BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP008B01 376 bp,

Length=348
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009802975.1|  PREDICTED: PH-interacting protein-like           57.0    9e-07   Nicotiana sylvestris
ref|XP_009598019.1|  PREDICTED: bromodomain and WD repeat-contain...  57.0    9e-07   Nicotiana tomentosiformis
ref|XP_006349193.1|  PREDICTED: PH-interacting protein-like           57.0    1e-06   Solanum tuberosum [potatoes]
ref|XP_008786250.1|  PREDICTED: bromodomain and WD repeat-contain...  57.0    1e-06   Phoenix dactylifera
ref|XP_008438944.1|  PREDICTED: bromodomain and WD repeat-contain...  57.0    1e-06   Cucumis melo [Oriental melon]
emb|CBI36946.3|  unnamed protein product                              57.0    1e-06   Vitis vinifera
ref|XP_008786249.1|  PREDICTED: bromodomain and WD repeat-contain...  57.0    1e-06   Phoenix dactylifera
gb|KHN14669.1|  Bromodomain and WD repeat-containing protein 1        57.0    1e-06   Glycine soja [wild soybean]
gb|KHN12888.1|  PH-interacting protein                                57.0    1e-06   Glycine soja [wild soybean]
ref|XP_007138998.1|  hypothetical protein PHAVU_009G256200g           57.0    1e-06   Phaseolus vulgaris [French bean]
ref|XP_010652238.1|  PREDICTED: bromodomain and WD repeat-contain...  57.0    1e-06   Vitis vinifera
ref|XP_006597707.1|  PREDICTED: PH-interacting protein-like isofo...  57.0    1e-06   Glycine max [soybeans]
ref|XP_006597706.1|  PREDICTED: PH-interacting protein-like isofo...  57.0    1e-06   Glycine max [soybeans]
ref|XP_006586898.1|  PREDICTED: PH-interacting protein-like isofo...  57.0    1e-06   Glycine max [soybeans]
ref|XP_006586896.1|  PREDICTED: PH-interacting protein-like isofo...  57.0    1e-06   Glycine max [soybeans]
gb|EYU29645.1|  hypothetical protein MIMGU_mgv1a000133mg              56.6    1e-06   Erythranthe guttata [common monkey flower]
ref|XP_011100778.1|  PREDICTED: bromodomain and WD repeat-contain...  56.6    1e-06   Sesamum indicum [beniseed]
ref|XP_004487773.1|  PREDICTED: PH-interacting protein-like isofo...  56.6    1e-06   
ref|XP_004487772.1|  PREDICTED: PH-interacting protein-like isofo...  56.6    1e-06   
gb|KDP28253.1|  hypothetical protein JCGZ_14024                       56.6    1e-06   Jatropha curcas
ref|XP_008438943.1|  PREDICTED: bromodomain and WD repeat-contain...  56.6    1e-06   Cucumis melo [Oriental melon]
ref|XP_006444488.1|  hypothetical protein CICLE_v10018465mg           56.6    1e-06   Citrus clementina
ref|XP_004134501.1|  PREDICTED: uncharacterized protein LOC101214610  56.6    1e-06   
ref|XP_002519206.1|  WD-repeat protein, putative                      56.6    1e-06   
ref|XP_002515288.1|  WD-repeat protein, putative                      56.6    1e-06   
ref|XP_006492329.1|  PREDICTED: bromodomain and WD repeat-contain...  56.6    1e-06   Citrus sinensis [Valencia orange]
ref|XP_008786246.1|  PREDICTED: bromodomain and WD repeat-contain...  56.6    1e-06   Phoenix dactylifera
ref|XP_008786244.1|  PREDICTED: bromodomain and WD repeat-contain...  56.6    1e-06   Phoenix dactylifera
ref|XP_006355386.1|  PREDICTED: bromodomain and WD repeat-contain...  56.6    1e-06   Solanum tuberosum [potatoes]
ref|XP_010649528.1|  PREDICTED: bromodomain and WD repeat-contain...  56.6    1e-06   Vitis vinifera
ref|XP_010649527.1|  PREDICTED: bromodomain and WD repeat-contain...  56.6    1e-06   Vitis vinifera
ref|XP_007035763.1|  WD40/YVTN repeat-like-containing domain,Brom...  56.2    1e-06   Theobroma cacao [chocolate]
gb|AES65027.2|  WD40/YVTN repeat containing domain-containing pro...  56.2    1e-06   Medicago truncatula
ref|XP_007035765.1|  WD40/YVTN repeat-like-containing domain,Brom...  56.2    2e-06   Theobroma cacao [chocolate]
gb|ABN06020.1|  Cytochrome cd1-nitrite reductase-like, C-terminal...  56.2    2e-06   Medicago truncatula
ref|XP_003594776.1|  Bromodomain and WD repeat-containing protein     56.2    2e-06   
ref|XP_010938293.1|  PREDICTED: bromodomain and WD repeat-contain...  56.2    2e-06   Elaeis guineensis
ref|XP_010921499.1|  PREDICTED: bromodomain and WD repeat-contain...  56.2    2e-06   Elaeis guineensis
ref|XP_008781101.1|  PREDICTED: bromodomain and WD repeat-contain...  56.2    2e-06   Phoenix dactylifera
emb|CBI22898.3|  unnamed protein product                              56.2    2e-06   Vitis vinifera
ref|XP_010507783.1|  PREDICTED: PH-interacting protein-like           56.2    2e-06   Camelina sativa [gold-of-pleasure]
gb|AAC62845.3|  putative WD-40 repeat protein                         56.2    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010413105.1|  PREDICTED: bromodomain and WD repeat-contain...  56.2    2e-06   Camelina sativa [gold-of-pleasure]
emb|CDY51423.1|  BnaA04g27000D                                        56.2    2e-06   Brassica napus [oilseed rape]
ref|XP_006295982.1|  hypothetical protein CARUB_v10025125mg           56.2    2e-06   Capsella rubella
ref|XP_006397936.1|  hypothetical protein EUTSA_v10001281mg           56.2    2e-06   Eutrema salsugineum
ref|XP_010544972.1|  PREDICTED: PH-interacting protein                56.2    2e-06   Tarenaya hassleriana [spider flower]
ref|XP_009118759.1|  PREDICTED: PH-interacting protein isoform X1     55.8    2e-06   Brassica rapa
ref|XP_009118768.1|  PREDICTED: PH-interacting protein isoform X2     55.8    2e-06   Brassica rapa
ref|XP_010546988.1|  PREDICTED: PH-interacting protein isoform X2     55.8    2e-06   Tarenaya hassleriana [spider flower]
ref|XP_007051094.1|  WD40/YVTN repeat-like-containing domain,Brom...  55.8    2e-06   Theobroma cacao [chocolate]
ref|XP_007051095.1|  WD40/YVTN repeat-like-containing domain,Brom...  55.8    2e-06   Theobroma cacao [chocolate]
ref|XP_002880300.1|  predicted protein                                55.8    2e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_010512810.1|  PREDICTED: PH-interacting protein-like           55.5    2e-06   Camelina sativa [gold-of-pleasure]
ref|NP_001189770.1|  WD40 domain-containing protein                   55.8    2e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AAM91568.1|  putative WD-40 repeat protein                         55.8    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850474.3|  WD40 domain-containing protein                      55.8    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007051096.1|  WD40/YVTN repeat-like-containing domain,Brom...  55.5    3e-06   Theobroma cacao [chocolate]
ref|XP_010546984.1|  PREDICTED: PH-interacting protein isoform X1     55.5    3e-06   Tarenaya hassleriana [spider flower]
ref|XP_011461754.1|  PREDICTED: PH-interacting protein                55.5    3e-06   Fragaria vesca subsp. vesca
dbj|BAB09913.1|  WD-40 repeat protein-like                            55.5    3e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CDX86234.1|  BnaA06g29510D                                        55.5    3e-06   Brassica napus [oilseed rape]
emb|CDX85409.1|  BnaC07g27200D                                        55.5    3e-06   Brassica napus [oilseed rape]
ref|XP_006279825.1|  hypothetical protein CARUB_v10028149mg           55.5    3e-06   Capsella rubella
ref|XP_009151300.1|  PREDICTED: bromodomain and WD repeat-contain...  55.5    3e-06   Brassica rapa
ref|XP_006395063.1|  hypothetical protein EUTSA_v10003509mg           55.5    3e-06   Eutrema salsugineum
ref|XP_010482217.1|  PREDICTED: bromodomain and WD repeat-contain...  55.1    3e-06   Camelina sativa [gold-of-pleasure]
ref|NP_199754.2|  WD40/YVTN repeat and Bromo-WDR9-I-like domain-c...  55.1    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010442408.1|  PREDICTED: bromodomain and WD repeat-contain...  55.1    4e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010318937.1|  PREDICTED: bromodomain and WD repeat-contain...  55.1    4e-06   Solanum lycopersicum
ref|XP_010440565.1|  PREDICTED: bromodomain and WD repeat-contain...  55.1    4e-06   Camelina sativa [gold-of-pleasure]
ref|XP_002865733.1|  transducin family protein                        55.1    4e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_004229396.2|  PREDICTED: uncharacterized protein LOC101243927  55.1    4e-06   Solanum lycopersicum
gb|EPS60483.1|  hypothetical protein M569_14320                       53.9    4e-06   Genlisea aurea
ref|XP_010442405.1|  PREDICTED: bromodomain and WD repeat-contain...  55.1    4e-06   Camelina sativa [gold-of-pleasure]
ref|XP_006855278.1|  hypothetical protein AMTR_s00057p00026390        54.7    5e-06   
emb|CDY27490.1|  BnaC04g51310D                                        54.7    5e-06   Brassica napus [oilseed rape]
emb|CDP17076.1|  unnamed protein product                              54.7    5e-06   Coffea canephora [robusta coffee]
ref|XP_008355498.1|  PREDICTED: bromodomain and WD repeat-contain...  54.7    5e-06   Malus domestica [apple tree]
ref|XP_008369050.1|  PREDICTED: bromodomain and WD repeat-contain...  54.7    5e-06   
ref|XP_009378715.1|  PREDICTED: bromodomain and WD repeat-contain...  54.7    5e-06   Pyrus x bretschneideri [bai li]
ref|XP_009339782.1|  PREDICTED: PH-interacting protein-like isofo...  54.7    5e-06   Pyrus x bretschneideri [bai li]
ref|XP_009378712.1|  PREDICTED: bromodomain and WD repeat-contain...  54.7    5e-06   Pyrus x bretschneideri [bai li]
ref|XP_009339781.1|  PREDICTED: PH-interacting protein-like isofo...  54.7    5e-06   Pyrus x bretschneideri [bai li]
ref|XP_008386783.1|  PREDICTED: bromodomain and WD repeat-contain...  54.7    5e-06   Malus domestica [apple tree]
ref|XP_006419405.1|  hypothetical protein CICLE_v10004131mg           54.7    6e-06   Citrus clementina
ref|XP_006419406.1|  hypothetical protein CICLE_v10004131mg           54.3    6e-06   Citrus clementina
ref|XP_006488853.1|  PREDICTED: bromodomain and WD repeat-contain...  54.3    6e-06   Citrus sinensis [Valencia orange]
ref|XP_006488854.1|  PREDICTED: bromodomain and WD repeat-contain...  54.3    6e-06   Citrus sinensis [Valencia orange]
ref|XP_010094309.1|  Bromodomain and WD repeat-containing protein 1   54.3    7e-06   Morus notabilis
ref|XP_010259313.1|  PREDICTED: bromodomain and WD repeat-contain...  53.9    1e-05   Nelumbo nucifera [Indian lotus]
ref|XP_008223320.1|  PREDICTED: PH-interacting protein                53.9    1e-05   Prunus mume [ume]
ref|XP_007221895.1|  hypothetical protein PRUPE_ppa016106mg           53.9    1e-05   Prunus persica
ref|XP_010671679.1|  PREDICTED: bromodomain and WD repeat-contain...  53.9    1e-05   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010671678.1|  PREDICTED: bromodomain and WD repeat-contain...  53.9    1e-05   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010671680.1|  PREDICTED: bromodomain and WD repeat-contain...  53.5    1e-05   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_011041261.1|  PREDICTED: bromodomain and WD repeat-contain...  53.5    1e-05   Populus euphratica
gb|EYU46805.1|  hypothetical protein MIMGU_mgv1a000149mg              53.5    1e-05   Erythranthe guttata [common monkey flower]
ref|XP_006375438.1|  hypothetical protein POPTR_0014s11620g           53.5    1e-05   Populus trichocarpa [western balsam poplar]
ref|XP_004172385.1|  PREDICTED: bromodomain and WD repeat-contain...  52.8    1e-05   
ref|XP_002320301.2|  hypothetical protein POPTR_0014s11620g           53.5    1e-05   Populus trichocarpa [western balsam poplar]
emb|CAN66736.1|  hypothetical protein VITISV_024187                   52.8    1e-05   Vitis vinifera
ref|XP_010069859.1|  PREDICTED: PH-interacting protein                53.5    1e-05   Eucalyptus grandis [rose gum]
gb|KCW58362.1|  hypothetical protein EUGRSUZ_H01047                   53.1    1e-05   Eucalyptus grandis [rose gum]
ref|XP_007199598.1|  hypothetical protein PRUPE_ppa023042mg           53.1    2e-05   Prunus persica
emb|CAN77503.1|  hypothetical protein VITISV_017801                   52.4    2e-05   Vitis vinifera
gb|KGN57161.1|  hypothetical protein Csa_3G166260                     52.8    2e-05   Cucumis sativus [cucumbers]
ref|XP_008235203.1|  PREDICTED: PH-interacting protein                53.1    2e-05   Prunus mume [ume]
gb|KDO87004.1|  hypothetical protein CISIN_1g0488012mg                52.8    2e-05   Citrus sinensis [Valencia orange]
ref|XP_009129789.1|  PREDICTED: bromodomain and WD repeat-contain...  52.8    2e-05   Brassica rapa
ref|XP_004984630.1|  PREDICTED: bromodomain and WD repeat-contain...  52.8    2e-05   Setaria italica
gb|ABF95528.1|  expressed protein                                     52.8    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009129788.1|  PREDICTED: bromodomain and WD repeat-contain...  52.8    2e-05   Brassica rapa
ref|XP_008655652.1|  PREDICTED: bromodomain and WD repeat-contain...  52.8    2e-05   Zea mays [maize]
ref|XP_009129786.1|  PREDICTED: bromodomain and WD repeat-contain...  52.8    2e-05   Brassica rapa
emb|CDY33904.1|  BnaA02g30830D                                        52.8    2e-05   Brassica napus [oilseed rape]
ref|XP_011465353.1|  PREDICTED: bromodomain and WD repeat-contain...  52.4    2e-05   Fragaria vesca subsp. vesca
ref|XP_006649960.1|  PREDICTED: bromodomain and WD repeat-contain...  52.4    3e-05   Oryza brachyantha
gb|AAM14817.1|  hypothetical protein                                  52.0    3e-05   Arabidopsis thaliana [mouse-ear cress]
gb|EEE58913.1|  hypothetical protein OsJ_10557                        52.4    3e-05   Oryza sativa Japonica Group [Japonica rice]
emb|CDY05630.1|  BnaC02g39070D                                        52.4    3e-05   Brassica napus [oilseed rape]
gb|KJB09463.1|  hypothetical protein B456_001G144100                  52.4    3e-05   Gossypium raimondii
ref|XP_011010129.1|  PREDICTED: bromodomain and WD repeat-contain...  52.4    3e-05   Populus euphratica
ref|XP_004495905.1|  PREDICTED: PH-interacting protein-like           52.4    3e-05   Cicer arietinum [garbanzo]
ref|XP_006378533.1|  hypothetical protein POPTR_0010s15260g           52.4    3e-05   Populus trichocarpa [western balsam poplar]
ref|XP_011010179.1|  PREDICTED: bromodomain and WD repeat-contain...  52.4    3e-05   Populus euphratica
ref|XP_011010145.1|  PREDICTED: bromodomain and WD repeat-contain...  52.4    3e-05   Populus euphratica
ref|XP_011010162.1|  PREDICTED: bromodomain and WD repeat-contain...  52.4    3e-05   Populus euphratica
ref|XP_008655651.1|  PREDICTED: bromodomain and WD repeat-contain...  52.4    3e-05   Zea mays [maize]
ref|XP_011079558.1|  PREDICTED: bromodomain and WD repeat-contain...  52.4    3e-05   Sesamum indicum [beniseed]
ref|XP_008655650.1|  PREDICTED: bromodomain and WD repeat-contain...  52.4    3e-05   Zea mays [maize]
ref|XP_008655649.1|  PREDICTED: bromodomain and WD repeat-contain...  52.0    3e-05   Zea mays [maize]
ref|XP_008655648.1|  PREDICTED: bromodomain and WD repeat-contain...  52.0    3e-05   Zea mays [maize]
ref|XP_010679369.1|  PREDICTED: bromodomain and WD repeat-contain...  52.0    3e-05   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_011081888.1|  PREDICTED: bromodomain and WD repeat-contain...  51.2    3e-05   Sesamum indicum [beniseed]
ref|XP_008345232.1|  PREDICTED: PH-interacting protein-like           51.2    4e-05   Malus domestica [apple tree]
emb|CDP10045.1|  unnamed protein product                              51.6    4e-05   Coffea canephora [robusta coffee]
ref|XP_009763234.1|  PREDICTED: PH-interacting protein                51.6    4e-05   Nicotiana sylvestris
ref|XP_009626318.1|  PREDICTED: PH-interacting protein-like           51.6    4e-05   Nicotiana tomentosiformis
ref|XP_010024785.1|  PREDICTED: PH-interacting protein                51.6    5e-05   Eucalyptus grandis [rose gum]
gb|KDO71898.1|  hypothetical protein CISIN_1g0002511mg                50.8    6e-05   Citrus sinensis [Valencia orange]
gb|KJB34708.1|  hypothetical protein B456_006G079300                  51.2    6e-05   Gossypium raimondii
gb|KJB34712.1|  hypothetical protein B456_006G079300                  51.2    7e-05   Gossypium raimondii
gb|EMS58000.1|  PH-interacting protein                                51.2    7e-05   Triticum urartu
gb|KDO71897.1|  hypothetical protein CISIN_1g0002511mg                50.8    7e-05   Citrus sinensis [Valencia orange]
ref|XP_009369942.1|  PREDICTED: bromodomain and WD repeat-contain...  51.2    7e-05   Pyrus x bretschneideri [bai li]
ref|XP_011020211.1|  PREDICTED: bromodomain and WD repeat-contain...  51.2    8e-05   Populus euphratica
gb|KJB34713.1|  hypothetical protein B456_006G079300                  50.8    8e-05   Gossypium raimondii
ref|XP_008340614.1|  PREDICTED: bromodomain and WD repeat-contain...  50.8    8e-05   Malus domestica [apple tree]
gb|KHG03709.1|  Bromodomain and WD repeat-containing 3                50.8    9e-05   Gossypium arboreum [tree cotton]
gb|EMT04324.1|  hypothetical protein F775_06469                       50.8    9e-05   Aegilops tauschii
ref|XP_006574534.1|  PREDICTED: bromodomain and WD repeat-contain...  50.8    9e-05   
ref|XP_006574533.1|  PREDICTED: bromodomain and WD repeat-contain...  50.8    9e-05   Glycine max [soybeans]
ref|XP_006588574.1|  PREDICTED: bromodomain and WD repeat-contain...  50.8    9e-05   
gb|KHN30643.1|  PH-interacting protein                                50.8    1e-04   Glycine soja [wild soybean]
ref|XP_006588573.1|  PREDICTED: bromodomain and WD repeat-contain...  50.8    1e-04   
ref|XP_006588572.1|  PREDICTED: bromodomain and WD repeat-contain...  50.8    1e-04   
ref|XP_006588570.1|  PREDICTED: bromodomain and WD repeat-contain...  50.8    1e-04   Glycine max [soybeans]
ref|XP_006574532.1|  PREDICTED: bromodomain and WD repeat-contain...  50.8    1e-04   Glycine max [soybeans]
ref|XP_006574531.1|  PREDICTED: bromodomain and WD repeat-contain...  50.8    1e-04   Glycine max [soybeans]
ref|XP_009383930.1|  PREDICTED: PH-interacting protein-like           50.1    1e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010087245.1|  PH-interacting protein                           50.1    2e-04   Morus notabilis
ref|XP_002457298.1|  hypothetical protein SORBIDRAFT_03g005130        49.7    2e-04   Sorghum bicolor [broomcorn]
ref|XP_002311385.2|  hypothetical protein POPTR_0008s106302g          49.7    2e-04   Populus trichocarpa [western balsam poplar]
ref|XP_010240435.1|  PREDICTED: bromodomain and WD repeat-contain...  49.7    2e-04   Brachypodium distachyon [annual false brome]
gb|EEC75085.1|  hypothetical protein OsI_11234                        49.3    2e-04   Oryza sativa Indica Group [Indian rice]
gb|EPS73773.1|  hypothetical protein M569_00983                       48.9    3e-04   Genlisea aurea
ref|XP_009384423.1|  PREDICTED: bromodomain and WD repeat-contain...  48.9    4e-04   Musa acuminata subsp. malaccensis [pisang utan]



>ref|XP_009802975.1| PREDICTED: PH-interacting protein-like [Nicotiana sylvestris]
 ref|XP_009802976.1| PREDICTED: PH-interacting protein-like [Nicotiana sylvestris]
 ref|XP_009802977.1| PREDICTED: PH-interacting protein-like [Nicotiana sylvestris]
Length=1665

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  88   SIFQWRLPDGLPISVLRGHTGGVTAIAFS  2
            SI  WRLPDGLPISVLRGHTG VTAIAF+
Sbjct  309  SIRVWRLPDGLPISVLRGHTGAVTAIAFT  337



>ref|XP_009598019.1| PREDICTED: bromodomain and WD repeat-containing protein 1-like 
[Nicotiana tomentosiformis]
 ref|XP_009598020.1| PREDICTED: bromodomain and WD repeat-containing protein 1-like 
[Nicotiana tomentosiformis]
 ref|XP_009598021.1| PREDICTED: bromodomain and WD repeat-containing protein 1-like 
[Nicotiana tomentosiformis]
 ref|XP_009598022.1| PREDICTED: bromodomain and WD repeat-containing protein 1-like 
[Nicotiana tomentosiformis]
Length=1665

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  88   SIFQWRLPDGLPISVLRGHTGGVTAIAFS  2
            SI  WRLPDGLPISVLRGHTG VTAIAF+
Sbjct  309  SIRVWRLPDGLPISVLRGHTGAVTAIAFT  337



>ref|XP_006349193.1| PREDICTED: PH-interacting protein-like [Solanum tuberosum]
Length=1668

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  88   SIFQWRLPDGLPISVLRGHTGGVTAIAFS  2
            SI  WRLPDGLPISVLRGHTG VTAIAF+
Sbjct  309  SIRVWRLPDGLPISVLRGHTGAVTAIAFT  337



>ref|XP_008786250.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
isoform X4 [Phoenix dactylifera]
Length=1528

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76  WRLPDGLPISVLRGHTGGVTAIAFS  2
           WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  41  WRLPDGLPISVLRGHTGAVTAIAFS  65



>ref|XP_008438944.1| PREDICTED: bromodomain and WD repeat-containing protein 1 isoform 
X2 [Cucumis melo]
Length=1541

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  128  WRLPDGLPISVLRGHTGAVTAIAFS  152



>emb|CBI36946.3| unnamed protein product [Vitis vinifera]
Length=1549

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  311  WRLPDGLPISVLRGHTGAVTAIAFS  335



>ref|XP_008786249.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
isoform X3 [Phoenix dactylifera]
Length=1567

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  80   WRLPDGLPISVLRGHTGAVTAIAFS  104



>gb|KHN14669.1| Bromodomain and WD repeat-containing protein 1 [Glycine soja]
Length=1624

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  309  WRLPDGLPISVLRGHTGAVTAIAFS  333



>gb|KHN12888.1| PH-interacting protein [Glycine soja]
Length=1719

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  309  WRLPDGLPISVLRGHTGAVTAIAFS  333



>ref|XP_007138998.1| hypothetical protein PHAVU_009G256200g [Phaseolus vulgaris]
 gb|ESW10992.1| hypothetical protein PHAVU_009G256200g [Phaseolus vulgaris]
Length=1746

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  326  WRLPDGLPISVLRGHTGAVTAIAFS  350



>ref|XP_010652238.1| PREDICTED: bromodomain and WD repeat-containing protein 3 [Vitis 
vinifera]
 ref|XP_010652239.1| PREDICTED: bromodomain and WD repeat-containing protein 3 [Vitis 
vinifera]
Length=1763

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  311  WRLPDGLPISVLRGHTGAVTAIAFS  335



>ref|XP_006597707.1| PREDICTED: PH-interacting protein-like isoform X2 [Glycine max]
Length=1769

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  309  WRLPDGLPISVLRGHTGAVTAIAFS  333



>ref|XP_006597706.1| PREDICTED: PH-interacting protein-like isoform X1 [Glycine max]
Length=1786

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  326  WRLPDGLPISVLRGHTGAVTAIAFS  350



>ref|XP_006586898.1| PREDICTED: PH-interacting protein-like isoform X3 [Glycine max]
Length=1790

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  326  WRLPDGLPISVLRGHTGAVTAIAFS  350



>ref|XP_006586896.1| PREDICTED: PH-interacting protein-like isoform X1 [Glycine max]
 ref|XP_006586897.1| PREDICTED: PH-interacting protein-like isoform X2 [Glycine max]
Length=1794

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  326  WRLPDGLPISVLRGHTGAVTAIAFS  350



>gb|EYU29645.1| hypothetical protein MIMGU_mgv1a000133mg [Erythranthe guttata]
Length=1665

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  322  WRLPDGLPISVLRGHTGAVTAIAFS  346



>ref|XP_011100778.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
[Sesamum indicum]
Length=1726

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  311  WRLPDGLPISVLRGHTGAVTAIAFS  335



>ref|XP_004487773.1| PREDICTED: PH-interacting protein-like isoform X2 [Cicer arietinum]
Length=1732

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  315  WRLPDGLPISVLRGHTGAVTAIAFS  339



>ref|XP_004487772.1| PREDICTED: PH-interacting protein-like isoform X1 [Cicer arietinum]
Length=1752

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  313  WRLPDGLPISVLRGHTGAVTAIAFS  337



>gb|KDP28253.1| hypothetical protein JCGZ_14024 [Jatropha curcas]
Length=1639

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  281  WRLPDGLPISVLRGHTGAVTAIAFS  305



>ref|XP_008438943.1| PREDICTED: bromodomain and WD repeat-containing protein 1 isoform 
X1 [Cucumis melo]
Length=1727

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  314  WRLPDGLPISVLRGHTGAVTAIAFS  338



>ref|XP_006444488.1| hypothetical protein CICLE_v10018465mg [Citrus clementina]
 ref|XP_006444489.1| hypothetical protein CICLE_v10018465mg [Citrus clementina]
 gb|ESR57728.1| hypothetical protein CICLE_v10018465mg [Citrus clementina]
 gb|ESR57729.1| hypothetical protein CICLE_v10018465mg [Citrus clementina]
Length=1727

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  312  WRLPDGLPISVLRGHTGAVTAIAFS  336



>ref|XP_004134501.1| PREDICTED: uncharacterized protein LOC101214610 [Cucumis sativus]
Length=1729

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  311  WRLPDGLPISVLRGHTGAVTAIAFS  335



>ref|XP_002519206.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF43070.1| WD-repeat protein, putative [Ricinus communis]
Length=1519

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  321  WRLPDGLPISVLRGHTGAVTAIAFS  345



>ref|XP_002515288.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF47272.1| WD-repeat protein, putative [Ricinus communis]
Length=1546

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  299  WRLPDGLPISVLRGHTGAVTAIAFS  323



>ref|XP_006492329.1| PREDICTED: bromodomain and WD repeat-containing protein 1-like 
isoform X1 [Citrus sinensis]
 ref|XP_006492330.1| PREDICTED: bromodomain and WD repeat-containing protein 1-like 
isoform X2 [Citrus sinensis]
Length=1727

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  312  WRLPDGLPISVLRGHTGAVTAIAFS  336



>ref|XP_008786246.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
isoform X2 [Phoenix dactylifera]
 ref|XP_008786247.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
isoform X2 [Phoenix dactylifera]
 ref|XP_008786248.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
isoform X2 [Phoenix dactylifera]
Length=1801

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  314  WRLPDGLPISVLRGHTGAVTAIAFS  338



>ref|XP_008786244.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008786245.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
isoform X1 [Phoenix dactylifera]
Length=1823

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  336  WRLPDGLPISVLRGHTGAVTAIAFS  360



>ref|XP_006355386.1| PREDICTED: bromodomain and WD repeat-containing protein 1-like 
[Solanum tuberosum]
Length=1698

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  309  WRLPDGLPISVLRGHTGAVTAIAFS  333



>ref|XP_010649528.1| PREDICTED: bromodomain and WD repeat-containing protein 3 isoform 
X2 [Vitis vinifera]
Length=1753

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  315  WRLPDGLPISVLRGHTGAVTAIAFS  339



>ref|XP_010649527.1| PREDICTED: bromodomain and WD repeat-containing protein 3 isoform 
X1 [Vitis vinifera]
Length=1776

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  338  WRLPDGLPISVLRGHTGAVTAIAFS  362



>ref|XP_007035763.1| WD40/YVTN repeat-like-containing domain,Bromodomain isoform 1 
[Theobroma cacao]
 ref|XP_007035764.1| WD40/YVTN repeat-like-containing domain,Bromodomain isoform 1 
[Theobroma cacao]
 gb|EOY06689.1| WD40/YVTN repeat-like-containing domain,Bromodomain isoform 1 
[Theobroma cacao]
 gb|EOY06690.1| WD40/YVTN repeat-like-containing domain,Bromodomain isoform 1 
[Theobroma cacao]
Length=1738

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  312  WRLPDGLPISVLRGHTGAVTAIAFS  336



>gb|AES65027.2| WD40/YVTN repeat containing domain-containing protein [Medicago 
truncatula]
Length=1726

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  310  WRLPDGLPISVLRGHTGAVTAIAFS  334



>ref|XP_007035765.1| WD40/YVTN repeat-like-containing domain,Bromodomain isoform 3 
[Theobroma cacao]
 gb|EOY06691.1| WD40/YVTN repeat-like-containing domain,Bromodomain isoform 3 
[Theobroma cacao]
Length=1671

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  312  WRLPDGLPISVLRGHTGAVTAIAFS  336



>gb|ABN06020.1| Cytochrome cd1-nitrite reductase-like, C-terminal haem d1 [Medicago 
truncatula]
Length=1826

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  338  WRLPDGLPISVLRGHTGAVTAIAFS  362



>ref|XP_003594776.1| Bromodomain and WD repeat-containing protein [Medicago truncatula]
Length=1844

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  340  WRLPDGLPISVLRGHTGAVTAIAFS  364



>ref|XP_010938293.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
[Elaeis guineensis]
Length=1801

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  314  WRLPDGLPISVLRGHTGAVTAIAFS  338



>ref|XP_010921499.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
[Elaeis guineensis]
Length=1801

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  314  WRLPDGLPISVLRGHTGAVTAIAFS  338



>ref|XP_008781101.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
[Phoenix dactylifera]
 ref|XP_008781102.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
[Phoenix dactylifera]
 ref|XP_008781103.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
[Phoenix dactylifera]
 ref|XP_008781105.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
[Phoenix dactylifera]
Length=1800

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  314  WRLPDGLPISVLRGHTGAVTAIAFS  338



>emb|CBI22898.3| unnamed protein product [Vitis vinifera]
Length=1569

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  312  WRLPDGLPISVLRGHTGAVTAIAFS  336



>ref|XP_010507783.1| PREDICTED: PH-interacting protein-like, partial [Camelina sativa]
Length=1216

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76  WRLPDGLPISVLRGHTGGVTAIAFS  2
           WRLPDG+PISVLRGHTG VTAIAFS
Sbjct  31  WRLPDGMPISVLRGHTGAVTAIAFS  55



>gb|AAC62845.3| putative WD-40 repeat protein [Arabidopsis thaliana]
Length=1269

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGHTG VTAIAFS
Sbjct  185  WRLPDGMPISVLRGHTGAVTAIAFS  209



>ref|XP_010413105.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
[Camelina sativa]
Length=1329

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGHTG VTAIAFS
Sbjct  82   WRLPDGMPISVLRGHTGAVTAIAFS  106



>emb|CDY51423.1| BnaA04g27000D [Brassica napus]
Length=1506

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGHTG VTAIAFS
Sbjct  264  WRLPDGMPISVLRGHTGAVTAIAFS  288



>ref|XP_006295982.1| hypothetical protein CARUB_v10025125mg [Capsella rubella]
 gb|EOA28880.1| hypothetical protein CARUB_v10025125mg [Capsella rubella]
Length=1553

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGHTG VTAIAFS
Sbjct  307  WRLPDGMPISVLRGHTGAVTAIAFS  331



>ref|XP_006397936.1| hypothetical protein EUTSA_v10001281mg [Eutrema salsugineum]
 gb|ESQ39389.1| hypothetical protein EUTSA_v10001281mg [Eutrema salsugineum]
Length=1566

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGHTG VTAIAFS
Sbjct  307  WRLPDGMPISVLRGHTGAVTAIAFS  331



>ref|XP_010544972.1| PREDICTED: PH-interacting protein [Tarenaya hassleriana]
 ref|XP_010544973.1| PREDICTED: PH-interacting protein [Tarenaya hassleriana]
 ref|XP_010544974.1| PREDICTED: PH-interacting protein [Tarenaya hassleriana]
Length=1589

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGHTG VTAIAFS
Sbjct  308  WRLPDGMPISVLRGHTGAVTAIAFS  332



>ref|XP_009118759.1| PREDICTED: PH-interacting protein isoform X1 [Brassica rapa]
Length=1548

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGHTG VTAIAFS
Sbjct  306  WRLPDGMPISVLRGHTGAVTAIAFS  330



>ref|XP_009118768.1| PREDICTED: PH-interacting protein isoform X2 [Brassica rapa]
Length=1544

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGHTG VTAIAFS
Sbjct  302  WRLPDGMPISVLRGHTGAVTAIAFS  326



>ref|XP_010546988.1| PREDICTED: PH-interacting protein isoform X2 [Tarenaya hassleriana]
Length=1469

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLP+SVLRGHTG VTAIAFS
Sbjct  84   WRLPDGLPVSVLRGHTGAVTAIAFS  108



>ref|XP_007051094.1| WD40/YVTN repeat-like-containing domain,Bromodomain isoform 1 
[Theobroma cacao]
 gb|EOX95251.1| WD40/YVTN repeat-like-containing domain,Bromodomain isoform 1 
[Theobroma cacao]
Length=1691

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLP+SVLRGHTG VTAIAFS
Sbjct  311  WRLPDGLPVSVLRGHTGAVTAIAFS  335



>ref|XP_007051095.1| WD40/YVTN repeat-like-containing domain,Bromodomain isoform 2 
[Theobroma cacao]
 gb|EOX95252.1| WD40/YVTN repeat-like-containing domain,Bromodomain isoform 2 
[Theobroma cacao]
Length=1692

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLP+SVLRGHTG VTAIAFS
Sbjct  311  WRLPDGLPVSVLRGHTGAVTAIAFS  335



>ref|XP_002880300.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56559.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1538

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGHTG VTAIAFS
Sbjct  304  WRLPDGMPISVLRGHTGAVTAIAFS  328



>ref|XP_010512810.1| PREDICTED: PH-interacting protein-like [Camelina sativa]
Length=1207

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGHTG VTAIAFS
Sbjct  303  WRLPDGMPISVLRGHTGAVTAIAFS  327



>ref|NP_001189770.1| WD40 domain-containing protein [Arabidopsis thaliana]
 gb|AEC10838.1| WD40 domain-containing protein [Arabidopsis thaliana]
Length=1519

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGHTG VTAIAFS
Sbjct  304  WRLPDGMPISVLRGHTGAVTAIAFS  328



>gb|AAM91568.1| putative WD-40 repeat protein [Arabidopsis thaliana]
Length=1519

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGHTG VTAIAFS
Sbjct  305  WRLPDGMPISVLRGHTGAVTAIAFS  329



>ref|NP_850474.3| WD40 domain-containing protein [Arabidopsis thaliana]
 gb|AEC10837.1| WD40 domain-containing protein [Arabidopsis thaliana]
Length=1520

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGHTG VTAIAFS
Sbjct  305  WRLPDGMPISVLRGHTGAVTAIAFS  329



>ref|XP_007051096.1| WD40/YVTN repeat-like-containing domain,Bromodomain isoform 3, 
partial [Theobroma cacao]
 gb|EOX95253.1| WD40/YVTN repeat-like-containing domain,Bromodomain isoform 3, 
partial [Theobroma cacao]
Length=1545

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLP+SVLRGHTG VTAIAFS
Sbjct  311  WRLPDGLPVSVLRGHTGAVTAIAFS  335



>ref|XP_010546984.1| PREDICTED: PH-interacting protein isoform X1 [Tarenaya hassleriana]
 ref|XP_010546986.1| PREDICTED: PH-interacting protein isoform X1 [Tarenaya hassleriana]
 ref|XP_010546987.1| PREDICTED: PH-interacting protein isoform X1 [Tarenaya hassleriana]
Length=1701

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLP+SVLRGHTG VTAIAFS
Sbjct  316  WRLPDGLPVSVLRGHTGAVTAIAFS  340



>ref|XP_011461754.1| PREDICTED: PH-interacting protein [Fragaria vesca subsp. vesca]
Length=1748

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAF+
Sbjct  311  WRLPDGLPISVLRGHTGAVTAIAFN  335



>dbj|BAB09913.1| WD-40 repeat protein-like [Arabidopsis thaliana]
Length=1576

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLP+SVLRGHTG VTAIAFS
Sbjct  314  WRLPDGLPVSVLRGHTGAVTAIAFS  338



>emb|CDX86234.1| BnaA06g29510D [Brassica napus]
Length=1680

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLP+SVLRGHTG VTAIAFS
Sbjct  316  WRLPDGLPVSVLRGHTGAVTAIAFS  340



>emb|CDX85409.1| BnaC07g27200D [Brassica napus]
Length=1685

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLP+SVLRGHTG VTAIAFS
Sbjct  317  WRLPDGLPVSVLRGHTGAVTAIAFS  341



>ref|XP_006279825.1| hypothetical protein CARUB_v10028149mg [Capsella rubella]
 gb|EOA12723.1| hypothetical protein CARUB_v10028149mg [Capsella rubella]
Length=1682

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLP+SVLRGHTG VTAIAFS
Sbjct  314  WRLPDGLPVSVLRGHTGAVTAIAFS  338



>ref|XP_009151300.1| PREDICTED: bromodomain and WD repeat-containing protein 1 [Brassica 
rapa]
 ref|XP_009151301.1| PREDICTED: bromodomain and WD repeat-containing protein 1 [Brassica 
rapa]
Length=1679

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLP+SVLRGHTG VTAIAFS
Sbjct  316  WRLPDGLPVSVLRGHTGAVTAIAFS  340



>ref|XP_006395063.1| hypothetical protein EUTSA_v10003509mg [Eutrema salsugineum]
 gb|ESQ32349.1| hypothetical protein EUTSA_v10003509mg [Eutrema salsugineum]
Length=1682

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLP+SVLRGHTG VTAIAFS
Sbjct  314  WRLPDGLPVSVLRGHTGAVTAIAFS  338



>ref|XP_010482217.1| PREDICTED: bromodomain and WD repeat-containing protein 1-like 
[Camelina sativa]
Length=1488

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  128  WRLPDGLPISVLRGHTGTVTAIAFS  152



>ref|NP_199754.2| WD40/YVTN repeat and Bromo-WDR9-I-like domain-containing protein 
[Arabidopsis thaliana]
 gb|AED95810.1| WD40/YVTN repeat and Bromo-WDR9-I-like domain-containing protein 
[Arabidopsis thaliana]
Length=1677

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLP+SVLRGHTG VTAIAFS
Sbjct  314  WRLPDGLPVSVLRGHTGAVTAIAFS  338



>ref|XP_010442408.1| PREDICTED: bromodomain and WD repeat-containing protein 1-like 
isoform X2 [Camelina sativa]
Length=1497

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  128  WRLPDGLPISVLRGHTGTVTAIAFS  152



>ref|XP_010318937.1| PREDICTED: bromodomain and WD repeat-containing protein 3 [Solanum 
lycopersicum]
 ref|XP_010318942.1| PREDICTED: bromodomain and WD repeat-containing protein 3 [Solanum 
lycopersicum]
 ref|XP_010318948.1| PREDICTED: bromodomain and WD repeat-containing protein 3 [Solanum 
lycopersicum]
Length=1697

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGH+G VTAIAFS
Sbjct  309  WRLPDGLPISVLRGHSGAVTAIAFS  333



>ref|XP_010440565.1| PREDICTED: bromodomain and WD repeat-containing protein 1-like 
[Camelina sativa]
Length=1681

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  314  WRLPDGLPISVLRGHTGTVTAIAFS  338



>ref|XP_002865733.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41992.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=1662

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLP+SVLRGHTG VTAIAFS
Sbjct  298  WRLPDGLPVSVLRGHTGAVTAIAFS  322



>ref|XP_004229396.2| PREDICTED: uncharacterized protein LOC101243927 [Solanum lycopersicum]
Length=2996

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  88   SIFQWRLPDGLPISVLRGHTGGVTAIAFS  2
            SI  WRLPDGLPISVLRGH G VTAIAF+
Sbjct  308  SIRVWRLPDGLPISVLRGHAGAVTAIAFT  336



>gb|EPS60483.1| hypothetical protein M569_14320, partial [Genlisea aurea]
Length=335

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -3

Query  85  IFQWRLPDGLPISVLRGHTGGVTAIAFS  2
           + QWRLPDG PISVLRGHTG VTAIAFS
Sbjct  4   LLQWRLPDGYPISVLRGHTGAVTAIAFS  31



>ref|XP_010442405.1| PREDICTED: bromodomain and WD repeat-containing protein 1-like 
isoform X1 [Camelina sativa]
 ref|XP_010442406.1| PREDICTED: bromodomain and WD repeat-containing protein 1-like 
isoform X1 [Camelina sativa]
Length=1683

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  314  WRLPDGLPISVLRGHTGTVTAIAFS  338



>ref|XP_006855278.1| hypothetical protein AMTR_s00057p00026390 [Amborella trichopoda]
 gb|ERN16745.1| hypothetical protein AMTR_s00057p00026390 [Amborella trichopoda]
Length=1844

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGHTG VTAIAFS
Sbjct  376  WRLPDGVPISVLRGHTGAVTAIAFS  400



>emb|CDY27490.1| BnaC04g51310D [Brassica napus]
Length=1041

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGHTG VTAIAFS
Sbjct  307  WRLPDGMPISVLRGHTGAVTAIAFS  331



>emb|CDP17076.1| unnamed protein product [Coffea canephora]
Length=1573

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  88   SIFQWRLPDGLPISVLRGHTGGVTAIAFS  2
            SI  WRLPDG PISVL+GHTG VTAIAFS
Sbjct  317  SIRVWRLPDGFPISVLQGHTGAVTAIAFS  345



>ref|XP_008355498.1| PREDICTED: bromodomain and WD repeat-containing protein 1-like 
[Malus domestica]
Length=1630

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  88   SIFQWRLPDGLPISVLRGHTGGVTAIAFS  2
            SI  WRLPDG PISVL+GHTG VTAIAFS
Sbjct  309  SIRVWRLPDGFPISVLQGHTGAVTAIAFS  337



>ref|XP_008369050.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
[Malus domestica]
Length=1631

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  88   SIFQWRLPDGLPISVLRGHTGGVTAIAFS  2
            SI  WRLPDG PISVL+GHTG VTAIAFS
Sbjct  310  SIRVWRLPDGFPISVLQGHTGAVTAIAFS  338



>ref|XP_009378715.1| PREDICTED: bromodomain and WD repeat-containing protein 1 isoform 
X2 [Pyrus x bretschneideri]
Length=1633

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  88   SIFQWRLPDGLPISVLRGHTGGVTAIAFS  2
            SI  WRLPDG PISVL+GHTG VTAIAFS
Sbjct  310  SIRVWRLPDGFPISVLQGHTGAVTAIAFS  338



>ref|XP_009339782.1| PREDICTED: PH-interacting protein-like isoform X2 [Pyrus x bretschneideri]
Length=1651

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  88   SIFQWRLPDGLPISVLRGHTGGVTAIAFS  2
            SI  WRLPDG PISVL+GHTG VTAIAFS
Sbjct  310  SIRVWRLPDGFPISVLQGHTGAVTAIAFS  338



>ref|XP_009378712.1| PREDICTED: bromodomain and WD repeat-containing protein 1 isoform 
X1 [Pyrus x bretschneideri]
Length=1663

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  88   SIFQWRLPDGLPISVLRGHTGGVTAIAFS  2
            SI  WRLPDG PISVL+GHTG VTAIAFS
Sbjct  310  SIRVWRLPDGFPISVLQGHTGAVTAIAFS  338



>ref|XP_009339781.1| PREDICTED: PH-interacting protein-like isoform X1 [Pyrus x bretschneideri]
Length=1681

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  88   SIFQWRLPDGLPISVLRGHTGGVTAIAFS  2
            SI  WRLPDG PISVL+GHTG VTAIAFS
Sbjct  310  SIRVWRLPDGFPISVLQGHTGAVTAIAFS  338



>ref|XP_008386783.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
[Malus domestica]
Length=1681

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  88   SIFQWRLPDGLPISVLRGHTGGVTAIAFS  2
            SI  WRLPDG PISVL+GHTG VTAIAFS
Sbjct  310  SIRVWRLPDGFPISVLQGHTGAVTAIAFS  338



>ref|XP_006419405.1| hypothetical protein CICLE_v10004131mg [Citrus clementina]
 gb|ESR32645.1| hypothetical protein CICLE_v10004131mg [Citrus clementina]
Length=1738

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHT  VTAIAFS
Sbjct  312  WRLPDGLPISVLRGHTAAVTAIAFS  336



>ref|XP_006419406.1| hypothetical protein CICLE_v10004131mg [Citrus clementina]
 gb|ESR32646.1| hypothetical protein CICLE_v10004131mg [Citrus clementina]
Length=1472

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHT  VTAIAFS
Sbjct  312  WRLPDGLPISVLRGHTAAVTAIAFS  336



>ref|XP_006488853.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
isoform X1 [Citrus sinensis]
Length=1784

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHT  VTAIAFS
Sbjct  339  WRLPDGLPISVLRGHTAAVTAIAFS  363



>ref|XP_006488854.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
isoform X2 [Citrus sinensis]
 ref|XP_006488855.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
isoform X3 [Citrus sinensis]
Length=1757

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHT  VTAIAFS
Sbjct  312  WRLPDGLPISVLRGHTAAVTAIAFS  336



>ref|XP_010094309.1| Bromodomain and WD repeat-containing protein 1 [Morus notabilis]
 gb|EXB55729.1| Bromodomain and WD repeat-containing protein 1 [Morus notabilis]
Length=1735

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG PISVLRGHTG VTAIAFS
Sbjct  313  WRLPDGQPISVLRGHTGAVTAIAFS  337



>ref|XP_010259313.1| PREDICTED: bromodomain and WD repeat-containing protein 1 [Nelumbo 
nucifera]
Length=1784

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+P+S LRGHTG VTAIAFS
Sbjct  315  WRLPDGMPVSTLRGHTGAVTAIAFS  339



>ref|XP_008223320.1| PREDICTED: PH-interacting protein [Prunus mume]
Length=1748

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/25 (88%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAI F+
Sbjct  311  WRLPDGLPISVLRGHTGAVTAITFN  335



>ref|XP_007221895.1| hypothetical protein PRUPE_ppa016106mg [Prunus persica]
 gb|EMJ23094.1| hypothetical protein PRUPE_ppa016106mg [Prunus persica]
Length=1748

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/25 (88%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAI F+
Sbjct  311  WRLPDGLPISVLRGHTGAVTAITFN  335



>ref|XP_010671679.1| PREDICTED: bromodomain and WD repeat-containing protein 1 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=1687

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG PISVLRGHTG VTAIAFS
Sbjct  311  WRLPDGQPISVLRGHTGAVTAIAFS  335



>ref|XP_010671678.1| PREDICTED: bromodomain and WD repeat-containing protein 1 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=1693

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG PISVLRGHTG VTAIAFS
Sbjct  317  WRLPDGQPISVLRGHTGAVTAIAFS  341



>ref|XP_010671680.1| PREDICTED: bromodomain and WD repeat-containing protein 1 isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=1629

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG PISVLRGHTG VTAIAFS
Sbjct  317  WRLPDGQPISVLRGHTGAVTAIAFS  341



>ref|XP_011041261.1| PREDICTED: bromodomain and WD repeat-containing protein 3 [Populus 
euphratica]
 ref|XP_011041269.1| PREDICTED: bromodomain and WD repeat-containing protein 3 [Populus 
euphratica]
 ref|XP_011041275.1| PREDICTED: bromodomain and WD repeat-containing protein 3 [Populus 
euphratica]
Length=1607

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  88   SIFQWRLPDGLPISVLRGHTGGVTAIAFS  2
            +I  WRLPDG+PISVL+GHTG VTAIAFS
Sbjct  306  AIRVWRLPDGMPISVLQGHTGAVTAIAFS  334



>gb|EYU46805.1| hypothetical protein MIMGU_mgv1a000149mg [Erythranthe guttata]
Length=1606

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  88   SIFQWRLPDGLPISVLRGHTGGVTAIAFS  2
            +I  WRLPDG PISVLRGHTG VTAIAF+
Sbjct  306  TIRVWRLPDGYPISVLRGHTGAVTAIAFT  334



>ref|XP_006375438.1| hypothetical protein POPTR_0014s11620g [Populus trichocarpa]
 gb|ERP53235.1| hypothetical protein POPTR_0014s11620g [Populus trichocarpa]
Length=1611

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVL+GHTG VTAIAFS
Sbjct  310  WRLPDGMPISVLQGHTGAVTAIAFS  334



>ref|XP_004172385.1| PREDICTED: bromodomain and WD repeat-containing protein 1-like 
[Cucumis sativus]
Length=344

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  311  WRLPDGLPISVLRGHTGAVTAIAFS  335



>ref|XP_002320301.2| hypothetical protein POPTR_0014s11620g [Populus trichocarpa]
 gb|EEE98616.2| hypothetical protein POPTR_0014s11620g [Populus trichocarpa]
Length=1472

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVL+GHTG VTAIAFS
Sbjct  171  WRLPDGMPISVLQGHTGAVTAIAFS  195



>emb|CAN66736.1| hypothetical protein VITISV_024187 [Vitis vinifera]
Length=434

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  312  WRLPDGLPISVLRGHTGAVTAIAFS  336



>ref|XP_010069859.1| PREDICTED: PH-interacting protein [Eucalyptus grandis]
Length=1675

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/25 (88%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG PISVLRGHTG VTAIAF+
Sbjct  314  WRLPDGFPISVLRGHTGAVTAIAFN  338



>gb|KCW58362.1| hypothetical protein EUGRSUZ_H01047 [Eucalyptus grandis]
Length=1826

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/25 (88%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG PISVLRGHTG VTAIAF+
Sbjct  488  WRLPDGFPISVLRGHTGAVTAIAFN  512



>ref|XP_007199598.1| hypothetical protein PRUPE_ppa023042mg [Prunus persica]
 gb|EMJ00797.1| hypothetical protein PRUPE_ppa023042mg [Prunus persica]
Length=1524

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  88   SIFQWRLPDGLPISVLRGHTGGVTAIAFS  2
            +I  WRLPDG PISVL+GHTG VTAIAFS
Sbjct  310  AIRVWRLPDGFPISVLQGHTGAVTAIAFS  338



>emb|CAN77503.1| hypothetical protein VITISV_017801 [Vitis vinifera]
Length=447

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  216  WRLPDGLPISVLRGHTGAVTAIAFS  240



>gb|KGN57161.1| hypothetical protein Csa_3G166260 [Cucumis sativus]
Length=671

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  314  WRLPDGLPISVLRGHTGAVTAIAFS  338



>ref|XP_008235203.1| PREDICTED: PH-interacting protein [Prunus mume]
Length=1647

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  88   SIFQWRLPDGLPISVLRGHTGGVTAIAFS  2
            +I  WRLPDG PISVL+GHTG VTAIAFS
Sbjct  310  AIRVWRLPDGFPISVLQGHTGAVTAIAFS  338



>gb|KDO87004.1| hypothetical protein CISIN_1g0488012mg, partial [Citrus sinensis]
Length=692

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHTG VTAIAFS
Sbjct  312  WRLPDGLPISVLRGHTGAVTAIAFS  336



>ref|XP_009129789.1| PREDICTED: bromodomain and WD repeat-containing protein 1-like 
isoform X3 [Brassica rapa]
Length=1447

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLP+SVLRGH G +TAIAFS
Sbjct  84   WRLPDGLPVSVLRGHIGAITAIAFS  108



>ref|XP_004984630.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
[Setaria italica]
Length=1707

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WR+PDG+P+SVL+GHTG VTAIAFS
Sbjct  310  WRMPDGMPVSVLKGHTGAVTAIAFS  334



>gb|ABF95528.1| expressed protein [Oryza sativa Japonica Group]
Length=1626

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WR+PDGLPISVL+GHTG VTAIAFS
Sbjct  233  WRIPDGLPISVLKGHTGVVTAIAFS  257



>ref|XP_009129788.1| PREDICTED: bromodomain and WD repeat-containing protein 1-like 
isoform X2 [Brassica rapa]
Length=1491

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLP+SVLRGH G +TAIAFS
Sbjct  128  WRLPDGLPVSVLRGHIGAITAIAFS  152



>ref|XP_008655652.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
isoform X5 [Zea mays]
Length=1681

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WR+PDG+P+SVL+GHTG VTAIAFS
Sbjct  310  WRMPDGMPVSVLKGHTGAVTAIAFS  334



>ref|XP_009129786.1| PREDICTED: bromodomain and WD repeat-containing protein 1-like 
isoform X1 [Brassica rapa]
Length=1674

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLP+SVLRGH G +TAIAFS
Sbjct  311  WRLPDGLPVSVLRGHIGAITAIAFS  335



>emb|CDY33904.1| BnaA02g30830D [Brassica napus]
Length=1674

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLP+SVLRGH G +TAIAFS
Sbjct  311  WRLPDGLPVSVLRGHIGAITAIAFS  335



>ref|XP_011465353.1| PREDICTED: bromodomain and WD repeat-containing protein 3 [Fragaria 
vesca subsp. vesca]
Length=1550

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/25 (88%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG PISVL+GHTG VTAIAFS
Sbjct  314  WRLPDGCPISVLQGHTGAVTAIAFS  338



>ref|XP_006649960.1| PREDICTED: bromodomain and WD repeat-containing protein 1-like 
[Oryza brachyantha]
Length=1696

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WR+PDGLPISVL+GHTG VTAIAFS
Sbjct  311  WRIPDGLPISVLKGHTGVVTAIAFS  335



>gb|AAM14817.1| hypothetical protein [Arabidopsis thaliana]
Length=544

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGHTG VTAIAFS
Sbjct  305  WRLPDGMPISVLRGHTGAVTAIAFS  329



>gb|EEE58913.1| hypothetical protein OsJ_10557 [Oryza sativa Japonica Group]
Length=1601

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WR+PDGLPISVL+GHTG VTAIAFS
Sbjct  233  WRIPDGLPISVLKGHTGVVTAIAFS  257



>emb|CDY05630.1| BnaC02g39070D [Brassica napus]
Length=1666

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLP+SVLRGH G +TAIAFS
Sbjct  311  WRLPDGLPVSVLRGHIGAITAIAFS  335



>gb|KJB09463.1| hypothetical protein B456_001G144100 [Gossypium raimondii]
Length=1690

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLP+SVLRGHT  VTAIAF+
Sbjct  300  WRLPDGLPVSVLRGHTAAVTAIAFN  324



>ref|XP_011010129.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
isoform X1 [Populus euphratica]
 ref|XP_011010136.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
isoform X1 [Populus euphratica]
Length=1713

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGH+  VTAIAFS
Sbjct  298  WRLPDGMPISVLRGHSAAVTAIAFS  322



>ref|XP_004495905.1| PREDICTED: PH-interacting protein-like [Cicer arietinum]
Length=1677

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/25 (84%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGHTG V  IAFS
Sbjct  313  WRLPDGMPISVLRGHTGAVNTIAFS  337



>ref|XP_006378533.1| hypothetical protein POPTR_0010s15260g [Populus trichocarpa]
 gb|ERP56330.1| hypothetical protein POPTR_0010s15260g [Populus trichocarpa]
Length=1700

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGH+  VTAIAFS
Sbjct  298  WRLPDGMPISVLRGHSAAVTAIAFS  322



>ref|XP_011010179.1| PREDICTED: bromodomain and WD repeat-containing protein 1-like 
isoform X2 [Populus euphratica]
Length=1710

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGH+  VTAIAFS
Sbjct  295  WRLPDGMPISVLRGHSAAVTAIAFS  319



>ref|XP_011010145.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
isoform X2 [Populus euphratica]
Length=1710

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGH+  VTAIAFS
Sbjct  295  WRLPDGMPISVLRGHSAAVTAIAFS  319



>ref|XP_011010162.1| PREDICTED: bromodomain and WD repeat-containing protein 1-like 
isoform X1 [Populus euphratica]
 ref|XP_011010171.1| PREDICTED: bromodomain and WD repeat-containing protein 1-like 
isoform X1 [Populus euphratica]
Length=1713

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGH+  VTAIAFS
Sbjct  298  WRLPDGMPISVLRGHSAAVTAIAFS  322



>ref|XP_008655651.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
isoform X4 [Zea mays]
Length=1773

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WR+PDG+P+SVL+GHTG VTAIAFS
Sbjct  402  WRMPDGMPVSVLKGHTGAVTAIAFS  426



>ref|XP_011079558.1| PREDICTED: bromodomain and WD repeat-containing protein 3 isoform 
X1 [Sesamum indicum]
Length=1665

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  88   SIFQWRLPDGLPISVLRGHTGGVTAIAFS  2
            +I  WRLPDG PISVLRGH+G VTAIAF+
Sbjct  309  TIRVWRLPDGYPISVLRGHSGAVTAIAFN  337



>ref|XP_008655650.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
isoform X3 [Zea mays]
Length=1774

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WR+PDG+P+SVL+GHTG VTAIAFS
Sbjct  403  WRMPDGMPVSVLKGHTGAVTAIAFS  427



>ref|XP_008655649.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
isoform X2 [Zea mays]
Length=1809

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WR+PDG+P+SVL+GHTG VTAIAFS
Sbjct  438  WRMPDGMPVSVLKGHTGAVTAIAFS  462



>ref|XP_008655648.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
isoform X1 [Zea mays]
Length=1810

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WR+PDG+P+SVL+GHTG VTAIAFS
Sbjct  439  WRMPDGMPVSVLKGHTGAVTAIAFS  463



>ref|XP_010679369.1| PREDICTED: bromodomain and WD repeat-containing protein 1 [Beta 
vulgaris subsp. vulgaris]
Length=1586

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/25 (84%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPIS+L+GH+G VTAIAFS
Sbjct  333  WRLPDGLPISILQGHSGTVTAIAFS  357



>ref|XP_011081888.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
[Sesamum indicum]
Length=348

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  88   SIFQWRLPDGLPISVLRGHTGGVTAIAFS  2
            +I  WRLPDG PISVLRGH+G VTAIAF+
Sbjct  309  TIRVWRLPDGYPISVLRGHSGAVTAIAFN  337



>ref|XP_008345232.1| PREDICTED: PH-interacting protein-like [Malus domestica]
Length=369

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  88  SIFQWRLPDGLPISVLRGHTGGVTAIAFS  2
           SI  WRLPDG PISVL+GHTG VTAIAFS
Sbjct  37  SIRVWRLPDGFPISVLQGHTGAVTAIAFS  65



>emb|CDP10045.1| unnamed protein product [Coffea canephora]
Length=725

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  88   SIFQWRLPDGLPISVLRGHTGGVTAIAFS  2
            SI  WRLPDG PISVL+GHTG VTAIAFS
Sbjct  294  SIRVWRLPDGFPISVLQGHTGAVTAIAFS  322



>ref|XP_009763234.1| PREDICTED: PH-interacting protein [Nicotiana sylvestris]
 ref|XP_009763235.1| PREDICTED: PH-interacting protein [Nicotiana sylvestris]
 ref|XP_009763236.1| PREDICTED: PH-interacting protein [Nicotiana sylvestris]
Length=1699

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/25 (88%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRL DGLPISVLRGHTG VTAIAF+
Sbjct  309  WRLADGLPISVLRGHTGAVTAIAFN  333



>ref|XP_009626318.1| PREDICTED: PH-interacting protein-like [Nicotiana tomentosiformis]
 ref|XP_009626319.1| PREDICTED: PH-interacting protein-like [Nicotiana tomentosiformis]
 ref|XP_009626320.1| PREDICTED: PH-interacting protein-like [Nicotiana tomentosiformis]
Length=1699

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/25 (88%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRL DGLPISVLRGHTG VTAIAF+
Sbjct  309  WRLADGLPISVLRGHTGAVTAIAFN  333



>ref|XP_010024785.1| PREDICTED: PH-interacting protein [Eucalyptus grandis]
 ref|XP_010024786.1| PREDICTED: PH-interacting protein [Eucalyptus grandis]
 gb|KCW61278.1| hypothetical protein EUGRSUZ_H04037 [Eucalyptus grandis]
Length=1738

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/25 (88%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRL DGLPISVLRGHTG VTAI FS
Sbjct  308  WRLADGLPISVLRGHTGAVTAITFS  332



>gb|KDO71898.1| hypothetical protein CISIN_1g0002511mg, partial [Citrus sinensis]
 gb|KDO71899.1| hypothetical protein CISIN_1g0002511mg, partial [Citrus sinensis]
 gb|KDO71900.1| hypothetical protein CISIN_1g0002511mg, partial [Citrus sinensis]
 gb|KDO71901.1| hypothetical protein CISIN_1g0002511mg, partial [Citrus sinensis]
Length=584

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHT  VTAIAFS
Sbjct  312  WRLPDGLPISVLRGHTAAVTAIAFS  336



>gb|KJB34708.1| hypothetical protein B456_006G079300 [Gossypium raimondii]
 gb|KJB34709.1| hypothetical protein B456_006G079300 [Gossypium raimondii]
 gb|KJB34710.1| hypothetical protein B456_006G079300 [Gossypium raimondii]
Length=1727

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/25 (88%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            W LPDG PISVLRGHTG VTAIAFS
Sbjct  310  WHLPDGQPISVLRGHTGAVTAIAFS  334



>gb|KJB34712.1| hypothetical protein B456_006G079300 [Gossypium raimondii]
Length=1545

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 22/25 (88%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            W LPDG PISVLRGHTG VTAIAFS
Sbjct  128  WHLPDGQPISVLRGHTGAVTAIAFS  152



>gb|EMS58000.1| PH-interacting protein [Triticum urartu]
Length=1870

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/25 (84%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WR+PDG+PISVL+GHTG VTAIAFS
Sbjct  427  WRIPDGMPISVLKGHTGVVTAIAFS  451



>gb|KDO71897.1| hypothetical protein CISIN_1g0002511mg, partial [Citrus sinensis]
Length=611

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHT  VTAIAFS
Sbjct  339  WRLPDGLPISVLRGHTAAVTAIAFS  363



>ref|XP_009369942.1| PREDICTED: bromodomain and WD repeat-containing protein 1 [Pyrus 
x bretschneideri]
Length=1729

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/25 (84%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHT  VTAI F+
Sbjct  314  WRLPDGLPISVLRGHTAAVTAITFN  338



>ref|XP_011020211.1| PREDICTED: bromodomain and WD repeat-containing protein 1-like 
[Populus euphratica]
 ref|XP_011020219.1| PREDICTED: bromodomain and WD repeat-containing protein 1-like 
[Populus euphratica]
 ref|XP_011020228.1| PREDICTED: bromodomain and WD repeat-containing protein 1-like 
[Populus euphratica]
 ref|XP_011020235.1| PREDICTED: bromodomain and WD repeat-containing protein 1-like 
[Populus euphratica]
Length=1725

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGH+  VT+IAFS
Sbjct  311  WRLPDGMPISVLRGHSAAVTSIAFS  335



>gb|KJB34713.1| hypothetical protein B456_006G079300 [Gossypium raimondii]
Length=1645

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 22/25 (88%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            W LPDG PISVLRGHTG VTAIAFS
Sbjct  310  WHLPDGQPISVLRGHTGAVTAIAFS  334



>ref|XP_008340614.1| PREDICTED: bromodomain and WD repeat-containing protein 1 [Malus 
domestica]
Length=1729

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/25 (84%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDGLPISVLRGHT  VTAI F+
Sbjct  316  WRLPDGLPISVLRGHTAAVTAITFN  340



>gb|KHG03709.1| Bromodomain and WD repeat-containing 3 [Gossypium arboreum]
Length=1784

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 22/25 (88%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            W LPDG PISVLRGHTG VTAIAFS
Sbjct  350  WHLPDGQPISVLRGHTGAVTAIAFS  374



>gb|EMT04324.1| hypothetical protein F775_06469 [Aegilops tauschii]
Length=1899

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 21/25 (84%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WR+PDG+PISVL+GHTG VTAIAFS
Sbjct  475  WRIPDGMPISVLKGHTGVVTAIAFS  499



>ref|XP_006574534.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
isoform X4 [Glycine max]
Length=1439

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 20/25 (80%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGHTG V  I FS
Sbjct  313  WRLPDGMPISVLRGHTGAVNTITFS  337



>ref|XP_006574533.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
isoform X3 [Glycine max]
Length=1445

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 20/25 (80%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGHTG V  I FS
Sbjct  313  WRLPDGMPISVLRGHTGAVNTITFS  337



>ref|XP_006588574.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
isoform X5 [Glycine max]
Length=1510

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 20/25 (80%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGHTG V  I FS
Sbjct  128  WRLPDGMPISVLRGHTGAVNTITFS  152



>gb|KHN30643.1| PH-interacting protein [Glycine soja]
Length=1683

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/25 (80%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGHTG V  I FS
Sbjct  312  WRLPDGMPISVLRGHTGAVNTITFS  336



>ref|XP_006588573.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
isoform X4 [Glycine max]
Length=1683

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/25 (80%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGHTG V  I FS
Sbjct  312  WRLPDGMPISVLRGHTGAVNTITFS  336



>ref|XP_006588572.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
isoform X3 [Glycine max]
Length=1693

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/25 (80%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGHTG V  I FS
Sbjct  312  WRLPDGMPISVLRGHTGAVNTITFS  336



>ref|XP_006588570.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
isoform X1 [Glycine max]
 ref|XP_006588571.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
isoform X2 [Glycine max]
Length=1694

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/25 (80%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGHTG V  I FS
Sbjct  312  WRLPDGMPISVLRGHTGAVNTITFS  336



>ref|XP_006574532.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
isoform X2 [Glycine max]
Length=1707

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/25 (80%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGHTG V  I FS
Sbjct  313  WRLPDGMPISVLRGHTGAVNTITFS  337



>ref|XP_006574531.1| PREDICTED: bromodomain and WD repeat-containing protein 3-like 
isoform X1 [Glycine max]
 gb|KHN08641.1| Bromodomain and WD repeat-containing protein 1 [Glycine soja]
Length=1708

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/25 (80%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGHTG V  I FS
Sbjct  313  WRLPDGMPISVLRGHTGAVNTITFS  337



>ref|XP_009383930.1| PREDICTED: PH-interacting protein-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009383931.1| PREDICTED: PH-interacting protein-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009383932.1| PREDICTED: PH-interacting protein-like [Musa acuminata subsp. 
malaccensis]
Length=1778

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/25 (84%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG PISVL+GH G VTAIAFS
Sbjct  312  WRLPDGHPISVLKGHAGAVTAIAFS  336



>ref|XP_010087245.1| PH-interacting protein [Morus notabilis]
 gb|EXB28595.1| PH-interacting protein [Morus notabilis]
Length=1727

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRL DG+P+SVL+GHTG VTAIAFS
Sbjct  317  WRLADGMPVSVLQGHTGAVTAIAFS  341



>ref|XP_002457298.1| hypothetical protein SORBIDRAFT_03g005130 [Sorghum bicolor]
 gb|EES02418.1| hypothetical protein SORBIDRAFT_03g005130 [Sorghum bicolor]
Length=712

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WR+PDG+P+SVL+GHTG VTAIAFS
Sbjct  310  WRMPDGMPVSVLKGHTGAVTAIAFS  334



>ref|XP_002311385.2| hypothetical protein POPTR_0008s106302g, partial [Populus trichocarpa]
 gb|EEE88752.2| hypothetical protein POPTR_0008s106302g, partial [Populus trichocarpa]
Length=899

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WRLPDG+PISVLRGH+  VT+IAFS
Sbjct  311  WRLPDGMPISVLRGHSAAVTSIAFS  335



>ref|XP_010240435.1| PREDICTED: bromodomain and WD repeat-containing DDB_G0285837-like 
[Brachypodium distachyon]
Length=1696

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/25 (76%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WR+PDG+P++VL+GHTG VTAIAFS
Sbjct  312  WRIPDGMPVAVLKGHTGVVTAIAFS  336



>gb|EEC75085.1| hypothetical protein OsI_11234 [Oryza sativa Indica Group]
Length=763

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WR+PDGLPISVL+GHTG VTAIAFS
Sbjct  233  WRIPDGLPISVLKGHTGVVTAIAFS  257



>gb|EPS73773.1| hypothetical protein M569_00983, partial [Genlisea aurea]
Length=704

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  76   WRLPDGLPISVLRGHTGGVTAIAFS  2
            WR+PDGLPISVLRGH+  VTAIAFS
Sbjct  311  WRMPDGLPISVLRGHSAAVTAIAFS  335



>ref|XP_009384423.1| PREDICTED: bromodomain and WD repeat-containing protein 1-like 
[Musa acuminata subsp. malaccensis]
Length=1760

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/30 (73%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -3

Query  91   SSIFQWRLPDGLPISVLRGHTGGVTAIAFS  2
            S I  W LPDG PISVL+GHTG VTA+AFS
Sbjct  310  SIIRVWHLPDGHPISVLKGHTGAVTALAFS  339



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552569507840