_006663032.1|  PREDICTED: 40S ribosomal protein S9-2-like         174   2e-52   Oryza brachyantha
ref|XP_010274527.1|  PREDICTED: 40S ribosomal protein S9-2-like         175   2e-52   Nelumbo nucifera [Indian lotus]
gb|ABA94602.1|  40S ribosomal protein S9, putative, expressed           174   2e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011004198.1|  PREDICTED: 40S ribosomal protein S9-2 isofor...    174   2e-52   Populus euphratica
ref|NP_001149705.1|  40S ribosomal protein S9                           174   2e-52   Zea mays [maize]
gb|EMS50632.1|  40S ribosomal protein S9-2                              174   2e-52   Triticum urartu
ref|XP_003562635.1|  PREDICTED: 40S ribosomal protein S9-2-like         174   2e-52   Brachypodium distachyon [annual false brome]
ref|NP_001131442.1|  uncharacterized protein LOC100192774               174   3e-52   Zea mays [maize]
ref|NP_001049004.1|  Os03g0154700                                       174   3e-52   
ref|XP_007155321.1|  hypothetical protein PHAVU_003G191200g             174   3e-52   Phaseolus vulgaris [French bean]
ref|NP_001276185.1|  40S ribosomal protein S9-2-like                    174   3e-52   Glycine max [soybeans]
tpg|DAA41535.1|  TPA: hypothetical protein ZEAMMB73_424707              176   3e-52   Zea mays [maize]
ref|XP_003549666.1|  PREDICTED: 40S ribosomal protein S9-2-like         174   3e-52   Glycine max [soybeans]
ref|XP_008780681.1|  PREDICTED: 40S ribosomal protein S9-2              174   4e-52   Phoenix dactylifera
ref|XP_004508755.1|  PREDICTED: 40S ribosomal protein S9-2-like         174   4e-52   Cicer arietinum [garbanzo]
ref|XP_010917021.1|  PREDICTED: 40S ribosomal protein S9-2              174   4e-52   Elaeis guineensis
ref|XP_003557815.1|  PREDICTED: 40S ribosomal protein S9-2              174   4e-52   Brachypodium distachyon [annual false brome]
ref|XP_006380606.1|  hypothetical protein POPTR_0007s09750g             174   4e-52   Populus trichocarpa [western balsam poplar]
ref|XP_002442158.1|  hypothetical protein SORBIDRAFT_08g015270          174   5e-52   Sorghum bicolor [broomcorn]
ref|XP_004962962.1|  PREDICTED: 40S ribosomal protein S9-2-like         173   6e-52   Setaria italica
gb|ACG33443.1|  40S ribosomal protein S9                                173   6e-52   Zea mays [maize]
ref|XP_006664031.1|  PREDICTED: 40S ribosomal protein S9-2-like         173   7e-52   Oryza brachyantha
ref|XP_007215987.1|  hypothetical protein PRUPE_ppa011733mg             173   7e-52   Prunus persica
gb|KJB74899.1|  hypothetical protein B456_012G055000                    173   7e-52   Gossypium raimondii
gb|KJB70960.1|  hypothetical protein B456_011G097500                    173   7e-52   Gossypium raimondii
gb|KJB33600.1|  hypothetical protein B456_006G020700                    173   7e-52   Gossypium raimondii
gb|KHG16530.1|  40S ribosomal S9-2 -like protein                        173   7e-52   Gossypium arboreum [tree cotton]
ref|XP_007037295.1|  Ribosomal protein S4                               173   8e-52   Theobroma cacao [chocolate]
ref|XP_009383889.1|  PREDICTED: 40S ribosomal protein S9-2-like         173   8e-52   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB11057.1|  hypothetical protein B456_001G238700                    173   1e-51   Gossypium raimondii
ref|XP_002463229.1|  hypothetical protein SORBIDRAFT_02g040120          172   1e-51   Sorghum bicolor [broomcorn]
ref|XP_002463225.1|  hypothetical protein SORBIDRAFT_02g040080          172   1e-51   Sorghum bicolor [broomcorn]
ref|XP_006657990.1|  PREDICTED: 40S ribosomal protein S9-2-like         172   1e-51   Oryza brachyantha
ref|XP_009389620.1|  PREDICTED: 40S ribosomal protein S9-2-like         172   1e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009414866.1|  PREDICTED: 40S ribosomal protein S9-2              172   1e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403622.1|  PREDICTED: 40S ribosomal protein S9-2-like         172   1e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004958404.1|  PREDICTED: 40S ribosomal protein S9-2-like         172   1e-51   Setaria italica
emb|CDP08233.1|  unnamed protein product                                169   1e-51   Coffea canephora [robusta coffee]
ref|XP_006650139.1|  PREDICTED: 40S ribosomal protein S9-2-like         172   1e-51   Oryza brachyantha
ref|XP_004984207.1|  PREDICTED: 40S ribosomal protein S9-2-like         172   1e-51   Setaria italica
gb|AES91245.2|  40S ribosomal protein S9, putative                      169   2e-51   Medicago truncatula
ref|XP_011004201.1|  PREDICTED: 40S ribosomal protein S9-2-like i...    172   2e-51   Populus euphratica
ref|XP_004304310.1|  PREDICTED: 40S ribosomal protein S9-2              172   2e-51   Fragaria vesca subsp. vesca
ref|XP_011004703.1|  PREDICTED: 40S ribosomal protein S9-2-like         172   2e-51   Populus euphratica
gb|ABR17162.1|  unknown                                                 172   2e-51   Picea sitchensis
ref|XP_002323418.1|  hypothetical protein POPTR_0016s07730g             172   2e-51   Populus trichocarpa [western balsam poplar]
ref|XP_010939529.1|  PREDICTED: 40S ribosomal protein S9-2-like         172   3e-51   Elaeis guineensis
ref|XP_007032505.1|  Ribosomal protein S4                               172   3e-51   Theobroma cacao [chocolate]
ref|XP_003598026.1|  40S ribosomal protein S9                           172   3e-51   Medicago truncatula
ref|XP_010937076.1|  PREDICTED: 40S ribosomal protein S9-2-like         172   3e-51   Elaeis guineensis
gb|ACU15321.1|  unknown                                                 172   3e-51   Glycine max [soybeans]
gb|AFK40975.1|  unknown                                                 171   3e-51   Medicago truncatula
ref|XP_010435836.1|  PREDICTED: 40S ribosomal protein S9-2              171   4e-51   Camelina sativa [gold-of-pleasure]
ref|XP_002324730.1|  hypothetical protein POPTR_0018s07520g             171   4e-51   Populus trichocarpa [western balsam poplar]
ref|XP_006282728.1|  hypothetical protein CARUB_v10005777mg             171   4e-51   Capsella rubella
dbj|BAJ90873.1|  predicted protein                                      171   5e-51   Hordeum vulgare subsp. vulgare [barley]
ref|NP_001238740.1|  uncharacterized protein LOC100305663               171   5e-51   Glycine max [soybeans]
ref|XP_003609048.1|  40S ribosomal protein S9                           171   7e-51   
emb|CDP07223.1|  unnamed protein product                                167   7e-51   Coffea canephora [robusta coffee]
ref|XP_010554004.1|  PREDICTED: 40S ribosomal protein S9-2              170   9e-51   Tarenaya hassleriana [spider flower]
ref|NP_198801.1|  40S ribosomal protein S9-2                            169   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870751.1|  40S ribosomal protein S9                           169   2e-50   Arabidopsis lyrata subsp. lyrata
gb|KFK33188.1|  hypothetical protein AALP_AA6G341500                    169   2e-50   Arabis alpina [alpine rockcress]
gb|AAT08735.1|  40S ribosomal protein S9                                168   5e-50   Hyacinthus orientalis [common hyacinth]
gb|AGV54486.1|  40S ribosomal protein S9-2-like protein                 168   5e-50   Phaseolus vulgaris [French bean]
ref|XP_006438663.1|  hypothetical protein CICLE_v10032800mg             168   5e-50   Citrus clementina
ref|XP_001754369.1|  predicted protein                                  168   6e-50   Physcomitrella patens
ref|XP_001767226.1|  predicted protein                                  168   6e-50   Physcomitrella patens
ref|XP_001777561.1|  predicted protein                                  168   6e-50   Physcomitrella patens
ref|XP_006405589.1|  hypothetical protein EUTSA_v10027944mg             168   6e-50   Eutrema salsugineum
ref|XP_008341567.1|  PREDICTED: 40S ribosomal protein S9-2              165   8e-50   Malus domestica [apple tree]
gb|EMS59613.1|  40S ribosomal protein S9-2                              167   9e-50   Triticum urartu
ref|XP_001754496.1|  predicted protein                                  167   1e-49   Physcomitrella patens
emb|CDP18850.1|  unnamed protein product                                164   1e-49   Coffea canephora [robusta coffee]
ref|XP_003623232.1|  40S ribosomal protein S9                           167   1e-49   Medicago truncatula
ref|XP_010551858.1|  PREDICTED: 40S ribosomal protein S9-2-like         166   3e-49   Tarenaya hassleriana [spider flower]
ref|XP_003637511.1|  40S ribosomal protein S9                           167   3e-49   
ref|XP_008341561.1|  PREDICTED: 40S ribosomal protein S9-2              166   3e-49   Malus domestica [apple tree]
ref|XP_008379343.1|  PREDICTED: 40S ribosomal protein S9-2              166   3e-49   Malus domestica [apple tree]
gb|EAY83173.1|  hypothetical protein OsI_38384                          165   4e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_010550058.1|  PREDICTED: 40S ribosomal protein S9-2-like         166   5e-49   Tarenaya hassleriana [spider flower]
ref|XP_010545191.1|  PREDICTED: 40S ribosomal protein S9-2-like         166   5e-49   Tarenaya hassleriana [spider flower]
ref|XP_006431128.1|  hypothetical protein CICLE_v10013599mg             166   5e-49   Citrus clementina
ref|XP_001762390.1|  predicted protein                                  166   6e-49   Physcomitrella patens
gb|EAY83171.1|  hypothetical protein OsI_38381                          165   1e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_010524330.1|  PREDICTED: 40S ribosomal protein S9-2-like         165   1e-48   Tarenaya hassleriana [spider flower]
ref|XP_010695717.1|  PREDICTED: 40S ribosomal protein S9-2-like         164   2e-48   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009124855.1|  PREDICTED: 40S ribosomal protein S9-2              164   2e-48   Brassica rapa
emb|CDX74423.1|  BnaA04g09660D                                          164   2e-48   Brassica napus [oilseed rape]
gb|KJB70959.1|  hypothetical protein B456_011G097500                    162   5e-48   Gossypium raimondii
ref|XP_010683223.1|  PREDICTED: 40S ribosomal protein S9-2              163   6e-48   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010420178.1|  PREDICTED: 40S ribosomal protein S9-1              163   6e-48   Camelina sativa [gold-of-pleasure]
ref|NP_001119227.1|  40S ribosomal protein S9-1                         161   8e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006400037.1|  hypothetical protein EUTSA_v10014722mg             162   9e-48   Eutrema salsugineum
ref|XP_006288701.1|  hypothetical protein CARUB_v10002009mg             162   9e-48   Capsella rubella
ref|NP_197024.1|  40S ribosomal protein S9-1                            162   9e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002985335.1|  hypothetical protein SELMODRAFT_157263             162   1e-47   Selaginella moellendorffii
gb|KFK25765.1|  hypothetical protein AALP_AA8G156800                    162   2e-47   Arabis alpina [alpine rockcress]
ref|XP_002873713.1|  40S ribosomal protein S9                           162   2e-47   Arabidopsis lyrata subsp. lyrata
ref|XP_002960852.1|  hypothetical protein SELMODRAFT_74302              160   1e-46   Selaginella moellendorffii
ref|XP_010092050.1|  40S ribosomal protein S9-2                         162   2e-46   Morus notabilis
ref|XP_009126038.1|  PREDICTED: 40S ribosomal protein S9-1-like         159   2e-46   Brassica rapa
ref|XP_009131450.1|  PREDICTED: 40S ribosomal protein S9-1              159   2e-46   Brassica rapa
gb|ADB77797.1|  40S ribosomal protein S9                                157   7e-46   Chlamydomonas reinhardtii
ref|XP_001702303.1|  ribosomal protein S9, component of cytosolic...    157   1e-45   Chlamydomonas reinhardtii
ref|XP_002958222.1|  component of cytosolic 80S ribosome and 40S ...    155   4e-45   Volvox carteri f. nagariensis
gb|EEC74543.1|  hypothetical protein OsI_10067                          158   8e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_006827176.1|  hypothetical protein AMTR_s00010p00256040          156   8e-45   
emb|CDY30273.1|  BnaC04g31840D                                          164   2e-44   Brassica napus [oilseed rape]
gb|ADB77799.1|  40S ribosomal protein S9                                150   1e-43   Klebsormidium flaccidum
gb|KHG14244.1|  40S ribosomal S9-2 -like protein                        152   1e-43   Gossypium arboreum [tree cotton]
gb|KHG14681.1|  40S ribosomal S9-2 -like protein                        152   1e-43   Gossypium arboreum [tree cotton]
ref|XP_002467783.1|  hypothetical protein SORBIDRAFT_01g033980          149   1e-42   Sorghum bicolor [broomcorn]
gb|ADB77794.1|  40S ribosomal protein S9                                147   1e-42   Ulvella repens
ref|XP_008367548.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    149   2e-42   
pdb|3J60|J  Chain J, Localization Of The Small Subunit Ribosomal ...    149   2e-42   Triticum aestivum [Canadian hard winter wheat]
gb|KHN30826.1|  40S ribosomal protein S9-2                              148   3e-42   Glycine soja [wild soybean]
ref|XP_002500609.1|  predicted protein                                  148   4e-42   Micromonas commoda
emb|CEF99084.1|  Ribosomal protein S4/S9, eukaryotic/archaeal           148   4e-42   Ostreococcus tauri
ref|XP_001419792.1|  Ribosomal protein S9, component of cytosolic...    147   7e-42   Ostreococcus lucimarinus CCE9901
gb|KHG06711.1|  40S ribosomal S9-2 -like protein                        148   2e-41   Gossypium arboreum [tree cotton]
gb|KDP41176.1|  hypothetical protein JCGZ_15583                         145   4e-41   Jatropha curcas
ref|XP_005849917.1|  hypothetical protein CHLNCDRAFT_56085              145   5e-41   Chlorella variabilis
gb|ADB77802.1|  40S ribosomal protein S9                                144   6e-41   Ulva intestinalis
gb|KIZ06357.1|  40S ribosomal protein S9-2                              145   7e-41   Monoraphidium neglectum
ref|XP_005648482.1|  ribosomal protein S9 component of cytosolic ...    144   8e-41   Coccomyxa subellipsoidea C-169
ref|XP_003056784.1|  predicted protein                                  144   2e-40   Micromonas pusilla CCMP1545
gb|KIZ02547.1|  40S ribosomal protein S9-2                              144   2e-40   Monoraphidium neglectum
emb|CCI69515.1|  40S ribosomal protein S9                               140   4e-40   Chlorochytrium lemnae
ref|WP_039781875.1|  hypothetical protein                               141   5e-40   
emb|CBN76630.1|  conserved unknown protein                              142   1e-39   Ectocarpus siliculosus
gb|EJK71823.1|  hypothetical protein THAOC_06697                        141   2e-39   Thalassiosira oceanica
gb|ADB77800.1|  40S ribosomal protein S9                                139   2e-39   Phyllodictyon orientale
gb|ADB77796.1|  40S ribosomal protein S9                                138   4e-39   Boodlea composita
ref|XP_002289706.1|  RS9, ribosomal protein 9                           140   6e-39   Thalassiosira pseudonana CCMP1335
gb|ADB77795.1|  40S ribosomal protein S9                                137   2e-38   Boergesenia forbesii
gb|ADB77801.1|  40S ribosomal protein S9                                136   3e-38   Siphonocladus tropicus
ref|XP_011399104.1|  40S ribosomal protein S9-1                         135   2e-37   Auxenochlorella protothecoides
gb|ADB77798.1|  40S ribosomal protein S9                                135   3e-37   Cladophora coelothrix
tpg|DAA45584.1|  TPA: hypothetical protein ZEAMMB73_929581              132   4e-37   Zea mays [maize]
gb|AEX13009.1|  hypothetical protein CL240Contig1_05                    131   6e-37   Pinus taeda
ref|XP_009038600.1|  hypothetical protein AURANDRAFT_28757              134   9e-37   Aureococcus anophagefferens
ref|XP_005708491.1|  40S ribosomal protein S9e                          133   2e-36   Galdieria sulphuraria
emb|CDR95115.1|  40S ribosomal subunit protein S9, putative             132   5e-36   Babesia bigemina
dbj|BAA78592.1|  40S ribosomal protein S9                               132   5e-36   Chlamydomonas sp. HS-5
ref|XP_002179777.1|  predicted protein                                  131   7e-36   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_005852611.1|  small subunit ribosomal protein S9e                132   1e-35   Nannochloropsis gaditana CCMP526
ref|XP_009531030.1|  hypothetical protein PHYSODRAFT_354997             131   1e-35   Phytophthora sojae
emb|CCF75909.1|  unnamed protein product                                131   1e-35   Babesia microti strain RI
gb|EWM23131.1|  40s ribosomal protein s9                                131   5e-35   Nannochloropsis gaditana
gb|ABF96251.1|  40S ribosomal protein S9, putative                      129   5e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002903192.1|  40S ribosomal protein S9-1                         129   8e-35   Phytophthora infestans T30-4
ref|XP_005780612.1|  hypothetical protein EMIHUDRAFT_460715             128   1e-34   Emiliania huxleyi CCMP1516
ref|XP_005534862.1|  40S ribosomal protein S9                           129   1e-34   Cyanidioschyzon merolae strain 10D
ref|XP_005767233.1|  hypothetical protein EMIHUDRAFT_61745              128   2e-34   Emiliania huxleyi CCMP1516
ref|XP_004830832.1|  40S ribosomal protein S9, putative                 128   2e-34   Theileria equi
ref|XP_006438664.1|  hypothetical protein CICLE_v10033755mg             127   4e-34   Citrus clementina
ref|XP_006381973.1|  hypothetical protein POPTR_0006s22640g             127   5e-34   Populus trichocarpa [western balsam poplar]
emb|CCI48676.1|  unnamed protein product                                127   6e-34   Albugo candida
ref|XP_001609790.1|  40S ribosomal subunit protein S9                   126   7e-34   Babesia bovis T2Bo
ref|XP_002139923.1|  40S ribosomal protein S9                           126   1e-33   Cryptosporidium muris RN66
ref|XP_008876439.1|  ribosomal protein S4                               125   2e-33   Aphanomyces invadans
ref|XP_008623589.1|  40S ribosomal protein                              125   2e-33   Plasmodium vinckei vinckei
gb|ETB62408.1|  40S ribosomal protein S9                                125   2e-33   Plasmodium yoelii 17X
emb|CDS49582.1|  40S ribosomal protein S9, putative                     125   2e-33   Plasmodium berghei ANKA
ref|XP_010092053.1|  40S ribosomal protein S9-2                         128   3e-33   Morus notabilis
ref|XP_763944.1|  40S ribosomal protein S9                              125   3e-33   Theileria parva strain Muguga
ref|XP_002367195.1|  40S ribosomal protein S9, putative                 125   4e-33   Toxoplasma gondii ME49
ref|XP_730059.1|  ribosomal protein S4                                  125   4e-33   Plasmodium yoelii yoelii 17XNL
emb|CCA22601.1|  40S ribosomal protein S91 putative                     125   4e-33   Albugo laibachii Nc14
emb|CDJ32982.1|  40S ribosomal protein S9, putative                     124   4e-33   Eimeria mitis
emb|CDI78299.1|  40S ribosomal protein S9, putative                     124   5e-33   Eimeria acervulina
gb|EME38681.1|  ribosomal protein S9-like protein                       124   5e-33   Dothistroma septosporum NZE10
gb|KIN07697.1|  hypothetical protein OIDMADRAFT_16275                   124   5e-33   Oidiodendron maius Zn
gb|KIV80024.1|  40S ribosomal protein S9                                124   5e-33   Exophiala sideris
gb|KEF58004.1|  40S ribosomal protein S9                                124   6e-33   Exophiala aquamarina CBS 119918
gb|KIW15420.1|  40S ribosomal protein S9                                124   6e-33   Exophiala spinifera
gb|EKG11582.1|  Ribosomal protein S4/S9                                 124   6e-33   Macrophomina phaseolina MS6
ref|XP_952982.1|  40S ribosomal protein S9                              124   6e-33   Theileria annulata strain Ankara
ref|XP_009846369.1|  ribosomal protein S4                               124   6e-33   Aphanomyces astaci
gb|KIW73335.1|  40S ribosomal protein S9                                124   6e-33   Capronia semi-immersa
ref|XP_008722253.1|  40S ribosomal protein S9                           124   6e-33   Cladophialophora carrionii CBS 160.54
ref|XP_001546443.1|  40S ribosomal protein S9                           124   7e-33   Botrytis cinerea B05.10
ref|XP_007724904.1|  40S ribosomal protein S9                           124   7e-33   Capronia coronata CBS 617.96
ref|XP_009155008.1|  40S ribosomal protein S9                           124   7e-33   Exophiala dermatitidis NIH/UT8656
ref|XP_007922661.1|  hypothetical protein MYCFIDRAFT_60241              124   8e-33   Cercospora fijiensis CIRAD86
gb|KIW44874.1|  40S ribosomal protein S9                                124   8e-33   Exophiala oligosperma
ref|XP_008654154.1|  PREDICTED: 40S ribosomal protein S9-2-like         124   8e-33   Zea mays [maize]
ref|XP_003886044.1|  hypothetical protein NCLIV_064440                  124   8e-33   Neospora caninum Liverpool
gb|KIW07901.1|  40S ribosomal protein S9                                124   8e-33   Verruconis gallopava
gb|KIW50177.1|  40S ribosomal protein S9                                124   8e-33   Exophiala xenobiotica
ref|XP_007587858.1|  putative 40s ribosomal protein s9 protein          124   8e-33   Neofusicoccum parvum UCRNP2
ref|XP_007750565.1|  40S ribosomal protein S9                           124   8e-33   Cladophialophora psammophila CBS 110553
gb|KIW24305.1|  40S ribosomal protein S9                                124   9e-33   Cladophialophora immunda
ref|XP_007782986.1|  40S ribosomal protein S9                           124   9e-33   Coniosporium apollinis CBS 100218
ref|XP_009692519.1|  40S ribosomal protein S9                           124   1e-32   Theileria orientalis strain Shintoku
ref|XP_007731850.1|  40S ribosomal protein S9                           124   1e-32   Capronia epimyces CBS 606.96
ref|XP_001712313.1|  rps9                                               123   1e-32   Hemiselmis andersenii
gb|AET50489.1|  hypothetical protein                                    123   1e-32   Eimeria tenella
gb|EJY75464.1|  Ribosomal protein S4, putative                          123   1e-32   Oxytricha trifallax
emb|CDW90132.1|  40s ribosomal protein                                  123   1e-32   Stylonychia lemnae
ref|XP_001351758.1|  40S ribosomal protein S9, putative                 123   1e-32   Plasmodium falciparum 3D7
ref|XP_002486003.1|  40S ribosomal protein S9                           123   2e-32   Talaromyces stipitatus ATCC 10500
emb|CDO63078.1|  40S ribosomal protein S9, putative                     123   2e-32   Plasmodium reichenowi
ref|XP_001613757.1|  40S ribosomal protein S9                           123   2e-32   Plasmodium vivax Sal-1
gb|ESZ90022.1|  40S ribosomal protein S9                                123   2e-32   Sclerotinia borealis F-4157
gb|AFP65624.1|  40S ribosomal protein S9                                123   2e-32   Chroomonas mesostigmatica CCMP1168
emb|CDJ50108.1|  40S ribosomal protein S9, putative                     123   2e-32   Eimeria brunetti
dbj|GAM43906.1|  40S ribosomal protein                                  123   2e-32   Talaromyces cellulolyticus
ref|XP_002259613.1|  40S ribosomal subunit protein S9                   123   2e-32   Plasmodium knowlesi strain H
ref|XP_001246606.1|  40S ribosomal protein S9                           123   2e-32   Coccidioides immitis RS
ref|XP_001594205.1|  40S ribosomal protein S9                           123   2e-32   Sclerotinia sclerotiorum 1980 UF-70
ref|XP_006691696.1|  40S ribosomal protein s9-like protein              123   2e-32   Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_001791646.1|  hypothetical protein SNOG_00985                    123   2e-32   Parastagonospora nodorum SN15
ref|XP_002152417.1|  40S ribosomal protein S9                           122   3e-32   Talaromyces marneffei ATCC 18224
ref|XP_007698387.1|  hypothetical protein COCSADRAFT_35730              122   3e-32   Bipolaris sorokiniana ND90Pr
ref|XP_662407.1|  RS9_PODAN 40S ribosomal protein S9 (S7)               122   3e-32   Aspergillus nidulans FGSC A4
tpg|DAA63719.1|  TPA: hypothetical protein ZEAMMB73_520702              123   3e-32   Zea mays [maize]
ref|XP_008815169.1|  40S ribosomal protein                              122   3e-32   Plasmodium inui San Antonio 1
gb|KIX06477.1|  40S ribosomal protein S9                                122   3e-32   Rhinocladiella mackenziei CBS 650.93
ref|XP_004222815.1|  40S ribosomal protein S9                           122   3e-32   Plasmodium cynomolgi strain B
gb|KDD75683.1|  hypothetical protein H632_c551p0                        122   4e-32   Helicosporidium sp. ATCC 50920
ref|XP_001937443.1|  40S ribosomal protein S9                           122   4e-32   Pyrenophora tritici-repentis Pt-1C-BFP
gb|KIV89206.1|  40S ribosomal protein S9                                122   4e-32   Exophiala mesophila
gb|KEQ66339.1|  40S ribosomal protein S9                                122   4e-32   Aureobasidium melanogenum CBS 110374
ref|XP_635999.1|  ribosomal protein 1024                                122   4e-32   
gb|AFK45544.1|  unknown                                                 122   4e-32   
ref|XP_003838270.1|  similar to 40S ribosomal protein S9                122   4e-32   
ref|XP_003303583.1|  40S ribosomal protein S9                           124   4e-32   
ref|XP_008618158.1|  30S ribosomal protein S4                           122   5e-32   
gb|EMF08137.1|  40S ribosomal protein S9                                122   5e-32   
gb|KEQ72499.1|  40S ribosomal protein S9                                122   5e-32   
ref|XP_011115175.1|  hypothetical protein H072_9617                     122   5e-32   
ref|XP_007687378.1|  hypothetical protein COCMIDRAFT_93683              122   6e-32   
ref|XP_007913411.1|  putative 40s ribosomal protein s9 protein          122   6e-32   
ref|XP_007674573.1|  hypothetical protein BAUCODRAFT_66115              122   6e-32   
gb|AFK45767.1|  unknown                                                 122   6e-32   
gb|ABW90415.1|  putative ribosomal protein S9                           122   6e-32   
ref|XP_009022737.1|  hypothetical protein HELRODRAFT_155894             122   6e-32   
ref|XP_005836916.1|  small subunit ribosomal protein S9e, cytopla...    122   6e-32   
gb|EPS26866.1|  hypothetical protein PDE_01806                          122   7e-32   
gb|KIX95793.1|  40S ribosomal protein S9                                122   7e-32   
gb|KEZ42817.1|  hypothetical protein SAPIO_CDS5234                      121   7e-32   
emb|CBK19682.2|  unnamed protein product                                121   7e-32   
gb|KIW78598.1|  40S ribosomal protein S9                                121   7e-32   
ref|XP_004336000.1|  ribosomal protein S4, putative                     121   8e-32   
emb|CAO94702.1|  putative ribosomal protein S9                          121   8e-32   
ref|XP_008711137.1|  40S ribosomal protein S9                           121   8e-32   
ref|XP_007829664.1|  40S ribosomal protein S9                           121   8e-32   
gb|EDL31198.1|  mCG18481, isoform CRA_b                                 120   9e-32   
gb|KDN65245.1|  putative ribosomal protein S4                           121   9e-32   
gb|AHB33642.1|  40S ribosomal protein S9                                121   9e-32   
ref|XP_007288535.1|  40S ribosomal protein S9                           121   9e-32   
gb|KHJ32708.1|  putative 40s ribosomal protein s9                       121   1e-31   
tpg|DAA63723.1|  TPA: hypothetical protein ZEAMMB73_488320              123   1e-31   
gb|EPQ66464.1|  Protein component of the small (40S) ribosomal su...    121   1e-31   
gb|EXX62810.1|  ribosomal 40S subunit protein S9A                       121   1e-31   
gb|ESA03224.1|  hypothetical protein GLOINDRAFT_243564                  121   1e-31   
ref|XP_007273485.1|  40s ribosomal protein                              121   1e-31   
emb|CCF33735.1|  40S ribosomal protein S9                               121   1e-31   
gb|EFQ29502.1|  ribosomal protein S4                                    121   1e-31   
gb|EXX79184.1|  ribosomal 40S subunit protein S9A                       121   1e-31   
gb|EER45719.1|  40S ribosomal protein S9                                121   1e-31   
ref|XP_007154240.1|  hypothetical protein PHAVU_003G102200g             118   1e-31   
ref|XP_001537827.1|  40S ribosomal protein S9                           120   1e-31   
ref|XP_001400515.1|  40S ribosomal protein S9                           120   2e-31   
ref|XP_001263755.1|  40S ribosomal protein S9                           120   2e-31   
ref|XP_001217311.1|  40S ribosomal protein S9                           120   2e-31   
emb|CCQ18585.1|  40S ribosomal protein S9                               120   2e-31   
gb|ABX26127.1|  ribosomal protein S9                                    120   2e-31   
ref|XP_001824638.1|  40S ribosomal protein S9                           120   2e-31   
ref|XP_007510860.1|  40S ribosomal protein S9                           122   2e-31   
gb|EEH07566.1|  40S ribosomal protein S9                                120   2e-31   
ref|XP_003007794.1|  40S ribosomal protein S9                           120   2e-31   
dbj|GAM27112.1|  hypothetical protein SAMD00019534_102870               120   2e-31   
dbj|GAM87141.1|  hypothetical protein ANO11243_051620                   120   2e-31   
gb|EPE04605.1|  40s ribosomal protein s9                                120   2e-31   
ref|XP_007788827.1|  putative 40s ribosomal protein s9 protein          120   2e-31   
ref|XP_002794235.1|  40S ribosomal protein S9                           120   2e-31   
ref|XP_002629546.1|  40S ribosomal protein S9                           120   3e-31   
gb|ACO15505.1|  40S ribosomal protein S9                                120   3e-31   
gb|AAT76788.1|  40S ribosomal protein S9                                120   3e-31   
gb|ACF24579.1|  40S ribosomal protein S9                                120   3e-31   
gb|ACO10247.1|  40S ribosomal protein S9                                120   3e-31   
gb|ACO11706.1|  40S ribosomal protein S9                                120   3e-31   
ref|XP_002842953.1|  40S ribosomal protein S9                           120   3e-31   
gb|AGH70193.1|  40S ribosomal protein S9                                120   3e-31   
gb|EGD95527.1|  ribosomal protein S9                                    120   3e-31   
ref|XP_001298508.1|  hypothetical protein                               120   3e-31   
ref|XP_003286040.1|  rp1024 protein                                     120   3e-31   
ref|XP_003172904.1|  40S ribosomal protein S9                           120   3e-31   
ref|XP_003237660.1|  40S ribosomal protein S9                           120   3e-31   
ref|XP_011122298.1|  hypothetical protein AOL_s00079g121                120   3e-31   
ref|XP_964233.1|  40S ribosomal protein S9                              119   4e-31   
ref|XP_001315080.1|  hypothetical protein                               119   4e-31   
ref|XP_001270715.1|  40S ribosomal protein S9                           119   4e-31   
ref|XP_001327744.1|  hypothetical protein                               119   4e-31   
ref|XP_001301101.1|  hypothetical protein                               119   4e-31   
ref|XP_003847713.1|  40S ribosomal protein S9                           119   4e-31   
ref|XP_003720755.1|  40S ribosomal protein S9                           119   5e-31   
tpe|CAL69096.1|  TPA: putative 40S ribosomal protein S9                 119   5e-31   
ref|XP_007593688.1|  40S ribosomal protein S9                           119   5e-31   
ref|XP_001312431.1|  hypothetical protein                               119   5e-31   
ref|XP_001713483.1|  40S ribosomal protein S9                           119   5e-31   
ref|XP_002110068.1|  S9 ribosomal protein                               119   5e-31   
ref|XP_003660223.1|  hypothetical protein MYCTH_2298252                 119   6e-31   
gb|ELR03231.1|  40S ribosomal protein S9                                119   6e-31   
emb|CAH04322.1|  S9e ribosomal protein                                  119   6e-31   
gb|ELT87958.1|  hypothetical protein CAPTEDRAFT_199319                  117   7e-31   
ref|XP_001429769.1|  hypothetical protein                               119   7e-31   
ref|XP_005090825.1|  PREDICTED: 40S ribosomal protein S9-like iso...    119   7e-31   
ref|XP_001347100.1|  40S ribosomal protein S9                           119   7e-31   
dbj|BAJ85708.1|  predicted protein                                      119   9e-31   
sp|P52810.1|RS9_PODAS  RecName: Full=40S ribosomal protein S9; Al...    119   9e-31   
emb|CDM31877.1|  40S ribosomal protein S9                               119   9e-31   
gb|ACF17615.1|  S-9                                                     115   1e-30   
dbj|BAN20249.1|  ribosomal protein S9                                   119   1e-30   
ref|XP_009172179.1|  hypothetical protein T265_14496                    118   1e-30   
gb|ABZ04261.1|  ribosomal protein rps9                                  118   1e-30   
gb|AGY97023.1|  ribosomal protein S9                                    118   1e-30   
ref|XP_003347095.1|  40S ribosomal protein S9                           118   1e-30   
ref|XP_006958740.1|  40S ribosomal protein S9                           118   1e-30   
ref|NP_729507.1|  ribosomal protein S9, isoform B                       117   1e-30   
ref|XP_005090824.1|  PREDICTED: 40S ribosomal protein S9-like iso...    119   1e-30   
ref|XP_004456722.1|  PREDICTED: 40S ribosomal protein S9 isoform 2      117   1e-30   
sp|Q29197.1|RS9_PIG  RecName: Full=40S ribosomal protein S9             116   1e-30   
ref|XP_002175454.1|  40S ribosomal protein S9                           118   2e-30   
gb|AAR10044.1|  similar to Drosophila melanogaster RpS9                 117   2e-30   
gb|AAH12491.1|  Rps9 protein                                            116   2e-30   
dbj|GAA54965.1|  small subunit ribosomal protein S9e                    120   2e-30   
gb|EFX05063.1|  40S ribosomal protein s9                                118   2e-30   
ref|XP_008544905.1|  PREDICTED: 40S ribosomal protein S9                118   2e-30   
ref|XP_006540483.1|  PREDICTED: 40S ribosomal protein S9 isoform X1     116   2e-30   
ref|XP_009098805.1|  PREDICTED: 40S ribosomal protein S9                117   2e-30   
gb|EAW72212.1|  ribosomal protein S9, isoform CRA_c                     116   2e-30   
gb|ACF17617.1|  S-9                                                     117   2e-30   
gb|ACO12686.1|  40S ribosomal protein S9                                118   2e-30   
ref|XP_001222689.1|  40S ribosomal protein S9                           118   2e-30   
ref|XP_009566807.1|  PREDICTED: 40S ribosomal protein S9                116   2e-30   
ref|XP_002171823.1|  40S ribosomal protein S9                           118   2e-30   
ref|XP_004671615.1|  PREDICTED: 40S ribosomal protein S9                116   2e-30   
gb|KDQ62955.1|  hypothetical protein JAAARDRAFT_28926                   118   2e-30   
emb|CDH55798.1|  40s ribosomal protein s9                               117   2e-30   
gb|ADO95157.1|  ribosomal protein S9                                    118   2e-30   
gb|ABG01900.1|  S9 ribosomal protein                                    117   2e-30   
dbj|BAM17690.1|  ribosomal protein S9                                   117   2e-30   
dbj|BAH13468.1|  unnamed protein product                                117   2e-30   
gb|AAX62465.1|  ribosomal protein S9                                    117   2e-30   
dbj|BAD26701.1|  ribosomal protein S9                                   117   2e-30   
gb|ADT80642.1|  ribosomal protein S9                                    117   2e-30   
gb|KGO75304.1|  Ribosomal protein S4/S9                                 117   2e-30   
gb|ERS98231.1|  40S ribosomal protein S9                                117   2e-30   
gb|EHJ71338.1|  ribosomal protein S9                                    117   3e-30   
ref|NP_001037265.1|  ribosomal protein S9                               117   3e-30   
dbj|BAM19012.1|  ribosomal protein S9                                   117   3e-30   
ref|XP_007860645.1|  ribosomal protein S4                               117   3e-30   
emb|CDS04034.1|  Putative 40S ribosomal protein S9                      117   3e-30   
ref|XP_001011432.2|  ribosomal protein S4 containing protein            117   3e-30   
ref|XP_006964217.1|  ribosomal protein S9, S4 family                    117   3e-30   
ref|XP_002562828.1|  Pc20g02740                                         117   3e-30   
emb|CAX71741.1|  putative 40S ribosomal protein S9                      117   3e-30   
gb|KGB37072.1|  40S ribosomal protein S9                                117   3e-30   
ref|XP_001894478.1|  40S ribosomal protein S9                           117   3e-30   
gb|KIO25495.1|  hypothetical protein M407DRAFT_91820                    117   3e-30   
ref|XP_003147914.1|  40S ribosomal protein S9                           117   3e-30   
gb|KIL71469.1|  hypothetical protein M378DRAFT_155038                   117   3e-30   
ref|XP_002841454.1|  40S ribosomal protein S9                           117   3e-30   
ref|XP_005240973.1|  PREDICTED: 40S ribosomal protein S9-like           116   4e-30   
emb|CCD82062.1|  putative 40s ribosomal protein S9                      117   4e-30   
ref|XP_011497696.1|  PREDICTED: 40S ribosomal protein S9                117   4e-30   
gb|AAY66962.1|  40S ribosomal protein S9                                117   4e-30   
gb|AAW24668.1|  SJCHGC07042 protein                                     118   4e-30   
ref|XP_008486802.1|  PREDICTED: 40S ribosomal protein S9                117   4e-30   
gb|ACD65142.1|  putative 40S ribosomal protein RPS9                     117   4e-30   
gb|AAR09821.1|  similar to Drosophila melanogaster RpS9                 117   4e-30   
gb|ADO28208.1|  40S ribosomal protein s9                                117   4e-30   
ref|NP_001187074.1|  40S ribosomal protein S9                           117   4e-30   
ref|XP_001956309.1|  GF24655                                            117   4e-30   
ref|XP_003387673.1|  PREDICTED: 40S ribosomal protein S9-like           117   5e-30   
ref|XP_001829481.1|  40S ribosomal protein S9                           117   5e-30   
gb|ADK11698.1|  ribosomal protein S9                                    116   5e-30   
gb|EAW72214.1|  ribosomal protein S9, isoform CRA_e                     116   5e-30   
ref|XP_001903023.1|  hypothetical protein                               117   5e-30   
ref|WP_017455665.1|  30S ribosomal protein S4                           114   5e-30   
gb|ACY71248.1|  ribosomal protein S9                                    117   5e-30   
ref|XP_002047289.1|  GJ13353                                            117   5e-30   
ref|NP_524004.2|  ribosomal protein S9, isoform A                       117   5e-30   
ref|XP_005367975.1|  PREDICTED: 40S ribosomal protein S9-like           117   5e-30   
ref|XP_007307288.1|  40S ribosomal protein S9                           117   5e-30   
ref|XP_004518997.1|  PREDICTED: 40S ribosomal protein S9-like           117   5e-30   
ref|XP_006015023.1|  PREDICTED: 40S ribosomal protein S9-like           117   5e-30   
ref|XP_001352621.1|  GA28351                                            117   5e-30   
gb|KIM82299.1|  hypothetical protein PILCRDRAFT_475098                  117   5e-30   
ref|XP_011180539.1|  PREDICTED: 40S ribosomal protein S9                117   5e-30   
ref|XP_001984182.1|  GH15146                                            117   6e-30   
ref|XP_001608270.1|  PREDICTED: 40S ribosomal protein S9                117   6e-30   
gb|EQL04090.1|  Ribosomal protein S4/S9                                 117   6e-30   
ref|XP_005534243.1|  PREDICTED: 40S ribosomal protein S9-like           117   6e-30   
ref|XP_005433872.1|  PREDICTED: 40S ribosomal protein S9-like           117   6e-30   
gb|EKV18981.1|  40S ribosomal protein S9                                116   6e-30   
ref|XP_007379209.1|  40S ribosomal protein S9                           116   6e-30   
gb|EHK22520.1|  hypothetical protein TRIVIDRAFT_216043                  116   6e-30   
emb|CAA47013.1|  ribosomal protein S9                                   116   6e-30   
gb|AAA85659.1|  ribosomal protein S9                                    116   7e-30   
ref|NP_001232711.1|  putative 40S ribosomal protein S9                  116   7e-30   
ref|XP_007538773.1|  PREDICTED: 40S ribosomal protein S9                116   7e-30   
gb|EAR91187.3|  ribosomal protein S9 component of cytosolic 80S r...    117   7e-30   
ref|XP_003697514.1|  PREDICTED: 40S ribosomal protein S9-like iso...    115   7e-30   
ref|XP_006897356.1|  PREDICTED: 40S ribosomal protein S9                116   7e-30   
gb|AAX48885.1|  S9                                                      116   7e-30   
gb|KIM47402.1|  hypothetical protein M413DRAFT_199385                   116   7e-30   
gb|AAX29348.1|  ribosomal protein S9                                    116   7e-30   
ref|XP_003651341.1|  40S ribosomal protein S9                           117   7e-30   
ref|XP_006122094.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    116   7e-30   
gb|ACU45029.1|  ribosomal protein S9                                    116   7e-30   
ref|XP_003052792.1|  40S ribosomal protein S9                           116   8e-30   
gb|ACY95323.1|  ribosomal protein S9                                    116   8e-30   
ref|XP_007256932.1|  PREDICTED: 40S ribosomal protein S9-like           116   8e-30   
ref|NP_001004.2|  40S ribosomal protein S9                              116   8e-30   
gb|AEA39492.1|  ribosomal protein S9                                    116   8e-30   
ref|XP_009259609.1|  hypothetical protein FPSE_08216                    116   8e-30   
gb|ABG01896.1|  S9 ribosomal protein                                    116   8e-30   
ref|XP_006671722.1|  40S ribosomal protein S9 (S7)                      116   9e-30   
gb|EHK42959.1|  hypothetical protein TRIATDRAFT_258286                  116   9e-30   
gb|KFH47053.1|  40S ribosomal protein S9-like protein                   116   9e-30   
ref|XP_001873539.1|  40S ribosomal protein S9                           116   9e-30   
ref|XP_009220754.1|  40S ribosomal protein S9                           116   9e-30   
ref|XP_006902935.1|  PREDICTED: 40S ribosomal protein S9-like           116   9e-30   
ref|XP_009540632.1|  hypothetical protein HETIRDRAFT_456594             116   9e-30   
emb|CAJ17220.1|  ribosomal protein S9e                                  116   9e-30   
gb|EPZ32298.1|  40S ribosomal protein S9                                116   9e-30   
ref|XP_009265857.1|  40S ribosomal protein S9-B                         116   9e-30   
gb|EGU79448.1|  hypothetical protein FOXB_10033                         116   1e-29   
ref|XP_004015482.1|  PREDICTED: 40S ribosomal protein S9 isoform 1      116   1e-29   
ref|XP_004995440.1|  40S ribosomal protein S9                           116   1e-29   
ref|XP_001873538.1|  40S ribosomal protein S9                           116   1e-29   
ref|XP_008601048.1|  40S ribosomal protein S9                           116   1e-29   
gb|KIJ95270.1|  hypothetical protein K443DRAFT_332076                   116   1e-29   
ref|XP_007265130.1|  40S ribosomal protein S9                           116   1e-29   
gb|ABM55670.1|  putative ribosomal protein S9                           116   1e-29   
gb|AAH31746.1|  Ribosomal protein S9                                    116   1e-29   
gb|KIY51995.1|  ribosomal protein S4                                    116   1e-29   
gb|KII94201.1|  hypothetical protein PLICRDRAFT_695235                  116   1e-29   
ref|XP_007811695.1|  40S ribosomal protein S9                           115   1e-29   
gb|KJA19242.1|  hypothetical protein HYPSUDRAFT_204799                  116   1e-29   
ref|XP_001945527.1|  PREDICTED: 40S ribosomal protein S9                116   1e-29   



>ref|XP_011075483.1| PREDICTED: 40S ribosomal protein S9-2 [Sesamum indicum]
 ref|XP_011075484.1| PREDICTED: 40S ribosomal protein S9-2 [Sesamum indicum]
Length=197

 Score =   182 bits (463),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/90 (98%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDE  90



>ref|NP_001275235.1| uncharacterized protein LOC102577830 [Solanum tuberosum]
 ref|XP_006367429.1| PREDICTED: 40S ribosomal protein S9-2-like [Solanum tuberosum]
 gb|ABA46767.1| unknown [Solanum tuberosum]
Length=197

 Score =   182 bits (462),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/90 (98%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_004135180.1| PREDICTED: 40S ribosomal protein S9-2-like [Cucumis sativus]
 ref|XP_004141548.1| PREDICTED: 40S ribosomal protein S9-2-like [Cucumis sativus]
 ref|XP_004172155.1| PREDICTED: 40S ribosomal protein S9-2-like [Cucumis sativus]
 ref|XP_004173021.1| PREDICTED: 40S ribosomal protein S9-2-like [Cucumis sativus]
 ref|XP_008446334.1| PREDICTED: 40S ribosomal protein S9-2 [Cucumis melo]
 ref|XP_008459594.1| PREDICTED: 40S ribosomal protein S9-2 [Cucumis melo]
 gb|KGN51904.1| hypothetical protein Csa_5G604980 [Cucumis sativus]
 gb|KGN52667.1| hypothetical protein Csa_5G649850 [Cucumis sativus]
Length=197

 Score =   181 bits (459),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 87/90 (97%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_010256989.1| PREDICTED: 40S ribosomal protein S9-2-like [Nelumbo nucifera]
 ref|XP_010269850.1| PREDICTED: 40S ribosomal protein S9-2-like [Nelumbo nucifera]
Length=197

 Score =   181 bits (459),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 87/90 (97%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>gb|KCW56192.1| hypothetical protein EUGRSUZ_I01938 [Eucalyptus grandis]
Length=147

 Score =   179 bits (453),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_004228395.1| PREDICTED: 40S ribosomal protein S9-2 [Solanum lycopersicum]
 ref|XP_004228398.1| PREDICTED: 40S ribosomal protein S9-2-like [Solanum lycopersicum]
 ref|XP_010319448.1| PREDICTED: 40S ribosomal protein S9-2 [Solanum lycopersicum]
 gb|AAU93594.1| 40S ribosomal protein S9 , putative [Solanum demissum]
Length=197

 Score =   181 bits (458),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 87/90 (97%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_004238784.1| PREDICTED: 40S ribosomal protein S9-2 [Solanum lycopersicum]
Length=197

 Score =   180 bits (457),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/90 (97%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDE  90



>gb|KCW87774.1| hypothetical protein EUGRSUZ_A00153 [Eucalyptus grandis]
Length=140

 Score =   178 bits (452),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_010037164.1| PREDICTED: 40S ribosomal protein S9-2-like [Eucalyptus grandis]
 gb|KCW48831.1| hypothetical protein EUGRSUZ_K02467 [Eucalyptus grandis]
Length=197

 Score =   180 bits (457),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_010029297.1| PREDICTED: 40S ribosomal protein S9-2 [Eucalyptus grandis]
 gb|KCW56190.1| hypothetical protein EUGRSUZ_I01938 [Eucalyptus grandis]
Length=197

 Score =   180 bits (456),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_011085760.1| PREDICTED: 40S ribosomal protein S9-2-like [Sesamum indicum]
Length=196

 Score =   180 bits (456),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/90 (97%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_002517490.1| 40S ribosomal protein S9, putative [Ricinus communis]
 gb|EEF45032.1| 40S ribosomal protein S9, putative [Ricinus communis]
Length=196

 Score =   180 bits (456),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/90 (97%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>emb|CDP02222.1| unnamed protein product [Coffea canephora]
Length=197

 Score =   180 bits (456),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDPRRIFEG+ALLRRMNRYGLL+E
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLEE  90



>ref|XP_011098613.1| PREDICTED: 40S ribosomal protein S9-2 [Sesamum indicum]
Length=196

 Score =   179 bits (455),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/90 (97%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_010029477.1| PREDICTED: 40S ribosomal protein S9-2 [Eucalyptus grandis]
 gb|KCW83573.1| hypothetical protein EUGRSUZ_B00467 [Eucalyptus grandis]
Length=197

 Score =   179 bits (455),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_010091216.1| 40S ribosomal protein S9-2 [Morus notabilis]
 gb|EXB43471.1| 40S ribosomal protein S9-2 [Morus notabilis]
Length=199

 Score =   179 bits (455),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNR+GLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRHGLLDE  90



>ref|XP_009627396.1| PREDICTED: 40S ribosomal protein S9-2 [Nicotiana tomentosiformis]
Length=197

 Score =   179 bits (455),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDPRRIFEG+AL+RRMNRYGLLDE
Sbjct  61   LLTLDEKDPRRIFEGEALMRRMNRYGLLDE  90



>gb|KCW56189.1| hypothetical protein EUGRSUZ_I01938 [Eucalyptus grandis]
Length=176

 Score =   178 bits (452),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>gb|KDP31233.1| hypothetical protein JCGZ_11609 [Jatropha curcas]
Length=197

 Score =   179 bits (454),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_009600364.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana tomentosiformis]
 ref|XP_009782105.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana sylvestris]
Length=197

 Score =   179 bits (454),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/90 (97%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_002283256.1| PREDICTED: 40S ribosomal protein S9-2 [Vitis vinifera]
 ref|XP_002275166.1| PREDICTED: 40S ribosomal protein S9-2 [Vitis vinifera]
 emb|CBI22191.3| unnamed protein product [Vitis vinifera]
 emb|CBI15244.3| unnamed protein product [Vitis vinifera]
Length=197

 Score =   179 bits (454),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>gb|KDP41175.1| hypothetical protein JCGZ_15582 [Jatropha curcas]
Length=197

 Score =   179 bits (454),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_009604777.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana tomentosiformis]
Length=197

 Score =   179 bits (454),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRP+EKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDE  90



>gb|EPS73776.1| hypothetical protein M569_00980 [Genlisea aurea]
Length=197

 Score =   179 bits (453),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNART  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDE  90



>ref|NP_001274868.1| 40S ribosomal protein S9-2-like [Solanum tuberosum]
 gb|AFW90596.1| putative 40S ribosomal protein S9 [Solanum tuberosum]
Length=197

 Score =   179 bits (453),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKD RRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKDSRRIFEGEALLRRMNRYGLLDE  90



>gb|EYU22431.1| hypothetical protein MIMGU_mgv1a014214mg [Erythranthe guttata]
Length=197

 Score =   179 bits (453),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV  YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVCVYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDP+RIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKDPKRIFEGEALLRRMNRYGLLDE  90



>ref|XP_007209623.1| hypothetical protein PRUPE_ppa011764mg [Prunus persica]
 ref|XP_008239810.1| PREDICTED: 40S ribosomal protein S9-2-like [Prunus mume]
 gb|EMJ10822.1| hypothetical protein PRUPE_ppa011764mg [Prunus persica]
Length=197

 Score =   179 bits (453),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEE  90



>ref|XP_009598709.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana tomentosiformis]
Length=197

 Score =   178 bits (452),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRP+EKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_009778292.1| PREDICTED: 40S ribosomal protein S9-2 [Nicotiana sylvestris]
Length=197

 Score =   178 bits (452),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDPRRIFEG+AL+RRMNRYGLLDE
Sbjct  61   LLTLDEKDPRRIFEGEALMRRMNRYGLLDE  90



>ref|XP_002276284.1| PREDICTED: 40S ribosomal protein S9-2 [Vitis vinifera]
 emb|CBI31983.3| unnamed protein product [Vitis vinifera]
Length=197

 Score =   178 bits (451),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMN+YGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNKYGLLDE  90



>ref|XP_009798560.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana sylvestris]
Length=197

 Score =   178 bits (451),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRP+EKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_009779308.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana sylvestris]
Length=197

 Score =   178 bits (451),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRP+EKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_006367430.1| PREDICTED: 40S ribosomal protein S9-2-like isoform X1 [Solanum 
tuberosum]
Length=197

 Score =   177 bits (450),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK PR IFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKAPRPIFEGEALLRRMNRYGLLDE  90



>gb|EYU34659.1| hypothetical protein MIMGU_mgv1a014209mg [Erythranthe guttata]
Length=197

 Score =   177 bits (450),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVCFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDP+RIFEG+ALLRRMN+Y LLDE
Sbjct  61   LLTLDEKDPKRIFEGEALLRRMNKYALLDE  90



>ref|XP_004299381.1| PREDICTED: 40S ribosomal protein S9-2-like [Fragaria vesca subsp. 
vesca]
Length=198

 Score =   177 bits (450),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVVFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEE  90



>ref|XP_002511557.1| 40S ribosomal protein S9, putative [Ricinus communis]
 gb|EEF52159.1| 40S ribosomal protein S9, putative [Ricinus communis]
Length=197

 Score =   177 bits (449),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEE  90



>ref|XP_010242426.1| PREDICTED: 40S ribosomal protein S9-2 [Nelumbo nucifera]
Length=197

 Score =   177 bits (448),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>tpg|DAA55417.1| TPA: hypothetical protein ZEAMMB73_005048 [Zea mays]
Length=169

 Score =   176 bits (445),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAE  90



>ref|XP_003577383.1| PREDICTED: 40S ribosomal protein S9-2-like [Brachypodium distachyon]
Length=195

 Score =   176 bits (445),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL +
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAD  90



>ref|XP_006367431.1| PREDICTED: 40S ribosomal protein S9-2-like isoform X2 [Solanum 
tuberosum]
Length=197

 Score =   176 bits (445),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK PR IFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKAPRPIFEGEALLRRMNRYGLLDE  90



>ref|XP_002522398.1| 40S ribosomal protein S9, putative [Ricinus communis]
 gb|EEF39890.1| 40S ribosomal protein S9, putative [Ricinus communis]
Length=196

 Score =   176 bits (445),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNQRRIFEGEALLRRMNRYGLLDE  90



>gb|ABQ32300.1| putative 40S ribosomal protein S9 [Artemisia annua]
Length=197

 Score =   176 bits (445),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVPFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTL+EKDPRRIFEG+AL+RRMNRYGLLDE
Sbjct  61   LLTLEEKDPRRIFEGEALMRRMNRYGLLDE  90



>ref|XP_002317362.1| hypothetical protein POPTR_0011s09670g [Populus trichocarpa]
 gb|ABK93285.1| unknown [Populus trichocarpa]
 gb|EEE97974.1| hypothetical protein POPTR_0011s09670g [Populus trichocarpa]
Length=197

 Score =   176 bits (445),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEE  90



>gb|ABF94049.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
Length=158

 Score =   174 bits (441),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL +
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAD  90



>ref|XP_003576178.1| PREDICTED: 40S ribosomal protein S9-2-like [Brachypodium distachyon]
Length=195

 Score =   175 bits (444),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAE  90



>gb|ABA94598.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
Length=158

 Score =   174 bits (441),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL +
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAD  90



>emb|CDP00311.1| unnamed protein product [Coffea canephora]
Length=197

 Score =   175 bits (444),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDPRR+FEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKDPRRVFEGEALLRRMNRYGLLDE  90



>emb|CAG47084.1| 40S ribosomal protein S9 [Catharanthus roseus]
Length=197

 Score =   175 bits (443),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNAARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDE  90



>ref|NP_001278530.1| 40S ribosomal protein S9 [Zea mays]
 gb|ACG32995.1| 40S ribosomal protein S9 [Zea mays]
 gb|ACG34689.1| 40S ribosomal protein S9 [Zea mays]
 gb|ACL52933.1| unknown [Zea mays]
 tpg|DAA55418.1| TPA: 40S ribosomal protein S9 isoform 1 [Zea mays]
 tpg|DAA55419.1| TPA: 40S ribosomal protein S9 isoform 2 [Zea mays]
Length=194

 Score =   175 bits (443),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAE  90



>gb|EYU28732.1| hypothetical protein MIMGU_mgv1a014218mg [Erythranthe guttata]
Length=197

 Score =   175 bits (443),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVCFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDPRRIFEG+AL+RRMN+Y LLDE
Sbjct  61   LLTLDEKDPRRIFEGEALMRRMNKYALLDE  90



>ref|XP_007138197.1| hypothetical protein PHAVU_009G188600g [Phaseolus vulgaris]
 gb|ESW10191.1| hypothetical protein PHAVU_009G188600g [Phaseolus vulgaris]
Length=197

 Score =   175 bits (443),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDE  90



>gb|AFK46709.1| unknown [Lotus japonicus]
Length=197

 Score =   175 bits (443),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDE  90



>gb|ABK21901.1| unknown [Picea sitchensis]
 gb|ACN40156.1| unknown [Picea sitchensis]
Length=197

 Score =   175 bits (443),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY LSRIRN ARM
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYTLSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_004499428.1| PREDICTED: 40S ribosomal protein S9-2-like [Cicer arietinum]
Length=197

 Score =   175 bits (443),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDE  90



>ref|XP_006663032.1| PREDICTED: 40S ribosomal protein S9-2-like [Oryza brachyantha]
Length=195

 Score =   174 bits (442),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL +
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAD  90



>ref|XP_010274527.1| PREDICTED: 40S ribosomal protein S9-2-like [Nelumbo nucifera]
Length=223

 Score =   175 bits (444),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>gb|ABA94602.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
Length=192

 Score =   174 bits (441),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL +
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAD  90



>ref|XP_011004198.1| PREDICTED: 40S ribosomal protein S9-2 isoform X1 [Populus euphratica]
 ref|XP_011004199.1| PREDICTED: 40S ribosomal protein S9-2 isoform X1 [Populus euphratica]
 ref|XP_011004200.1| PREDICTED: 40S ribosomal protein S9-2 isoform X2 [Populus euphratica]
Length=197

 Score =   174 bits (442),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEE  90



>ref|NP_001149705.1| 40S ribosomal protein S9 [Zea mays]
 gb|ACG36447.1| 40S ribosomal protein S9 [Zea mays]
 gb|AFR11274.1| ribosomal protein S9 [Zea mays]
 tpg|DAA41536.1| TPA: 40S ribosomal protein S9 [Zea mays]
Length=193

 Score =   174 bits (441),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGE  90



>gb|EMS50632.1| 40S ribosomal protein S9-2 [Triticum urartu]
 gb|EMT06699.1| 40S ribosomal protein S9-2 [Aegilops tauschii]
Length=195

 Score =   174 bits (442),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG ALLRRMNRYGLL E
Sbjct  61   LLTLDEKNPRRIFEGAALLRRMNRYGLLAE  90



>ref|XP_003562635.1| PREDICTED: 40S ribosomal protein S9-2-like [Brachypodium distachyon]
Length=195

 Score =   174 bits (441),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK PRRIFEG+ALLRRMNRYGLL E
Sbjct  61   LLTLDEKSPRRIFEGEALLRRMNRYGLLAE  90



>ref|NP_001131442.1| uncharacterized protein LOC100192774 [Zea mays]
 gb|ACG30355.1| 40S ribosomal protein S9 [Zea mays]
 gb|AFW87984.1| 40S ribosomal protein S9 [Zea mays]
Length=193

 Score =   174 bits (441),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGE  90



>ref|NP_001049004.1| Os03g0154700 [Oryza sativa Japonica Group]
 ref|NP_001068233.1| Os11g0602600 [Oryza sativa Japonica Group]
 gb|ABA94599.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA94601.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF94048.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABG22548.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10918.1| Os03g0154700 [Oryza sativa Japonica Group]
 dbj|BAF28596.1| Os11g0602600 [Oryza sativa Japonica Group]
 gb|EAY81477.1| hypothetical protein OsI_36650 [Oryza sativa Indica Group]
 gb|EAZ18880.1| hypothetical protein OsJ_34422 [Oryza sativa Japonica Group]
 gb|ABR25448.1| 40S ribosomal protein S9 [Oryza sativa Indica Group]
 dbj|BAG96424.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87870.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93092.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96556.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96871.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96935.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC68442.1| hypothetical protein OsI_36651 [Oryza sativa Indica Group]
 gb|EEE52362.1| hypothetical protein OsJ_34424 [Oryza sativa Japonica Group]
 gb|EEE58343.1| hypothetical protein OsJ_09456 [Oryza sativa Japonica Group]
Length=195

 Score =   174 bits (441),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL +
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAD  90



>ref|XP_007155321.1| hypothetical protein PHAVU_003G191200g [Phaseolus vulgaris]
 gb|ESW27315.1| hypothetical protein PHAVU_003G191200g [Phaseolus vulgaris]
Length=197

 Score =   174 bits (441),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDE  90



>ref|NP_001276185.1| 40S ribosomal protein S9-2-like [Glycine max]
 ref|XP_003523030.1| PREDICTED: 40S ribosomal protein S9-2-like [Glycine max]
 ref|XP_007137996.1| hypothetical protein PHAVU_009G172300g [Phaseolus vulgaris]
 gb|ACU20562.1| unknown [Glycine max]
 gb|ESW09990.1| hypothetical protein PHAVU_009G172300g [Phaseolus vulgaris]
Length=197

 Score =   174 bits (441),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDE  90



>tpg|DAA41535.1| TPA: hypothetical protein ZEAMMB73_424707 [Zea mays]
Length=243

 Score =   176 bits (445),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGE  90



>ref|XP_003549666.1| PREDICTED: 40S ribosomal protein S9-2-like [Glycine max]
 gb|KHN18541.1| 40S ribosomal protein S9-2 [Glycine soja]
 gb|KHN48678.1| 40S ribosomal protein S9-2 [Glycine soja]
Length=197

 Score =   174 bits (441),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDE  90



>ref|XP_008780681.1| PREDICTED: 40S ribosomal protein S9-2 [Phoenix dactylifera]
 ref|XP_008780688.1| PREDICTED: 40S ribosomal protein S9-2 [Phoenix dactylifera]
 ref|XP_008780693.1| PREDICTED: 40S ribosomal protein S9-2 [Phoenix dactylifera]
Length=197

 Score =   174 bits (440),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQ+ALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQFALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_004508755.1| PREDICTED: 40S ribosomal protein S9-2-like [Cicer arietinum]
 ref|XP_004508756.1| PREDICTED: 40S ribosomal protein S9-2-like [Cicer arietinum]
Length=197

 Score =   174 bits (440),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDE  90



>ref|XP_010917021.1| PREDICTED: 40S ribosomal protein S9-2 [Elaeis guineensis]
Length=197

 Score =   174 bits (440),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYSLSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_003557815.1| PREDICTED: 40S ribosomal protein S9-2 [Brachypodium distachyon]
Length=195

 Score =   174 bits (440),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK PRRIFEG+ALLRRMNRYGLL E
Sbjct  61   LLTLDEKSPRRIFEGEALLRRMNRYGLLAE  90



>ref|XP_006380606.1| hypothetical protein POPTR_0007s09750g [Populus trichocarpa]
 gb|ERP58403.1| hypothetical protein POPTR_0007s09750g [Populus trichocarpa]
Length=197

 Score =   174 bits (440),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEE  90



>ref|XP_002442158.1| hypothetical protein SORBIDRAFT_08g015270 [Sorghum bicolor]
 gb|EES15996.1| hypothetical protein SORBIDRAFT_08g015270 [Sorghum bicolor]
Length=195

 Score =   174 bits (440),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAE  90



>ref|XP_004962962.1| PREDICTED: 40S ribosomal protein S9-2-like [Setaria italica]
Length=195

 Score =   173 bits (439),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAE  90



>gb|ACG33443.1| 40S ribosomal protein S9 [Zea mays]
Length=194

 Score =   173 bits (439),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+P RIFEG+ALLRRMNRYGLL E
Sbjct  61   LLTLDEKNPHRIFEGEALLRRMNRYGLLAE  90



>ref|XP_006664031.1| PREDICTED: 40S ribosomal protein S9-2-like [Oryza brachyantha]
Length=195

 Score =   173 bits (439),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAE  90



>ref|XP_007215987.1| hypothetical protein PRUPE_ppa011733mg [Prunus persica]
 ref|XP_008230756.1| PREDICTED: 40S ribosomal protein S9-2 [Prunus mume]
 gb|EMJ17186.1| hypothetical protein PRUPE_ppa011733mg [Prunus persica]
Length=198

 Score =   173 bits (439),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK PRRIFEG+ALLRRMNRYGLL+E
Sbjct  61   LLTLDEKSPRRIFEGEALLRRMNRYGLLEE  90



>gb|KJB74899.1| hypothetical protein B456_012G055000 [Gossypium raimondii]
Length=197

 Score =   173 bits (438),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>gb|KJB70960.1| hypothetical protein B456_011G097500 [Gossypium raimondii]
Length=197

 Score =   173 bits (438),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>gb|KJB33600.1| hypothetical protein B456_006G020700 [Gossypium raimondii]
Length=197

 Score =   173 bits (438),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>gb|KHG16530.1| 40S ribosomal S9-2 -like protein [Gossypium arboreum]
 gb|KJB39897.1| hypothetical protein B456_007G036500 [Gossypium raimondii]
Length=197

 Score =   173 bits (438),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_007037295.1| Ribosomal protein S4 [Theobroma cacao]
 gb|EOY21796.1| Ribosomal protein S4 [Theobroma cacao]
Length=197

 Score =   173 bits (438),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_009383889.1| PREDICTED: 40S ribosomal protein S9-2-like [Musa acuminata subsp. 
malaccensis]
Length=197

 Score =   173 bits (438),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEE  90



>gb|KJB11057.1| hypothetical protein B456_001G238700 [Gossypium raimondii]
 gb|KJB11058.1| hypothetical protein B456_001G238700 [Gossypium raimondii]
Length=197

 Score =   173 bits (438),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_002463229.1| hypothetical protein SORBIDRAFT_02g040120 [Sorghum bicolor]
 gb|EER99750.1| hypothetical protein SORBIDRAFT_02g040120 [Sorghum bicolor]
Length=194

 Score =   172 bits (437),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGE  90



>ref|XP_002463225.1| hypothetical protein SORBIDRAFT_02g040080 [Sorghum bicolor]
 gb|EER99746.1| hypothetical protein SORBIDRAFT_02g040080 [Sorghum bicolor]
Length=194

 Score =   172 bits (437),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGE  90



>ref|XP_006657990.1| PREDICTED: 40S ribosomal protein S9-2-like [Oryza brachyantha]
Length=194

 Score =   172 bits (437),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGE  90



>ref|XP_009389620.1| PREDICTED: 40S ribosomal protein S9-2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009411686.1| PREDICTED: 40S ribosomal protein S9-2-like [Musa acuminata subsp. 
malaccensis]
Length=197

 Score =   172 bits (437),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEE  90



>ref|XP_009414866.1| PREDICTED: 40S ribosomal protein S9-2 [Musa acuminata subsp. 
malaccensis]
Length=197

 Score =   172 bits (437),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEE  90



>ref|XP_009403622.1| PREDICTED: 40S ribosomal protein S9-2-like [Musa acuminata subsp. 
malaccensis]
Length=197

 Score =   172 bits (437),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEE  90



>ref|XP_004958404.1| PREDICTED: 40S ribosomal protein S9-2-like [Setaria italica]
Length=194

 Score =   172 bits (437),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGE  90



>emb|CDP08233.1| unnamed protein product [Coffea canephora]
Length=99

 Score =   169 bits (428),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGK FKKP+RPYEKE LDAEL+LVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKPFKKPQRPYEKEPLDAELRLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLD  328
            LLTLDEKDPRRIFEG+ALLRRMNRYGLL+
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLE  89



>ref|XP_006650139.1| PREDICTED: 40S ribosomal protein S9-2-like [Oryza brachyantha]
Length=195

 Score =   172 bits (437),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGE  90



>ref|XP_004984207.1| PREDICTED: 40S ribosomal protein S9-2-like [Setaria italica]
Length=194

 Score =   172 bits (436),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGE  90



>gb|AES91245.2| 40S ribosomal protein S9, putative [Medicago truncatula]
Length=116

 Score =   169 bits (429),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNART  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRM ++GLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFKHGLLDE  90



>ref|XP_011004201.1| PREDICTED: 40S ribosomal protein S9-2-like isoform X1 [Populus 
euphratica]
 ref|XP_011004202.1| PREDICTED: 40S ribosomal protein S9-2-like isoform X2 [Populus 
euphratica]
Length=197

 Score =   172 bits (435),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+ RRIFEG+ALLRRMNRYGLL+E
Sbjct  61   LLTLDEKNSRRIFEGEALLRRMNRYGLLEE  90



>ref|XP_004304310.1| PREDICTED: 40S ribosomal protein S9-2 [Fragaria vesca subsp. 
vesca]
Length=197

 Score =   172 bits (435),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVVFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEE  90



>ref|XP_011004703.1| PREDICTED: 40S ribosomal protein S9-2-like [Populus euphratica]
Length=197

 Score =   172 bits (435),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+ RRIFEG+ALLRRMNRYGLL+E
Sbjct  61   LLTLDEKNSRRIFEGEALLRRMNRYGLLEE  90



>gb|ABR17162.1| unknown [Picea sitchensis]
 gb|ACN39805.1| unknown [Picea sitchensis]
 gb|ACN39957.1| unknown [Picea sitchensis]
 gb|ACN40724.1| unknown [Picea sitchensis]
 gb|ADE77363.1| unknown [Picea sitchensis]
Length=197

 Score =   172 bits (435),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY LSRIRN ARM
Sbjct  1    MVHVVFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYTLSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_002323418.1| hypothetical protein POPTR_0016s07730g [Populus trichocarpa]
 ref|XP_002322813.2| 40S ribosomal protein S9 [Populus trichocarpa]
 gb|ABK93151.1| unknown [Populus trichocarpa]
 gb|ABK96412.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEF05179.1| hypothetical protein POPTR_0016s07730g [Populus trichocarpa]
 gb|EEF04574.2| 40S ribosomal protein S9 [Populus trichocarpa]
Length=197

 Score =   172 bits (435),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+ RRIFEG+ALLRRMNRYGLL+E
Sbjct  61   LLTLDEKNSRRIFEGEALLRRMNRYGLLEE  90



>ref|XP_010939529.1| PREDICTED: 40S ribosomal protein S9-2-like [Elaeis guineensis]
Length=197

 Score =   172 bits (435),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNR+GLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRFGLLDE  90



>ref|XP_007032505.1| Ribosomal protein S4 [Theobroma cacao]
 gb|EOY03431.1| Ribosomal protein S4 [Theobroma cacao]
Length=197

 Score =   172 bits (435),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNR+GLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRHGLLDE  90



>ref|XP_003598026.1| 40S ribosomal protein S9 [Medicago truncatula]
 ref|XP_003598028.1| 40S ribosomal protein S9 [Medicago truncatula]
 ref|XP_003604908.1| 40S ribosomal protein S9 [Medicago truncatula]
 gb|ACJ85917.1| unknown [Medicago truncatula]
 gb|AES68277.1| 40S ribosomal S9-like protein [Medicago truncatula]
 gb|AES68279.1| 40S ribosomal S9-like protein [Medicago truncatula]
 gb|AES87105.1| 40S ribosomal S9-like protein [Medicago truncatula]
 gb|AFK39708.1| unknown [Medicago truncatula]
 gb|AFK43821.1| unknown [Medicago truncatula]
Length=197

 Score =   172 bits (435),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNART  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRM ++GLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFKHGLLDE  90



>ref|XP_010937076.1| PREDICTED: 40S ribosomal protein S9-2-like [Elaeis guineensis]
Length=197

 Score =   172 bits (435),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>gb|ACU15321.1| unknown [Glycine max]
Length=222

 Score =   172 bits (437),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKT KKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTLKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDE  90



>gb|AFK40975.1| unknown [Medicago truncatula]
Length=197

 Score =   171 bits (434),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNART  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRM ++GLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFKHGLLDE  90



>ref|XP_010435836.1| PREDICTED: 40S ribosomal protein S9-2 [Camelina sativa]
 ref|XP_010441098.1| PREDICTED: 40S ribosomal protein S9-2 [Camelina sativa]
 ref|XP_010450759.1| PREDICTED: 40S ribosomal protein S9-2 [Camelina sativa]
Length=197

 Score =   171 bits (434),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVNVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_002324730.1| hypothetical protein POPTR_0018s07520g [Populus trichocarpa]
 ref|XP_006381972.1| hypothetical protein POPTR_0006s22630g [Populus trichocarpa]
 gb|ABK93418.1| unknown [Populus trichocarpa]
 gb|ABK95800.1| unknown [Populus trichocarpa]
 gb|ABK96647.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEF03295.1| hypothetical protein POPTR_0018s07520g [Populus trichocarpa]
 gb|ERP59769.1| hypothetical protein POPTR_0006s22630g [Populus trichocarpa]
Length=197

 Score =   171 bits (434),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+ RRIFEG+ALLRRMNRYGLL+E
Sbjct  61   LLTLDEKNQRRIFEGEALLRRMNRYGLLEE  90



>ref|XP_006282728.1| hypothetical protein CARUB_v10005777mg [Capsella rubella]
 gb|EOA15626.1| hypothetical protein CARUB_v10005777mg [Capsella rubella]
Length=198

 Score =   171 bits (434),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVNVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>dbj|BAJ90873.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99877.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=195

 Score =   171 bits (433),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK PRRIFEG ALLRRMNRYGLL E
Sbjct  61   LLTLDEKSPRRIFEGAALLRRMNRYGLLSE  90



>ref|NP_001238740.1| uncharacterized protein LOC100305663 [Glycine max]
 gb|ACU13464.1| unknown [Glycine max]
Length=197

 Score =   171 bits (433),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNY KTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYEKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDE  90



>ref|XP_003609048.1| 40S ribosomal protein S9 [Medicago truncatula]
Length=200

 Score =   171 bits (432),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNART  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRM ++GLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFKHGLLDE  90



>emb|CDP07223.1| unnamed protein product [Coffea canephora]
Length=99

 Score =   167 bits (423),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGK FKKPRRPYEKE LDAEL+LVGEYGLRCKRELWRVQYALS IRNNARM
Sbjct  1    MVHVSFYRNYGKPFKKPRRPYEKEPLDAELRLVGEYGLRCKRELWRVQYALSCIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLD  328
            LLTLDEKDPRRIFEG+ALLRRMNRYGLL+
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLE  89



>ref|XP_010554004.1| PREDICTED: 40S ribosomal protein S9-2 [Tarenaya hassleriana]
Length=197

 Score =   170 bits (431),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+V+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVNVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMN+YGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNKYGLLDE  90



>ref|NP_198801.1| 40S ribosomal protein S9-2 [Arabidopsis thaliana]
 sp|Q9FLF0.1|RS92_ARATH RecName: Full=40S ribosomal protein S9-2 [Arabidopsis thaliana]
 dbj|BAB10209.1| 40S ribosomal protein S9 [Arabidopsis thaliana]
 gb|AAM65655.1| 40S ribosomal protein S9-like [Arabidopsis thaliana]
 gb|ABD94071.1| At5g39850 [Arabidopsis thaliana]
 gb|AED94483.1| 40S ribosomal protein S9-2 [Arabidopsis thaliana]
Length=197

 Score =   169 bits (429),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVNVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_002870751.1| 40S ribosomal protein S9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47010.1| 40S ribosomal protein S9 [Arabidopsis lyrata subsp. lyrata]
Length=197

 Score =   169 bits (429),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVNVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>gb|KFK33188.1| hypothetical protein AALP_AA6G341500 [Arabis alpina]
Length=197

 Score =   169 bits (429),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVQVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>gb|AAT08735.1| 40S ribosomal protein S9 [Hyacinthus orientalis]
Length=197

 Score =   168 bits (426),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY LSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYVLSRIRNAARQ  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDE+DPRR+FEG+ALLRRM++YGLLDE
Sbjct  61   LLTLDERDPRRVFEGEALLRRMHKYGLLDE  90



>gb|AGV54486.1| 40S ribosomal protein S9-2-like protein [Phaseolus vulgaris]
Length=197

 Score =   168 bits (426),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGL  322
            LLTLDEK+PRRIFEG+ALLRRM RYGL
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGL  87



>ref|XP_006438663.1| hypothetical protein CICLE_v10032800mg [Citrus clementina]
 ref|XP_006483187.1| PREDICTED: 40S ribosomal protein S9-2-like [Citrus sinensis]
 ref|XP_006483188.1| PREDICTED: 40S ribosomal protein S9-2-like [Citrus sinensis]
 gb|ESR51903.1| hypothetical protein CICLE_v10032800mg [Citrus clementina]
Length=197

 Score =   168 bits (426),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRM+RYG L+E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMHRYGFLEE  90



>ref|XP_001754369.1| predicted protein [Physcomitrella patens]
 ref|XP_001761244.1| predicted protein [Physcomitrella patens]
 gb|EDQ73966.1| predicted protein [Physcomitrella patens]
 gb|EDQ80819.1| predicted protein [Physcomitrella patens]
Length=198

 Score =   168 bits (426),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV  +RNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQYALSRIRNNARM
Sbjct  1    MVHVASFRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNTRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_001767226.1| predicted protein [Physcomitrella patens]
 gb|EDQ67907.1| predicted protein [Physcomitrella patens]
Length=198

 Score =   168 bits (426),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV  +RNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQYALSRIRNNARM
Sbjct  1    MVHVASFRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNTRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_001777561.1| predicted protein [Physcomitrella patens]
 gb|EDQ57604.1| predicted protein [Physcomitrella patens]
Length=197

 Score =   168 bits (426),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV  +RNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQYALSRIRNNARM
Sbjct  1    MVHVASFRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNTRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_006405589.1| hypothetical protein EUTSA_v10027944mg [Eutrema salsugineum]
 gb|ESQ47042.1| hypothetical protein EUTSA_v10027944mg [Eutrema salsugineum]
Length=198

 Score =   168 bits (426),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVQVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNR GLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRSGLLDE  90



>ref|XP_008341567.1| PREDICTED: 40S ribosomal protein S9-2, partial [Malus domestica]
Length=116

 Score =   165 bits (418),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV  YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVVHYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYSLSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>gb|EMS59613.1| 40S ribosomal protein S9-2 [Triticum urartu]
 gb|EMT26225.1| 40S ribosomal protein S9-2 [Aegilops tauschii]
Length=195

 Score =   167 bits (424),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KREL+RVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELYRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG ALLRRMNRYGLL E
Sbjct  61   LLTLDEKNPRRIFEGAALLRRMNRYGLLTE  90



>ref|XP_001754496.1| predicted protein [Physcomitrella patens]
 gb|EDQ80466.1| predicted protein [Physcomitrella patens]
Length=198

 Score =   167 bits (424),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV  +RNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQYALSRIRNNARM
Sbjct  1    MVHVASFRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNTRRIFEGEALLRRMNRYGLLDE  90



>emb|CDP18850.1| unnamed protein product [Coffea canephora]
Length=99

 Score =   164 bits (416),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVH++FYRNYGK FKKPRRPYEKE LDAEL+LVGEYGLRCKRELWRVQYALSRIRNNA M
Sbjct  1    MVHISFYRNYGKPFKKPRRPYEKEPLDAELRLVGEYGLRCKRELWRVQYALSRIRNNAIM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLD  328
            LLTLDEKDPRRIFEG+ALLRRMNRY LL+
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYCLLE  89



>ref|XP_003623232.1| 40S ribosomal protein S9 [Medicago truncatula]
 gb|AES79450.1| 40S ribosomal S9-like protein [Medicago truncatula]
Length=197

 Score =   167 bits (423),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLV EYGLRCKRELWRVQYALSRIRNN+R 
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVREYGLRCKRELWRVQYALSRIRNNSRT  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRM ++GLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFKHGLLDE  90



>ref|XP_010551858.1| PREDICTED: 40S ribosomal protein S9-2-like [Tarenaya hassleriana]
Length=197

 Score =   166 bits (421),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+VN+YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVNVNYYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+P+RIFEG+ALLRRMNR+GLLDE
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRFGLLDE  90



>ref|XP_003637511.1| 40S ribosomal protein S9 [Medicago truncatula]
 gb|KEH42383.1| 40S ribosomal S9-like protein [Medicago truncatula]
Length=224

 Score =   167 bits (423),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  28   MVKVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  87

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRM ++GLLDE
Sbjct  88   LLTLDEKNPRRIFEGEALLRRMFKHGLLDE  117



>ref|XP_008341561.1| PREDICTED: 40S ribosomal protein S9-2 [Malus domestica]
Length=197

 Score =   166 bits (421),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV  YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVVHYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYSLSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_008379343.1| PREDICTED: 40S ribosomal protein S9-2 [Malus domestica]
Length=197

 Score =   166 bits (421),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV  YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVVHYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYSLSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDE  90



>gb|EAY83173.1| hypothetical protein OsI_38384 [Oryza sativa Indica Group]
Length=173

 Score =   165 bits (418),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M+HV+FYRNYGKTFKK RRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MMHVSFYRNYGKTFKKQRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+P RIFEG+ALLRRMNRYGLL E
Sbjct  61   LLTLDEKNPCRIFEGEALLRRMNRYGLLAE  90



>ref|XP_010550058.1| PREDICTED: 40S ribosomal protein S9-2-like [Tarenaya hassleriana]
Length=197

 Score =   166 bits (420),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+V++YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVNVSYYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDE  90



>ref|XP_010545191.1| PREDICTED: 40S ribosomal protein S9-2-like [Tarenaya hassleriana]
Length=197

 Score =   166 bits (420),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+V++YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVNVSYYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDE  90



>ref|XP_006431128.1| hypothetical protein CICLE_v10013599mg [Citrus clementina]
 ref|XP_006482573.1| PREDICTED: 40S ribosomal protein S9-2-like [Citrus sinensis]
 gb|ESR44368.1| hypothetical protein CICLE_v10013599mg [Citrus clementina]
 gb|KDO72548.1| hypothetical protein CISIN_1g046291mg [Citrus sinensis]
Length=197

 Score =   166 bits (420),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVG +GLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGSFGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLD  328
            LLTLDEKDPRRIFEG ALLRRM RYGLL+
Sbjct  61   LLTLDEKDPRRIFEGQALLRRMFRYGLLE  89



>ref|XP_001762390.1| predicted protein [Physcomitrella patens]
 gb|EDQ72857.1| predicted protein [Physcomitrella patens]
Length=198

 Score =   166 bits (419),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV  +RNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQY LSRIRNNARM
Sbjct  1    MVHVASFRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYVLSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNTRRIFEGEALLRRMNRYGLLDE  90



>gb|EAY83171.1| hypothetical protein OsI_38381 [Oryza sativa Indica Group]
Length=192

 Score =   165 bits (417),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKP+RPYEKERLDAELKLVGEYGLRCKRELWRVQYAL+RIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPKRPYEKERLDAELKLVGEYGLRCKRELWRVQYALNRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMN Y LL E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNHYRLLAE  90



>ref|XP_010524330.1| PREDICTED: 40S ribosomal protein S9-2-like [Tarenaya hassleriana]
Length=197

 Score =   165 bits (417),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+V++YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVNVSYYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+P+RIFEG+ALLRRMNR+GLLDE
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRFGLLDE  90



>ref|XP_010695717.1| PREDICTED: 40S ribosomal protein S9-2-like [Beta vulgaris subsp. 
vulgaris]
Length=197

 Score =   164 bits (416),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY LSRIRN AR 
Sbjct  1    MVHVCFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYVLSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRM+R+GLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMHRHGLLDE  90



>ref|XP_009124855.1| PREDICTED: 40S ribosomal protein S9-2 [Brassica rapa]
Length=197

 Score =   164 bits (415),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVQVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIF+G+ALLRRMN+ GLLDE
Sbjct  61   LLTLDEKNPRRIFQGEALLRRMNKNGLLDE  90



>emb|CDX74423.1| BnaA04g09660D [Brassica napus]
Length=198

 Score =   164 bits (415),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVQVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIF+G+ALLRRMN+ GLLDE
Sbjct  61   LLTLDEKNPRRIFQGEALLRRMNKNGLLDE  90



>gb|KJB70959.1| hypothetical protein B456_011G097500 [Gossypium raimondii]
Length=144

 Score =   162 bits (409),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYG  319
            LLTLDEK+PRRIFEG+ALLRRMNR G
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRVG  86



>ref|XP_010683223.1| PREDICTED: 40S ribosomal protein S9-2 [Beta vulgaris subsp. vulgaris]
Length=197

 Score =   163 bits (413),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV +YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYVLSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRMN++GLLDE
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNKHGLLDE  90



>ref|XP_010420178.1| PREDICTED: 40S ribosomal protein S9-1 [Camelina sativa]
Length=198

 Score =   163 bits (412),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDE  90



>ref|NP_001119227.1| 40S ribosomal protein S9-1 [Arabidopsis thaliana]
 gb|AED92129.1| 40S ribosomal protein S9-1 [Arabidopsis thaliana]
Length=156

 Score =   161 bits (408),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKSPRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_006400037.1| hypothetical protein EUTSA_v10014722mg [Eutrema salsugineum]
 gb|ESQ41490.1| hypothetical protein EUTSA_v10014722mg [Eutrema salsugineum]
Length=198

 Score =   162 bits (411),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDE  90



>ref|XP_006288701.1| hypothetical protein CARUB_v10002009mg [Capsella rubella]
 ref|XP_010453649.1| PREDICTED: 40S ribosomal protein S9-1-like [Camelina sativa]
 ref|XP_010492346.1| PREDICTED: 40S ribosomal protein S9-1-like [Camelina sativa]
 gb|EOA21599.1| hypothetical protein CARUB_v10002009mg [Capsella rubella]
Length=197

 Score =   162 bits (411),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDE  90



>ref|NP_197024.1| 40S ribosomal protein S9-1 [Arabidopsis thaliana]
 sp|Q9LXG1.1|RS91_ARATH RecName: Full=40S ribosomal protein S9-1 [Arabidopsis thaliana]
 emb|CAB89330.1| 40S ribosomal protein-like [Arabidopsis thaliana]
 gb|AAR24214.1| At5g15200 [Arabidopsis thaliana]
 gb|AAR92351.1| At5g15200 [Arabidopsis thaliana]
 dbj|BAF00367.1| 40S ribosomal protein - like [Arabidopsis thaliana]
 gb|AED92128.1| 40S ribosomal protein S9-1 [Arabidopsis thaliana]
Length=198

 Score =   162 bits (411),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK PRRIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKSPRRIFEGEALLRRMNRYGLLDE  90



>ref|XP_002985335.1| hypothetical protein SELMODRAFT_157263 [Selaginella moellendorffii]
 ref|XP_002987182.1| hypothetical protein SELMODRAFT_235178 [Selaginella moellendorffii]
 gb|EFJ11758.1| hypothetical protein SELMODRAFT_235178 [Selaginella moellendorffii]
 gb|EFJ13465.1| hypothetical protein SELMODRAFT_157263 [Selaginella moellendorffii]
Length=198

 Score =   162 bits (411),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+V+FYRNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWR+QY LSRIRN AR 
Sbjct  1    MVNVSFYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRLQYVLSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEGDALLRRM+RYGLL+E
Sbjct  61   LLTLDEKNPRRIFEGDALLRRMHRYGLLEE  90



>gb|KFK25765.1| hypothetical protein AALP_AA8G156800 [Arabis alpina]
Length=197

 Score =   162 bits (410),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDE  90



>ref|XP_002873713.1| 40S ribosomal protein S9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49972.1| 40S ribosomal protein S9 [Arabidopsis lyrata subsp. lyrata]
Length=198

 Score =   162 bits (409),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK P+RIFEG+ALLRRMNRYGLLDE
Sbjct  61   LLTLDEKSPKRIFEGEALLRRMNRYGLLDE  90



>ref|XP_002960852.1| hypothetical protein SELMODRAFT_74302 [Selaginella moellendorffii]
 ref|XP_002967162.1| hypothetical protein SELMODRAFT_144850 [Selaginella moellendorffii]
 gb|EFJ31761.1| hypothetical protein SELMODRAFT_144850 [Selaginella moellendorffii]
 gb|EFJ38391.1| hypothetical protein SELMODRAFT_74302 [Selaginella moellendorffii]
Length=198

 Score =   160 bits (404),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV  YRNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQY LSRIRN +R 
Sbjct  1    MVHVCVYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYVLSRIRNASRH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRM+RYGLL+E
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMHRYGLLEE  90



>ref|XP_010092050.1| 40S ribosomal protein S9-2 [Morus notabilis]
 gb|EXB49964.1| 40S ribosomal protein S9-2 [Morus notabilis]
Length=271

 Score =   162 bits (409),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = +2

Query  92   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  271
            GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK+PR
Sbjct  85   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKNPR  144

Query  272  RIFEGDALLRRMNRYGLLDE  331
            RIFEG+ALLRRMNRYGLLDE
Sbjct  145  RIFEGEALLRRMNRYGLLDE  164



>ref|XP_009126038.1| PREDICTED: 40S ribosomal protein S9-1-like [Brassica rapa]
Length=197

 Score =   159 bits (403),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/90 (86%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV +YRNYGKTFK PRRP+EKERLD+ELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPFEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+P+RIFEG+ALLR+MNRYGLLDE
Sbjct  61   LLTLDEKNPKRIFEGEALLRKMNRYGLLDE  90



>ref|XP_009131450.1| PREDICTED: 40S ribosomal protein S9-1 [Brassica rapa]
 ref|XP_009121599.1| PREDICTED: 40S ribosomal protein S9-1 [Brassica rapa]
 emb|CDX91003.1| BnaC02g05940D [Brassica napus]
 emb|CDX85559.1| BnaA02g02540D [Brassica napus]
 emb|CDX85058.1| BnaC05g19970D [Brassica napus]
 emb|CDX78618.1| BnaA03g05300D [Brassica napus]
 emb|CDX70599.1| BnaC03g06830D [Brassica napus]
 emb|CDX69542.1| BnaA10g18910D [Brassica napus]
Length=197

 Score =   159 bits (403),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/90 (86%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV +YRNYGKTFK PRRP+EKERLD+ELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPFEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+P+RIFEG+ALLR+MNRYGLLDE
Sbjct  61   LLTLDEKNPKRIFEGEALLRKMNRYGLLDE  90



>gb|ADB77797.1| 40S ribosomal protein S9 [Chlamydomonas reinhardtii]
Length=178

 Score =   157 bits (397),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  + FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQ  LS+IRN AR+
Sbjct  1    MPKIGFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRNAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDP+RIFEG+AL+RRMNRYGLL+E
Sbjct  61   LLTLDEKDPKRIFEGNALMRRMNRYGLLNE  90



>ref|XP_001702303.1| ribosomal protein S9, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 gb|EDO97033.1| ribosomal protein S9, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
Length=190

 Score =   157 bits (396),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  + FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQ  LS+IRN AR+
Sbjct  1    MPKIGFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRNAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDP+RIFEG+AL+RRMNRYGLL+E
Sbjct  61   LLTLDEKDPKRIFEGNALMRRMNRYGLLNE  90



>ref|XP_002958222.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ40676.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=190

 Score =   155 bits (393),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  + FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQ  LS+IRN AR+
Sbjct  1    MPKIGFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRNAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTL+EKDP+RIFEG+AL+RRMNRYGLL E
Sbjct  61   LLTLEEKDPKRIFEGNALMRRMNRYGLLSE  90



>gb|EEC74543.1| hypothetical protein OsI_10067 [Oryza sativa Indica Group]
Length=292

 Score =   158 bits (399),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +2

Query  89   YGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDP  268
            YGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR LLTLDEK+P
Sbjct  107  YGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARHLLTLDEKNP  166

Query  269  RRIFEGDALLRRMNRYGLL  325
            RRIFEG+ALLRRMNRYGLL
Sbjct  167  RRIFEGEALLRRMNRYGLL  185



>ref|XP_006827176.1| hypothetical protein AMTR_s00010p00256040 [Amborella trichopoda]
 gb|ERM94413.1| hypothetical protein AMTR_s00010p00256040 [Amborella trichopoda]
Length=227

 Score =   156 bits (394),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +2

Query  77   FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLD  256
            F   +GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR LLTLD
Sbjct  36   FIEVHGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARELLTLD  95

Query  257  EKDPRRIFEGDALLRRMNRYGLLDE  331
            EK+P+RIFEG+ALLRRMNRYGLLDE
Sbjct  96   EKNPKRIFEGEALLRRMNRYGLLDE  120



>emb|CDY30273.1| BnaC04g31840D [Brassica napus]
Length=965

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  769  MVQVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARE  828

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIF+G+ALLRRMN+ GLLDE
Sbjct  829  LLTLDEKNPRRIFQGEALLRRMNKNGLLDE  858



>gb|ADB77799.1| 40S ribosomal protein S9 [Klebsormidium flaccidum]
Length=129

 Score =   150 bits (379),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  + +YRNYGKTFKKPRRP+ KERLDAELKLVGEYGLR KRELWRVQ+ALS+IRNNAR 
Sbjct  1    MPKIAYYRNYGKTFKKPRRPFVKERLDAELKLVGEYGLRNKRELWRVQHALSKIRNNART  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+ RRIFEG+ALLRR+ RYGLLDE
Sbjct  61   LLTLDEKNTRRIFEGEALLRRIFRYGLLDE  90



>gb|KHG14244.1| 40S ribosomal S9-2 -like protein [Gossypium arboreum]
Length=191

 Score =   152 bits (383),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  92   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  271
            GKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR LLTLDEK+PR
Sbjct  5    GKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARDLLTLDEKNPR  64

Query  272  RIFEGDALLRRMNRYGLLDE  331
            RIFEG+ALLRRMNRYGLLDE
Sbjct  65   RIFEGEALLRRMNRYGLLDE  84



>gb|KHG14681.1| 40S ribosomal S9-2 -like protein [Gossypium arboreum]
Length=189

 Score =   152 bits (383),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  92   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  271
            GKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR LLTLDEK+PR
Sbjct  3    GKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARDLLTLDEKNPR  62

Query  272  RIFEGDALLRRMNRYGLLDE  331
            RIFEG+ALLRRMNRYGLLDE
Sbjct  63   RIFEGEALLRRMNRYGLLDE  82



>ref|XP_002467783.1| hypothetical protein SORBIDRAFT_01g033980 [Sorghum bicolor]
 gb|EER94781.1| hypothetical protein SORBIDRAFT_01g033980 [Sorghum bicolor]
Length=177

 Score =   149 bits (376),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/76 (93%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGD  289
            LLTLDEK+PRRIFEG+
Sbjct  61   LLTLDEKNPRRIFEGE  76



>gb|ADB77794.1| 40S ribosomal protein S9 [Ulvella repens]
Length=129

 Score =   147 bits (372),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 81/92 (88%), Gaps = 3/92 (3%)
 Frame = +2

Query  56   PKMVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNA  235
            PK+ H   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQ  LS+IRN A
Sbjct  2    PKIAH---YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQMQLSKIRNAA  58

Query  236  RMLLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            R LLTL+E+D RRIF+G+ALLRRM RYGLLDE
Sbjct  59   RTLLTLEERDSRRIFQGNALLRRMYRYGLLDE  90



>ref|XP_008367548.1| PREDICTED: LOW QUALITY PROTEIN: 40S ribosomal protein S9-2-like 
[Malus domestica]
Length=197

 Score =   149 bits (376),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M HV+FYRNYGKT KKPRRPYEKERLDAELKLVGE+GLR  RELWRV  + SRIRNNAR 
Sbjct  1    MFHVSFYRNYGKTLKKPRRPYEKERLDAELKLVGEFGLRXPRELWRVSASQSRIRNNARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRI  G+ALLRRMNRY LLDE
Sbjct  61   LLTLDEKNPRRIIXGEALLRRMNRYKLLDE  90



>pdb|3J60|J Chain J, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
Length=195

 Score =   149 bits (376),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 79/85 (93%), Gaps = 2/85 (2%)
 Frame = +2

Query  83   RNYGKTF--KKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLD  256
            R Y KT+  KKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR LLTLD
Sbjct  6    RTYSKTYSTKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARHLLTLD  65

Query  257  EKDPRRIFEGDALLRRMNRYGLLDE  331
            EK+PRRIFEG+ALLRRMNRYGLL +
Sbjct  66   EKNPRRIFEGEALLRRMNRYGLLAD  90



>gb|KHN30826.1| 40S ribosomal protein S9-2 [Glycine soja]
Length=188

 Score =   148 bits (374),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 79/90 (88%), Gaps = 9/90 (10%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGE         WRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGE---------WRVQYALSRIRNNARN  51

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE
Sbjct  52   LLTLDEKNPRRIFEGEALLRRMFRYGLLDE  81



>ref|XP_002500609.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61867.1| predicted protein [Micromonas sp. RCC299]
Length=194

 Score =   148 bits (373),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M    FYR+Y KTFKKPRRP+EKERLD+ELK+VGEYGLR KRELWRVQ+AL+++RN AR+
Sbjct  1    MPSTTFYRSYSKTFKKPRRPFEKERLDSELKIVGEYGLRNKRELWRVQFALNKLRNAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDP+RIFEG+A++RRM RYGLLDE
Sbjct  61   LLTLDEKDPKRIFEGEAIMRRMYRYGLLDE  90



>emb|CEF99084.1| Ribosomal protein S4/S9, eukaryotic/archaeal [Ostreococcus tauri]
Length=192

 Score =   148 bits (373),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M    FYRNYGKTFKKPRRP+EK+RLDAELK+VGE+GLR KRELWRVQ+AL+++RN AR+
Sbjct  1    MPSSTFYRNYGKTFKKPRRPFEKDRLDAELKIVGEFGLRNKRELWRVQFALNKLRNAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDP+RIFEG+A++RRM  YGLLDE
Sbjct  61   LLTLDEKDPKRIFEGEAIIRRMRAYGLLDE  90



>ref|XP_001419792.1| Ribosomal protein S9, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO98085.1| Ribosomal protein S9, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=194

 Score =   147 bits (372),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M    +YRNYGKTFKKPRRP+EKERLDAELK+VGE+GLR KRELWRVQ+AL+++RN AR+
Sbjct  1    MPSSTYYRNYGKTFKKPRRPFEKERLDAELKIVGEFGLRNKRELWRVQFALNKLRNAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDP+RIFEG+A++RRM  YGLLDE
Sbjct  61   LLTLDEKDPKRIFEGEAIMRRMRNYGLLDE  90



>gb|KHG06711.1| 40S ribosomal S9-2 -like protein [Gossypium arboreum]
Length=250

 Score =   148 bits (373),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  86   NYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKD  265
            +   TFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR LLTLDEK+
Sbjct  62   STATTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARDLLTLDEKN  121

Query  266  PRRIFEGDALLRRMNRYGLLDE  331
            PRRIFEG+ALLRRMNRYGLLDE
Sbjct  122  PRRIFEGEALLRRMNRYGLLDE  143



>gb|KDP41176.1| hypothetical protein JCGZ_15583 [Jatropha curcas]
Length=201

 Score =   145 bits (367),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 78/88 (89%), Gaps = 2/88 (2%)
 Frame = +2

Query  68   HVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLL  247
            H++F  +    F   RRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARMLL
Sbjct  9    HIDF--SLTSPFGGGRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARMLL  66

Query  248  TLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            TLDEK+PRRIFEG+ALLRRMNRYGLLDE
Sbjct  67   TLDEKNPRRIFEGEALLRRMNRYGLLDE  94



>ref|XP_005849917.1| hypothetical protein CHLNCDRAFT_56085 [Chlorella variabilis]
 gb|EFN57815.1| hypothetical protein CHLNCDRAFT_56085 [Chlorella variabilis]
Length=192

 Score =   145 bits (366),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  + FYRNYGKTFKKPRRP+EKERLDAELK+VGE+GLR KRELWRVQ  LS++R  AR 
Sbjct  1    MPSIGFYRNYGKTFKKPRRPFEKERLDAELKVVGEFGLRNKRELWRVQMVLSKLRARARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDP+R+FEG+ALLRRM RYG LDE
Sbjct  61   LLTLDEKDPKRLFEGEALLRRMYRYGFLDE  90



>gb|ADB77802.1| 40S ribosomal protein S9 [Ulva intestinalis]
Length=175

 Score =   144 bits (364),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQ  LS+IRN AR L+TL+E
Sbjct  5    YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQMQLSKIRNAARTLITLEE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDE  331
            +DPRRIF+G+ALL+RM RYGLLDE
Sbjct  65   RDPRRIFQGNALLKRMYRYGLLDE  88



>gb|KIZ06357.1| 40S ribosomal protein S9-2 [Monoraphidium neglectum]
Length=191

 Score =   145 bits (365),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  + FYR+YGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQ  LS+IR  AR+
Sbjct  1    MPKIGFYRSYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRKAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTL++KDP+RIFEG+AL+RRM +YGLL+E
Sbjct  61   LLTLEDKDPKRIFEGNALMRRMYKYGLLNE  90



>ref|XP_005648482.1| ribosomal protein S9 component of cytosolic 80S ribosome and 
40S small subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE23938.1| ribosomal protein S9 component of cytosolic 80S ribosome and 
40S small subunit [Coccomyxa subellipsoidea C-169]
Length=180

 Score =   144 bits (364),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M H+++YRNYGKTFKKPRRP+EKERLD+ELKLVGE+GLR KRELWRVQ ALS+IR  AR 
Sbjct  1    MPHISYYRNYGKTFKKPRRPFEKERLDSELKLVGEFGLRNKRELWRVQMALSKIRQAART  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLD+K+ +R+FEG+ALLRRM +YGLL+E
Sbjct  61   LLTLDDKETKRLFEGEALLRRMYKYGLLEE  90



>ref|XP_003056784.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58429.1| predicted protein [Micromonas pusilla CCMP1545]
Length=196

 Score =   144 bits (362),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M    FYR+Y KTFKKPRRP+EKERLD ELK VGE+GLR KRELWRVQ+AL+++RN AR+
Sbjct  1    MPSSTFYRSYSKTFKKPRRPFEKERLDNELKTVGEFGLRNKRELWRVQFALNKLRNAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDP+RIFEG+A++RRM RYGLLDE
Sbjct  61   LLTLDEKDPKRIFEGEAIMRRMYRYGLLDE  90



>gb|KIZ02547.1| 40S ribosomal protein S9-2 [Monoraphidium neglectum]
Length=227

 Score =   144 bits (364),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  + FYR+YGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQ  LS+IR  AR+
Sbjct  1    MPKIGFYRSYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRKAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTL++KDP+RIFEG+AL+RRM +YGLL+E
Sbjct  61   LLTLEDKDPKRIFEGNALMRRMYKYGLLNE  90



>emb|CCI69515.1| 40S ribosomal protein S9, partial [Chlorochytrium lemnae]
Length=119

 Score =   140 bits (354),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQ  LS+IR  AR LLTL+E
Sbjct  1    YRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRKAARTLLTLEE  60

Query  260  KDPRRIFEGDALLRRMNRYGLLDE  331
            KDP+RIFEG AL+RRM +YGLL+E
Sbjct  61   KDPKRIFEGQALMRRMYKYGLLNE  84



>ref|WP_039781875.1| hypothetical protein, partial [Nocardia cerradoensis]
Length=150

 Score =   141 bits (356),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M H+ +YRNYGKTFKKPRRP+E+ERLD+ELKLVGE+GLR KRELWRVQ ALS+IR  AR 
Sbjct  1    MPHIAYYRNYGKTFKKPRRPFEEERLDSELKLVGEFGLRNKRELWRVQMALSKIRQAART  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLD+K+ +R+FEG+ALLRRM +YGLL+E
Sbjct  61   LLTLDDKETKRLFEGEALLRRMYKYGLLEE  90



>emb|CBN76630.1| conserved unknown protein [Ectocarpus siliculosus]
Length=194

 Score =   142 bits (357),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  V  +RNY KTFK PRRPYEKERLD+ELKL GEYGLRCKRE+WRVQ+AL++IR  AR 
Sbjct  1    MPKVGIHRNYRKTFKTPRRPYEKERLDSELKLCGEYGLRCKREIWRVQFALAKIRKAARQ  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLD KDP+R+FEG ALLRRM+R+GLL E
Sbjct  61   LLTLDTKDPKRLFEGPALLRRMSRFGLLGE  90



>gb|EJK71823.1| hypothetical protein THAOC_06697 [Thalassiosira oceanica]
Length=190

 Score =   141 bits (355),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            +RNY KT+K PRRPYEKERLDAELKLVGEYGLRCKRE+WRVQYAL+++R  AR+LLTLD 
Sbjct  7    HRNYRKTYKTPRRPYEKERLDAELKLVGEYGLRCKREIWRVQYALAKLRKAARVLLTLDP  66

Query  260  KDPRRIFEGDALLRRMNRYGLLDE  331
            KDP+RIFEG ALLRRM+RYGLL +
Sbjct  67   KDPKRIFEGAALLRRMSRYGLLAD  90



>gb|ADB77800.1| 40S ribosomal protein S9 [Phyllodictyon orientale]
Length=130

 Score =   139 bits (350),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  + +YR+YGKTF+ PRRP+EKERLDAELKLVGEYGLR KRELWRVQ ALS++R  AR 
Sbjct  1    MPKIAYYRSYGKTFRGPRRPFEKERLDAELKLVGEYGLRNKRELWRVQLALSKLRGAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDE DP+RIF+G++LLRRM RYGLLD+
Sbjct  61   LLTLDEDDPKRIFQGNSLLRRMYRYGLLDQ  90



>gb|ADB77796.1| 40S ribosomal protein S9 [Boodlea composita]
Length=130

 Score =   138 bits (348),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  + +YR+YGKTF+ PRRP+EKERLD+ELKLVGEYGLR KRELWRVQ ALS++R  AR 
Sbjct  1    MPKIGYYRSYGKTFRGPRRPFEKERLDSELKLVGEYGLRNKRELWRVQLALSKLRGAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDE DP+RIF+G++LLRRM RYGLLD+
Sbjct  61   LLTLDEDDPKRIFQGNSLLRRMYRYGLLDQ  90



>ref|XP_002289706.1| RS9, ribosomal protein 9 [Thalassiosira pseudonana CCMP1335]
 gb|EED93243.1| RS9, ribosomal protein 9 [Thalassiosira pseudonana CCMP1335]
Length=190

 Score =   140 bits (352),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            +RNY KT+K PRRPYEKERLDAELKLVGEYGLRCKRE+WR QYAL+++R  AR LLTLD 
Sbjct  7    HRNYRKTYKTPRRPYEKERLDAELKLVGEYGLRCKREIWRCQYALAKLRKAARTLLTLDP  66

Query  260  KDPRRIFEGDALLRRMNRYGLLDE  331
            KDP+RIFEG ALLRRM+RYGLL E
Sbjct  67   KDPKRIFEGTALLRRMSRYGLLAE  90



>gb|ADB77795.1| 40S ribosomal protein S9 [Boergesenia forbesii]
Length=130

 Score =   137 bits (344),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  +  YR+YGKTF+ PRRP+EKERLD+ELKLVGEYGLR KRELWRVQ ALS++R  AR 
Sbjct  1    MPKIGHYRSYGKTFRGPRRPFEKERLDSELKLVGEYGLRNKRELWRVQLALSKLRGAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDE DP+RIF+G++LLRRM RYGLLD+
Sbjct  61   LLTLDEDDPKRIFQGNSLLRRMYRYGLLDQ  90



>gb|ADB77801.1| 40S ribosomal protein S9 [Siphonocladus tropicus]
Length=130

 Score =   136 bits (342),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  + +YR+YGKTF+ PRRP+EKERLD+ELKLVGEYGLR KRELWRVQ ALS++R  AR 
Sbjct  1    MPKIAYYRSYGKTFRGPRRPFEKERLDSELKLVGEYGLRSKRELWRVQLALSKLRGAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDE D +RIF+G++LLRRM RYGLLD+
Sbjct  61   LLTLDEDDSKRIFQGNSLLRRMYRYGLLDQ  90



>ref|XP_011399104.1| 40S ribosomal protein S9-1 [Auxenochlorella protothecoides]
 gb|KFM26208.1| 40S ribosomal protein S9-1 [Auxenochlorella protothecoides]
Length=192

 Score =   135 bits (341),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  ++ YRNYGKTFKKPRRP+EKERLDAELK VGE+GLR KRELWRVQ  LS+ R+ AR 
Sbjct  1    MPSISCYRNYGKTFKKPRRPFEKERLDAELKTVGEFGLRNKRELWRVQLVLSKFRSRARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLD  328
            LLTL+EKDP+R+FEG+AL+RRM RYG L+
Sbjct  61   LLTLEEKDPKRLFEGEALMRRMYRYGFLE  89



>gb|ADB77798.1| 40S ribosomal protein S9 [Cladophora coelothrix]
Length=179

 Score =   135 bits (339),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  + +YR+YGKTF+ PRRP+EKER D+ELKLVGE+GLR KRELWRVQ ALS++R  AR 
Sbjct  1    MPKIAYYRSYGKTFRGPRRPFEKERPDSELKLVGEFGLRNKRELWRVQLALSKLRGAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDE DP+RIF+G++LLRRM RYGLLD+
Sbjct  61   LLTLDEDDPKRIFQGNSLLRRMYRYGLLDQ  90



>tpg|DAA45584.1| TPA: hypothetical protein ZEAMMB73_929581 [Zea mays]
Length=101

 Score =   132 bits (333),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKREL RVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELCRVQYALSRIRNAARE  60

Query  242  LLTLDEKDP  268
            LLTLDEK+P
Sbjct  61   LLTLDEKNP  69



>gb|AEX13009.1| hypothetical protein CL240Contig1_05, partial [Pinus taeda]
 gb|AEX13010.1| hypothetical protein CL240Contig1_05, partial [Pinus taeda]
 gb|AEX13011.1| hypothetical protein CL240Contig1_05, partial [Pinus taeda]
 gb|AEX13012.1| hypothetical protein CL240Contig1_05, partial [Pinus taeda]
 gb|AEX13013.1| hypothetical protein CL240Contig1_05, partial [Pinus taeda]
 gb|AEX13014.1| hypothetical protein CL240Contig1_05, partial [Pinus taeda]
 gb|AEX13015.1| hypothetical protein CL240Contig1_05, partial [Pinus taeda]
 gb|AEX13016.1| hypothetical protein CL240Contig1_05, partial [Pinus taeda]
 gb|AEX13017.1| hypothetical protein CL240Contig1_05, partial [Pinus taeda]
 gb|AEX13018.1| hypothetical protein CL240Contig1_05, partial [Pinus taeda]
 gb|AEX13019.1| hypothetical protein CL240Contig1_05, partial [Pinus taeda]
 gb|AEX13020.1| hypothetical protein CL240Contig1_05, partial [Pinus taeda]
 gb|AEX13021.1| hypothetical protein CL240Contig1_05, partial [Pinus taeda]
 gb|AEX13022.1| hypothetical protein CL240Contig1_05, partial [Pinus taeda]
 gb|AEX13023.1| hypothetical protein CL240Contig1_05, partial [Pinus taeda]
 gb|AEX13024.1| hypothetical protein CL240Contig1_05, partial [Pinus taeda]
 gb|AEX13025.1| hypothetical protein CL240Contig1_05, partial [Pinus taeda]
 gb|AEX13026.1| hypothetical protein CL240Contig1_05, partial [Pinus taeda]
 gb|AEX13027.1| hypothetical protein CL240Contig1_05, partial [Pinus radiata]
 gb|AFB34088.1| hypothetical protein CL240Contig1_05, partial [Pinus mugo]
 gb|AFB34089.1| hypothetical protein CL240Contig1_05, partial [Pinus mugo]
Length=70

 Score =   131 bits (329),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/68 (96%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  59   KMVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR  238
            KMVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY LSRIRN AR
Sbjct  3    KMVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYTLSRIRNAAR  62

Query  239  MLLTLDEK  262
            MLLTLDEK
Sbjct  63   MLLTLDEK  70



>ref|XP_009038600.1| hypothetical protein AURANDRAFT_28757 [Aureococcus anophagefferens]
 gb|EGB06855.1| hypothetical protein AURANDRAFT_28757 [Aureococcus anophagefferens]
Length=196

 Score =   134 bits (338),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M   +F RNY KT K PRRP+EKER+D ELKLVGEYGLRCKRELWR Q AL+++R  AR 
Sbjct  1    MPKTSFLRNYRKTSKTPRRPFEKERIDGELKLVGEYGLRCKRELWRTQLALAKLRKAART  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLD KDP R+FE  ALLRR+ RYGLLDE
Sbjct  61   LLTLDTKDPARMFEAPALLRRLQRYGLLDE  90



>ref|XP_005708491.1| 40S ribosomal protein S9e [Galdieria sulphuraria]
 gb|EME31971.1| 40S ribosomal protein S9e [Galdieria sulphuraria]
Length=193

 Score =   133 bits (335),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YR   KT++ PRRP+EKERLDAELKLVGEYGLR KRELWRV++ALS+IR  AR LLTL+E
Sbjct  5    YRTCSKTYRTPRRPFEKERLDAELKLVGEYGLRNKRELWRVEFALSKIRAAARDLLTLEE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDE  331
            KDPRRIFEG+ALLRR+ R+GLLDE
Sbjct  65   KDPRRIFEGNALLRRLTRFGLLDE  88



>emb|CDR95115.1| 40S ribosomal subunit protein S9, putative [Babesia bigemina]
Length=184

 Score =   132 bits (332),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +2

Query  71   VNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLT  250
            V  YRNY KTF+ P+RP+EKERLD ELKL+GEYGL+ KRE+WRVQY LS+IR+ AR LLT
Sbjct  2    VGSYRNYSKTFRNPKRPFEKERLDQELKLIGEYGLKNKREVWRVQYVLSKIRSAARYLLT  61

Query  251  LDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LDEKD +R F+GDALLRRM RYGL+ E
Sbjct  62   LDEKDTKRQFQGDALLRRMVRYGLMGE  88



>dbj|BAA78592.1| 40S ribosomal protein S9 [Chlamydomonas sp. HS-5]
Length=192

 Score =   132 bits (332),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  +  YRNYGKTFKKPRRP+EKERLD ELKLVGEYGLR KRELWRVQ  LS+IRN AR 
Sbjct  1    MPKIGQYRNYGKTFKKPRRPFEKERLDGELKLVGEYGLRNKRELWRVQMILSKIRNAARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LL  DE D +R+FEG AL+RRM +YGLL+E
Sbjct  61   LLQHDEDDTKRLFEGQALMRRMYKYGLLNE  90



>ref|XP_002179777.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC48763.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=167

 Score =   131 bits (330),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  92   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  271
             KT K PRRP+EKERLDAELKLVGEYGLRCKRE+WRVQ+AL+++R  AR LLTLD  DP+
Sbjct  1    SKTSKTPRRPFEKERLDAELKLVGEYGLRCKREIWRVQFALAKLRKAARTLLTLDPSDPK  60

Query  272  RIFEGDALLRRMNRYGLLDE  331
            RIFEG ALLRRMNRYGLL +
Sbjct  61   RIFEGAALLRRMNRYGLLAD  80



>ref|XP_005852611.1| small subunit ribosomal protein S9e [Nannochloropsis gaditana 
CCMP526]
 gb|EKU23223.1| small subunit ribosomal protein S9e [Nannochloropsis gaditana 
CCMP526]
Length=200

 Score =   132 bits (331),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  + F RNY KT K PRRP+EKERLD ELKL GEYGLRCK E+WRVQ+AL++IR  AR 
Sbjct  1    MPSIAFRRNYRKTDKTPRRPFEKERLDQELKLCGEYGLRCKAEIWRVQFALAKIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDPRR+FEG ALLRR  R GLL++
Sbjct  61   LLTLDEKDPRRVFEGPALLRRCVRAGLLEQ  90



>ref|XP_009531030.1| hypothetical protein PHYSODRAFT_354997 [Phytophthora sojae]
 gb|EGZ13601.1| hypothetical protein PHYSODRAFT_354997 [Phytophthora sojae]
Length=192

 Score =   131 bits (330),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  ++ +RNY KT++ P R +EKERLD ELKL+GEYGLRCKRE+WRVQYALS++R  AR 
Sbjct  1    MPKISRHRNYRKTYRTPSRAFEKERLDQELKLLGEYGLRCKREIWRVQYALSKLRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLD KDP+RIFEG ALLRR+ RYG+L E
Sbjct  61   LLTLDPKDPKRIFEGSALLRRLKRYGMLSE  90



>emb|CCF75909.1| unnamed protein product [Babesia microti strain RI]
Length=189

 Score =   131 bits (329),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRN  KT +KP+RPY KERLD+ELKL+GEYGL+ KRE+WRVQY L++IR+ AR LLTLDE
Sbjct  5    YRNSSKTSRKPKRPYGKERLDSELKLIGEYGLKNKREVWRVQYVLAKIRSAARHLLTLDE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDE  331
            KDP+R+F+GDALLRRM RYGLL E
Sbjct  65   KDPKRLFQGDALLRRMVRYGLLGE  88



>gb|EWM23131.1| 40s ribosomal protein s9 [Nannochloropsis gaditana]
Length=254

 Score =   131 bits (330),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  + F RNY KT K PRRP+EKERLD ELKL GEYGLRCK E+WRVQ+AL++IR  AR 
Sbjct  55   MPSIAFRRNYRKTDKTPRRPFEKERLDQELKLCGEYGLRCKAEIWRVQFALAKIRKAARE  114

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEKDPRR+FEG ALLRR  R GLL++
Sbjct  115  LLTLDEKDPRRVFEGPALLRRCVRAGLLEQ  144



>gb|ABF96251.1| 40S ribosomal protein S9, putative [Oryza sativa Japonica Group]
Length=157

 Score =   129 bits (323),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 71/90 (79%), Gaps = 11/90 (12%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV V+FYRNYGKTFKKPRRPYEKER DAELKL GEYGLR K ELWRVQ            
Sbjct  1    MVRVSFYRNYGKTFKKPRRPYEKERPDAELKLYGEYGLRSKCELWRVQ-----------E  49

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLDEK+PRRIFEG+ALLR MNRYGLL E
Sbjct  50   LLTLDEKNPRRIFEGEALLRHMNRYGLLGE  79



>ref|XP_002903192.1| 40S ribosomal protein S9-1 [Phytophthora infestans T30-4]
 ref|XP_008911307.1| ribosomal protein S4 [Phytophthora parasitica INRA-310]
 gb|EEY55616.1| 40S ribosomal protein S9-1 [Phytophthora infestans T30-4]
 gb|ETI37949.1| ribosomal protein S4 [Phytophthora parasitica P1569]
 gb|ETK78146.1| ribosomal protein S4 [Phytophthora parasitica]
 gb|ETL31582.1| ribosomal protein S4 [Phytophthora parasitica]
 gb|ETL84827.1| ribosomal protein S4 [Phytophthora parasitica]
 gb|ETM37979.1| ribosomal protein S4 [Phytophthora parasitica]
 gb|ETN03534.1| ribosomal protein S4 [Phytophthora parasitica INRA-310]
 gb|ETO66726.1| ribosomal protein S4 [Phytophthora parasitica P1976]
 gb|ETP07838.1| ribosomal protein S4 [Phytophthora parasitica CJ01A1]
 gb|ETP35871.1| ribosomal protein S4 [Phytophthora parasitica P10297]
Length=192

 Score =   129 bits (325),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  ++ +RNY KT++ P R +EKERLD ELKL+GEYGLRCKRE+WRVQYALS++R  AR 
Sbjct  1    MPKISRHRNYRKTYRTPSRAFEKERLDQELKLLGEYGLRCKREIWRVQYALSKLRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLD KDP+R+FEG ALLRR+ RYG+L E
Sbjct  61   LLTLDPKDPKRLFEGSALLRRLKRYGMLAE  90



>ref|XP_005780612.1| hypothetical protein EMIHUDRAFT_460715 [Emiliania huxleyi CCMP1516]
 gb|EOD28183.1| hypothetical protein EMIHUDRAFT_460715 [Emiliania huxleyi CCMP1516]
Length=164

 Score =   128 bits (321),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M H +F RN+GKT + PRRP+EK+RLD E+KL+GE+GL+ KRE+WR Q  L+RIR  AR+
Sbjct  1    MPHASFLRNHGKTARTPRRPFEKQRLDIEMKLIGEFGLKNKREVWRTQLTLARIRKAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTL++KDP+R+FEG+ALLRR+ R G+LDE
Sbjct  61   LLTLEDKDPKRLFEGNALLRRLVRLGVLDE  90



>ref|XP_005534862.1| 40S ribosomal protein S9 [Cyanidioschyzon merolae strain 10D]
 dbj|BAM80255.1| 40S ribosomal protein S9 [Cyanidioschyzon merolae strain 10D]
Length=193

 Score =   129 bits (323),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRN+ K +K PRRP+EKERLDAELKL GEYGLR KRE+WRVQYALS+IR  AR LLT DE
Sbjct  5    YRNFSKVYKIPRRPFEKERLDAELKLCGEYGLRNKREVWRVQYALSKIRAAARELLTKDE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDE  331
            KD RRI EG ALLRR+ RYGLLD+
Sbjct  65   KDERRIVEGAALLRRLTRYGLLDQ  88



>ref|XP_005767233.1| hypothetical protein EMIHUDRAFT_61745 [Emiliania huxleyi CCMP1516]
 gb|EOD14804.1| hypothetical protein EMIHUDRAFT_61745 [Emiliania huxleyi CCMP1516]
Length=194

 Score =   128 bits (322),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M H +F RN+GKT + PRRP+EK+RLD E+KL+GE+GL+ KRE+WR Q  L+RIR  AR+
Sbjct  1    MPHASFLRNHGKTARTPRRPFEKQRLDIEMKLIGEFGLKNKREVWRTQLTLARIRKAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTL++KDP+R+FEG+ALLRR+ R G+LDE
Sbjct  61   LLTLEDKDPKRLFEGNALLRRLVRLGVLDE  90



>ref|XP_004830832.1| 40S ribosomal protein S9, putative [Babesia equi]
 gb|AFZ81166.1| 40S ribosomal protein S9, putative [Babesia equi strain WA]
Length=184

 Score =   128 bits (321),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +2

Query  71   VNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLT  250
            V  YRNY +T + P+RP+EKERLD ELKL+GEYGL+ KRE+WRVQY LS+IR+ AR LLT
Sbjct  2    VGSYRNYSRTSRHPKRPFEKERLDQELKLIGEYGLKNKREVWRVQYVLSKIRSAARYLLT  61

Query  251  LDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LD KD +RIF+GDALLRRM RYGL++E
Sbjct  62   LDVKDNKRIFQGDALLRRMVRYGLMNE  88



>ref|XP_006438664.1| hypothetical protein CICLE_v10033755mg [Citrus clementina]
 gb|ESR51904.1| hypothetical protein CICLE_v10033755mg [Citrus clementina]
Length=178

 Score =   127 bits (319),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRR  274
            L+ L EK  R+
Sbjct  61   LVNLGEKKTRK  71



>ref|XP_006381973.1| hypothetical protein POPTR_0006s22640g [Populus trichocarpa]
 gb|ERP59770.1| hypothetical protein POPTR_0006s22640g [Populus trichocarpa]
Length=178

 Score =   127 bits (318),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGK FKKPRRPYEKE LDAELKLVGEYGLR KRELWRVQYA SRIRN A M
Sbjct  1    MVHVSFYRNYGKNFKKPRRPYEKECLDAELKLVGEYGLRAKRELWRVQYAFSRIRNAATM  60

Query  242  LLTLDEKDPRR  274
            LLTLDEK+ R+
Sbjct  61   LLTLDEKNQRQ  71



>emb|CCI48676.1| unnamed protein product [Albugo candida]
Length=194

 Score =   127 bits (318),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 74/92 (80%), Gaps = 3/92 (3%)
 Frame = +2

Query  56   PKMVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNA  235
            PK+ H+    NY KT++ P R +EK RLD ELKL+GEYGLRCKRE+WRVQYALS++R  A
Sbjct  2    PKVSHLT---NYRKTYRTPTRVFEKARLDQELKLLGEYGLRCKREIWRVQYALSKLRKAA  58

Query  236  RMLLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            R LLTLD KDP+R+FEG ALLRR+ RYGLL E
Sbjct  59   RELLTLDAKDPKRLFEGAALLRRLKRYGLLTE  90



>ref|XP_001609790.1| 40S ribosomal subunit protein S9 [Babesia bovis T2Bo]
 gb|EDO06222.1| 40S ribosomal subunit protein S9, putative [Babesia bovis]
Length=182

 Score =   126 bits (317),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            RNY KTF+ P+RP+EKERLD ELKL+GEYGL+ KRE+WRVQY LS+IR+ AR LLTLD+K
Sbjct  6    RNYSKTFRNPKRPFEKERLDQELKLIGEYGLKNKREVWRVQYVLSKIRSAARYLLTLDDK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDE  331
            D +R F+GDALLRRM RYGL+ E
Sbjct  66   DVKRQFQGDALLRRMVRYGLMGE  88



>ref|XP_002139923.1| 40S ribosomal protein S9 [Cryptosporidium muris RN66]
 gb|EEA05574.1| 40S ribosomal protein S9, putative [Cryptosporidium muris RN66]
Length=189

 Score =   126 bits (316),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  71   VNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLT  250
            V  Y N+ KT ++P+RP+EKERLDAE+KL+GEYGL+ KRE+WRVQY L++IR  AR LLT
Sbjct  2    VKSYTNHSKTSRQPKRPFEKERLDAEMKLIGEYGLKNKREVWRVQYTLAKIRAAARHLLT  61

Query  251  LDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LD+KDP R+F+G+ALLRRM R GLL E
Sbjct  62   LDDKDPIRVFQGEALLRRMERLGLLSE  88



>ref|XP_008876439.1| ribosomal protein S4 [Aphanomyces invadans]
 gb|ETV94848.1| ribosomal protein S4 [Aphanomyces invadans]
Length=196

 Score =   125 bits (315),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  ++ +RNY KT++ P R +EKERLD E+KL+GEYGLRCKRE+WRVQY L+++R  AR 
Sbjct  1    MPKISRHRNYRKTYRTPSRAFEKERLDQEMKLLGEYGLRCKREIWRVQYTLAKLRKAARQ  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLD KDP+R+FEG AL+RR+ RYGLL E
Sbjct  61   LLTLDPKDPKRLFEGPALMRRLKRYGLLAE  90



>ref|XP_008623589.1| 40S ribosomal protein [Plasmodium vinckei vinckei]
 gb|KEG03665.1| 40S ribosomal protein [Plasmodium vinckei vinckei]
Length=189

 Score =   125 bits (315),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRNY KT + P+RP+EKERLD ELKL+GEYGL+ KRE+WRVQY L++IR+ AR LLTLDE
Sbjct  5    YRNYSKTARNPKRPFEKERLDQELKLIGEYGLKNKREIWRVQYLLAKIRSAARYLLTLDE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDE  331
            K P+RIF+G+ALLRRM R GLL E
Sbjct  65   KSPKRIFQGEALLRRMVRQGLLGE  88



>gb|ETB62408.1| 40S ribosomal protein S9 [Plasmodium yoelii 17X]
 gb|ETB62409.1| 40S ribosomal protein S9, variant 1 [Plasmodium yoelii 17X]
 gb|ETB62410.1| 40S ribosomal protein S9, variant 2 [Plasmodium yoelii 17X]
 gb|EUD72327.1| 40S ribosomal protein [Plasmodium vinckei petteri]
 emb|CDR14909.1| 40S ribosomal protein S9, putative [Plasmodium chabaudi chabaudi]
 emb|CDU19544.1| 40S ribosomal protein S9, putative [Plasmodium yoelii]
 emb|CDZ13848.1| 40S ribosomal protein S9, putative [Plasmodium yoelii]
Length=189

 Score =   125 bits (315),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRNY KT + P+RP+EKERLD ELKL+GEYGL+ KRE+WRVQY L++IR+ AR LLTLDE
Sbjct  5    YRNYSKTARNPKRPFEKERLDQELKLIGEYGLKNKREIWRVQYLLAKIRSAARYLLTLDE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDE  331
            K P+RIF+G+ALLRRM R GLL E
Sbjct  65   KSPKRIFQGEALLRRMVRQGLLGE  88



>emb|CDS49582.1| 40S ribosomal protein S9, putative [Plasmodium berghei ANKA]
Length=189

 Score =   125 bits (314),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRNY KT + P+RP+EKERLD ELKL+GEYGL+ KRE+WRVQY L++IR+ AR LLTLDE
Sbjct  5    YRNYSKTARNPKRPFEKERLDQELKLIGEYGLKNKREIWRVQYLLAKIRSAARYLLTLDE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDE  331
            K P+RIF+G+ALLRRM R GLL E
Sbjct  65   KSPKRIFQGEALLRRMVRQGLLGE  88



>ref|XP_010092053.1| 40S ribosomal protein S9-2 [Morus notabilis]
 gb|EXB49967.1| 40S ribosomal protein S9-2 [Morus notabilis]
Length=302

 Score =   128 bits (321),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/66 (92%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  92   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  271
            GKTFKKPRRPYEKERLDAELKLVGEYGL CKRELWRVQYALSRIRNNARMLLTLDEK PR
Sbjct  37   GKTFKKPRRPYEKERLDAELKLVGEYGLHCKRELWRVQYALSRIRNNARMLLTLDEKSPR  96

Query  272  RIFEGD  289
            RI E +
Sbjct  97   RIVEAN  102



>ref|XP_763944.1| 40S ribosomal protein S9 [Theileria parva strain Muguga]
 gb|EAN31661.1| 40S ribosomal protein S9, putative [Theileria parva]
Length=188

 Score =   125 bits (313),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +2

Query  71   VNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLT  250
            V  YRNY +T + P+RP+EKERLD ELKL+GEYGL+ KRE+WRVQY LS+IR+ AR LLT
Sbjct  2    VGSYRNYSRTSRNPKRPFEKERLDQELKLIGEYGLKNKREVWRVQYVLSKIRSAARYLLT  61

Query  251  LDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LD KD +R+F+G+ALLRRM RYGL++E
Sbjct  62   LDPKDNKRLFQGEALLRRMVRYGLMNE  88



>ref|XP_002367195.1| 40S ribosomal protein S9, putative [Toxoplasma gondii ME49]
 ref|XP_008883863.1| ribosomal protein RPS9 [Hammondia hammondi]
 gb|EPR63525.1| ribosomal protein RPS9 [Toxoplasma gondii GT1]
 gb|EPT25014.1| ribosomal protein RPS9 [Toxoplasma gondii ME49]
 gb|ESS34279.1| ribosomal protein RPS9 [Toxoplasma gondii VEG]
 gb|KEP65652.1| ribosomal protein RPS9 [Hammondia hammondi]
 gb|KFG46575.1| ribosomal protein RPS9 [Toxoplasma gondii GAB2-2007-GAL-DOM2]
 gb|KFG48357.1| ribosomal protein RPS9 [Toxoplasma gondii p89]
 gb|KFG54080.1| ribosomal protein RPS9 [Toxoplasma gondii FOU]
 gb|KFG64413.1| ribosomal protein RPS9 [Toxoplasma gondii RUB]
 gb|KFH12211.1| ribosomal protein RPS9 [Toxoplasma gondii VAND]
 gb|KFH16022.1| ribosomal protein RPS9 [Toxoplasma gondii MAS]
Length=188

 Score =   125 bits (313),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YR Y KT + P+RP+EKERLD E+KL+GEYGL+ KRE+WRVQYAL++IR+ AR LLTL+E
Sbjct  5    YRTYSKTARSPKRPFEKERLDQEMKLLGEYGLKNKREVWRVQYALAKIRSAARELLTLEE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDE  331
            KDPRR+F+G ALLRRM R GLL E
Sbjct  65   KDPRRVFQGTALLRRMVRLGLLGE  88



>ref|XP_730059.1| ribosomal protein S4 [Plasmodium yoelii yoelii 17XNL]
 gb|EAA21624.1| ribosomal protein S4, putative [Plasmodium yoelii yoelii]
Length=214

 Score =   125 bits (314),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRNY KT + P+RP+EKERLD ELKL+GEYGL+ KRE+WRVQY L++IR+ AR LLTLDE
Sbjct  5    YRNYSKTARNPKRPFEKERLDQELKLIGEYGLKNKREIWRVQYLLAKIRSAARYLLTLDE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDE  331
            K P+RIF+G+ALLRRM R GLL E
Sbjct  65   KSPKRIFQGEALLRRMVRQGLLGE  88



>emb|CCA22601.1| 40S ribosomal protein S91 putative [Albugo laibachii Nc14]
Length=194

 Score =   125 bits (313),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  V+   NY KT++ P R +EK RLD ELKL+GEYGLRCKRE+WRVQYALS++R  AR 
Sbjct  1    MPKVSRLTNYRKTYRTPTRVFEKARLDQELKLLGEYGLRCKREIWRVQYALSKLRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LLTLD KDP+R+FEG ALLRR+ RYGLL E
Sbjct  61   LLTLDAKDPKRLFEGAALLRRLKRYGLLTE  90



>emb|CDJ32982.1| 40S ribosomal protein S9, putative [Eimeria mitis]
Length=188

 Score =   124 bits (312),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRN+ KT + P+RP+EKERLD EL+L+GEYGL+ KRE+WRVQYAL++IR+ AR LLTL+E
Sbjct  5    YRNHSKTARNPKRPFEKERLDQELRLLGEYGLKNKREVWRVQYALAKIRSAARELLTLEE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDE  331
            KDPRRIF+G ALLRRM R GLL E
Sbjct  65   KDPRRIFQGTALLRRMVRLGLLSE  88



>emb|CDI78299.1| 40S ribosomal protein S9, putative [Eimeria acervulina]
 emb|CDI87489.1| 40S ribosomal protein S9, putative [Eimeria praecox]
 emb|CDJ56695.1| 40S ribosomal protein S9, putative [Eimeria maxima]
Length=188

 Score =   124 bits (312),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRN+ KT + P+RP+EKERLD EL+L+GEYGL+ KRE+WRVQYAL++IR+ AR LLTL+E
Sbjct  5    YRNHSKTARNPKRPFEKERLDQELRLLGEYGLKNKREVWRVQYALAKIRSAARELLTLEE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDE  331
            KDPRRIF+G ALLRRM R GLL E
Sbjct  65   KDPRRIFQGTALLRRMVRLGLLSE  88



>gb|EME38681.1| ribosomal protein S9-like protein [Dothistroma septosporum NZE10]
Length=193

 Score =   124 bits (312),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDE  331
            DP+R+FEG+AL+RR+ R G+LDE
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDE  86



>gb|KIN07697.1| hypothetical protein OIDMADRAFT_16275 [Oidiodendron maius Zn]
Length=192

 Score =   124 bits (312),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R+Y KT+K PRRP+E  RLD+ELKLVGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKLVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDE  331
            DP+R+FEG+AL+RR+ R G+LDE
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDE  86



>gb|KIV80024.1| 40S ribosomal protein S9 [Exophiala sideris]
Length=193

 Score =   124 bits (312),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDE  331
            DP+R+FEG+AL+RR+ R G+LDE
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDE  86



>gb|KEF58004.1| 40S ribosomal protein S9 [Exophiala aquamarina CBS 119918]
Length=193

 Score =   124 bits (312),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDE  331
            DP+R+FEG+AL+RR+ R G+LDE
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDE  86



>gb|KIW15420.1| 40S ribosomal protein S9 [Exophiala spinifera]
Length=193

 Score =   124 bits (312),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDE  331
            DP+R+FEG+AL+RR+ R G+LDE
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDE  86



>gb|EKG11582.1| Ribosomal protein S4/S9 [Macrophomina phaseolina MS6]
Length=191

 Score =   124 bits (312),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDE  331
            DP+R+FEG+AL+RR+ R G+LDE
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDE  86



>ref|XP_952982.1| 40S ribosomal protein S9 [Theileria annulata strain Ankara]
 emb|CAI76357.1| 40S ribosomal protein S9, putative [Theileria annulata]
Length=188

 Score =   124 bits (312),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +2

Query  71   VNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLT  250
            V  YRNY +T + P+RP+EKERLD ELKL+GEYGL+ KRE+WRVQY LS+IR+ AR LLT
Sbjct  2    VGNYRNYSRTSRNPKRPFEKERLDQELKLIGEYGLKNKREVWRVQYVLSKIRSAARYLLT  61

Query  251  LDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LD KD +R+F+G+ALLRRM RYGL++E
Sbjct  62   LDPKDNKRLFQGEALLRRMVRYGLMNE  88



>ref|XP_009846369.1| ribosomal protein S4 [Aphanomyces astaci]
 gb|ETV64145.1| ribosomal protein S4 [Aphanomyces astaci]
Length=196

 Score =   124 bits (312),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  ++ +RNY KT++ P R +EKERLD E+KL+GEYGLRCKRE+WRVQY L+++R  AR 
Sbjct  1    MPKISRHRNYRKTYRTPSRAFEKERLDQEMKLLGEYGLRCKREIWRVQYTLAKLRKAARQ  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLL  325
            LLTLD KDP+R+FEG AL+RR+ RYGLL
Sbjct  61   LLTLDPKDPKRLFEGPALIRRLKRYGLL  88



>gb|KIW73335.1| 40S ribosomal protein S9 [Capronia semiimmersa]
Length=193

 Score =   124 bits (312),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDE  331
            DP+R+FEG+AL+RR+ R G+LDE
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDE  86



>ref|XP_008722253.1| 40S ribosomal protein S9 [Cladophialophora carrionii CBS 160.54]
 gb|ETI28179.1| 40S ribosomal protein S9 [Cladophialophora carrionii CBS 160.54]
Length=193

 Score =   124 bits (312),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDE  331
            DP+R+FEG+AL+RR+ R G+LDE
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDE  86



>ref|XP_001546443.1| 40S ribosomal protein S9 [Botrytis cinerea B05.10]
 emb|CCD54749.1| similar to 40S ribosomal protein S9 [Botrytis cinerea T4]
 gb|EMR81651.1| putative 40s ribosomal protein s9 protein [Botrytis cinerea BcDW1]
Length=191

 Score =   124 bits (311),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDE  331
            DP+R+FEG+AL+RR+ R G+LDE
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDE  86



>ref|XP_007724904.1| 40S ribosomal protein S9 [Capronia coronata CBS 617.96]
 gb|EXJ85466.1| 40S ribosomal protein S9 [Capronia coronata CBS 617.96]
Length=193

 Score =   124 bits (311),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDE  331
            DP+R+FEG+AL+RR+ R G+LDE
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDE  86



>ref|XP_009155008.1| 40S ribosomal protein S9 [Exophiala dermatitidis NIH/UT8656]
 gb|EHY54547.1| 40S ribosomal protein S9 [Exophiala dermatitidis NIH/UT8656]
Length=193

 Score =   124 bits (311),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDE  331
            DP+R+FEG+AL+RR+ R G+LDE
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDE  86



>ref|XP_007922661.1| hypothetical protein MYCFIDRAFT_60241 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME85361.1| hypothetical protein MYCFIDRAFT_60241 [Pseudocercospora fijiensis 
CIRAD86]
Length=193

 Score =   124 bits (311),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFEAARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDE  331
            DP+R+FEG+AL+RR+ R G+LDE
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDE  86



>gb|KIW44874.1| 40S ribosomal protein S9 [Exophiala oligosperma]
Length=193

 Score =   124 bits (311),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDE  331
            DP+R+FEG+AL+RR+ R G+LDE
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDE  86



>ref|XP_008654154.1| PREDICTED: 40S ribosomal protein S9-2-like [Zea mays]
Length=173

 Score =   124 bits (310),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +2

Query  131  ERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPRRIFEGDALLRRMN  310
            +RLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR LLTLDEK+PRRIFEG+ALLRRMN
Sbjct  65   KRLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARELLTLDEKNPRRIFEGEALLRRMN  124

Query  311  RYGLLDE  331
            RYGLL E
Sbjct  125  RYGLLGE  131



>ref|XP_003886044.1| hypothetical protein NCLIV_064440 [Neospora caninum Liverpool]
 emb|CBZ56018.1| hypothetical protein NCLIV_064440 [Neospora caninum Liverpool]
Length=188

 Score =   124 bits (311),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YR Y KT + P+RP+EKERLD E+KL+GEYGL+ KRE+WRVQYAL++IR+ AR LLTL+E
Sbjct  5    YRTYSKTARSPKRPFEKERLDQEMKLLGEYGLKNKREVWRVQYALAKIRSAARELLTLEE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDE  331
            KDPRR+F+G ALLRRM R GLL E
Sbjct  65   KDPRRLFQGTALLRRMVRLGLLGE  88



>gb|KIW07901.1| 40S ribosomal protein S9 [Verruconis gallopava]
Length=191

 Score =   124 bits (311),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDE  331
            DP+R+FEG+AL+RR+ R G+LDE
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDE  86



>gb|KIW50177.1| 40S ribosomal protein S9 [Exophiala xenobiotica]
Length=193

 Score =   124 bits (311),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDE  331
            DP+R+FEG+AL+RR+ R G+LDE
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDE  86



>ref|XP_007587858.1| putative 40s ribosomal protein s9 protein [Neofusicoccum parvum 
UCRNP2]
 gb|EOD44674.1| putative 40s ribosomal protein s9 protein [Neofusicoccum parvum 
UCRNP2]
Length=191

 Score =   124 bits (311),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDE  331
            DP+R+FEG+AL+RR+ R G+LDE
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDE  86



>ref|XP_007750565.1| 40S ribosomal protein S9 [Cladophialophora psammophila CBS 110553]
 gb|EXJ61489.1| 40S ribosomal protein S9 [Cladophialophora psammophila CBS 110553]
 gb|KIW95815.1| 40S ribosomal protein S9 [Cladophialophora bantiana CBS 173.52]
Length=192

 Score =   124 bits (311),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDE  331
            DP+R+FEG+AL+RR+ R G+LDE
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDE  86



>gb|KIW24305.1| 40S ribosomal protein S9 [Cladophialophora immunda]
Length=193

 Score =   124 bits (311),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDE  331
            DP+R+FEG+AL+RR+ R G+LDE
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDE  86



>ref|XP_007782986.1| 40S ribosomal protein S9 [Coniosporium apollinis CBS 100218]
 gb|EON67669.1| 40S ribosomal protein S9 [Coniosporium apollinis CBS 100218]
Length=191

 Score =   124 bits (311),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDE  331
            DP+R+FEG+AL+RR+ R G+LDE
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDE  86



>ref|XP_009692519.1| 40S ribosomal protein S9 [Theileria orientalis strain Shintoku]
 dbj|BAM42218.1| 40S ribosomal protein S9 [Theileria orientalis strain Shintoku]
Length=184

 Score =   124 bits (310),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  71   VNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLT  250
            V  YR Y +T + P+RP+EK+RLD ELKL+GEYGL+ KRE+WRVQY LS+IR+ AR LLT
Sbjct  2    VGSYRTYSRTSRNPKRPFEKDRLDQELKLIGEYGLKNKREVWRVQYVLSKIRSVARYLLT  61

Query  251  LDEKDPRRIFEGDALLRRMNRYGLLDE  331
            LD KD +R+F+GDALLRRM RYGL+ E
Sbjct  62   LDPKDNKRVFQGDALLRRMVRYGLMSE  88



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562698116640