BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP007G07 661 bp,

Length=621
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009769831.1|  PREDICTED: BI1-like protein                        232   1e-72   Nicotiana sylvestris
ref|XP_009609402.1|  PREDICTED: BI1-like protein                        232   1e-72   Nicotiana tomentosiformis
ref|XP_006339425.1|  PREDICTED: BI1-like protein-like                   232   1e-72   Solanum tuberosum [potatoes]
ref|XP_004229465.1|  PREDICTED: BI1-like protein                        229   9e-72   Solanum lycopersicum
gb|EYU43851.1|  hypothetical protein MIMGU_mgv1a011019mg                215   2e-65   Erythranthe guttata [common monkey flower]
ref|XP_002279368.2|  PREDICTED: BI1-like protein                        209   1e-63   Vitis vinifera
ref|XP_006419766.1|  hypothetical protein CICLE_v10005717mg             207   4e-63   Citrus clementina
ref|XP_006489229.1|  PREDICTED: BI1-like protein-like                   207   5e-63   Citrus sinensis [Valencia orange]
emb|CDO98965.1|  unnamed protein product                                203   3e-61   Coffea canephora [robusta coffee]
ref|XP_008223040.1|  PREDICTED: BI1-like protein                        202   8e-61   Prunus mume [ume]
ref|XP_010024447.1|  PREDICTED: BI1-like protein                        199   6e-60   Eucalyptus grandis [rose gum]
ref|XP_010105697.1|  hypothetical protein L484_011309                   199   7e-60   Morus notabilis
ref|XP_007223728.1|  hypothetical protein PRUPE_ppa010433mg             199   8e-60   Prunus persica
gb|KHG22240.1|  hypothetical protein F383_06527                         199   8e-60   Gossypium arboreum [tree cotton]
ref|XP_007035358.1|  Bax inhibitor-1 family protein isoform 2           198   2e-59   Theobroma cacao [chocolate]
ref|XP_008390802.1|  PREDICTED: BI1-like protein                        198   2e-59   Malus domestica [apple tree]
ref|XP_011090832.1|  PREDICTED: BI1-like protein                        197   6e-59   Sesamum indicum [beniseed]
ref|XP_009352144.1|  PREDICTED: BI1-like protein                        197   6e-59   Pyrus x bretschneideri [bai li]
ref|XP_009339935.1|  PREDICTED: BI1-like protein                        196   1e-58   Pyrus x bretschneideri [bai li]
ref|XP_010279039.1|  PREDICTED: BI1-like protein                        196   2e-58   Nelumbo nucifera [Indian lotus]
gb|KHG20306.1|  hypothetical protein F383_02282                         195   2e-58   Gossypium arboreum [tree cotton]
ref|XP_010693836.1|  PREDICTED: BI1-like protein                        195   2e-58   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009624081.1|  PREDICTED: BI1-like protein                        195   3e-58   Nicotiana tomentosiformis
ref|XP_008340894.1|  PREDICTED: BI1-like protein                        195   4e-58   Malus domestica [apple tree]
ref|XP_009785292.1|  PREDICTED: BI1-like protein                        193   2e-57   Nicotiana sylvestris
ref|XP_007035357.1|  Bax inhibitor-1 family protein isoform 1           193   2e-57   Theobroma cacao [chocolate]
ref|XP_004144961.1|  PREDICTED: BI1-like protein-like                   192   3e-57   
ref|XP_004297019.1|  PREDICTED: BI1-like protein                        192   3e-57   Fragaria vesca subsp. vesca
gb|KJB74487.1|  hypothetical protein B456_011G181100                    191   2e-56   Gossypium raimondii
gb|EPS68151.1|  hypothetical protein M569_06622                         190   2e-56   Genlisea aurea
ref|XP_010524498.1|  PREDICTED: BI1-like protein                        189   5e-56   Tarenaya hassleriana [spider flower]
ref|XP_009419853.1|  PREDICTED: BI1-like protein                        189   9e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002312729.1|  hypothetical protein POPTR_0008s20370g             188   1e-55   Populus trichocarpa [western balsam poplar]
ref|XP_002516809.1|  Transmembrane BAX inhibitor motif-containing...    187   1e-55   
ref|XP_009414206.1|  PREDICTED: BI1-like protein                        187   2e-55   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP40073.1|  hypothetical protein JCGZ_02071                         187   2e-55   Jatropha curcas
ref|XP_011006595.1|  PREDICTED: BI1-like protein                        187   3e-55   Populus euphratica
gb|KJB34591.1|  hypothetical protein B456_006G074200                    197   6e-55   Gossypium raimondii
ref|XP_002314428.1|  hypothetical protein POPTR_0010s02990g             186   7e-55   Populus trichocarpa [western balsam poplar]
emb|CDX90589.1|  BnaA03g41920D                                          186   9e-55   Brassica napus [oilseed rape]
ref|XP_008809232.1|  PREDICTED: BI1-like protein                        186   9e-55   Phoenix dactylifera
emb|CDY09066.1|  BnaC08g10200D                                          186   1e-54   Brassica napus [oilseed rape]
ref|XP_011006069.1|  PREDICTED: BI1-like protein                        185   2e-54   Populus euphratica
ref|XP_008776713.1|  PREDICTED: BI1-like protein                        185   3e-54   Phoenix dactylifera
gb|KHG16370.1|  hypothetical protein F383_22614                         184   9e-54   Gossypium arboreum [tree cotton]
ref|XP_002870236.1|  hypothetical protein ARALYDRAFT_493344             184   1e-53   Arabidopsis lyrata subsp. lyrata
ref|XP_003546118.1|  PREDICTED: BI1-like protein-like                   183   1e-53   Glycine max [soybeans]
ref|NP_001237753.1|  uncharacterized protein LOC100499906               183   2e-53   Glycine max [soybeans]
ref|XP_009107842.1|  PREDICTED: BI1-like protein                        183   2e-53   Brassica rapa
gb|KHN37547.1|  BI1-like protein                                        182   2e-53   Glycine soja [wild soybean]
ref|XP_006850841.1|  hypothetical protein AMTR_s00025p00133870          182   2e-53   Amborella trichopoda
emb|CDY09761.1|  BnaC07g33000D                                          182   2e-53   Brassica napus [oilseed rape]
gb|AAL07001.1|  AT4g15470/dl3775w                                       181   3e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567466.1|  Bax inhibitor-1 like protein                          182   3e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010548892.1|  PREDICTED: BI1-like protein                        182   4e-53   Tarenaya hassleriana [spider flower]
ref|XP_009136696.1|  PREDICTED: BI1-like protein                        182   4e-53   Brassica rapa
emb|CDY22739.1|  BnaA08g05690D                                          182   4e-53   Brassica napus [oilseed rape]
ref|XP_010551036.1|  PREDICTED: BI1-like protein                        182   5e-53   Tarenaya hassleriana [spider flower]
ref|XP_010905739.1|  PREDICTED: BI1-like protein                        181   8e-53   Elaeis guineensis
ref|XP_006284243.1|  hypothetical protein CARUB_v10005406mg             182   1e-52   Capsella rubella
gb|AFK46458.1|  unknown                                                 181   1e-52   Medicago truncatula
ref|XP_010938798.1|  PREDICTED: BI1-like protein                        181   1e-52   Elaeis guineensis
ref|XP_006414507.1|  hypothetical protein EUTSA_v10026042mg             181   2e-52   Eutrema salsugineum
ref|XP_010440304.1|  PREDICTED: BI1-like protein                        181   2e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010434979.1|  PREDICTED: BI1-like protein                        180   2e-52   Camelina sativa [gold-of-pleasure]
ref|XP_007147817.1|  hypothetical protein PHAVU_006G157400g             180   2e-52   Phaseolus vulgaris [French bean]
gb|KFK22627.1|  hypothetical protein AALP_AAs50448U000500               180   3e-52   Arabis alpina [alpine rockcress]
gb|ACU19337.1|  unknown                                                 179   3e-52   Glycine max [soybeans]
ref|XP_010434338.1|  PREDICTED: BI1-like protein                        178   1e-51   Camelina sativa [gold-of-pleasure]
ref|XP_004486099.1|  PREDICTED: BI1-like protein-like                   178   2e-51   Cicer arietinum [garbanzo]
gb|KJB28559.1|  hypothetical protein B456_005G055600                    177   2e-51   Gossypium raimondii
ref|XP_006353796.1|  PREDICTED: BI1-like protein-like                   171   8e-49   Solanum tuberosum [potatoes]
ref|XP_003594082.1|  Transmembrane BAX inhibitor motif-containing...    171   1e-48   
gb|KJB74488.1|  hypothetical protein B456_011G181100                    167   1e-47   Gossypium raimondii
ref|XP_009402474.1|  PREDICTED: BI1-like protein                        162   2e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004243681.1|  PREDICTED: BI1-like protein                        161   3e-45   Solanum lycopersicum
ref|XP_003568491.1|  PREDICTED: BI1-like protein                        162   6e-45   Brachypodium distachyon [annual false brome]
ref|NP_001055493.1|  Os05g0402300                                       160   1e-44   
ref|XP_006654376.1|  PREDICTED: BI1-like protein-like                   160   2e-44   Oryza brachyantha
ref|XP_004962144.1|  PREDICTED: BI1-like protein-like                   157   2e-43   Setaria italica
ref|NP_001149877.1|  transmembrane BAX inhibitor motif-containing...    157   3e-43   Zea mays [maize]
gb|EMS67433.1|  hypothetical protein TRIUR3_20458                       156   5e-43   Triticum urartu
ref|NP_001149641.1|  transmembrane BAX inhibitor motif-containing...    153   6e-42   
gb|ACG33127.1|  transmembrane BAX inhibitor motif-containing prot...    153   7e-42   Zea mays [maize]
gb|ABK25077.1|  unknown                                                 145   6e-39   Picea sitchensis
ref|XP_001768622.1|  predicted protein                                  144   3e-38   Physcomitrella patens
ref|XP_002975127.1|  hypothetical protein SELMODRAFT_150230             143   3e-38   Selaginella moellendorffii
ref|XP_001757037.1|  predicted protein                                  141   2e-37   Physcomitrella patens
ref|XP_002992613.1|  hypothetical protein SELMODRAFT_430816             138   4e-36   Selaginella moellendorffii
ref|XP_002968030.1|  hypothetical protein SELMODRAFT_88443              138   4e-36   Selaginella moellendorffii
emb|CAI53895.2|  putative receptor associated protein                   136   2e-35   Capsicum chinense [Scotch bonnet]
gb|AFW77940.1|  hypothetical protein ZEAMMB73_292541                    135   3e-35   Zea mays [maize]
ref|XP_006349714.1|  PREDICTED: BI1-like protein-like                   135   3e-35   
ref|XP_010326401.1|  PREDICTED: BI1-like protein                        135   3e-35   Solanum lycopersicum
gb|AIT42146.1|  Bax inhibitor-like protein                              135   4e-35   Solanum tuberosum [potatoes]
ref|XP_008786054.1|  PREDICTED: BI1-like protein                        135   5e-35   Phoenix dactylifera
ref|XP_004290629.1|  PREDICTED: BI1-like protein                        134   9e-35   Fragaria vesca subsp. vesca
ref|XP_001768467.1|  predicted protein                                  134   1e-34   Physcomitrella patens
ref|XP_010923520.1|  PREDICTED: BI1-like protein                        134   1e-34   
gb|KFK35489.1|  hypothetical protein AALP_AA5G291100                    134   1e-34   Arabis alpina [alpine rockcress]
ref|XP_009618293.1|  PREDICTED: BI1-like protein                        133   2e-34   Nicotiana tomentosiformis
ref|XP_009789970.1|  PREDICTED: BI1-like protein                        133   2e-34   Nicotiana sylvestris
ref|XP_006303615.1|  hypothetical protein CARUB_v10011301mg             133   3e-34   Capsella rubella
ref|XP_006352761.1|  PREDICTED: BI1-like protein-like                   132   4e-34   Solanum tuberosum [potatoes]
ref|XP_004242346.2|  PREDICTED: BI1-like protein                        132   7e-34   Solanum lycopersicum
ref|XP_010457316.1|  PREDICTED: BI1-like protein                        132   7e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010481523.1|  PREDICTED: BI1-like protein                        132   7e-34   Camelina sativa [gold-of-pleasure]
ref|XP_009119572.1|  PREDICTED: BI1-like protein                        131   1e-33   Brassica rapa
ref|XP_002889434.1|  glutamate binding protein                          131   1e-33   Arabidopsis lyrata subsp. lyrata
emb|CDX89914.1|  BnaA10g01680D                                          131   1e-33   Brassica napus [oilseed rape]
ref|NP_171806.1|  protein lifeguard 4                                   131   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006402289.1|  hypothetical protein EUTSA_v10006212mg             131   1e-33   Eutrema salsugineum
ref|XP_007200360.1|  hypothetical protein PRUPE_ppa010573mg             131   1e-33   Prunus persica
ref|XP_010474912.1|  PREDICTED: BI1-like protein                        130   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010474910.1|  PREDICTED: BI1-like protein                        130   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_009398556.1|  PREDICTED: BI1-like protein                        130   3e-33   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY18147.1|  BnaC05g01700D                                          130   3e-33   Brassica napus [oilseed rape]
ref|XP_006418268.1|  hypothetical protein EUTSA_v10008600mg             130   4e-33   Eutrema salsugineum
ref|XP_002463744.1|  hypothetical protein SORBIDRAFT_01g005260          129   8e-33   Sorghum bicolor [broomcorn]
ref|XP_010256169.1|  PREDICTED: BI1-like protein                        129   9e-33   Nelumbo nucifera [Indian lotus]
gb|KFK42668.1|  hypothetical protein AALP_AA1G024300                    129   9e-33   Arabis alpina [alpine rockcress]
gb|KCW60898.1|  hypothetical protein EUGRSUZ_H03636                     130   9e-33   Eucalyptus grandis [rose gum]
ref|XP_004981439.1|  PREDICTED: BI1-like protein-like                   129   1e-32   Setaria italica
ref|XP_008235367.1|  PREDICTED: BI1-like protein                        129   1e-32   Prunus mume [ume]
gb|ACG32419.1|  transmembrane BAX inhibitor motif-containing prot...    128   1e-32   Zea mays [maize]
ref|XP_010545100.1|  PREDICTED: BI1-like protein                        128   1e-32   Tarenaya hassleriana [spider flower]
gb|KDP21410.1|  hypothetical protein JCGZ_21881                         128   2e-32   Jatropha curcas
ref|XP_009804930.1|  PREDICTED: BI1-like protein                        128   2e-32   Nicotiana sylvestris
ref|XP_010259137.1|  PREDICTED: BI1-like protein                        127   3e-32   Nelumbo nucifera [Indian lotus]
emb|CDP03667.1|  unnamed protein product                                127   3e-32   Coffea canephora [robusta coffee]
ref|NP_001149171.1|  transmembrane BAX inhibitor motif-containing...    127   3e-32   Zea mays [maize]
ref|XP_011082582.1|  PREDICTED: BI1-like protein                        127   4e-32   Sesamum indicum [beniseed]
emb|CDX93913.1|  BnaC04g20720D                                          127   6e-32   Brassica napus [oilseed rape]
ref|XP_010556773.1|  PREDICTED: BI1-like protein                        126   8e-32   Tarenaya hassleriana [spider flower]
emb|CDY53716.1|  BnaAnng12570D                                          126   8e-32   Brassica napus [oilseed rape]
ref|XP_003632329.1|  PREDICTED: BI1-like protein                        126   9e-32   Vitis vinifera
ref|XP_010070336.1|  PREDICTED: BI1-like protein                        126   9e-32   Eucalyptus grandis [rose gum]
ref|XP_010038064.1|  PREDICTED: BI1-like protein                        126   9e-32   Eucalyptus grandis [rose gum]
ref|XP_003553470.1|  PREDICTED: BI1-like protein-like isoform X1        126   1e-31   Glycine max [soybeans]
gb|EYU46520.1|  hypothetical protein MIMGU_mgv11b010581mg               126   1e-31   Erythranthe guttata [common monkey flower]
ref|NP_192178.1|  BAX inhibitor-1 motif-containing protein              126   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001149807.1|  transmembrane BAX inhibitor motif-containing...    125   2e-31   Zea mays [maize]
ref|XP_004495172.1|  PREDICTED: BI1-like protein-like                   125   2e-31   Cicer arietinum [garbanzo]
ref|XP_009144548.1|  PREDICTED: BI1-like protein                        125   2e-31   Brassica rapa
ref|XP_010092433.1|  hypothetical protein L484_009115                   125   2e-31   Morus notabilis
emb|CDX91308.1|  BnaC02g27190D                                          125   2e-31   Brassica napus [oilseed rape]
gb|EMS49504.1|  hypothetical protein TRIUR3_04678                       124   3e-31   Triticum urartu
emb|CDX97282.1|  BnaA02g20730D                                          125   3e-31   Brassica napus [oilseed rape]
ref|XP_006396483.1|  hypothetical protein EUTSA_v10028915mg             125   3e-31   Eutrema salsugineum
ref|XP_006292690.1|  hypothetical protein CARUB_v10018936mg             125   3e-31   Capsella rubella
gb|EYU40897.1|  hypothetical protein MIMGU_mgv1a012728mg                124   4e-31   Erythranthe guttata [common monkey flower]
ref|XP_006443997.1|  hypothetical protein CICLE_v10021936mg             124   4e-31   Citrus clementina
ref|XP_010679114.1|  PREDICTED: BI1-like protein                        124   4e-31   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_002283304.2|  PREDICTED: BI1-like protein                        124   5e-31   Vitis vinifera
gb|KJB22579.1|  hypothetical protein B456_004G056000                    124   6e-31   Gossypium raimondii
ref|XP_002307607.1|  hypothetical protein POPTR_0005s23570g             124   6e-31   Populus trichocarpa [western balsam poplar]
ref|XP_003557479.1|  PREDICTED: BI1-like protein                        124   6e-31   Brachypodium distachyon [annual false brome]
gb|KJB34592.1|  hypothetical protein B456_006G074200                    129   8e-31   Gossypium raimondii
ref|XP_009601840.1|  PREDICTED: BI1-like protein isoform X1             124   1e-30   Nicotiana tomentosiformis
gb|EPS72667.1|  hypothetical protein M569_02091                         123   1e-30   Genlisea aurea
ref|XP_009138661.1|  PREDICTED: BI1-like protein                        123   1e-30   Brassica rapa
ref|XP_010695291.1|  PREDICTED: BI1-like protein                        123   1e-30   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_002878509.1|  glutamate binding protein                          123   1e-30   Arabidopsis lyrata subsp. lyrata
ref|XP_002874901.1|  glutamate binding protein                          123   1e-30   Arabidopsis lyrata subsp. lyrata
ref|NP_191890.1|  BRZ-INSENSITIVE-LONG HYPOCOTYLS 4                     123   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002524726.1|  Transmembrane BAX inhibitor motif-containing...    123   1e-30   Ricinus communis
ref|XP_010512744.1|  PREDICTED: BI1-like protein                        122   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_002300819.1|  hypothetical protein POPTR_0002s04980g             122   2e-30   Populus trichocarpa [western balsam poplar]
ref|XP_011032646.1|  PREDICTED: BI1-like protein                        122   2e-30   Populus euphratica
ref|NP_001059026.1|  Os07g0177300                                       122   2e-30   
ref|XP_002312548.2|  hypothetical protein POPTR_0008s15690g             121   2e-30   Populus trichocarpa [western balsam poplar]
ref|XP_007050515.1|  Bax inhibitor-1 family protein                     122   3e-30   Theobroma cacao [chocolate]
ref|XP_010422556.1|  PREDICTED: BI1-like protein                        122   3e-30   Camelina sativa [gold-of-pleasure]
emb|CDM85340.1|  unnamed protein product                                122   3e-30   Triticum aestivum [Canadian hard winter wheat]
gb|AFK43813.1|  unknown                                                 121   3e-30   Medicago truncatula
ref|XP_006288281.1|  hypothetical protein CARUB_v10001524mg             124   3e-30   Capsella rubella
ref|XP_010026938.1|  PREDICTED: BI1-like protein                        122   4e-30   Eucalyptus grandis [rose gum]
gb|KHG09280.1|  hypothetical protein F383_07618                         122   4e-30   Gossypium arboreum [tree cotton]
ref|XP_011079906.1|  PREDICTED: BI1-like protein                        122   4e-30   Sesamum indicum [beniseed]
gb|KFK30873.1|  hypothetical protein AALP_AA6G036900                    122   4e-30   Arabis alpina [alpine rockcress]
ref|XP_003590585.1|  BI1-like protein                                   122   5e-30   Medicago truncatula
ref|XP_003559738.1|  PREDICTED: BI1-like protein                        122   5e-30   Brachypodium distachyon [annual false brome]
ref|XP_006657498.1|  PREDICTED: BI1-like protein-like                   122   6e-30   Oryza brachyantha
ref|XP_007144660.1|  hypothetical protein PHAVU_007G174500g             121   6e-30   Phaseolus vulgaris [French bean]
ref|XP_010932816.1|  PREDICTED: BI1-like protein                        121   6e-30   Elaeis guineensis
ref|XP_009367582.1|  PREDICTED: BI1-like protein                        121   6e-30   Pyrus x bretschneideri [bai li]
emb|CBI28738.3|  unnamed protein product                                121   6e-30   Vitis vinifera
ref|XP_004145423.1|  PREDICTED: BI1-like protein-like                   121   7e-30   Cucumis sativus [cucumbers]
ref|XP_010455996.1|  PREDICTED: BI1-like protein                        121   7e-30   Camelina sativa [gold-of-pleasure]
ref|XP_011026112.1|  PREDICTED: BI1-like protein isoform X1             121   7e-30   Populus euphratica
ref|XP_010430038.1|  PREDICTED: BI1-like protein                        121   7e-30   Camelina sativa [gold-of-pleasure]
ref|XP_002466473.1|  hypothetical protein SORBIDRAFT_01g008350          121   8e-30   Sorghum bicolor [broomcorn]
gb|KEH23825.1|  inhibitor of apoptosis-promoting Bax1 protein           121   8e-30   Medicago truncatula
ref|XP_009402334.1|  PREDICTED: BI1-like protein                        121   9e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008665403.1|  PREDICTED: BI1-like protein                        121   1e-29   Zea mays [maize]
ref|XP_011027040.1|  PREDICTED: BI1-like protein                        120   1e-29   Populus euphratica
ref|XP_008449318.1|  PREDICTED: BI1-like protein                        120   1e-29   Cucumis melo [Oriental melon]
ref|XP_008789734.1|  PREDICTED: BI1-like protein                        120   1e-29   Phoenix dactylifera
ref|XP_008386439.1|  PREDICTED: BI1-like protein                        120   1e-29   Malus domestica [apple tree]
ref|NP_001237340.1|  uncharacterized protein LOC100527528               120   2e-29   Glycine max [soybeans]
gb|ABK27003.1|  unknown                                                 120   2e-29   Picea sitchensis
gb|KDO74482.1|  hypothetical protein CISIN_1g026616mg                   119   2e-29   Citrus sinensis [Valencia orange]
ref|XP_008775649.1|  PREDICTED: BI1-like protein                        119   3e-29   Phoenix dactylifera
ref|XP_003518904.1|  PREDICTED: BI1-like protein-like                   119   3e-29   Glycine max [soybeans]
gb|EMS50944.1|  hypothetical protein TRIUR3_13925                       120   3e-29   Triticum urartu
gb|EMT30807.1|  hypothetical protein F775_10013                         119   4e-29   Aegilops tauschii
ref|XP_006420012.1|  hypothetical protein CICLE_v10006442mg             119   5e-29   Citrus clementina
ref|XP_006650573.1|  PREDICTED: BI1-like protein-like                   119   6e-29   Oryza brachyantha
ref|XP_006650725.1|  PREDICTED: BI1-like protein-like                   118   8e-29   Oryza brachyantha
gb|EMS57375.1|  hypothetical protein TRIUR3_34180                       119   8e-29   Triticum urartu
ref|XP_010096442.1|  hypothetical protein L484_002350                   118   9e-29   Morus notabilis
gb|KHG20710.1|  hypothetical protein F383_10571                         118   9e-29   Gossypium arboreum [tree cotton]
ref|XP_011399245.1|  BI1-like protein                                   118   1e-28   Auxenochlorella protothecoides
gb|EMT04950.1|  hypothetical protein F775_18737                         118   1e-28   Aegilops tauschii
gb|KJB23000.1|  hypothetical protein B456_004G077400                    118   1e-28   Gossypium raimondii
gb|ACU19259.1|  unknown                                                 118   1e-28   Glycine max [soybeans]
ref|XP_002971406.1|  hypothetical protein SELMODRAFT_95705              117   2e-28   Selaginella moellendorffii
ref|XP_002966079.1|  hypothetical protein SELMODRAFT_84281              117   2e-28   Selaginella moellendorffii
gb|EMT04947.1|  hypothetical protein F775_08799                         117   2e-28   Aegilops tauschii
emb|CDM85336.1|  unnamed protein product                                117   2e-28   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004493722.1|  PREDICTED: BI1-like protein-like                   117   3e-28   Cicer arietinum [garbanzo]
gb|EPS70625.1|  hypothetical protein M569_04132                         117   3e-28   Genlisea aurea
ref|XP_010024226.1|  PREDICTED: BI1-like protein                        117   3e-28   Eucalyptus grandis [rose gum]
ref|XP_004955618.1|  PREDICTED: BI1-like protein-like                   117   3e-28   Setaria italica
emb|CDM85345.1|  unnamed protein product                                117   3e-28   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007162464.1|  hypothetical protein PHAVU_001G154500g             116   5e-28   Phaseolus vulgaris [French bean]
ref|XP_009410985.1|  PREDICTED: BI1-like protein                        116   5e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001051551.1|  Os03g0795800                                       116   7e-28   
emb|CBI26304.3|  unnamed protein product                                115   7e-28   Vitis vinifera
ref|XP_003557492.1|  PREDICTED: BI1-like protein                        116   8e-28   Brachypodium distachyon [annual false brome]
gb|KJB23003.1|  hypothetical protein B456_004G077400                    115   9e-28   Gossypium raimondii
ref|NP_001130584.1|  uncharacterized protein LOC100191683               115   2e-27   Zea mays [maize]
gb|ACG33000.1|  transmembrane BAX inhibitor motif-containing prot...    115   2e-27   Zea mays [maize]
ref|XP_008355439.1|  PREDICTED: BI1-like protein                        115   2e-27   Malus domestica [apple tree]
dbj|BAK00103.1|  predicted protein                                      115   2e-27   Hordeum vulgare subsp. vulgare [barley]
ref|NP_193209.2|  Bax inhibitor-1 family protein                        114   2e-27   Arabidopsis thaliana [mouse-ear cress]
emb|CDM86339.1|  unnamed protein product                                115   2e-27   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002870289.1|  hypothetical protein ARALYDRAFT_355323             114   3e-27   Arabidopsis lyrata subsp. lyrata
gb|ABR16790.1|  unknown                                                 114   3e-27   Picea sitchensis
ref|NP_001151352.1|  transmembrane BAX inhibitor motif-containing...    114   4e-27   Zea mays [maize]
gb|AFW67649.1|  transmembrane BAX inhibitor motif protein-contain...    114   4e-27   Zea mays [maize]
ref|XP_002461535.1|  hypothetical protein SORBIDRAFT_02g004350          114   4e-27   Sorghum bicolor [broomcorn]
ref|XP_004981803.1|  PREDICTED: BI1-like protein-like                   114   5e-27   Setaria italica
ref|XP_010923521.1|  PREDICTED: BI1-like protein                        113   6e-27   Elaeis guineensis
ref|XP_009419748.1|  PREDICTED: BI1-like protein                        112   2e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008786053.1|  PREDICTED: BI1-like protein                        112   3e-26   Phoenix dactylifera
gb|KJB23001.1|  hypothetical protein B456_004G077400                    110   3e-26   Gossypium raimondii
ref|XP_009370780.1|  PREDICTED: BI1-like protein                        111   3e-26   Pyrus x bretschneideri [bai li]
gb|KDO74902.1|  hypothetical protein CISIN_1g0265232mg                  108   4e-26   Citrus sinensis [Valencia orange]
gb|KJB23002.1|  hypothetical protein B456_004G077400                    110   4e-26   Gossypium raimondii
gb|KDD74103.1|  inhibitor of apoptosis-promoting Bax1                   111   4e-26   Helicosporidium sp. ATCC 50920
ref|XP_006286105.1|  hypothetical protein CARUB_v10007653mg             110   7e-26   Capsella rubella
gb|KFK22589.1|  hypothetical protein AALP_AAs43532U000100               110   8e-26   Arabis alpina [alpine rockcress]
ref|XP_011079979.1|  PREDICTED: BI1-like protein                        110   1e-25   Sesamum indicum [beniseed]
ref|XP_009413900.1|  PREDICTED: BI1-like protein                        110   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN81203.1|  hypothetical protein VITISV_035442                     110   1e-25   Vitis vinifera
tpg|DAA59750.1|  TPA: hypothetical protein ZEAMMB73_617181              108   1e-25   Zea mays [maize]
ref|XP_009413899.1|  PREDICTED: BI1-like protein                        109   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003561356.1|  PREDICTED: BI1-like protein isoform X2             109   3e-25   Brachypodium distachyon [annual false brome]
ref|XP_004309714.1|  PREDICTED: BI1-like protein                        109   3e-25   Fragaria vesca subsp. vesca
ref|XP_010450003.1|  PREDICTED: BI1-like protein                        109   3e-25   Camelina sativa [gold-of-pleasure]
ref|NP_001051246.2|  Os03g0745600                                       109   3e-25   
ref|XP_010440403.1|  PREDICTED: BI1-like protein                        108   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_002463745.1|  hypothetical protein SORBIDRAFT_01g005270          108   6e-25   Sorghum bicolor [broomcorn]
ref|XP_008368927.1|  PREDICTED: BI1-like protein                        108   9e-25   
gb|AAK71568.1|AC087852_28  putative receptor-associated protein         107   1e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007142929.1|  hypothetical protein PHAVU_007G029100g             107   2e-24   Phaseolus vulgaris [French bean]
ref|XP_005849730.1|  hypothetical protein CHLNCDRAFT_59619              107   2e-24   Chlorella variabilis
ref|XP_010435077.1|  PREDICTED: BI1-like protein                        106   3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_004145382.1|  PREDICTED: BI1-like protein-like                   106   3e-24   
ref|NP_001136515.1|  uncharacterized protein LOC100216630               105   5e-24   Zea mays [maize]
ref|XP_008449342.1|  PREDICTED: BI1-like protein                        105   6e-24   Cucumis melo [Oriental melon]
ref|XP_006414652.1|  hypothetical protein EUTSA_v10026089mg             105   7e-24   Eutrema salsugineum
ref|XP_010497467.1|  PREDICTED: BI1-like protein                        103   7e-24   Camelina sativa [gold-of-pleasure]
ref|NP_001051550.1|  Os03g0795600                                       105   7e-24   
ref|XP_009148344.1|  PREDICTED: BI1-like protein                        105   9e-24   Brassica rapa
gb|ACJ68113.1|  hypothetical protein                                    105   9e-24   Brassica napus [oilseed rape]
gb|EAY92172.1|  hypothetical protein OsI_13886                          105   1e-23   Oryza sativa Indica Group [Indian rice]
gb|EAY92177.1|  hypothetical protein OsI_13891                          102   4e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_009417103.1|  PREDICTED: BI1-like protein                        103   5e-23   
ref|XP_010932815.1|  PREDICTED: BI1-like protein                        103   5e-23   
ref|XP_004497074.1|  PREDICTED: BI1-like protein-like                   103   5e-23   
ref|XP_003592636.1|  Transmembrane BAX inhibitor motif-containing...    102   6e-23   
emb|CDY16255.1|  BnaC01g22900D                                          102   7e-23   
ref|XP_007226041.1|  hypothetical protein PRUPE_ppa010563mg             102   7e-23   
gb|KJB25942.1|  hypothetical protein B456_004G217400                    102   7e-23   
ref|XP_006838960.1|  hypothetical protein AMTR_s00002p00271010          102   7e-23   
ref|XP_003535722.1|  PREDICTED: BI1-like protein-like                   102   8e-23   
ref|XP_005647458.1|  UPF0005-domain-containing protein                  102   8e-23   
ref|XP_010228294.1|  PREDICTED: BI1-like protein isoform X1             102   1e-22   
ref|XP_004981440.1|  PREDICTED: BI1-like protein-like                   101   2e-22   
ref|XP_008224251.1|  PREDICTED: BI1-like protein                        101   2e-22   
gb|AFK47143.1|  unknown                                               99.0    4e-22   
ref|XP_009343941.1|  PREDICTED: BI1-like protein                      99.0    2e-21   
emb|CDO99103.1|  unnamed protein product                              98.6    2e-21   
ref|XP_008390943.1|  PREDICTED: BI1-like protein                      98.2    3e-21   
ref|XP_008367186.1|  PREDICTED: BI1-like protein                      97.8    5e-21   
ref|XP_006363485.1|  PREDICTED: BI1-like protein-like                 97.8    6e-21   
ref|XP_002524728.1|  Transmembrane BAX inhibitor motif-containing...  97.1    8e-21   
dbj|BAK05072.1|  predicted protein                                    96.7    1e-20   
ref|XP_003555237.1|  PREDICTED: BI1-like protein-like                 96.3    2e-20   
gb|EMT02672.1|  hypothetical protein F775_19037                       94.7    6e-20   
emb|CAB10325.1|  hypothetical protein                                 97.4    1e-19   
ref|XP_009601841.1|  PREDICTED: BI1-like protein isoform X2           93.6    1e-19   
ref|XP_002307606.2|  hypothetical protein POPTR_0005s23560g           93.6    1e-19   
ref|XP_006650724.1|  PREDICTED: BI1-like protein-like                 93.2    2e-19   
ref|XP_011032647.1|  PREDICTED: BI1-like protein                      93.2    2e-19   
gb|KHN11404.1|  BI1-like protein                                      92.0    4e-19   
gb|EYU46519.1|  hypothetical protein MIMGU_mgv1a012770mg              92.0    5e-19   
ref|XP_008807245.1|  PREDICTED: BI1-like protein isoform X2           92.0    5e-19   
ref|XP_003559313.1|  PREDICTED: BI1-like protein                      92.0    6e-19   
gb|EYU30338.1|  hypothetical protein MIMGU_mgv1a019280mg              91.3    7e-19   
ref|XP_010326728.1|  PREDICTED: BI1-like protein                      91.3    9e-19   
ref|XP_004297970.1|  PREDICTED: BI1-like protein                      90.9    1e-18   
ref|XP_004979563.1|  PREDICTED: BI1-like protein-like                 89.0    7e-18   
gb|AFW65316.1|  hypothetical protein ZEAMMB73_585427                  88.2    1e-17   
gb|KEH23822.1|  inhibitor of apoptosis-promoting Bax1 protein         87.8    2e-17   
ref|XP_003575924.1|  PREDICTED: BI1-like protein isoform X1           87.4    2e-17   
gb|AFW65317.1|  hypothetical protein ZEAMMB73_585427                  87.4    3e-17   
ref|XP_009631099.1|  PREDICTED: BI1-like protein                      87.4    3e-17   
emb|CDM85337.1|  unnamed protein product                              87.0    3e-17   
ref|XP_008807244.1|  PREDICTED: BI1-like protein isoform X1           86.3    6e-17   
gb|KHN02553.1|  BI1-like protein                                      85.9    7e-17   
ref|XP_009796306.1|  PREDICTED: BI1-like protein                      84.3    3e-16   
gb|KEH23817.1|  inhibitor of apoptosis-promoting Bax1 protein         84.0    4e-16   
gb|EYU23690.1|  hypothetical protein MIMGU_mgv1a012711mg              84.0    4e-16   
ref|XP_002451016.1|  hypothetical protein SORBIDRAFT_05g022690        83.6    6e-16   
gb|KEH23815.1|  inhibitor of apoptosis-promoting Bax1 protein         82.8    9e-16   
gb|EMS49503.1|  hypothetical protein TRIUR3_04677                     82.0    9e-16   
ref|XP_002524727.1|  Transmembrane BAX inhibitor motif-containing...  82.8    1e-15   
gb|EMT04948.1|  hypothetical protein F775_23516                       82.8    1e-15   
ref|XP_008390989.1|  PREDICTED: BI1-like protein                      81.3    2e-15   
dbj|BAC83444.1|  putative z-protein                                   80.9    3e-15   
gb|EEC81607.1|  hypothetical protein OsI_25099                        81.3    4e-15   
ref|NP_001059025.2|  Os07g0177200                                     80.9    5e-15   
gb|KDO38627.1|  hypothetical protein CISIN_1g043748mg                 77.8    1e-14   
ref|XP_011458590.1|  PREDICTED: BI1-like protein                      78.6    2e-14   
ref|XP_011026113.1|  PREDICTED: BI1-like protein isoform X2           74.7    4e-13   
ref|XP_011307519.1|  PREDICTED: protein lifeguard 4-like              74.3    7e-13   
gb|EMT05505.1|  hypothetical protein F775_18457                       73.9    8e-13   
tpg|DAA51896.1|  TPA: hypothetical protein ZEAMMB73_897912            71.6    1e-12   
ref|XP_006663554.1|  PREDICTED: BI1-like protein-like                 73.6    1e-12   
ref|XP_006657497.1|  PREDICTED: BI1-like protein-like                 71.2    7e-12   
tpg|DAA59749.1|  TPA: hypothetical protein ZEAMMB73_617181            70.9    9e-12   
gb|EEC68424.1|  hypothetical protein OsI_36602                        71.2    9e-12   
ref|NP_001068154.1|  Os11g0581900                                     71.2    9e-12   
ref|XP_011159251.1|  PREDICTED: protein lifeguard 4-like              70.9    1e-11   
ref|XP_010791836.1|  PREDICTED: protein lifeguard 4                   68.6    7e-11   
ref|XP_001757696.1|  predicted protein                                67.4    1e-10   
ref|XP_011059322.1|  PREDICTED: protein lifeguard 4-like              67.4    2e-10   
ref|XP_005989484.1|  PREDICTED: protein lifeguard 4                   67.0    2e-10   
gb|EMS68250.1|  hypothetical protein TRIUR3_19365                     67.8    2e-10   
ref|XP_003455683.2|  PREDICTED: protein lifeguard 4-like              67.4    3e-10   
ref|XP_007259801.1|  PREDICTED: protein lifeguard 4-like              66.2    5e-10   
ref|XP_010897266.1|  PREDICTED: protein lifeguard 4                   66.2    5e-10   
ref|XP_005709020.1|  transmembrane BAX inhibitor motif containing...  66.2    7e-10   
ref|NP_998303.2|  protein lifeguard 4 isoform 1                       65.5    7e-10   
ref|NP_570396.1|  CMLV006                                             65.1    1e-09   
ref|NP_001089282.1|  transmembrane BAX inhibitor motif containing 4   65.1    1e-09   
ref|XP_011254402.1|  PREDICTED: protein lifeguard 4-like              65.1    1e-09   
ref|XP_004573137.1|  PREDICTED: protein lifeguard 4-like              65.5    2e-09   
ref|XP_011150726.1|  PREDICTED: protein lifeguard 4-like isoform X3   64.7    2e-09   
ref|XP_011150724.1|  PREDICTED: protein lifeguard 4-like isoform X1   64.7    2e-09   
ref|XP_011150725.1|  PREDICTED: protein lifeguard 4-like isoform X2   64.7    2e-09   
ref|XP_007848574.1|  glutamate binding protein                        64.7    3e-09   
gb|AAG37461.1|  CMP6L                                                 63.5    4e-09   
gb|ACO09924.1|  Transmembrane BAX inhibitor motif-containing prot...  63.2    5e-09   
ref|XP_005295606.1|  PREDICTED: protein lifeguard 4                   63.2    6e-09   
ref|XP_011329701.1|  PREDICTED: protein lifeguard 4-like              63.2    6e-09   
ref|XP_006130256.1|  PREDICTED: protein lifeguard 4                   63.2    6e-09   
ref|NP_954547.1|  protein lifeguard 4                                 63.2    7e-09   
ref|XP_005933883.1|  PREDICTED: protein lifeguard 4-like              62.8    7e-09   
ref|XP_006799805.1|  PREDICTED: protein lifeguard 4-like              62.8    7e-09   
dbj|BAM18153.1|  N-methyl-D-aspartate receptor-associated protein     62.8    9e-09   
gb|ADZ30183.1|  TNF-alpha-receptor-like protein                       62.4    1e-08   
ref|XP_005519389.1|  PREDICTED: protein lifeguard 4                   62.4    1e-08   
ref|XP_004700531.1|  PREDICTED: protein lifeguard 4                   62.4    1e-08   
gb|EMT02671.1|  hypothetical protein F775_31127                       63.2    1e-08   
gb|ADZ29755.1|  NMDA receptor-like protein                            62.0    1e-08   
ref|XP_010083044.1|  PREDICTED: LOW QUALITY PROTEIN: protein life...  61.6    3e-08   
ref|XP_003590586.1|  BI1-like protein                                 59.7    4e-08   
ref|XP_003798583.1|  PREDICTED: protein lifeguard 4 isoform 2         59.3    5e-08   
ref|XP_003385460.1|  PREDICTED: protein lifeguard 4-like              60.5    5e-08   
ref|XP_008924810.1|  PREDICTED: protein lifeguard 4                   60.5    5e-08   
gb|KFW83144.1|  Protein lifeguard 4                                   60.5    5e-08   
emb|CAD90752.1|  T1R protein                                          60.1    6e-08   
ref|XP_001235093.1|  PREDICTED: protein lifeguard 4                   60.5    6e-08   
ref|XP_008314213.1|  PREDICTED: protein lifeguard 4                   60.1    7e-08   
ref|NP_080893.1|  protein lifeguard 4                                 60.1    7e-08   
gb|ADZ29327.1|  NMDA receptor-like protein                            60.1    8e-08   
ref|NP_001279731.1|  transmembrane BAX inhibitor motif containing 4   59.7    9e-08   
gb|AAW21699.1|  Golgi anti-apoptotic protein                          59.7    9e-08   
sp|Q49P94.1|GAAP_VACCL  RecName: Full=Golgi anti-apoptotic protei...  59.7    1e-07   
gb|AAV98625.1|  Golgi anti-apoptotic protein                          59.7    1e-07   
ref|XP_006259337.1|  PREDICTED: protein lifeguard 4                   59.7    1e-07   
ref|XP_003798582.1|  PREDICTED: protein lifeguard 4 isoform 1         59.3    1e-07   
ref|XP_002130837.1|  PREDICTED: protein lifeguard 4-like              59.3    1e-07   
gb|EMP28487.1|  Transmembrane BAX inhibitor motif-containing prot...  58.9    1e-07   
emb|CDX98559.1|  BnaC05g38160D                                        57.8    1e-07   
ref|XP_006022537.1|  PREDICTED: protein lifeguard 4                   59.7    1e-07   
gb|KFQ95554.1|  Protein lifeguard 4                                   59.3    1e-07   
emb|CDY49039.1|  BnaA01g22850D                                        58.2    2e-07   
gb|EWM23688.1|  transmembrane bax inhibitor motif-containing prot...  60.1    2e-07   
gb|ERE92110.1|  transmembrane BAX inhibitor motif-containing prot...  58.2    2e-07   
ref|XP_009461489.1|  PREDICTED: protein lifeguard 4                   59.3    2e-07   
ref|XP_010753211.1|  PREDICTED: protein lifeguard 4                   58.2    2e-07   
ref|XP_010411952.1|  PREDICTED: protein lifeguard 4                   58.9    2e-07   
gb|ADZ30397.1|  NMDA receptor-like protein                            58.9    2e-07   
ref|NP_001187457.1|  transmembrane bax inhibitor motif-containing...  58.9    2e-07   
ref|XP_007067592.1|  PREDICTED: protein lifeguard 4                   58.2    2e-07   
ref|XP_003224670.1|  PREDICTED: protein lifeguard 4                   58.9    2e-07   
ref|XP_007421419.1|  PREDICTED: protein lifeguard 4                   58.5    3e-07   
ref|XP_008066860.1|  PREDICTED: protein lifeguard 4-like              58.5    3e-07   
gb|ADZ24213.1|  NMDA receptor-like protein                            58.5    3e-07   
gb|KFQ56216.1|  Protein lifeguard 4                                   58.5    3e-07   
ref|XP_004675981.1|  PREDICTED: protein lifeguard 4                   58.5    3e-07   
ref|XP_005141851.1|  PREDICTED: protein lifeguard 4-like              58.5    3e-07   
ref|XP_007082282.1|  PREDICTED: protein lifeguard 4                   58.2    3e-07   
ref|XP_009093312.1|  PREDICTED: protein lifeguard 4                   58.2    3e-07   
ref|XP_003497176.1|  PREDICTED: protein lifeguard 4                   58.2    4e-07   
ref|XP_001605147.1|  PREDICTED: protein lifeguard 4-like              58.2    4e-07   
ref|XP_003989054.1|  PREDICTED: protein lifeguard 4                   58.2    4e-07   
ref|XP_007864171.1|  UPF0005-domain-containing protein                58.5    4e-07   
ref|XP_005480627.1|  PREDICTED: protein lifeguard 4                   58.2    4e-07   
ref|NP_001232150.1|  putative transmembrane BAX inhibitor motif c...  58.2    4e-07   
ref|XP_010706128.1|  PREDICTED: protein lifeguard 4 isoform X1        57.8    5e-07   
ref|XP_010560256.1|  PREDICTED: protein lifeguard 4                   58.5    5e-07   
ref|XP_004923036.1|  PREDICTED: protein lifeguard 4-like              57.8    5e-07   
ref|XP_010185696.1|  PREDICTED: protein lifeguard 4                   57.4    6e-07   
ref|XP_002924755.1|  PREDICTED: protein lifeguard 4                   57.8    6e-07   
gb|AFK47976.1|  unknown                                               54.7    6e-07   
gb|EHJ65865.1|  hypothetical protein KGM_10827                        57.8    7e-07   
emb|CBJ28269.1|  Homologue of a Golgi anti-apoptotic protein iden...  57.8    7e-07   
gb|KEH23818.1|  inhibitor of apoptosis-promoting Bax1 protein         55.1    7e-07   
ref|NP_001004879.1|  transmembrane BAX inhibitor motif containing 4   57.4    8e-07   
gb|KFQ30283.1|  Protein lifeguard 4                                   57.4    8e-07   
ref|XP_010134037.1|  PREDICTED: protein lifeguard 4                   57.0    8e-07   
gb|ACO15172.1|  Transmembrane BAX inhibitor motif-containing prot...  57.4    8e-07   
ref|XP_005026809.1|  PREDICTED: protein lifeguard 4                   57.0    8e-07   
gb|KFP72715.1|  Protein lifeguard 4                                   56.6    9e-07   
ref|XP_006973410.1|  PREDICTED: protein lifeguard 4                   57.4    9e-07   
gb|KIK27569.1|  hypothetical protein PISMIDRAFT_674439                57.4    9e-07   
gb|KCW58779.1|  hypothetical protein EUGRSUZ_H014131                  55.5    1e-06   
gb|ACO10701.1|  Transmembrane BAX inhibitor motif-containing prot...  57.0    1e-06   
ref|XP_009080879.1|  PREDICTED: protein lifeguard 4                   56.6    1e-06   
ref|XP_001986333.1|  GH21301                                          57.4    1e-06   
ref|XP_005910418.1|  PREDICTED: protein lifeguard 4 isoform X3        55.5    1e-06   
ref|XP_003327732.1|  hypothetical protein PGTG_09266                  57.4    1e-06   
ref|XP_009045767.1|  hypothetical protein LOTGIDRAFT_137312           56.6    1e-06   
gb|KGL79168.1|  Protein lifeguard 4                                   56.2    2e-06   
ref|XP_006923773.1|  PREDICTED: protein lifeguard 4                   56.6    2e-06   
ref|XP_004797405.1|  PREDICTED: protein lifeguard 4                   57.0    2e-06   
gb|KFV96484.1|  Protein lifeguard 4                                   56.6    2e-06   
ref|XP_009584963.1|  PREDICTED: protein lifeguard 4                   56.6    2e-06   
ref|XP_001510640.1|  PREDICTED: protein lifeguard 4                   56.6    2e-06   
ref|XP_002162929.2|  PREDICTED: protein lifeguard 4-like              55.1    2e-06   
ref|XP_004650122.1|  PREDICTED: protein lifeguard 4                   56.6    2e-06   
ref|XP_010300609.1|  PREDICTED: protein lifeguard 4                   55.8    2e-06   
ref|XP_010118322.1|  PREDICTED: protein lifeguard 4                   56.2    2e-06   
ref|XP_005910417.1|  PREDICTED: protein lifeguard 4 isoform X2        55.5    2e-06   
ref|XP_010215686.1|  PREDICTED: protein lifeguard 4                   55.8    2e-06   
ref|XP_004381598.1|  PREDICTED: protein lifeguard 4                   56.2    2e-06   
ref|XP_003405231.1|  PREDICTED: protein lifeguard 4 isoform X1        56.2    2e-06   
ref|XP_005081574.1|  PREDICTED: protein lifeguard 4                   56.2    2e-06   
gb|KIJ18531.1|  hypothetical protein PAXINDRAFT_167135                56.6    2e-06   
ref|XP_005039476.1|  PREDICTED: protein lifeguard 4                   56.2    2e-06   
ref|XP_011073458.1|  PREDICTED: BI1-like protein                      54.7    2e-06   
ref|XP_001986335.1|  GH21302                                          56.6    2e-06   
ref|XP_009670069.1|  PREDICTED: protein lifeguard 4                   55.8    2e-06   
ref|NP_509543.2|  Protein TMBI-4                                      56.2    2e-06   
ref|XP_004752536.1|  PREDICTED: protein lifeguard 4                   56.2    2e-06   
ref|XP_011372108.1|  PREDICTED: protein lifeguard 4                   55.8    3e-06   
ref|XP_007381152.1|  UPF0005-domain-containing protein                56.2    3e-06   
ref|XP_010839876.1|  PREDICTED: protein lifeguard 4                   55.8    3e-06   
ref|XP_005763132.1|  hypothetical protein EMIHUDRAFT_358129           55.8    3e-06   
ref|XP_008827332.1|  PREDICTED: protein lifeguard 4                   55.5    3e-06   
emb|CDY28900.1|  BnaC06g26880D                                        52.4    4e-06   
ref|XP_009996070.1|  PREDICTED: protein lifeguard 4                   55.8    4e-06   
ref|XP_006886128.1|  PREDICTED: protein lifeguard 4 isoform X2        55.5    4e-06   
ref|XP_011418870.1|  PREDICTED: protein lifeguard 4-like isoform X1   55.5    4e-06   
gb|KFU89672.1|  Protein lifeguard 4                                   55.5    4e-06   
ref|XP_005962412.1|  PREDICTED: protein lifeguard 4 isoform X1        55.5    4e-06   
emb|CCG81377.1|  Bax Inhibitor family protein                         55.8    4e-06   
ref|NP_001014914.1|  protein lifeguard 4                              55.1    4e-06   
ref|XP_009929929.1|  PREDICTED: protein lifeguard 4                   55.5    5e-06   
ref|XP_011418871.1|  PREDICTED: protein lifeguard 4-like isoform X2   55.1    5e-06   
ref|XP_010612014.1|  PREDICTED: protein lifeguard 4                   55.1    5e-06   
ref|XP_007516917.1|  PREDICTED: protein lifeguard 4                   55.1    5e-06   
ref|XP_009561645.1|  PREDICTED: protein lifeguard 4                   55.1    5e-06   
gb|KFO70110.1|  Protein lifeguard 4                                   55.1    6e-06   
gb|KFP92883.1|  Protein lifeguard 4                                   54.7    6e-06   
ref|XP_531662.1|  PREDICTED: protein lifeguard 4                      54.7    6e-06   
ref|XP_006731256.1|  PREDICTED: protein lifeguard 4                   54.7    6e-06   
ref|XP_004415674.1|  PREDICTED: protein lifeguard 4                   54.7    6e-06   
ref|XP_005761881.1|  hypothetical protein EMIHUDRAFT_350606           55.1    6e-06   
gb|KFQ27543.1|  Protein lifeguard 4                                   54.3    7e-06   
ref|XP_006066515.1|  PREDICTED: protein lifeguard 4 isoform X1        54.7    7e-06   
ref|XP_001491162.1|  PREDICTED: protein lifeguard 4                   54.7    7e-06   
dbj|BAN82040.1|  hypothetical protein                                 54.7    7e-06   
gb|KFR06608.1|  Protein lifeguard 4                                   54.3    7e-06   



>ref|XP_009769831.1| PREDICTED: BI1-like protein [Nicotiana sylvestris]
Length=246

 Score =   232 bits (591),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagv  248
            MYGF  +S+  D G+KGDIEEGTLYPG+GYGENQLRWGFIRKVYGI++AQILLTT+V+ V
Sbjct  1    MYGFTSLSTENDVGIKGDIEEGTLYPGLGYGENQLRWGFIRKVYGILAAQILLTTVVSAV  60

Query  249  tvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVS  428
            TVLYAP+N++L+G+S LLL L+FLPF+LLWPLHVYQQ+HPLNF+FLGLFTASLS  V VS
Sbjct  61   TVLYAPINDLLRGNSGLLLVLIFLPFVLLWPLHVYQQKHPLNFVFLGLFTASLSLTVGVS  120

Query  429  CANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMF  608
            CANTDG IVLEALILTSAVV ALTGYTFWA++KG+DF++LGPILFTSLF+LILTGF+QMF
Sbjct  121  CANTDGKIVLEALILTSAVVSALTGYTFWASRKGKDFSYLGPILFTSLFVLILTGFMQMF  180

Query  609  FPLG  620
            FPLG
Sbjct  181  FPLG  184



>ref|XP_009609402.1| PREDICTED: BI1-like protein [Nicotiana tomentosiformis]
Length=246

 Score =   232 bits (591),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagv  248
            MYGF  +S+  D G+KGDIEEGTLYPG+GYGENQLRWGFIRKVYGI++AQILLTT+V+ V
Sbjct  1    MYGFTSLSTENDVGIKGDIEEGTLYPGLGYGENQLRWGFIRKVYGILAAQILLTTVVSAV  60

Query  249  tvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVS  428
            TVLYAP+N++L+G+S LLL L+FLPF+LLWPLHVYQQ+HPLNF+FLGLFTASLS  V VS
Sbjct  61   TVLYAPINDLLRGNSGLLLVLIFLPFVLLWPLHVYQQKHPLNFVFLGLFTASLSLTVGVS  120

Query  429  CANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMF  608
            CANTDG IVLEALILTSAVV ALTGYTFWA++KG+DF++LGPILFTSLF+LILTGF+QMF
Sbjct  121  CANTDGKIVLEALILTSAVVSALTGYTFWASRKGKDFSYLGPILFTSLFVLILTGFMQMF  180

Query  609  FPLG  620
            FPLG
Sbjct  181  FPLG  184



>ref|XP_006339425.1| PREDICTED: BI1-like protein-like [Solanum tuberosum]
Length=246

 Score =   232 bits (591),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagv  248
            MYGF  +S+  DGG+KGDIEEGTLYPG+GYGENQLRWGFIRKVYGI++AQILLTTLV+ V
Sbjct  1    MYGFTSLSTESDGGIKGDIEEGTLYPGLGYGENQLRWGFIRKVYGILAAQILLTTLVSAV  60

Query  249  tvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVS  428
            TVLY P+N++L+GS  LLL LVFLPF+LLWPLH+YQQ+HPLNFIFLGLFTASLS  V V+
Sbjct  61   TVLYTPINDLLRGSPGLLLLLVFLPFVLLWPLHIYQQKHPLNFIFLGLFTASLSLTVGVT  120

Query  429  CANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMF  608
            CANTDG IVLEAL+LTSAVV ALTGYTFWA+KKG+DF+FLGPILFTSLF+LILTGF+QMF
Sbjct  121  CANTDGRIVLEALLLTSAVVSALTGYTFWASKKGKDFSFLGPILFTSLFVLILTGFMQMF  180

Query  609  FPLG  620
            FPLG
Sbjct  181  FPLG  184



>ref|XP_004229465.1| PREDICTED: BI1-like protein [Solanum lycopersicum]
Length=246

 Score =   229 bits (585),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagv  248
            MYGF  + +  DGG+KGDIEEGTLYPG+GYGENQLRWGFIRKVYGI++AQILLTTLV+ V
Sbjct  1    MYGFTSLRTESDGGIKGDIEEGTLYPGLGYGENQLRWGFIRKVYGILAAQILLTTLVSAV  60

Query  249  tvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVS  428
            TVLY P+N++L+GS  LLLFL+FLPF+LLWPLH+YQQ+HPLNFIFLGLFTASLS  V V+
Sbjct  61   TVLYTPINDLLRGSPGLLLFLIFLPFVLLWPLHIYQQKHPLNFIFLGLFTASLSLTVGVT  120

Query  429  CANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMF  608
            CANTDG IVLEAL+LTSAVV ALTGYTFWA+KKG+DF+FLGPILFTSLF+LILTGF+QMF
Sbjct  121  CANTDGRIVLEALLLTSAVVSALTGYTFWASKKGKDFSFLGPILFTSLFVLILTGFMQMF  180

Query  609  FPLG  620
            FPLG
Sbjct  181  FPLG  184



>gb|EYU43851.1| hypothetical protein MIMGU_mgv1a011019mg [Erythranthe guttata]
Length=294

 Score =   215 bits (547),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 149/224 (67%), Positives = 176/224 (79%), Gaps = 25/224 (11%)
 Frame = +3

Query  24   HISRERERDLRAK---------------------AKMYGFERVSSSYDGGMKG---DIEE  131
            ++ RERER++  +                      KMYG+  VSS     MKG   DIE 
Sbjct  10   NLGREREREISTEISRERKSQRRTRPNRRRNQRSEKMYGYAGVSSDGPAAMKGGEFDIES  69

Query  132  G-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSAlllf  308
            G  LYPGIG+GENQLRWGFI+KVYGI++AQIL+TT+V+   VLYAP+N++L+G+S LLLF
Sbjct  70   GDMLYPGIGHGENQLRWGFIQKVYGILAAQILMTTVVSAAVVLYAPINDLLRGNSVLLLF  129

Query  309  lvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILTSAVV  488
            L+F PF+LLWPLHVYQQ HPLNFIFLGLFTASLS  V VSCANT+GAIVLEALILTSAVV
Sbjct  130  LIFTPFILLWPLHVYQQTHPLNFIFLGLFTASLSLTVGVSCANTEGAIVLEALILTSAVV  189

Query  489  LALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
             ALTGYTFWA+KKG+DF+FLGP+LFTSLFIL+LTGFIQ+FFPLG
Sbjct  190  SALTGYTFWASKKGKDFSFLGPVLFTSLFILVLTGFIQVFFPLG  233



>ref|XP_002279368.2| PREDICTED: BI1-like protein [Vitis vinifera]
 emb|CBI26161.3| unnamed protein product [Vitis vinifera]
Length=241

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 161/184 (88%), Gaps = 6/184 (3%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagv  248
            MYGF  VSS      KGD+EEGTLYPG+ YGEN+LRWGFIRKVYGI++AQILLTTLV+  
Sbjct  1    MYGFTSVSS------KGDLEEGTLYPGLSYGENELRWGFIRKVYGILAAQILLTTLVSSF  54

Query  249  tvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVS  428
            TVLY+PLN +L+G+S LLLFL+FLPF+LLWPLHVYQQRHPLN IFLGLFT S+S  V VS
Sbjct  55   TVLYSPLNLLLRGNSGLLLFLIFLPFILLWPLHVYQQRHPLNLIFLGLFTVSMSLTVGVS  114

Query  429  CANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMF  608
            CA TDG IVLEALILTSAVV +LTGYTFWA+KKG+DF++LGPILF+SL ILILTGFIQ F
Sbjct  115  CAKTDGRIVLEALILTSAVVSSLTGYTFWASKKGKDFSYLGPILFSSLIILILTGFIQTF  174

Query  609  FPLG  620
            FPLG
Sbjct  175  FPLG  178



>ref|XP_006419766.1| hypothetical protein CICLE_v10005717mg [Citrus clementina]
 gb|ESR33006.1| hypothetical protein CICLE_v10005717mg [Citrus clementina]
Length=249

 Score =   207 bits (528),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 159/187 (85%), Gaps = 3/187 (2%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGT---LYPGIGYGENQLRWGFIRKVYGIISAQIllttlv  239
            M G+E V S  DG  + D+E G    LYPG+ YGENQLRWGFIRKVYGI++AQI+LTTLV
Sbjct  1    MLGYETVRSKDDGKFEVDLEGGDGERLYPGLSYGENQLRWGFIRKVYGILTAQIVLTTLV  60

Query  240  agvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPV  419
            + +TVLY P+N++L+G+S LLLFL  LPF+LLWPLHVY Q+HP+N I LGLFT SLS PV
Sbjct  61   SSITVLYNPINDLLRGNSGLLLFLSILPFILLWPLHVYHQKHPVNLIVLGLFTVSLSLPV  120

Query  420  AVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfi  599
            AVSCANTDG IVLEALILTSAVV +LTGYTFWA+KKG+DF+FLGPILFTSL ILILT F+
Sbjct  121  AVSCANTDGRIVLEALILTSAVVCSLTGYTFWASKKGKDFSFLGPILFTSLIILILTSFM  180

Query  600  QMFFPLG  620
            QMFFPLG
Sbjct  181  QMFFPLG  187



>ref|XP_006489229.1| PREDICTED: BI1-like protein-like [Citrus sinensis]
Length=249

 Score =   207 bits (528),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 159/187 (85%), Gaps = 3/187 (2%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGT---LYPGIGYGENQLRWGFIRKVYGIISAQIllttlv  239
            M G+E V S  DG  + D+E G    LYPG+ YGENQLRWGFIRKVYGI++AQI+LTTLV
Sbjct  1    MLGYETVRSKDDGKFEVDLEGGDGERLYPGLSYGENQLRWGFIRKVYGILTAQIVLTTLV  60

Query  240  agvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPV  419
            + +TVLY P+N++L+G+S LLLFL  LPF+LLWPLHVY Q+HP+N I LGLFT SLS PV
Sbjct  61   SSITVLYNPINDLLRGNSGLLLFLSILPFILLWPLHVYHQKHPVNLIVLGLFTVSLSLPV  120

Query  420  AVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfi  599
            AVSCANTDG IVLEALILTSAVV +LTGYTFWA+KKG+DF+FLGPILFTSL ILILT F+
Sbjct  121  AVSCANTDGRIVLEALILTSAVVCSLTGYTFWASKKGKDFSFLGPILFTSLIILILTSFM  180

Query  600  QMFFPLG  620
            QMFFPLG
Sbjct  181  QMFFPLG  187



>emb|CDO98965.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   203 bits (516),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 152/168 (90%), Gaps = 1/168 (1%)
 Frame = +3

Query  120  DIEEGTL-YPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA  296
            D+E G L YPGIGYGENQLRWGFIRKVYGI++AQI+LTTLV+ + VLY P+N++L+G+S 
Sbjct  16   DLEAGDLLYPGIGYGENQLRWGFIRKVYGILAAQIVLTTLVSALIVLYDPINQLLRGNSI  75

Query  297  lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILT  476
            LLLFL FLPF+LLWPLHVYQQ+HPLN +FLGLFTASLS  V VSCANTDG IVLEALILT
Sbjct  76   LLLFLCFLPFVLLWPLHVYQQKHPLNLVFLGLFTASLSLTVGVSCANTDGRIVLEALILT  135

Query  477  SAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            SAVV+ LTGYTFWAAKKG+DF+FLGPILFTSL +L+LT F+QMFFPLG
Sbjct  136  SAVVVGLTGYTFWAAKKGKDFSFLGPILFTSLVVLLLTSFLQMFFPLG  183



>ref|XP_008223040.1| PREDICTED: BI1-like protein [Prunus mume]
Length=250

 Score =   202 bits (513),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 159/186 (85%), Gaps = 1/186 (1%)
 Frame = +3

Query  66   KMYGFERVSSSYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlva  242
            KM+G+  V ++   G++ DIE G TLYPG+  GENQLRWGFIRKVYGI++AQ++LTTL++
Sbjct  3    KMHGYTEVGTNSVKGVEVDIESGETLYPGLSKGENQLRWGFIRKVYGILAAQMVLTTLIS  62

Query  243  gvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
             VTVLYAP+N++LKGS  +LLF   LP +LLWPLHVYQQ+HPLNF+FLGLFT  LS  V+
Sbjct  63   FVTVLYAPINDLLKGSPGILLFFAILPLILLWPLHVYQQKHPLNFVFLGLFTLCLSVTVS  122

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQ  602
            V+ ANTDGAIVLEAL+LTSAVV +LT YTFWA+KKG+DF+FLGP+LFT L +L++TGF+Q
Sbjct  123  VAVANTDGAIVLEALVLTSAVVASLTAYTFWASKKGKDFSFLGPVLFTGLIVLLVTGFMQ  182

Query  603  MFFPLG  620
            MFFPLG
Sbjct  183  MFFPLG  188



>ref|XP_010024447.1| PREDICTED: BI1-like protein [Eucalyptus grandis]
Length=244

 Score =   199 bits (506),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 160/187 (86%), Gaps = 8/187 (4%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlv  239
            M G+ RV     G ++ D+E G   TLYPG+ YGENQLRWGFIRKVYGI++AQI+LTT+V
Sbjct  1    MDGYARV-----GKLEKDLELGEGETLYPGLSYGENQLRWGFIRKVYGILTAQIVLTTVV  55

Query  240  agvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPV  419
            + VTVLYAP+N++L+G+S LLLFL+FLP +LLWPLH+YQQ+HPLNFIFLGLFT SLS  V
Sbjct  56   SSVTVLYAPVNDLLRGNSGLLLFLMFLPLVLLWPLHIYQQKHPLNFIFLGLFTLSLSLTV  115

Query  420  AVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfi  599
             VSCANT+G IVLEALILTS+VV ALTGYTFWA+KKG+DF++LGPILFT L +L++T F+
Sbjct  116  GVSCANTEGRIVLEALILTSSVVCALTGYTFWASKKGKDFSYLGPILFTGLIVLLMTSFM  175

Query  600  QMFFPLG  620
            QM FPLG
Sbjct  176  QMMFPLG  182



>ref|XP_010105697.1| hypothetical protein L484_011309 [Morus notabilis]
 gb|EXC05728.1| hypothetical protein L484_011309 [Morus notabilis]
Length=244

 Score =   199 bits (506),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 159/185 (86%), Gaps = 4/185 (2%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvag  245
            MYG+  ++S  +   + D+E G  LYPG+  GENQLRWGFIRKVYGI++AQI+LTT+V+ 
Sbjct  1    MYGYSGLNSKSE---EVDLESGEILYPGLSAGENQLRWGFIRKVYGILTAQIVLTTVVSA  57

Query  246  vtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAV  425
            VTVLYAP+N++L+GS  LLLFL  LP +LLWPLHVYQQ+HPLNFIFLGLFT +LSF V V
Sbjct  58   VTVLYAPVNDLLRGSPGLLLFLAILPLILLWPLHVYQQKHPLNFIFLGLFTVTLSFTVGV  117

Query  426  SCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQM  605
            SCANTDG IVLEALILTSAVV++LTGYTFWA+KKG+DF+FLGPILFT L IL+LTGFIQ 
Sbjct  118  SCANTDGRIVLEALILTSAVVVSLTGYTFWASKKGKDFSFLGPILFTGLIILVLTGFIQA  177

Query  606  FFPLG  620
            FFPLG
Sbjct  178  FFPLG  182



>ref|XP_007223728.1| hypothetical protein PRUPE_ppa010433mg [Prunus persica]
 gb|EMJ24927.1| hypothetical protein PRUPE_ppa010433mg [Prunus persica]
Length=250

 Score =   199 bits (506),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 157/186 (84%), Gaps = 1/186 (1%)
 Frame = +3

Query  66   KMYGFERVSSSYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlva  242
            KM+G+  V ++   G++ DIE G TLYPG+  GENQLRWGFIRKVYGI++AQ++LTTL++
Sbjct  3    KMHGYTEVGTNSVKGVEVDIESGETLYPGLSKGENQLRWGFIRKVYGILAAQMVLTTLIS  62

Query  243  gvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
             VTVLYAP+N++LKGS  +LLF   LP +LLWPLHVYQQ+HPLNF+FLGLFT  LS  V 
Sbjct  63   FVTVLYAPINDLLKGSPGILLFFAILPLILLWPLHVYQQKHPLNFVFLGLFTLCLSVTVG  122

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQ  602
            V+  NTDGAIVLEAL+LTSAVV +LT YTFWA+KKG+DF+FLGP+LFT L +L++TGF+Q
Sbjct  123  VAVGNTDGAIVLEALVLTSAVVASLTAYTFWASKKGKDFSFLGPVLFTGLIVLLVTGFMQ  182

Query  603  MFFPLG  620
            MFFPLG
Sbjct  183  MFFPLG  188



>gb|KHG22240.1| hypothetical protein F383_06527 [Gossypium arboreum]
Length=248

 Score =   199 bits (506),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 155/186 (83%), Gaps = 2/186 (1%)
 Frame = +3

Query  69   MYGFERVSS-SYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlva  242
            MY +ERVSS S     K D+E G TLYPG+ YGENQLRWGFIRKVYGI++AQ++LTT+V+
Sbjct  1    MYRYERVSSTSVSKADKVDLESGDTLYPGLSYGENQLRWGFIRKVYGIVAAQLVLTTVVS  60

Query  243  gvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
               V  AP+NE+L+G+S +LLFL  +PF+LLWPLHVY Q+HP+N I LGLFT SLS  V 
Sbjct  61   AFVVFSAPVNELLRGNSGILLFLCLVPFILLWPLHVYHQKHPVNLIILGLFTVSLSLTVG  120

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQ  602
            VSCANTDG IVLEALILT+ VV +LTGYTFWA+KKG+DF+FLGPILFTSL ILIL+G IQ
Sbjct  121  VSCANTDGRIVLEALILTACVVASLTGYTFWASKKGKDFSFLGPILFTSLIILILSGLIQ  180

Query  603  MFFPLG  620
            MFFPLG
Sbjct  181  MFFPLG  186



>ref|XP_007035358.1| Bax inhibitor-1 family protein isoform 2, partial [Theobroma 
cacao]
 gb|EOY06284.1| Bax inhibitor-1 family protein isoform 2, partial [Theobroma 
cacao]
Length=261

 Score =   198 bits (504),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 166/204 (81%), Gaps = 7/204 (3%)
 Frame = +3

Query  24   HISRERERDLRAKAK-MYGFERVSSSYDGGMKG---DIEEG-TLYPGIGYGENQLRWGFI  188
            H +R++E++   + K M G+ERV+S   G  K    D+E G TLYPGI YGENQLRWGFI
Sbjct  26   HFTRKQEKEQGNREKTMNGYERVNS--KGASKAEQIDLESGETLYPGISYGENQLRWGFI  83

Query  189  RKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHP  368
            RKVYGI++AQ++LTT+V+   VL AP+NE+L+G+S LLLFL  +PF+LLWPLHVY Q+HP
Sbjct  84   RKVYGILAAQLVLTTVVSAFVVLSAPVNELLRGNSGLLLFLCLIPFILLWPLHVYHQKHP  143

Query  369  LNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFL  548
            +N I LGLFT SLS  V VSCANTDG IVLEALILT+ VV +LTGYTFWA+KKG+DF++L
Sbjct  144  VNLIVLGLFTVSLSLTVGVSCANTDGRIVLEALILTAGVVTSLTGYTFWASKKGKDFSYL  203

Query  549  GPilftslfililtgfiQMFFPLG  620
            GPILFTSL ILILTG IQMFFPLG
Sbjct  204  GPILFTSLIILILTGLIQMFFPLG  227



>ref|XP_008390802.1| PREDICTED: BI1-like protein [Malus domestica]
Length=250

 Score =   198 bits (503),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 157/186 (84%), Gaps = 1/186 (1%)
 Frame = +3

Query  66   KMYGFERVSSSYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlva  242
            KM+G+  V ++    ++ DIE G  LYPG+  GENQLRWGFIRKVYGI++AQ++LTTLV+
Sbjct  3    KMHGYTEVGTNSGKAVEVDIESGELLYPGLSKGENQLRWGFIRKVYGILAAQMVLTTLVS  62

Query  243  gvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
             VTVLYAP+N++LKGS  +LLF   LP +LLWPLHVYQQ+HPLNF+FLGLFT SLS  V 
Sbjct  63   FVTVLYAPINDLLKGSPGILLFFAILPLILLWPLHVYQQKHPLNFVFLGLFTLSLSVTVG  122

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQ  602
            V+ ANTDGAIVLEALILTSAVV +LT YTFWA++KG+DF+FLGP+LFT L +L+LTGF+Q
Sbjct  123  VAVANTDGAIVLEALILTSAVVASLTAYTFWASRKGKDFSFLGPVLFTGLIVLLLTGFMQ  182

Query  603  MFFPLG  620
            MFFPLG
Sbjct  183  MFFPLG  188



>ref|XP_011090832.1| PREDICTED: BI1-like protein [Sesamum indicum]
Length=250

 Score =   197 bits (501),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 162/191 (85%), Gaps = 9/191 (5%)
 Frame = +3

Query  69   MYGFERVSSSYDGG---MKG---DIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIll  227
            M+ +  VSS   GG   MKG   DIE G  LYPGIG+GENQLRWGFIRKVYGI+SAQIL+
Sbjct  1    MFNYTSVSSG--GGAAEMKGGEFDIESGDMLYPGIGHGENQLRWGFIRKVYGILSAQILV  58

Query  228  ttlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASL  407
            TT V+ VTVLYAP+N++L+ S  LLLFLVF PF+LLWPLHVYQQ+HPLNF+FLGLFT SL
Sbjct  59   TTAVSAVTVLYAPVNDLLRSSPGLLLFLVFTPFILLWPLHVYQQKHPLNFVFLGLFTVSL  118

Query  408  SFPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfilil  587
            S  V ++CANT+G IVLEALILTSAVV ALTGYTFWAAKKG+DF+FLGPILFTSLFIL+L
Sbjct  119  SLTVGMTCANTEGRIVLEALILTSAVVSALTGYTFWAAKKGKDFSFLGPILFTSLFILVL  178

Query  588  tgfiQMFFPLG  620
            T FIQ+F PLG
Sbjct  179  TSFIQVFCPLG  189



>ref|XP_009352144.1| PREDICTED: BI1-like protein [Pyrus x bretschneideri]
Length=250

 Score =   197 bits (500),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +3

Query  66   KMYGFERVSSSYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlva  242
            KM+G+  V ++     + DIE G  LYPG+  GENQLRWGFIRKVYGI++AQ++LTTLV+
Sbjct  3    KMHGYTEVGTNSGKAAEVDIESGELLYPGLSKGENQLRWGFIRKVYGILAAQMVLTTLVS  62

Query  243  gvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
             VTVLYAP+N++LKGS  +LLF   LP +LLWPLHVYQQ+HPLNF+FLGLFT SLS  V 
Sbjct  63   FVTVLYAPINDLLKGSPGILLFFAILPLILLWPLHVYQQKHPLNFVFLGLFTLSLSVTVG  122

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQ  602
            V+ ANTDGAIVLEALILTSAVV +LT YTFWA++KG+DF+FLGP+LFT L IL+LTGF+Q
Sbjct  123  VAVANTDGAIVLEALILTSAVVASLTAYTFWASRKGKDFSFLGPVLFTGLVILLLTGFMQ  182

Query  603  MFFPLG  620
            MFFPLG
Sbjct  183  MFFPLG  188



>ref|XP_009339935.1| PREDICTED: BI1-like protein [Pyrus x bretschneideri]
Length=252

 Score =   196 bits (498),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 158/187 (84%), Gaps = 2/187 (1%)
 Frame = +3

Query  66   KMYGFERVSSSYDG-GMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlv  239
            KM+G+  V ++  G  ++ DIE G  LYPG+  GENQLRWGFIRKVYGI++AQ++LTT++
Sbjct  4    KMHGYTEVGTNSGGKAVEVDIESGELLYPGLSKGENQLRWGFIRKVYGILAAQMVLTTMI  63

Query  240  agvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPV  419
            + VTVLYAP+N++LKGS  +LLF   LP +LLWPLHVYQQ+HPLNF+FLGLFT SLS  V
Sbjct  64   SFVTVLYAPINDLLKGSPGILLFFAILPLILLWPLHVYQQKHPLNFVFLGLFTLSLSVTV  123

Query  420  AVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfi  599
             V+ ANTDGAIVLEALILTSAVV +LT YTFWA++KG+DF+FLGP+LFT L +L+LTGF+
Sbjct  124  GVAVANTDGAIVLEALILTSAVVASLTAYTFWASRKGKDFSFLGPVLFTGLIVLLLTGFM  183

Query  600  QMFFPLG  620
            QMFFPLG
Sbjct  184  QMFFPLG  190



>ref|XP_010279039.1| PREDICTED: BI1-like protein [Nelumbo nucifera]
Length=242

 Score =   196 bits (497),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 134/186 (72%), Positives = 158/186 (85%), Gaps = 9/186 (5%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDI--EEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlva  242
            MYGF  +S       KGD+  E GTLYPG+ YGEN+LRWGFIRKVYGI+SAQ++LTT+V+
Sbjct  1    MYGFTSLS-------KGDLDLESGTLYPGLSYGENELRWGFIRKVYGILSAQVVLTTIVS  53

Query  243  gvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
              TVLY+P+NE+L+ SS LLLFL FLP +L+WPL+VYQQ+HPLN +FLGLFTASLS  V 
Sbjct  54   SATVLYSPINELLRSSSGLLLFLTFLPLILMWPLYVYQQKHPLNLVFLGLFTASLSITVG  113

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQ  602
            V CANT+G IVLEALILTSAVV ALTGYTFWA+KKG+DF+FLGPILF SL +L+LTGFIQ
Sbjct  114  VVCANTEGRIVLEALILTSAVVCALTGYTFWASKKGKDFSFLGPILFASLLVLVLTGFIQ  173

Query  603  MFFPLG  620
            MFFPLG
Sbjct  174  MFFPLG  179



>gb|KHG20306.1| hypothetical protein F383_02282 [Gossypium arboreum]
Length=248

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 159/186 (85%), Gaps = 2/186 (1%)
 Frame = +3

Query  69   MYGFERVS-SSYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlva  242
            M+G++RV+ SS +   + D+E G TLYPG+ YGENQLRWGFIRKVYGI++AQ++LTT+V+
Sbjct  1    MFGYDRVNHSSANKADEIDLESGETLYPGLSYGENQLRWGFIRKVYGILAAQLVLTTVVS  60

Query  243  gvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
               VL AP+NE+L+G+S LLLFL  +PF+LLWPLHVY Q+HP+N + LGLFT SLS  V 
Sbjct  61   AFVVLSAPVNELLRGNSGLLLFLCLIPFVLLWPLHVYHQKHPVNLVILGLFTVSLSLTVG  120

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQ  602
            VSCANTDG IVLEALILT+AVV +LTGYTFWA+KKG+DF++LGPILFTSL ILILTG IQ
Sbjct  121  VSCANTDGRIVLEALILTAAVVASLTGYTFWASKKGKDFSYLGPILFTSLIILILTGLIQ  180

Query  603  MFFPLG  620
            MFFPLG
Sbjct  181  MFFPLG  186



>ref|XP_010693836.1| PREDICTED: BI1-like protein [Beta vulgaris subsp. vulgaris]
Length=238

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  111  MKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            +KGDIEEGTLYPG+GYGE QLRWGFIRKVYGI+SAQ++LTTLV+ +TVLY+P+NE L+G+
Sbjct  7    VKGDIEEGTLYPGLGYGETQLRWGFIRKVYGILSAQLILTTLVSLLTVLYSPINETLRGN  66

Query  291  SAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALI  470
            SALLLF  F+PF+LLWPL+ YQQ+HP N IFLGLFT  LS  V V+CANTDG IV++AL+
Sbjct  67   SALLLFFAFMPFILLWPLYHYQQKHPQNLIFLGLFTLCLSLTVGVACANTDGKIVIQALV  126

Query  471  LTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LT+AVV +LT YTFWAAKKG+DF+FLGP+LF SL  +I  G +Q+FFP G
Sbjct  127  LTAAVVCSLTAYTFWAAKKGKDFSFLGPVLFASLVGIIFAGLLQVFFPFG  176



>ref|XP_009624081.1| PREDICTED: BI1-like protein [Nicotiana tomentosiformis]
Length=240

 Score =   195 bits (495),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 153/174 (88%), Gaps = 1/174 (1%)
 Frame = +3

Query  102  DGGMKGDIEEGTL-YPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEV  278
            + G+KGDIE G L YPGIG GEN+LRWGFIRKVY I++AQILLTT+V+ VT LY P+N++
Sbjct  8    NDGVKGDIEGGNLLYPGIGNGENELRWGFIRKVYYILAAQILLTTVVSAVTALYTPINQL  67

Query  279  LKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            L+G+  LL+ L+FLP +LLWPL+++QQ+HPLNF+FLGLFT SLSF V VSCANTDG IVL
Sbjct  68   LRGNIVLLILLIFLPLILLWPLYIFQQKHPLNFVFLGLFTVSLSFGVGVSCANTDGRIVL  127

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EALILTSAVVL+LTGYTFWA++KG+DF+FLGP LF SL +L+L GFIQ+FFPLG
Sbjct  128  EALILTSAVVLSLTGYTFWASRKGQDFSFLGPFLFASLSVLVLVGFIQIFFPLG  181



>ref|XP_008340894.1| PREDICTED: BI1-like protein [Malus domestica]
Length=252

 Score =   195 bits (495),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 156/187 (83%), Gaps = 2/187 (1%)
 Frame = +3

Query  66   KMYGFERVSSSYDG-GMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlv  239
            KM+G+  V ++  G   + DIE G  LYPG+  GENQLRWGFIRKVYGI++AQ++LTT +
Sbjct  4    KMHGYTEVGTNSGGKAAEVDIESGELLYPGLSKGENQLRWGFIRKVYGILAAQMVLTTXI  63

Query  240  agvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPV  419
            + VTVLYAP+N++LKGS  +LLF   LP +LLWPLHVYQQ+HPLNF+FLGLFT SLS  V
Sbjct  64   SFVTVLYAPINDLLKGSPGILLFFAILPLILLWPLHVYQQKHPLNFVFLGLFTLSLSVTV  123

Query  420  AVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfi  599
             V+ ANTDGAIVLEALILTSAVV +LT YTFWA++KG+DF+FLGP+LFT L +L+LTGF+
Sbjct  124  GVAVANTDGAIVLEALILTSAVVASLTAYTFWASRKGKDFSFLGPVLFTGLIVLLLTGFM  183

Query  600  QMFFPLG  620
            QMFFPLG
Sbjct  184  QMFFPLG  190



>ref|XP_009785292.1| PREDICTED: BI1-like protein [Nicotiana sylvestris]
Length=240

 Score =   193 bits (490),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 152/174 (87%), Gaps = 1/174 (1%)
 Frame = +3

Query  102  DGGMKGDIEEGTL-YPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEV  278
            + G+KGDIE G L YPGIG GEN+LRWGFIRKVY I++AQILLTT+V+ VT LY P+N++
Sbjct  8    NDGVKGDIEGGNLLYPGIGNGENELRWGFIRKVYYILAAQILLTTVVSAVTALYTPINQL  67

Query  279  LKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            L G+  LL+ L+FLP +LLWPL+++QQ+HPLNF+FLGLFT SLSF V V+CANTDG IVL
Sbjct  68   LSGNIVLLILLIFLPLILLWPLYIFQQKHPLNFVFLGLFTVSLSFGVGVTCANTDGRIVL  127

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EALILTSAVVL+LTGYTFWA++KG+DF+FLGP LF SL +L+L GF+Q+FFPLG
Sbjct  128  EALILTSAVVLSLTGYTFWASRKGQDFSFLGPFLFASLSVLVLVGFLQIFFPLG  181



>ref|XP_007035357.1| Bax inhibitor-1 family protein isoform 1 [Theobroma cacao]
 gb|EOY06283.1| Bax inhibitor-1 family protein isoform 1 [Theobroma cacao]
Length=248

 Score =   193 bits (490),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 156/188 (83%), Gaps = 6/188 (3%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKG---DIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttl  236
            M G+ERV+S   G  K    D+E G TLYPGI YGENQLRWGFIRKVYGI++AQ++LTT+
Sbjct  1    MNGYERVNSK--GASKAEQIDLESGETLYPGISYGENQLRWGFIRKVYGILAAQLVLTTV  58

Query  237  vagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFP  416
            V+   VL AP+NE+L+G+S LLLFL  +PF+LLWPLHVY Q+HP+N I LGLFT SLS  
Sbjct  59   VSAFVVLSAPVNELLRGNSGLLLFLCLIPFILLWPLHVYHQKHPVNLIVLGLFTVSLSLT  118

Query  417  VAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgf  596
            V VSCANTDG IVLEALILT+ VV +LTGYTFWA+KKG+DF++LGPILFTSL ILILTG 
Sbjct  119  VGVSCANTDGRIVLEALILTAGVVTSLTGYTFWASKKGKDFSYLGPILFTSLIILILTGL  178

Query  597  iQMFFPLG  620
            IQMFFPLG
Sbjct  179  IQMFFPLG  186



>ref|XP_004144961.1| PREDICTED: BI1-like protein-like [Cucumis sativus]
 ref|XP_004153426.1| PREDICTED: BI1-like protein-like [Cucumis sativus]
 ref|XP_004168808.1| PREDICTED: BI1-like protein-like [Cucumis sativus]
 ref|XP_008458536.1| PREDICTED: BI1-like protein [Cucumis melo]
 gb|KGN46165.1| hypothetical protein Csa_6G061760 [Cucumis sativus]
Length=244

 Score =   192 bits (489),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 127/185 (69%), Positives = 160/185 (86%), Gaps = 4/185 (2%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvag  245
            M+G+  VS+    G + D+E G TLYPG+ YGENQLRWGFIRKVYGI++AQI+LTT+V+ 
Sbjct  1    MFGYTGVSNK---GGEVDLESGETLYPGLSYGENQLRWGFIRKVYGILAAQIVLTTIVSS  57

Query  246  vtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAV  425
            VTVLY+P+N++L+G+S LLLFL FLP +LLWP+++Y+Q+HPLN +FLG+FTA+LS  V V
Sbjct  58   VTVLYSPINDLLRGNSGLLLFLCFLPLILLWPMYIYRQKHPLNLVFLGIFTATLSLTVGV  117

Query  426  SCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQM  605
            SCANTDG IVLEALILTSAVV +LTGYTFWA+KKG+DF++LGP LFT+L IL+LT FIQ 
Sbjct  118  SCANTDGRIVLEALILTSAVVSSLTGYTFWASKKGKDFSYLGPFLFTALMILLLTSFIQA  177

Query  606  FFPLG  620
            FFPLG
Sbjct  178  FFPLG  182



>ref|XP_004297019.1| PREDICTED: BI1-like protein [Fragaria vesca subsp. vesca]
Length=249

 Score =   192 bits (489),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 150/182 (82%), Gaps = 1/182 (1%)
 Frame = +3

Query  78   FERVSSSYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtv  254
            +  VS++     + DIE G  LYPGI  GENQLRWGFIRKVYGI+SAQ+LLTT ++ VTV
Sbjct  6    YAEVSTTAGKLEEVDIESGELLYPGISKGENQLRWGFIRKVYGILSAQLLLTTAISFVTV  65

Query  255  lYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCA  434
            LY P+N++LKGS  LLLF  FLP +LLWPLHVYQQRHPLNFIFLGLFT SLS  V V+ A
Sbjct  66   LYTPVNDLLKGSPGLLLFFAFLPLVLLWPLHVYQQRHPLNFIFLGLFTLSLSVTVGVAVA  125

Query  435  NTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFP  614
            NTDGAIVLEALILTS VV +LT YTFWA+KKG+DF+FLGP+LFT L +L+LT F+QMFFP
Sbjct  126  NTDGAIVLEALILTSGVVASLTAYTFWASKKGKDFSFLGPVLFTGLMVLLLTSFMQMFFP  185

Query  615  LG  620
            LG
Sbjct  186  LG  187



>gb|KJB74487.1| hypothetical protein B456_011G181100 [Gossypium raimondii]
Length=248

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 153/186 (82%), Gaps = 2/186 (1%)
 Frame = +3

Query  69   MYGFERVSS-SYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlva  242
            M  +ERVSS S     K D+E G TLY G+ YGENQLRWGFIRKVYGI++AQ++LTT+V+
Sbjct  1    MSRYERVSSTSASKADKVDLESGDTLYRGLSYGENQLRWGFIRKVYGILAAQLVLTTVVS  60

Query  243  gvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
               V  AP+NE+L+G+S +LLFL  +PF+LLWPLHVY Q+HP+N I LGLFT SLS  V 
Sbjct  61   AFVVFSAPVNELLRGNSGILLFLCLVPFILLWPLHVYHQKHPVNLIILGLFTVSLSLTVG  120

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQ  602
            VSCANTDG IVLEALILT+ VV +LTGYTFWA+KKG+DF+FLGPILFTSL ILILTG IQ
Sbjct  121  VSCANTDGRIVLEALILTAGVVASLTGYTFWASKKGKDFSFLGPILFTSLIILILTGLIQ  180

Query  603  MFFPLG  620
            MFFPLG
Sbjct  181  MFFPLG  186



>gb|EPS68151.1| hypothetical protein M569_06622, partial [Genlisea aurea]
Length=250

 Score =   190 bits (483),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 158/189 (84%), Gaps = 4/189 (2%)
 Frame = +3

Query  66   KMYGFERVSSSYDGGMKG---DIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIlltt  233
            KM  +  V S     MK    D+E G +LYPGIG GEN+LRWGFIRKVYGI++AQIL+TT
Sbjct  1    KMQAYTAVGSVEADEMKKVEIDLESGESLYPGIGRGENRLRWGFIRKVYGILAAQILITT  60

Query  234  lvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSF  413
             V+ VTVLYAP+N++L+GS  L++FL+F PF+L+WPL++Y+Q+HPLN +FLGLFT SLS 
Sbjct  61   AVSAVTVLYAPVNDLLRGSPGLMMFLIFTPFILMWPLYIYRQKHPLNLVFLGLFTTSLSL  120

Query  414  PVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtg  593
             V VSCANT+G IVLEALILTSAVV  LTGYTFWAAKKG+DF+FLGPILFTSL IL+LTG
Sbjct  121  TVGVSCANTEGYIVLEALILTSAVVSGLTGYTFWAAKKGKDFSFLGPILFTSLSILLLTG  180

Query  594  fiQMFFPLG  620
            FIQ+FFPLG
Sbjct  181  FIQVFFPLG  189



>ref|XP_010524498.1| PREDICTED: BI1-like protein [Tarenaya hassleriana]
Length=255

 Score =   189 bits (481),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 154/191 (81%), Gaps = 6/191 (3%)
 Frame = +3

Query  66   KMYGFERVS--SSYDGGMKGDIE----EGTLYPGIGYGENQLRWGFIRKVYGIISAQIll  227
            K YG+  V+  SS+  G   D+E    E TLYPG+ +GENQLRWGFIRKVYGI+SAQ+LL
Sbjct  3    KPYGYASVNAGSSFSVGKDVDLEMGGGEATLYPGLSFGENQLRWGFIRKVYGILSAQLLL  62

Query  228  ttlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASL  407
            TT+++ V VL  P+ E+L GS  LLLFL  +PF+L+WPLH+Y Q+HP+N I LGLFT SL
Sbjct  63   TTVISAVVVLNPPVTELLTGSPGLLLFLCIVPFVLIWPLHIYHQKHPVNLILLGLFTVSL  122

Query  408  SFPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfilil  587
            SF V VSCANTDG IVLEALILT AVV +LT YTFWAAKKG+DF+FLGPILFTSL IL++
Sbjct  123  SFTVGVSCANTDGRIVLEALILTLAVVSSLTAYTFWAAKKGKDFSFLGPILFTSLIILVV  182

Query  588  tgfiQMFFPLG  620
            TGFIQMFFPLG
Sbjct  183  TGFIQMFFPLG  193



>ref|XP_009419853.1| PREDICTED: BI1-like protein [Musa acuminata subsp. malaccensis]
Length=246

 Score =   189 bits (479),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 145/184 (79%), Gaps = 2/184 (1%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagv  248
            M+G+ERV      G  GDIE GTLYPG+  G+N+LRWGF+RKVYGI++AQ+LLTT V+  
Sbjct  1    MHGYERVEKGAAPG--GDIEAGTLYPGLSRGDNELRWGFVRKVYGILAAQVLLTTAVSAA  58

Query  249  tvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVS  428
            TVLY P+N  L  S  L L L FLP  LL PL+ YQQ+HPLNF+FLGLFT  LS  V V+
Sbjct  59   TVLYRPVNAALASSPGLALCLAFLPLFLLCPLYYYQQKHPLNFLFLGLFTVCLSLSVGVA  118

Query  429  CANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMF  608
            CANT G IVLEALILTSAVVL+LTGYTFWA++KG+DF++LGPI+F+ L +L L+ FIQ+F
Sbjct  119  CANTQGRIVLEALILTSAVVLSLTGYTFWASRKGKDFSYLGPIVFSGLMVLFLSTFIQIF  178

Query  609  FPLG  620
            FPLG
Sbjct  179  FPLG  182



>ref|XP_002312729.1| hypothetical protein POPTR_0008s20370g [Populus trichocarpa]
 gb|EEE90096.1| hypothetical protein POPTR_0008s20370g [Populus trichocarpa]
Length=252

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 152/190 (80%), Gaps = 4/190 (2%)
 Frame = +3

Query  60   KAKMYGFERVSSSYDGGMKGDIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllt  230
             A+M+G+  VS+  D G + D+E G   TLYPG+  GENQLRWG IRKVYGI++AQ++LT
Sbjct  2    SAEMFGYSSVSNK-DAGKEVDLEAGNGETLYPGLSLGENQLRWGLIRKVYGILAAQLILT  60

Query  231  tlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLS  410
            T+VA  TVLY P+ ++L+GS   ++ L  +PF+LLWPLHVY Q+HP+N I LGLFT SLS
Sbjct  61   TIVAAATVLYTPITDLLRGSFGFVMLLSIVPFILLWPLHVYHQKHPVNLIILGLFTVSLS  120

Query  411  FPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililt  590
              V  SCAN +G IVLEALILTSAVV +LTGYTFWA+KKG+DF+FLGPILFT+L ILILT
Sbjct  121  LLVGASCANIEGKIVLEALILTSAVVCSLTGYTFWASKKGKDFSFLGPILFTALIILILT  180

Query  591  gfiQMFFPLG  620
             FIQ+FFPLG
Sbjct  181  SFIQVFFPLG  190



>ref|XP_002516809.1| Transmembrane BAX inhibitor motif-containing protein, putative 
[Ricinus communis]
 gb|EEF45423.1| Transmembrane BAX inhibitor motif-containing protein, putative 
[Ricinus communis]
Length=210

 Score =   187 bits (475),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 147/187 (79%), Gaps = 6/187 (3%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlv  239
            MYGF  +SS      + D+E G   TLYPG+G GENQLRWG IRKVYGI+SAQ+LLTT+V
Sbjct  1    MYGFTSLSSKEK---EVDLEAGNGETLYPGLGVGENQLRWGLIRKVYGILSAQLLLTTIV  57

Query  240  agvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPV  419
            +  TVLY P N +L  S  LLL L  +PF+LLWPLHVY Q+HP+N I LGLFT SLS  V
Sbjct  58   SAATVLYTPFNTLLGDSPGLLLLLCIVPFVLLWPLHVYHQKHPVNLIVLGLFTVSLSLLV  117

Query  420  AVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfi  599
             VSCA TDG IVLEALILTSAVV +LT YTFWAAKKG+DF+FLGPILFTSL ILILT FI
Sbjct  118  GVSCAQTDGKIVLEALILTSAVVCSLTAYTFWAAKKGQDFSFLGPILFTSLIILILTSFI  177

Query  600  QMFFPLG  620
            QMFFPLG
Sbjct  178  QMFFPLG  184



>ref|XP_009414206.1| PREDICTED: BI1-like protein [Musa acuminata subsp. malaccensis]
Length=246

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 144/184 (78%), Gaps = 2/184 (1%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagv  248
            MYG++RV      G+  DIE GTLYPG+  GEN LRWGFIRKVYGI++ Q+LLTT V+  
Sbjct  1    MYGYDRVEKGVAPGL--DIEAGTLYPGLSLGENDLRWGFIRKVYGILAVQVLLTTAVSAA  58

Query  249  tvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVS  428
            TV Y P+N  L  S  L L L  LP  LL+PL+ YQQ+HPLNF+FLGLFT  LS  V V+
Sbjct  59   TVFYRPVNAALASSPGLALVLALLPLFLLFPLYHYQQKHPLNFLFLGLFTVCLSLSVGVA  118

Query  429  CANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMF  608
            CANT G IVLEALILTSAVVL+LTGYTFWA++KG+DF++LGPILF++L +L+LT FIQ+F
Sbjct  119  CANTQGRIVLEALILTSAVVLSLTGYTFWASRKGKDFSYLGPILFSALTVLLLTTFIQIF  178

Query  609  FPLG  620
            FPLG
Sbjct  179  FPLG  182



>gb|KDP40073.1| hypothetical protein JCGZ_02071 [Jatropha curcas]
Length=246

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 148/187 (79%), Gaps = 6/187 (3%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlv  239
            M+GF  +S+      + D+E G   TLYPG+G GENQLRWG IRKVYGI++ Q++LTT+V
Sbjct  1    MHGFTSLSTK---DKEVDLEAGNGETLYPGLGLGENQLRWGLIRKVYGILAVQLILTTIV  57

Query  240  agvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPV  419
            +  TVLY P+N +L  S  LLL L  +PF+LLWPLHVY Q+HP+N I LGLFT SLSF V
Sbjct  58   SATTVLYTPINNLLAESPGLLLLLCIVPFVLLWPLHVYHQKHPVNLIILGLFTVSLSFLV  117

Query  420  AVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfi  599
             VSCANTDG IVLEALILTSAVV +LT YTFWAAKKG+DF+FLGPILFT L ILILT FI
Sbjct  118  GVSCANTDGKIVLEALILTSAVVCSLTAYTFWAAKKGKDFSFLGPILFTGLIILILTSFI  177

Query  600  QMFFPLG  620
            QMFFPLG
Sbjct  178  QMFFPLG  184



>ref|XP_011006595.1| PREDICTED: BI1-like protein [Populus euphratica]
Length=248

 Score =   187 bits (476),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 150/187 (80%), Gaps = 4/187 (2%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlv  239
            MYG+  VS+  DG  + D+E G   TLYPG+  GENQLRWG IRKVYGI++AQ++LTT+V
Sbjct  1    MYGYASVSNK-DGAKEIDLEAGNGETLYPGLSLGENQLRWGLIRKVYGILAAQLVLTTIV  59

Query  240  agvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPV  419
            + VT+LY P+ ++LKGS   +LFL   PF+LLWPLHVY Q+HP+N I LGLFT SLS  V
Sbjct  60   SAVTILYTPMTDLLKGSFGFVLFLSIAPFILLWPLHVYHQKHPVNLIILGLFTVSLSLLV  119

Query  420  AVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfi  599
              SCAN +G IVLEALILTSAVV +LT YTFWAAKKG+DF+FLGPILFTSL ILILT FI
Sbjct  120  GASCANIEGKIVLEALILTSAVVCSLTAYTFWAAKKGKDFSFLGPILFTSLIILILTSFI  179

Query  600  QMFFPLG  620
            Q+FFPLG
Sbjct  180  QVFFPLG  186



>gb|KJB34591.1| hypothetical protein B456_006G074200 [Gossypium raimondii]
Length=831

 Score =   197 bits (500),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 159/189 (84%), Gaps = 2/189 (1%)
 Frame = +3

Query  60   KAKMYGFERVS-SSYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIlltt  233
            + KM+ ++RVS SS +   + D+E G TLYPG+ YGENQLRWGFIRKVYGI++AQ++LTT
Sbjct  581  REKMFAYDRVSHSSANKADEIDLESGETLYPGLSYGENQLRWGFIRKVYGILAAQLVLTT  640

Query  234  lvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSF  413
            +V+   VL AP+NE+L+G+S LLLFL  +PF+LLWPLHVY Q+HP+N + LGLFT SLS 
Sbjct  641  VVSAFVVLSAPVNELLRGNSGLLLFLCLIPFVLLWPLHVYHQKHPVNLVILGLFTVSLSL  700

Query  414  PVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtg  593
             V VSCANTDG IVLEALILT+AVV +LTGYTFWA+KKG+DF++LGPILFT L ILILTG
Sbjct  701  TVGVSCANTDGRIVLEALILTAAVVASLTGYTFWASKKGKDFSYLGPILFTGLIILILTG  760

Query  594  fiQMFFPLG  620
             IQMFFPLG
Sbjct  761  LIQMFFPLG  769



>ref|XP_002314428.1| hypothetical protein POPTR_0010s02990g [Populus trichocarpa]
 gb|ABK94990.1| unknown [Populus trichocarpa]
 gb|EEF00599.1| hypothetical protein POPTR_0010s02990g [Populus trichocarpa]
Length=248

 Score =   186 bits (473),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 151/187 (81%), Gaps = 4/187 (2%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlv  239
            MYG+  VS+  DG  + D+E G   +LYPG+  GENQLRWG IRKVYGI++AQ++LTT+V
Sbjct  1    MYGYASVSNK-DGAKEIDLEAGNRESLYPGLSLGENQLRWGLIRKVYGILAAQLVLTTIV  59

Query  240  agvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPV  419
            + VT+LY P+ ++LKGS   +LFL  +PF+LLWPLHVY Q+HP+N I LGLFT SLS  V
Sbjct  60   SAVTILYTPMTDLLKGSFGFVLFLSIVPFILLWPLHVYHQKHPVNLIILGLFTVSLSLLV  119

Query  420  AVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfi  599
              SCAN +G IVLEALILTSAVV +LT YTFWAAKKG+DF+FLGPILFTSL ILILT FI
Sbjct  120  GASCANIEGKIVLEALILTSAVVCSLTAYTFWAAKKGKDFSFLGPILFTSLIILILTSFI  179

Query  600  QMFFPLG  620
            Q+FFPLG
Sbjct  180  QVFFPLG  186



>emb|CDX90589.1| BnaA03g41920D [Brassica napus]
Length=255

 Score =   186 bits (473),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 150/191 (79%), Gaps = 6/191 (3%)
 Frame = +3

Query  66   KMYGFERVSSSYDGGMKGDIE------EGTLYPGIGYGENQLRWGFIRKVYGIISAQIll  227
            K YG+  VS S D     DI+      E TLYPG+ YGENQLRWGFIRKVYGI+SAQ+LL
Sbjct  3    KPYGYASVSMSGDRAAGKDIDLEMGTGEATLYPGLSYGENQLRWGFIRKVYGILSAQLLL  62

Query  228  ttlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASL  407
            TTL++ V VL  P+N+VL GS  LLLFL  +PF+L+WPLHVY Q+HP+N I L LFT SL
Sbjct  63   TTLISAVVVLNPPVNDVLTGSPGLLLFLCIIPFVLIWPLHVYHQKHPVNLILLALFTISL  122

Query  408  SFPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfilil  587
            SF V VSCA T+G IVLEALILT +VV +LT YTFWAAKKG+DF+FLGPILFTSL IL++
Sbjct  123  SFTVGVSCAMTEGRIVLEALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILVV  182

Query  588  tgfiQMFFPLG  620
            T F+QMFFPLG
Sbjct  183  TSFMQMFFPLG  193



>ref|XP_008809232.1| PREDICTED: BI1-like protein [Phoenix dactylifera]
Length=244

 Score =   186 bits (472),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 147/184 (80%), Gaps = 4/184 (2%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagv  248
            MYG+  V    +    GD+E G+LYPG+  GEN LRWGF+RKVYGI++AQ+LLTT+V+  
Sbjct  1    MYGYTSV----EKAAGGDLEAGSLYPGLSRGENDLRWGFVRKVYGILAAQLLLTTVVSAA  56

Query  249  tvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVS  428
            TVL A +NE+L GSS L L L  LP  L++PL++YQQ+HPLNFIFLGLFT  LS  V V+
Sbjct  57   TVLNASINELLTGSSGLALGLALLPLFLMFPLYLYQQKHPLNFIFLGLFTLCLSLSVGVA  116

Query  429  CANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMF  608
            CANT G IVLEALILTSAVV +LTGYTFWA+KKG+DF++LGPILF SL +L+LT FIQ+F
Sbjct  117  CANTQGRIVLEALILTSAVVSSLTGYTFWASKKGKDFSYLGPILFASLLVLLLTSFIQIF  176

Query  609  FPLG  620
            FPLG
Sbjct  177  FPLG  180



>emb|CDY09066.1| BnaC08g10200D [Brassica napus]
Length=256

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 151/192 (79%), Gaps = 7/192 (4%)
 Frame = +3

Query  66   KMYGFERVSSSYDG-----GMKGDIE--EGTLYPGIGYGENQLRWGFIRKVYGIISAQIl  224
            K YG+  VS S  G     G   D+E  E TLYPG+ YGENQLRWGFIRKVYGI+SAQ+L
Sbjct  3    KPYGYASVSMSMSGVDRSAGKDIDLEMGEATLYPGLSYGENQLRWGFIRKVYGILSAQLL  62

Query  225  lttlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTAS  404
            LTTL++ V VL  P+NE+L GS  LLLFL  +PF+L+WPLHVY Q+HP+N I L LFT S
Sbjct  63   LTTLISAVVVLNPPVNELLTGSPGLLLFLCIIPFVLIWPLHVYHQKHPVNLILLALFTIS  122

Query  405  LSFPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfili  584
            LSF V VSCA T+G IVLEALILT +VV +LT YTFWAAKKG+DF+FLGPILFTSL IL+
Sbjct  123  LSFTVGVSCAMTEGRIVLEALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILV  182

Query  585  ltgfiQMFFPLG  620
            +T F+QMFFPLG
Sbjct  183  VTSFMQMFFPLG  194



>ref|XP_011006069.1| PREDICTED: BI1-like protein [Populus euphratica]
Length=252

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 151/190 (79%), Gaps = 4/190 (2%)
 Frame = +3

Query  60   KAKMYGFERVSSSYDGGMKGDIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllt  230
             A+M+ +  VS+  D G + D+E G   TLYPG+  GENQLRWG IRKVYGI++AQ++LT
Sbjct  2    SAEMFRYSSVSNK-DAGKEVDLEAGNGETLYPGLSLGENQLRWGLIRKVYGILAAQLVLT  60

Query  231  tlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLS  410
            T+VA  TVLY P+ ++L+GS   ++ L  +PF+LLWPLHVY Q+HP+N I LGLFT SLS
Sbjct  61   TIVAAATVLYTPITDLLRGSFGFVMLLSIVPFILLWPLHVYHQKHPVNLIILGLFTVSLS  120

Query  411  FPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililt  590
              V  SCAN +G IVLEALILTSAVV +LTGYTFWA+KKG+DF+FLGPILFT+L ILILT
Sbjct  121  LLVGASCANIEGKIVLEALILTSAVVCSLTGYTFWASKKGKDFSFLGPILFTALIILILT  180

Query  591  gfiQMFFPLG  620
             FIQ+FFPLG
Sbjct  181  SFIQVFFPLG  190



>ref|XP_008776713.1| PREDICTED: BI1-like protein [Phoenix dactylifera]
Length=247

 Score =   185 bits (469),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 146/185 (79%), Gaps = 4/185 (2%)
 Frame = +3

Query  66   KMYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvag  245
            +MYG+  V  +      GD+E GTLYPGI  GE++LRWGF+RKVYGI++AQ++LTT+V+ 
Sbjct  3    EMYGYASVEKA----AGGDLEAGTLYPGISRGESELRWGFVRKVYGILAAQLVLTTVVSA  58

Query  246  vtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAV  425
             TVL A +N +L GSS L L    LP  L++PL+ YQQ+HPLNFIFLGLFT  LS  V V
Sbjct  59   ATVLNASINNLLTGSSGLALGFAILPLFLMFPLYHYQQKHPLNFIFLGLFTVCLSLSVGV  118

Query  426  SCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQM  605
            +CANT G IVLEAL+LTSAVVL+LTGYTFWA+KKG+DF++LGPILF  L +L+LT FIQ+
Sbjct  119  ACANTQGRIVLEALVLTSAVVLSLTGYTFWASKKGKDFSYLGPILFAGLLVLLLTSFIQI  178

Query  606  FFPLG  620
            FFPLG
Sbjct  179  FFPLG  183



>gb|KHG16370.1| hypothetical protein F383_22614 [Gossypium arboreum]
Length=248

 Score =   184 bits (466),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 147/186 (79%), Gaps = 2/186 (1%)
 Frame = +3

Query  69   MYGFERVS-SSYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlva  242
            MYG+E +S +      + D+E G TLYPG+GYGEN+LRWGFIRKVYGI++ Q+LLTT+V+
Sbjct  1    MYGYESLSRTDARKAEQIDLESGETLYPGLGYGENELRWGFIRKVYGILAVQLLLTTVVS  60

Query  243  gvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
               V    + ++L+G+S LLLF   +P +L+WPLHVY Q+HPLNFI LG FT  LS  V 
Sbjct  61   AFVVSSPSIIDLLRGNSGLLLFFCLVPLILVWPLHVYHQKHPLNFIILGAFTVFLSLTVG  120

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQ  602
            VSCANTDG IVLEALILT+AVV +LTGYTFWA+K G+DFN+LGPILFTSL IL+LT  IQ
Sbjct  121  VSCANTDGRIVLEALILTAAVVTSLTGYTFWASKNGKDFNYLGPILFTSLVILVLTSLIQ  180

Query  603  MFFPLG  620
            MFFPLG
Sbjct  181  MFFPLG  186



>ref|XP_002870236.1| hypothetical protein ARALYDRAFT_493344 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46495.1| hypothetical protein ARALYDRAFT_493344 [Arabidopsis lyrata subsp. 
lyrata]
Length=256

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 150/188 (80%), Gaps = 1/188 (1%)
 Frame = +3

Query  57   AKAKMYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttl  236
            A   M G +R S+  D  ++  + E TLYPG+ YGENQLRWGFIRKVYGI+SAQ+LLTTL
Sbjct  8    ASVSMSGIDR-SAGKDIDLEMGVGEATLYPGLSYGENQLRWGFIRKVYGILSAQLLLTTL  66

Query  237  vagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFP  416
            ++ V VL  P+N+VL GS  +LLFL  +PF+L+WPLH+Y Q+HP+N I L LFT SLSF 
Sbjct  67   ISAVVVLNPPVNDVLTGSPGILLFLCIVPFILIWPLHIYHQKHPVNLILLALFTVSLSFT  126

Query  417  VAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgf  596
            V VSCA T+G IVL+ALILT +VV +LT YTFWAAKKG+DF+FLGPILFTSL IL++T F
Sbjct  127  VGVSCAMTEGRIVLQALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILVVTSF  186

Query  597  iQMFFPLG  620
            IQMFFPLG
Sbjct  187  IQMFFPLG  194



>ref|XP_003546118.1| PREDICTED: BI1-like protein-like [Glycine max]
 gb|KHN33086.1| BI1-like protein [Glycine soja]
Length=246

 Score =   183 bits (464),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = +3

Query  120  DIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA  296
            D+E G TLYPG+  GENQLRWGFIRKVYGI+SAQI+LTTLV+  TV Y P+N++LKG+S 
Sbjct  17   DLESGETLYPGLSVGENQLRWGFIRKVYGILSAQIVLTTLVSVTTVFYTPINDLLKGNST  76

Query  297  lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILT  476
            LLL L+FLPF+ L PL  YQQ+HP N+I L LFT S+S  V V+CANTDG IVLEALILT
Sbjct  77   LLLILLFLPFIFLIPLLKYQQKHPHNYILLALFTVSISSTVGVTCANTDGKIVLEALILT  136

Query  477  SAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            SAVV +LTGY FWA+KKG+DF+FLGP+LFTSLF LILTG +QMFFPLG
Sbjct  137  SAVVSSLTGYAFWASKKGKDFSFLGPVLFTSLFTLILTGMMQMFFPLG  184



>ref|NP_001237753.1| uncharacterized protein LOC100499906 [Glycine max]
 gb|ACU14127.1| unknown [Glycine max]
Length=246

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = +3

Query  120  DIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA  296
            D+E G TLYPG+  GENQLRWGFIRKVYGI+SAQI+LTTLV+  TV Y P+N++LKG+S 
Sbjct  17   DLESGETLYPGLSVGENQLRWGFIRKVYGILSAQIVLTTLVSVTTVFYTPINDLLKGNST  76

Query  297  lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILT  476
            LLL L+FLPF+ L PL  YQQ+HP N+I L LFT S+S  + V+CANTDG IVLEALILT
Sbjct  77   LLLILLFLPFIFLIPLLKYQQKHPHNYILLALFTVSISSTIGVTCANTDGKIVLEALILT  136

Query  477  SAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            SAVV +LTGY FWA+KKG+DF+FLGPILFTSL  LILTG +QMFFPLG
Sbjct  137  SAVVSSLTGYAFWASKKGKDFSFLGPILFTSLITLILTGMMQMFFPLG  184



>ref|XP_009107842.1| PREDICTED: BI1-like protein [Brassica rapa]
Length=254

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 150/190 (79%), Gaps = 5/190 (3%)
 Frame = +3

Query  66   KMYGFERVSSS---YDGGMKGDIE--EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllt  230
            K YG+  VS S      G   D+E  E TLYPG+ YGENQLRWGFIRKVYGI+SAQ+LLT
Sbjct  3    KPYGYASVSMSGVDRSAGKDIDLEMGEATLYPGLSYGENQLRWGFIRKVYGILSAQLLLT  62

Query  231  tlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLS  410
            TL++ V VL  P+N++L GS  LLLFL  +PF+L+WPLHVY Q+HP+N I L LFT SLS
Sbjct  63   TLISAVVVLNPPVNDLLTGSPGLLLFLCIIPFVLIWPLHVYHQKHPVNLILLALFTISLS  122

Query  411  FPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililt  590
            F V VSCA T+G IVLEALILT +VV +LT YTFWAAKKG+DF+FLGPILFTSL IL++T
Sbjct  123  FTVGVSCAMTEGRIVLEALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILVVT  182

Query  591  gfiQMFFPLG  620
             F+QMFFPLG
Sbjct  183  SFMQMFFPLG  192



>gb|KHN37547.1| BI1-like protein [Glycine soja]
Length=246

 Score =   182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = +3

Query  120  DIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA  296
            D+E G TLYPG+  GENQLRWGFIRKVYGI+SAQI+LTTLV+  TV Y P+N++LKG+S 
Sbjct  17   DLESGETLYPGLSVGENQLRWGFIRKVYGILSAQIVLTTLVSVTTVFYTPINDLLKGNST  76

Query  297  lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILT  476
            LLL L+FLPF+ L PL  YQQ+HP N+I L LFT S+S  + V+CANTDG IVLEALILT
Sbjct  77   LLLILLFLPFIFLIPLLKYQQKHPHNYILLALFTVSISSTIGVTCANTDGKIVLEALILT  136

Query  477  SAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            SAVV +LTGY FWA+KKG+DF+FLGPILFTSL  LILTG +QMFFPLG
Sbjct  137  SAVVSSLTGYAFWASKKGKDFSFLGPILFTSLITLILTGMMQMFFPLG  184



>ref|XP_006850841.1| hypothetical protein AMTR_s00025p00133870 [Amborella trichopoda]
 gb|ERN12422.1| hypothetical protein AMTR_s00025p00133870 [Amborella trichopoda]
Length=241

 Score =   182 bits (462),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 140/169 (83%), Gaps = 0/169 (0%)
 Frame = +3

Query  114  KGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSS  293
            KGD+E GTLYPG+GYGEN+LRWGFIRKVYGI++ QI+LTT+VA + VL+ P++ +L+ S 
Sbjct  9    KGDLEAGTLYPGLGYGENELRWGFIRKVYGILATQIVLTTVVAAIVVLHPPISHLLQNSP  68

Query  294  AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALIL  473
             L + L  LP +L+ PL+ Y Q+HP+N I LGLFT  LS  V V+CANT+G IVLEALIL
Sbjct  69   GLAIGLAILPLILMCPLYYYHQKHPVNLILLGLFTVFLSLSVGVACANTEGTIVLEALIL  128

Query  474  TSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            TSAVV +LTGYTFWA+KKG+DF+FLGPILF  L ILILTGFIQ+FFPLG
Sbjct  129  TSAVVCSLTGYTFWASKKGKDFSFLGPILFAGLMILILTGFIQIFFPLG  177



>emb|CDY09761.1| BnaC07g33000D [Brassica napus]
Length=256

 Score =   182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 150/192 (78%), Gaps = 7/192 (4%)
 Frame = +3

Query  66   KMYGFERVS-SSYDGGMKGDIE------EGTLYPGIGYGENQLRWGFIRKVYGIISAQIl  224
            K YG+  V  SS D     DI+      E TLYPG+ YGENQLRWGFIRKVYGI+SAQ+L
Sbjct  3    KPYGYASVGMSSVDRAAGKDIDLEMGGGEATLYPGLSYGENQLRWGFIRKVYGILSAQLL  62

Query  225  lttlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTAS  404
            LTTL++ V VL  P+N+VL GS  LLLFL  +PF+L+WPLHVY Q+HP+N I L LFT S
Sbjct  63   LTTLISAVVVLNPPVNDVLTGSPGLLLFLCIIPFVLIWPLHVYHQKHPVNLILLSLFTIS  122

Query  405  LSFPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfili  584
            LSF V VSCA T+G IVLEALILT +VV +LT YTFWAAKKG+DF+FLGPILFTSL IL+
Sbjct  123  LSFTVGVSCAMTEGRIVLEALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILV  182

Query  585  ltgfiQMFFPLG  620
            +T F+QMFFPLG
Sbjct  183  VTSFMQMFFPLG  194



>gb|AAL07001.1| AT4g15470/dl3775w [Arabidopsis thaliana]
Length=226

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 150/188 (80%), Gaps = 1/188 (1%)
 Frame = +3

Query  57   AKAKMYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttl  236
            A   M G +R S+  D  ++  + E TLYPG+ YGENQLRWGFIRKVYGI+SAQ+LLTTL
Sbjct  8    ASVSMSGIDR-SAGKDIDLEMGVGEATLYPGLSYGENQLRWGFIRKVYGILSAQLLLTTL  66

Query  237  vagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFP  416
            ++ V VL  P+N++L GS  +LLFL  +PF+L+WPLH+Y Q+HP+N I L LFT SLSF 
Sbjct  67   ISAVVVLNPPVNDLLTGSPGILLFLCIVPFILIWPLHIYHQKHPVNLILLALFTVSLSFT  126

Query  417  VAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgf  596
            V VSCA T+G IVL+ALILT +VV +LT YTFWAAKKG+DF+FLGPILFTSL IL++T F
Sbjct  127  VGVSCAMTEGRIVLQALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILVVTSF  186

Query  597  iQMFFPLG  620
            IQMFFPLG
Sbjct  187  IQMFFPLG  194



>ref|NP_567466.1| Bax inhibitor-1 like protein [Arabidopsis thaliana]
 sp|Q94A20.1|BI1L_ARATH RecName: Full=BI1-like protein [Arabidopsis thaliana]
 gb|AAK91458.1| AT4g15470/dl3775w [Arabidopsis thaliana]
 gb|AAM19872.1| AT4g15470/dl3775w [Arabidopsis thaliana]
 gb|AEE83607.1| Bax inhibitor-1 like protein [Arabidopsis thaliana]
Length=256

 Score =   182 bits (462),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 150/188 (80%), Gaps = 1/188 (1%)
 Frame = +3

Query  57   AKAKMYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttl  236
            A   M G +R S+  D  ++  + E TLYPG+ YGENQLRWGFIRKVYGI+SAQ+LLTTL
Sbjct  8    ASVSMSGIDR-SAGKDIDLEMGVGEATLYPGLSYGENQLRWGFIRKVYGILSAQLLLTTL  66

Query  237  vagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFP  416
            ++ V VL  P+N++L GS  +LLFL  +PF+L+WPLH+Y Q+HP+N I L LFT SLSF 
Sbjct  67   ISAVVVLNPPVNDLLTGSPGILLFLCIVPFILIWPLHIYHQKHPVNLILLALFTVSLSFT  126

Query  417  VAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgf  596
            V VSCA T+G IVL+ALILT +VV +LT YTFWAAKKG+DF+FLGPILFTSL IL++T F
Sbjct  127  VGVSCAMTEGRIVLQALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILVVTSF  186

Query  597  iQMFFPLG  620
            IQMFFPLG
Sbjct  187  IQMFFPLG  194



>ref|XP_010548892.1| PREDICTED: BI1-like protein [Tarenaya hassleriana]
Length=252

 Score =   182 bits (462),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 149/189 (79%), Gaps = 5/189 (3%)
 Frame = +3

Query  66   KMYGFERVSSSYDGGMKGDIE----EGTLYPGIGYGENQLRWGFIRKVYGIISAQIlltt  233
            K YG+  VS+   GG   D+E    E TLYPG+  GENQLRWGFIRKVYGI+S Q+LLTT
Sbjct  3    KPYGYASVSTG-AGGKDVDLEMGGGEATLYPGLSDGENQLRWGFIRKVYGILSGQLLLTT  61

Query  234  lvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSF  413
            +++   VL   + ++L GSS +LLFL  +PF+L+WPLH+Y Q+HPLN I LGLFT SLSF
Sbjct  62   VISASVVLNPSVTDLLTGSSGILLFLCIVPFVLIWPLHIYHQKHPLNLILLGLFTVSLSF  121

Query  414  PVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtg  593
             V V+CANTDG IVLEALILT  VV +LT YTFWAAKKG+DF+FLGPILFTSL ILI+TG
Sbjct  122  TVGVTCANTDGRIVLEALILTLTVVASLTAYTFWAAKKGKDFSFLGPILFTSLIILIVTG  181

Query  594  fiQMFFPLG  620
            FIQMFFPLG
Sbjct  182  FIQMFFPLG  190



>ref|XP_009136696.1| PREDICTED: BI1-like protein [Brassica rapa]
Length=256

 Score =   182 bits (462),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 149/190 (78%), Gaps = 7/190 (4%)
 Frame = +3

Query  72   YGFERVS-SSYDGGMKGDIE------EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllt  230
            YG+  VS S  D     DI+      E TLYPG+ YGENQLRWGFIRKVYGI+SAQ+LLT
Sbjct  5    YGYASVSRSGVDRAAGKDIDLEMGTGEATLYPGLSYGENQLRWGFIRKVYGILSAQLLLT  64

Query  231  tlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLS  410
            TL++ V VL  P+N+VL GS  LLLFL  +PF+L+WPLHVY Q+HP+N I L LFT SLS
Sbjct  65   TLISAVVVLNPPVNDVLTGSPGLLLFLCIIPFVLIWPLHVYHQKHPVNLILLALFTISLS  124

Query  411  FPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililt  590
            F V VSCA T+G IVLEALILT +VV +LT YTFWAAKKG+DF+FLGPILFTSL IL++T
Sbjct  125  FTVGVSCAMTEGRIVLEALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILVVT  184

Query  591  gfiQMFFPLG  620
             F+QMFFPLG
Sbjct  185  SFMQMFFPLG  194



>emb|CDY22739.1| BnaA08g05690D [Brassica napus]
Length=272

 Score =   182 bits (463),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 150/190 (79%), Gaps = 5/190 (3%)
 Frame = +3

Query  66   KMYGFERVSSS---YDGGMKGDIEEG--TLYPGIGYGENQLRWGFIRKVYGIISAQIllt  230
            K YG+  VS S      G   D+E G  TLYPG+ YGENQLRWGFIRKVYGI+SAQ+LLT
Sbjct  3    KPYGYASVSMSGVDRSAGKDIDLEMGGATLYPGLSYGENQLRWGFIRKVYGILSAQLLLT  62

Query  231  tlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLS  410
            TL++ V VL  P+N++L GS  LLLFL  +PF+L+WPLHVY Q+HP+N I L LFT SLS
Sbjct  63   TLISAVVVLNPPVNDLLTGSPGLLLFLCIIPFVLIWPLHVYHQKHPVNLILLALFTISLS  122

Query  411  FPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililt  590
            F V VSCA T+G IVLEALILT +VV +LT YTFWAAKKG+DF+FLGPILFTSL IL++T
Sbjct  123  FTVGVSCAMTEGRIVLEALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILVVT  182

Query  591  gfiQMFFPLG  620
             F+QMFFPLG
Sbjct  183  SFMQMFFPLG  192



>ref|XP_010551036.1| PREDICTED: BI1-like protein [Tarenaya hassleriana]
Length=260

 Score =   182 bits (462),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 145/193 (75%), Gaps = 8/193 (4%)
 Frame = +3

Query  66   KMYGFERVSSS----YDGGMKGDIE----EGTLYPGIGYGENQLRWGFIRKVYGIISAQI  221
            K YG+  VSSS    + G    D E    E TLYPG+ Y ENQLRWGFIRKVYGI+SAQ+
Sbjct  3    KPYGYASVSSSSGVPFVGDKDADPEMGGGEATLYPGLSYSENQLRWGFIRKVYGILSAQL  62

Query  222  llttlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTA  401
            LLTT+++   VL  PL ++L GS   LL L  +P +L+WPL+++ Q HP+N IFLGLFT 
Sbjct  63   LLTTVISAAVVLNPPLTDLLTGSYGFLLLLCIVPIVLIWPLYIFHQTHPVNLIFLGLFTV  122

Query  402  SLSFPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfil  581
            SLSF V V CANTDG IVLEALILT AVV +LT YTFWAAKKG+DF+FLGP L+TSL IL
Sbjct  123  SLSFCVGVCCANTDGRIVLEALILTLAVVASLTAYTFWAAKKGKDFSFLGPFLYTSLVIL  182

Query  582  iltgfiQMFFPLG  620
            I+ GFIQ+FFPLG
Sbjct  183  IVVGFIQLFFPLG  195



>ref|XP_010905739.1| PREDICTED: BI1-like protein [Elaeis guineensis]
Length=244

 Score =   181 bits (459),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 147/184 (80%), Gaps = 4/184 (2%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagv  248
            MYG+  V  +      GD+E GTLYPG+  GEN+LRWGF+RKVYGI++AQ+LLTT+V+G 
Sbjct  1    MYGYASVEKA----AGGDLEAGTLYPGLSRGENELRWGFVRKVYGILAAQLLLTTVVSGA  56

Query  249  tvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVS  428
            TVL A +N++L G+S L L L  LP  L++PL++YQQ+HPLNF+FLGLFT  LS  V V+
Sbjct  57   TVLNASINKLLTGNSGLALGLALLPLFLMFPLYLYQQKHPLNFLFLGLFTLCLSLSVGVA  116

Query  429  CANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMF  608
            CANT G IVLEALILTSAVV +LTGYTFWA+KKG+DF++LGPILF  L +L+LT FIQ+ 
Sbjct  117  CANTQGRIVLEALILTSAVVASLTGYTFWASKKGKDFSYLGPILFAGLLVLLLTSFIQIL  176

Query  609  FPLG  620
            FPLG
Sbjct  177  FPLG  180



>ref|XP_006284243.1| hypothetical protein CARUB_v10005406mg, partial [Capsella rubella]
 gb|EOA17141.1| hypothetical protein CARUB_v10005406mg, partial [Capsella rubella]
Length=288

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 151/194 (78%), Gaps = 6/194 (3%)
 Frame = +3

Query  57   AKAKMYGFERVSSSYDGGMKGDIE------EGTLYPGIGYGENQLRWGFIRKVYGIISAQ  218
            A  K YG+  VS S     + DI+      E TLYPG+ YGENQLRWGFIRKVYGI+SAQ
Sbjct  33   AMEKPYGYASVSMSGIDRDRKDIDLEMGVGEATLYPGLSYGENQLRWGFIRKVYGILSAQ  92

Query  219  IllttlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFT  398
            +LLTTL++ V VL  P+N++L GS  +LLFL  +PF+L+WPLH+Y Q+HP+N I L LFT
Sbjct  93   LLLTTLISAVVVLNPPVNDLLTGSPGILLFLCIIPFILIWPLHIYHQKHPVNLILLALFT  152

Query  399  ASLSFPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfi  578
             SLSF V VSCA T+G IVL+ALILT +VV +LT YTFWAAKKG+DF+FLGPILFTSL I
Sbjct  153  VSLSFTVGVSCAMTEGRIVLQALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLII  212

Query  579  liltgfiQMFFPLG  620
            L++T FIQMFFPLG
Sbjct  213  LVVTSFIQMFFPLG  226



>gb|AFK46458.1| unknown [Medicago truncatula]
 gb|AES64333.2| inhibitor of apoptosis-promoting Bax1 protein [Medicago truncatula]
Length=257

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = +3

Query  120  DIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA  296
            DIE G TLYPG+  GENQLRWGFIRKVYGI+SAQILLTT+V+ +TV Y PLN +L+G+S 
Sbjct  28   DIESGETLYPGLSLGENQLRWGFIRKVYGILSAQILLTTIVSVITVFYTPLNLLLRGNSP  87

Query  297  lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILT  476
            LLLFLVFLPF+ L PL  YQQ+HP N+I LGLFT S+SF V V+CANTDG IVLEAL+LT
Sbjct  88   LLLFLVFLPFIFLIPLLRYQQKHPHNYILLGLFTLSISFTVGVTCANTDGKIVLEALVLT  147

Query  477  SAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            SAVV +LT Y FWA+KKG+DF++LGP+LFT LF L+LTG +QMFFPLG
Sbjct  148  SAVVSSLTAYAFWASKKGKDFSYLGPLLFTCLFTLVLTGMMQMFFPLG  195



>ref|XP_010938798.1| PREDICTED: BI1-like protein [Elaeis guineensis]
Length=247

 Score =   181 bits (458),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 145/185 (78%), Gaps = 4/185 (2%)
 Frame = +3

Query  66   KMYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvag  245
            +MYG+  V  +      GD+E GTLYPG+  GE++LRWGF+RKVYGI++AQ+LLTT+V+ 
Sbjct  3    EMYGYASVEKA----AAGDLEAGTLYPGLSRGESELRWGFVRKVYGILAAQLLLTTVVSA  58

Query  246  vtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAV  425
             TVL A +N +L  SS L L L  +P  L++PL+ YQQ+HPLNFIFLGLFT  LS  V V
Sbjct  59   ATVLNASINNLLTESSGLALGLAIVPLFLMFPLYHYQQKHPLNFIFLGLFTVCLSLSVGV  118

Query  426  SCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQM  605
            +CANT G IVLEALILTS VVL+LTGYTFWA+KKG+DF++LGPILF  L +L+LT FIQ+
Sbjct  119  ACANTQGRIVLEALILTSTVVLSLTGYTFWASKKGKDFSYLGPILFAGLLVLLLTSFIQI  178

Query  606  FFPLG  620
            FFPLG
Sbjct  179  FFPLG  183



>ref|XP_006414507.1| hypothetical protein EUTSA_v10026042mg [Eutrema salsugineum]
 gb|ESQ55960.1| hypothetical protein EUTSA_v10026042mg [Eutrema salsugineum]
Length=256

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 150/192 (78%), Gaps = 7/192 (4%)
 Frame = +3

Query  66   KMYGFERVSSS---YDGGMKGDIE----EGTLYPGIGYGENQLRWGFIRKVYGIISAQIl  224
            K YG+  VS S     GG   D+E    E TLYPG+ +GENQLRWGFIRKVYGI+SAQ+L
Sbjct  3    KPYGYASVSMSGIDRAGGKDIDLEMGVGEATLYPGLSFGENQLRWGFIRKVYGILSAQLL  62

Query  225  lttlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTAS  404
            LTTL++ V VL  P+N+VL  S  LLLFL  +PF+L+WPLH+Y Q+HP+N I L LFT S
Sbjct  63   LTTLISAVVVLNPPVNDVLTASPGLLLFLCIVPFVLIWPLHIYHQKHPINLILLALFTIS  122

Query  405  LSFPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfili  584
            LSF V VSCA T+G IVLEALILT +VV +LT YTFWAAKKG+DF+FLGPILFTSL ILI
Sbjct  123  LSFTVGVSCAMTEGRIVLEALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILI  182

Query  585  ltgfiQMFFPLG  620
            +T FIQMFFPLG
Sbjct  183  VTSFIQMFFPLG  194



>ref|XP_010440304.1| PREDICTED: BI1-like protein [Camelina sativa]
Length=255

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 148/188 (79%), Gaps = 2/188 (1%)
 Frame = +3

Query  57   AKAKMYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttl  236
            A   M G +R     D  ++  + E TLYPG+ YGENQLRWGFIRKVYGI+SAQ+LLTTL
Sbjct  8    ASVSMTGIDRDRKDID--LEMGVGEATLYPGLSYGENQLRWGFIRKVYGILSAQLLLTTL  65

Query  237  vagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFP  416
            ++ V VL  P+N++L GS  +LLFL  +PF+L+WPLH+Y Q+HP+N I L LFT SLSF 
Sbjct  66   ISAVVVLNPPVNDLLTGSPGILLFLCIVPFILIWPLHIYHQKHPVNLILLALFTVSLSFT  125

Query  417  VAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgf  596
            V VSCA T+G IVL+ALILT +VV +LT YTFWAAKKG+DF+FLGPILFTSL IL++T F
Sbjct  126  VGVSCAMTEGRIVLQALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILLVTSF  185

Query  597  iQMFFPLG  620
            IQMFFPLG
Sbjct  186  IQMFFPLG  193



>ref|XP_010434979.1| PREDICTED: BI1-like protein [Camelina sativa]
Length=255

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 148/188 (79%), Gaps = 2/188 (1%)
 Frame = +3

Query  57   AKAKMYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttl  236
            A   M G +R     D  ++  + E TLYPG+ YGENQLRWGFIRKVYGI+SAQ+LLTTL
Sbjct  8    ASVSMTGIDRDRKDID--LEMGVGEATLYPGLSYGENQLRWGFIRKVYGILSAQLLLTTL  65

Query  237  vagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFP  416
            ++ V VL  P+N++L GS  +LLFL  +PF+L+WPLH+Y Q+HP+N I L LFT SLSF 
Sbjct  66   ISAVVVLNPPVNDLLTGSPGILLFLCIVPFILIWPLHIYHQKHPVNLILLALFTVSLSFT  125

Query  417  VAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgf  596
            V VSCA T+G IVL+ALILT +VV +LT YTFWAAKKG+DF+FLGPILFTSL IL++T F
Sbjct  126  VGVSCAMTEGRIVLQALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILVVTSF  185

Query  597  iQMFFPLG  620
            IQMFFPLG
Sbjct  186  IQMFFPLG  193



>ref|XP_007147817.1| hypothetical protein PHAVU_006G157400g [Phaseolus vulgaris]
 gb|ESW19811.1| hypothetical protein PHAVU_006G157400g [Phaseolus vulgaris]
Length=246

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = +3

Query  120  DIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA  296
            D+E G TLYPG+  GENQLRWGFIRKVYGI+SAQI+LTTLV+ +TV Y+P+N++LKG+S 
Sbjct  17   DLESGETLYPGLSLGENQLRWGFIRKVYGILSAQIVLTTLVSLITVFYSPINDLLKGNST  76

Query  297  lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILT  476
            LLL LVFLPF+ L PL  YQQ+HP N+I L LFT S+S  V V+CANTDG IVLEALILT
Sbjct  77   LLLVLVFLPFIFLIPLLRYQQKHPHNYILLALFTVSISSTVGVTCANTDGKIVLEALILT  136

Query  477  SAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            SAVV +LT Y FWA+KKG+DF+FLGPILFTSLF L LTG +QMFFPLG
Sbjct  137  SAVVSSLTAYAFWASKKGKDFSFLGPILFTSLFTLFLTGMMQMFFPLG  184



>gb|KFK22627.1| hypothetical protein AALP_AAs50448U000500 [Arabis alpina]
Length=256

 Score =   180 bits (456),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 151/192 (79%), Gaps = 7/192 (4%)
 Frame = +3

Query  66   KMYGFERVSS-SYDGGMKGDIE------EGTLYPGIGYGENQLRWGFIRKVYGIISAQIl  224
            K YG+  VS     G +K +I+      E TLYPG+ YGENQLRWGFIRKVYGI+SAQ+L
Sbjct  3    KPYGYASVSGVDRAGDVKKEIDLEMGVGEATLYPGLSYGENQLRWGFIRKVYGILSAQLL  62

Query  225  lttlvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTAS  404
            LTTL++ V VL  P+N++L GS  +LLFL  +PF+L+WPLHVY Q+HP+N I L LFT S
Sbjct  63   LTTLISAVVVLNPPVNDLLTGSPGILLFLCIVPFVLIWPLHVYHQKHPVNLILLALFTIS  122

Query  405  LSFPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfili  584
            LSF V VSCA T+G IVL+ALILT +VV +LT YTFWAAKKG+DF+FLGPILFTSL IL+
Sbjct  123  LSFTVGVSCAMTEGKIVLQALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILV  182

Query  585  ltgfiQMFFPLG  620
            +T FIQMFFPLG
Sbjct  183  VTSFIQMFFPLG  194



>gb|ACU19337.1| unknown [Glycine max]
Length=246

 Score =   179 bits (455),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 140/168 (83%), Gaps = 1/168 (1%)
 Frame = +3

Query  120  DIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA  296
            D+E G TLYPG+  GENQLRWGFIRKVYGI+SAQI+LTTLV+   V Y P+N++LKG+S 
Sbjct  17   DLESGETLYPGLSVGENQLRWGFIRKVYGILSAQIVLTTLVSVTAVFYTPINDLLKGNST  76

Query  297  lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILT  476
            LLL L+FLPF+ L PL  YQQ+HP N+I L LFT S+S  V V+CANTDG IVLEALILT
Sbjct  77   LLLILLFLPFIFLIPLLKYQQKHPHNYILLALFTVSISSTVGVTCANTDGKIVLEALILT  136

Query  477  SAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            SAVV +LTGY FWA+KKG+ F+FLGP+LFTSLF LILTG +QMFFPLG
Sbjct  137  SAVVSSLTGYAFWASKKGKGFSFLGPVLFTSLFTLILTGMMQMFFPLG  184



>ref|XP_010434338.1| PREDICTED: BI1-like protein [Camelina sativa]
Length=255

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 147/188 (78%), Gaps = 2/188 (1%)
 Frame = +3

Query  57   AKAKMYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttl  236
            A   M G +R     D  ++  + E TLYPG+ YGENQLRW FIRKVYGI+SAQ+LLTTL
Sbjct  8    ASVSMTGIDRDRKDID--LEMGVGEATLYPGLSYGENQLRWSFIRKVYGILSAQLLLTTL  65

Query  237  vagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFP  416
            ++ V VL  P+N++L GS  +LLFL  +PF+L+WPLH+Y Q+HP+N I L LFT SLSF 
Sbjct  66   ISAVVVLNPPVNDLLTGSPGILLFLCIVPFILIWPLHIYHQKHPVNLILLALFTVSLSFT  125

Query  417  VAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgf  596
            V VSCA T+G IVL+ALILT +VV +LT YTFWAAKKG+DF+FLGPILFTSL IL++T F
Sbjct  126  VGVSCAMTEGRIVLQALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILLVTSF  185

Query  597  iQMFFPLG  620
            IQMFFPLG
Sbjct  186  IQMFFPLG  193



>ref|XP_004486099.1| PREDICTED: BI1-like protein-like [Cicer arietinum]
Length=257

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = +3

Query  120  DIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA  296
            DIE G TLYPG+  G+NQLRWGFIRKVYGI+SAQILLTT+V+ +TV Y PLN +L+G+S 
Sbjct  28   DIESGETLYPGLSLGDNQLRWGFIRKVYGILSAQILLTTIVSVITVFYTPLNLLLRGNSP  87

Query  297  lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILT  476
            LLLFLVFLPF+ L PL  YQQ+HP N+I LG FT S+S  V V+CANTDG IVLEALILT
Sbjct  88   LLLFLVFLPFIFLIPLLRYQQKHPHNYILLGCFTLSISLTVGVTCANTDGKIVLEALILT  147

Query  477  SAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            SAVV +LTGY FWA+KKG+DF++LGP+LFT LF L+LTG +QMFFPLG
Sbjct  148  SAVVSSLTGYAFWASKKGKDFSYLGPLLFTCLFTLVLTGMMQMFFPLG  195



>gb|KJB28559.1| hypothetical protein B456_005G055600 [Gossypium raimondii]
Length=248

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 146/186 (78%), Gaps = 2/186 (1%)
 Frame = +3

Query  69   MYGFERVS-SSYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlva  242
            MYG+E +S +      + D+E G TLYPG+ YGEN+LRWGFIRKVYGI++ Q+LLTT+V+
Sbjct  1    MYGYESLSRTDARKAEQIDLESGETLYPGLSYGENELRWGFIRKVYGILAVQLLLTTMVS  60

Query  243  gvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
               V    + ++L+G+S LLLFL  +P +L+WPLHVY Q+HPLNFI LG FT  LS  + 
Sbjct  61   AFVVSSPSIIDLLRGNSGLLLFLCLIPLILVWPLHVYHQKHPLNFIILGAFTVFLSLTIG  120

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQ  602
            VSCANTD  IVLEALILT+AVV +LTGYTFWA+K G+DFN+LGPILFTSL IL+LT  IQ
Sbjct  121  VSCANTDERIVLEALILTAAVVTSLTGYTFWASKNGKDFNYLGPILFTSLVILVLTSLIQ  180

Query  603  MFFPLG  620
            MFFPLG
Sbjct  181  MFFPLG  186



>ref|XP_006353796.1| PREDICTED: BI1-like protein-like [Solanum tuberosum]
Length=242

 Score =   171 bits (432),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 141/178 (79%), Gaps = 7/178 (4%)
 Frame = +3

Query  105  GGMKGD-IEEGT-----LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAP  266
             G+KGD +EEG+     LYPGIG  EN LRWGFIRKVY I+++QILLTT+V+ VTVLY P
Sbjct  2    SGVKGDDVEEGSTTSSLLYPGIGNEENDLRWGFIRKVYYILASQILLTTIVSAVTVLYLP  61

Query  267  LNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
            +N +L G + LL+ L+    LLL   + Y+Q+HPLNF+FLGL+T +LS  + ++CA  DG
Sbjct  62   VNNILHGKTILLILLILPLLLLLPL-YFYRQKHPLNFVFLGLYTVTLSVSIGIACATIDG  120

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
             IVLEALILTSAVVL+LTGYTFWA+K+G+DF+FLGPILF SL +L LTG +Q+FFPLG
Sbjct  121  KIVLEALILTSAVVLSLTGYTFWASKRGQDFSFLGPILFASLIVLFLTGLLQLFFPLG  178



>ref|XP_003594082.1| Transmembrane BAX inhibitor motif-containing protein [Medicago 
truncatula]
Length=274

 Score =   171 bits (433),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 142/185 (77%), Gaps = 18/185 (10%)
 Frame = +3

Query  120  DIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA  296
            DIE G TLYPG+  GENQLRWGFIRKVYGI+SAQILLTT+V+ +TV Y PLN +L+G+S 
Sbjct  28   DIESGETLYPGLSLGENQLRWGFIRKVYGILSAQILLTTIVSVITVFYTPLNLLLRGNSP  87

Query  297  lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILT  476
            LLLFLVFLPF+ L PL  YQQ+HP N+I LGLFT S+SF V V+CANTDG IVLEAL+LT
Sbjct  88   LLLFLVFLPFIFLIPLLRYQQKHPHNYILLGLFTLSISFTVGVTCANTDGKIVLEALVLT  147

Query  477  SAVVLALTGYTFWAAKKGRDFNFLGPilftslfililt-----------------gfiQM  605
            SAVV +LT Y FWA+KKG+DF++LGP+LFT LF L+LT                   +QM
Sbjct  148  SAVVSSLTAYAFWASKKGKDFSYLGPLLFTCLFTLVLTGMMQIMLAAFLLLKTRFSLVQM  207

Query  606  FFPLG  620
            FFPLG
Sbjct  208  FFPLG  212



>gb|KJB74488.1| hypothetical protein B456_011G181100 [Gossypium raimondii]
Length=236

 Score =   167 bits (423),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 143/186 (77%), Gaps = 14/186 (8%)
 Frame = +3

Query  69   MYGFERVSS-SYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlva  242
            M  +ERVSS S     K D+E G TLY G+ YGENQLRWGFIRKVYGI++AQ++LTT+V+
Sbjct  1    MSRYERVSSTSASKADKVDLESGDTLYRGLSYGENQLRWGFIRKVYGILAAQLVLTTVVS  60

Query  243  gvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
               V  AP+NE+L+G+S +LLFL  +PF+LLWPLHVY Q+HP+N I LGLFT SLS  V 
Sbjct  61   AFVVFSAPVNELLRGNSGILLFLCLVPFILLWPLHVYHQKHPVNLIILGLFTVSLSLTVG  120

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQ  602
            VSCANTDG            VV +LTGYTFWA+KKG+DF+FLGPILFTSL ILILTG IQ
Sbjct  121  VSCANTDG------------VVASLTGYTFWASKKGKDFSFLGPILFTSLIILILTGLIQ  168

Query  603  MFFPLG  620
            MFFPLG
Sbjct  169  MFFPLG  174



>ref|XP_009402474.1| PREDICTED: BI1-like protein [Musa acuminata subsp. malaccensis]
Length=248

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 139/184 (76%), Gaps = 6/184 (3%)
 Frame = +3

Query  75   GFERVSSSYDGGMKGDIEEG--TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagv  248
            G+ RV    + G +GD+E G   L+PG+  GE++LRWGF+RKVYGI++ QILLTT V+  
Sbjct  5    GYTRV----EKGEEGDLEAGWGPLHPGLSRGESELRWGFVRKVYGILATQILLTTAVSAA  60

Query  249  tvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVS  428
            TVL+  +N  L  S  L + L  LP +LL PL+ Y+Q+HPLNF+FLGLFT  LS  + V+
Sbjct  61   TVLHPSVNAALAASPGLAVVLAILPLVLLCPLYHYRQKHPLNFMFLGLFTVCLSLSIGVA  120

Query  429  CANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMF  608
            CANT G IVLEALILTSAVV +LTGYTFWA++KG+DF+++GP +F+ L IL++T  IQ+F
Sbjct  121  CANTQGRIVLEALILTSAVVASLTGYTFWASRKGKDFSYVGPFVFSGLIILLVTSLIQIF  180

Query  609  FPLG  620
            FPLG
Sbjct  181  FPLG  184



>ref|XP_004243681.1| PREDICTED: BI1-like protein [Solanum lycopersicum]
Length=243

 Score =   161 bits (408),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 140/179 (78%), Gaps = 8/179 (4%)
 Frame = +3

Query  105  GGMKG-DIEEGT------LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYA  263
             G+KG D+EEG+      LYPGI   EN LRW FIRKVY I+++QILLTT+V+  TVLY 
Sbjct  2    SGVKGNDVEEGSTTTSLLLYPGIRNDENDLRWDFIRKVYYILASQILLTTIVSAGTVLYL  61

Query  264  PLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTD  443
            P+N +L G + LL+ L+    LLL   + Y+Q+HPLNF+FLG++T +LS  + ++CA  +
Sbjct  62   PVNNILHGKTILLILLILPLLLLLPL-YFYRQKHPLNFVFLGIYTITLSISIGIACATIN  120

Query  444  GAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            G IVLEALILTSAVVL+LTGYTFWA+K+G+DF+FLGPILF SL +LILTGF+Q+FFPLG
Sbjct  121  GKIVLEALILTSAVVLSLTGYTFWASKRGQDFSFLGPILFASLNVLILTGFLQLFFPLG  179



>ref|XP_003568491.1| PREDICTED: BI1-like protein [Brachypodium distachyon]
Length=293

 Score =   162 bits (410),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 132/170 (78%), Gaps = 3/170 (2%)
 Frame = +3

Query  120  DIEEGT---LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            D+E G    LYPGI  GEN LRWGFIRKVYGI+ AQ+LLTT+V+ VTVL+  LN  L  S
Sbjct  62   DLEAGNGEMLYPGISRGENALRWGFIRKVYGILCAQLLLTTIVSAVTVLHPTLNATLSSS  121

Query  291  SAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALI  470
              L L L  LPF+L+ PL+ YQ RHP NF+FLGLFT  LSF + V+CANT+G IVLEAL+
Sbjct  122  PVLALVLAVLPFVLMIPLYHYQHRHPHNFVFLGLFTLCLSFSIGVACANTEGTIVLEALV  181

Query  471  LTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LTSAVV +LT YTFWA+KKG++F +LGP LF++L IL++T FIQ+FFP G
Sbjct  182  LTSAVVASLTAYTFWASKKGKEFGYLGPFLFSALTILVVTSFIQIFFPFG  231



>ref|NP_001055493.1| Os05g0402300 [Oryza sativa Japonica Group]
 gb|AAT85152.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAT85204.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17407.1| Os05g0402300 [Oryza sativa Japonica Group]
 dbj|BAG91740.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79197.1| hypothetical protein OsI_19905 [Oryza sativa Indica Group]
 gb|EEE63667.1| hypothetical protein OsJ_18485 [Oryza sativa Japonica Group]
Length=264

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 133/170 (78%), Gaps = 3/170 (2%)
 Frame = +3

Query  120  DIEEGT---LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            D+E GT   LYPGI  GE+ LRWGF+RKVYGI++AQ+LLTT V+ +TVL+  LN  L  S
Sbjct  31   DLEAGTGETLYPGISRGESALRWGFVRKVYGILAAQLLLTTAVSALTVLHPTLNATLSSS  90

Query  291  SAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALI  470
              L L L  LPF+L+ PL+ YQ +HP NF++LGLFT  LSF + V+CANT G IVLEALI
Sbjct  91   PTLALVLAVLPFVLMVPLYHYQHKHPHNFVYLGLFTLCLSFSIGVACANTQGKIVLEALI  150

Query  471  LTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LTSAVV +LT YTFWA+KKG++F +LGPILF++L +L++  FIQ+FFPLG
Sbjct  151  LTSAVVASLTAYTFWASKKGKEFGYLGPILFSALVLLVVISFIQVFFPLG  200



>ref|XP_006654376.1| PREDICTED: BI1-like protein-like [Oryza brachyantha]
Length=258

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 133/170 (78%), Gaps = 3/170 (2%)
 Frame = +3

Query  120  DIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            D+E G   TLYPGI  GE+ LRWGF+RKVYGI++AQ+LLTT V+ +TVL+  LN  L  S
Sbjct  25   DLEAGNGETLYPGISRGESALRWGFVRKVYGILAAQLLLTTAVSALTVLHPTLNATLSSS  84

Query  291  SAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALI  470
              L L L  LPF+L+ PL+ YQ +HP NF++LGLFT  LSF + V+CANT G IVLEALI
Sbjct  85   PTLALVLAVLPFVLMVPLYHYQHKHPHNFVYLGLFTLCLSFSIGVACANTQGKIVLEALI  144

Query  471  LTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LTSAVV +LT YTFWA+KKG++F +LGPILF++L +LI+  F+Q+FFPLG
Sbjct  145  LTSAVVASLTAYTFWASKKGKEFGYLGPILFSALILLIVISFVQVFFPLG  194



>ref|XP_004962144.1| PREDICTED: BI1-like protein-like [Setaria italica]
Length=264

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 132/170 (78%), Gaps = 3/170 (2%)
 Frame = +3

Query  120  DIEEGT---LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            D+E GT   LYPGI  GE+ LRWGF+RKVYGI++AQ+LLTT V+ +TVL+  LN  L  S
Sbjct  31   DLEAGTGETLYPGISRGESALRWGFVRKVYGILAAQLLLTTAVSALTVLHPTLNATLSDS  90

Query  291  SAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALI  470
            + L L L  LPF+L+ PL+ YQ +HP NF+FLGLFT  LSF + V+CANT G IVLEAL+
Sbjct  91   AGLALVLAVLPFILMIPLYHYQHKHPHNFVFLGLFTLCLSFSIGVACANTQGKIVLEALV  150

Query  471  LTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LT+ VV +LT Y FWA+KKG++F +LGPIL ++L IL+LT F+Q+FFPLG
Sbjct  151  LTAGVVASLTAYAFWASKKGKEFGYLGPILSSALTILVLTSFLQIFFPLG  200



>ref|NP_001149877.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays]
 gb|ACG37071.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays]
 gb|ACG37899.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays]
 gb|ACN29032.1| unknown [Zea mays]
 gb|AFW77939.1| transmembrane BAX inhibitor motif protein-containing protein 
4 [Zea mays]
Length=264

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 132/170 (78%), Gaps = 3/170 (2%)
 Frame = +3

Query  120  DIEEGT---LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            D+E GT   LYPGI  GE+ LRWGF+RKVYGI++AQ+LLTT V+ +TVL+  LN  L  S
Sbjct  31   DLEAGTGETLYPGISRGESALRWGFVRKVYGILAAQLLLTTAVSALTVLHPTLNATLSDS  90

Query  291  SAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALI  470
              L L L  LPF+L+ PL+ YQ +HP NF+FLGLFT  LSF + V+CANT G IVLEAL+
Sbjct  91   PGLALVLAVLPFILMIPLYHYQHKHPHNFVFLGLFTLCLSFSIGVACANTQGKIVLEALV  150

Query  471  LTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LT+ VV++LT Y FWA+KKG++F +LGPIL ++L IL+LT F+Q+FFPLG
Sbjct  151  LTAGVVVSLTAYAFWASKKGKEFGYLGPILSSALTILVLTSFLQVFFPLG  200



>gb|EMS67433.1| hypothetical protein TRIUR3_20458 [Triticum urartu]
 gb|EMT15777.1| hypothetical protein F775_27898 [Aegilops tauschii]
Length=266

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 127/174 (73%), Gaps = 7/174 (4%)
 Frame = +3

Query  120  DIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            D+E G   TLYPGI  GEN LRWGFIRKVYGI+ AQ++LTT+V+ +TV +  LN  L  S
Sbjct  31   DLEAGNGETLYPGISRGENALRWGFIRKVYGILCAQLVLTTVVSAITVFHPTLNATLSNS  90

Query  291  SAlllflvfl----pflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
              L L L  L       ++ PL++YQ RHP N   LGLFT  LSF + V+CANT+G IVL
Sbjct  91   PVLALVLAVLPFIRYDAVMIPLYIYQHRHPHNLAILGLFTLCLSFSIGVACANTEGTIVL  150

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            +AL+LTSAVV++LT YTFWAAKKG++F++LGP LF++L IL++  F Q+FFP G
Sbjct  151  QALVLTSAVVVSLTAYTFWAAKKGKEFSYLGPFLFSALTILVVISFTQIFFPFG  204



>ref|NP_001149641.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays]
 gb|ACG36210.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays]
Length=264

 Score =   153 bits (387),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 131/170 (77%), Gaps = 3/170 (2%)
 Frame = +3

Query  120  DIEEGT---LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            D+E GT   LYPGI  GE+ LRWGF+RKVYGI++AQ+LLTT V+ +TVL+  LN  L  S
Sbjct  31   DLEAGTGETLYPGISRGESALRWGFVRKVYGILAAQLLLTTAVSALTVLHPTLNATLSDS  90

Query  291  SAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALI  470
              L L L  LPF+L+ PL+ YQ +HP N +FLGLFT  LSF + V+CANT G IVLEAL+
Sbjct  91   PGLALVLAVLPFILMIPLYHYQHKHPHNSVFLGLFTLCLSFSIGVACANTQGKIVLEALV  150

Query  471  LTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LT+ VV++LT Y FWA+KKG++F +LGPIL ++L IL+LT F+Q+FFPLG
Sbjct  151  LTAGVVVSLTAYAFWASKKGKEFGYLGPILSSALTILVLTSFLQVFFPLG  200



>gb|ACG33127.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays]
Length=264

 Score =   153 bits (387),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 131/170 (77%), Gaps = 3/170 (2%)
 Frame = +3

Query  120  DIEEGT---LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            D+E GT   LYPGI  GE+ LRWGF+RKVYGI++AQ+LLTT V+ +TVL+  LN  L  S
Sbjct  31   DLEAGTWETLYPGISRGESALRWGFVRKVYGILAAQLLLTTAVSALTVLHPTLNATLSDS  90

Query  291  SAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALI  470
              L L L  LPF+L+ PL+ YQ +HP N +FLGLFT  LSF + V+CANT G IVLEAL+
Sbjct  91   PGLALVLAVLPFILMIPLYHYQHKHPHNSVFLGLFTLCLSFSIGVACANTQGKIVLEALV  150

Query  471  LTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LT+ VV++LT Y FWA+KKG++F +LGPIL ++L IL+LT F+Q+FFPLG
Sbjct  151  LTAGVVVSLTAYAFWASKKGKEFGYLGPILSSALTILVLTSFLQVFFPLG  200



>gb|ABK25077.1| unknown [Picea sitchensis]
Length=245

 Score =   145 bits (366),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 128/182 (70%), Gaps = 7/182 (4%)
 Frame = +3

Query  75   GFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtv  254
            G E V   + GG       G LYPG+   +N++R GF++KVY I+S Q+LLT +VA   V
Sbjct  10   GVEDVEMGHGGG-------GVLYPGLSLQDNEMRLGFLKKVYSILSMQLLLTVIVAATVV  62

Query  255  lYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCA  434
            LY P    L  +  LLL +  LP +L+ PL+ Y Q+HP+N   LGLFT  LS  V +SCA
Sbjct  63   LYTPATLFLVKTPGLLLGISILPLILMCPLYAYHQKHPVNLALLGLFTVVLSLTVGISCA  122

Query  435  NTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFP  614
             T G IVLEALILT+AVV +LTGYTFWAAKKG+DF+FLGPILF+SL ++IL GFIQ+FFP
Sbjct  123  YTKGIIVLEALILTAAVVFSLTGYTFWAAKKGKDFSFLGPILFSSLLVIILFGFIQVFFP  182

Query  615  LG  620
            LG
Sbjct  183  LG  184



>ref|XP_001768622.1| predicted protein [Physcomitrella patens]
 gb|EDQ66560.1| predicted protein [Physcomitrella patens]
Length=249

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 128/185 (69%), Gaps = 9/185 (5%)
 Frame = +3

Query  93   SSYDGGMKGD----IEEG-----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvag  245
            + + GG+K D    +E G      LYPGI   EN LRWGFIRKVYGI+S QILLTT+VAG
Sbjct  2    AEFQGGLKADKFDDLEAGFGGSSMLYPGISADENTLRWGFIRKVYGILSVQILLTTIVAG  61

Query  246  vtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAV  425
              V +  L    + +  L+LFL F+P +++ PL+ Y Q HPLN I LGLFT ++S  V +
Sbjct  62   SVVYFEGLKTFFQQTPGLVLFLAFVPLIVMCPLYAYHQSHPLNLILLGLFTVTMSLSVGI  121

Query  426  SCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQM  605
            S +     IVLEA +LT+ VV+ALTGYT+WAAKKG DFNFLGP+LFTSL +L+  G IQ 
Sbjct  122  SSSMAPAPIVLEAFVLTTIVVVALTGYTYWAAKKGMDFNFLGPVLFTSLVVLVFFGLIQA  181

Query  606  FFPLG  620
            FFPLG
Sbjct  182  FFPLG  186



>ref|XP_002975127.1| hypothetical protein SELMODRAFT_150230 [Selaginella moellendorffii]
 ref|XP_002977530.1| hypothetical protein SELMODRAFT_151868 [Selaginella moellendorffii]
 gb|EFJ21534.1| hypothetical protein SELMODRAFT_151868 [Selaginella moellendorffii]
 gb|EFJ23912.1| hypothetical protein SELMODRAFT_150230 [Selaginella moellendorffii]
Length=238

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 123/174 (71%), Gaps = 3/174 (2%)
 Frame = +3

Query  105  GGMKG---DIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNE  275
            GG +G   DIE G LYPG+   ++ LRWGFIRKVYGI++ QI+LT +VA V V   P+  
Sbjct  3    GGKQGYDYDIESGGLYPGLSADDSTLRWGFIRKVYGILTTQIVLTAIVASVVVFSRPVAM  62

Query  276  VLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
                +  L +FL FLP +LL  +H Y+Q HP+N I LG+FT  LS PV +SCA T G IV
Sbjct  63   FFVTTPGLPIFLAFLPLILLCVIHPYRQSHPINLILLGIFTVCLSLPVGISCAFTRGDIV  122

Query  456  LEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPL  617
            LEALILT+A+   LT YT+WAAK+G+DF+FLGP LF ++ ILIL G IQ FFP+
Sbjct  123  LEALILTAAIGFGLTAYTYWAAKRGQDFSFLGPFLFVAVIILILWGLIQSFFPI  176



>ref|XP_001757037.1| predicted protein [Physcomitrella patens]
 gb|EDQ78268.1| predicted protein [Physcomitrella patens]
Length=248

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 123/172 (72%), Gaps = 5/172 (3%)
 Frame = +3

Query  120  DIEEG-----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
            D+E G      LYPGI   EN+LRWGFIRKVYGI+S Q+LLTT+++   V   P+ E   
Sbjct  14   DLEVGYGSTPALYPGISADENELRWGFIRKVYGILSVQVLLTTVISAFVVSTPPVVEFFL  73

Query  285  GSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEA  464
             +  +LL   F P +L+ PL+ Y Q+HP+N + LGLFTA++S  V +S A T G IVLEA
Sbjct  74   SNIWVLLLTSFAPLILMCPLYYYHQQHPVNLVLLGLFTATISLTVGISSALTKGYIVLEA  133

Query  465  LILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            L+LT+AVVL+LT YT WA++KG DF+FLGPILF SL IL+L G IQ FFPLG
Sbjct  134  LLLTAAVVLSLTAYTHWASRKGHDFSFLGPILFASLVILVLFGLIQAFFPLG  185



>ref|XP_002992613.1| hypothetical protein SELMODRAFT_430816 [Selaginella moellendorffii]
 gb|EFJ06315.1| hypothetical protein SELMODRAFT_430816 [Selaginella moellendorffii]
Length=252

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 119/177 (67%), Gaps = 5/177 (3%)
 Frame = +3

Query  105  GGMKGDIE-----EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPL  269
            GG   DIE      G LYPGI Y +N LRWGFIRKVYGI+S QI+LT LVA V V   P+
Sbjct  12   GGGYADIETGYEPSGALYPGIDYSDNVLRWGFIRKVYGILSTQIVLTALVAAVIVFSQPV  71

Query  270  NEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGA  449
             +    ++ LL+ L  LP +LL PL+ YQ  HPLN + L LFT  LS  V  SCA   G 
Sbjct  72   ADFFAHNTLLLVLLALLPLILLCPLYNYQHHHPLNLVLLSLFTVFLSLSVGTSCAFIRGD  131

Query  450  IVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            ++LEALILT+ V LALT YTFWA K+G DF+FL P LF SL +L+L G IQ+FFPLG
Sbjct  132  VLLEALILTATVALALTAYTFWAVKQGHDFSFLRPYLFVSLVVLVLWGIIQIFFPLG  188



>ref|XP_002968030.1| hypothetical protein SELMODRAFT_88443 [Selaginella moellendorffii]
 gb|EFJ31377.1| hypothetical protein SELMODRAFT_88443 [Selaginella moellendorffii]
Length=252

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 119/177 (67%), Gaps = 5/177 (3%)
 Frame = +3

Query  105  GGMKGDIE-----EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPL  269
            GG   DIE      G LYPGI Y +N LRWGFIRKVYGI+S QI+LT LVA V V   P+
Sbjct  12   GGGYADIETGYEPSGALYPGIDYSDNVLRWGFIRKVYGILSTQIVLTALVAAVIVFSQPV  71

Query  270  NEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGA  449
             +    ++ LL+ L  LP +LL PL+ YQ  HPLN + L LFT  LS  V  SCA   G 
Sbjct  72   ADFFAHNTLLLVLLALLPLILLCPLYNYQHHHPLNLVLLSLFTVFLSLSVGTSCAFIRGD  131

Query  450  IVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            ++LEALILT+ V LALT YTFWA K+G DF+FL P LF SL +++L G IQ+FFPLG
Sbjct  132  VLLEALILTATVALALTAYTFWAVKQGHDFSFLRPYLFVSLVVVVLWGIIQIFFPLG  188



>emb|CAI53895.2| putative receptor associated protein [Capsicum chinense]
Length=242

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 123/174 (71%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E GT  LYP +     +LRW F RKVY II+ Q+LLT  VA V V   P++     
Sbjct  8    KYDVEAGTAPLYPEM-LESPELRWSFTRKVYSIITIQLLLTIAVASVVVTVHPISHFFAT  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            +SA   + + LV  PF+ L PL+ Y Q+HP+N++ LGLFT SL+F V ++CA T G ++L
Sbjct  67   TSAGIGVYIVLVITPFITLCPLYYYHQKHPVNYLLLGLFTVSLAFTVGLTCAFTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EA+ILT+AVV++LT YTFWAAK+G+DFNFLGP LF +L +L+L   IQ+FFPLG
Sbjct  127  EAVILTTAVVISLTAYTFWAAKRGQDFNFLGPFLFGALVVLLLFSLIQIFFPLG  180



>gb|AFW77940.1| hypothetical protein ZEAMMB73_292541 [Zea mays]
Length=242

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 106/140 (76%), Gaps = 3/140 (2%)
 Frame = +3

Query  120  DIEEGT---LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            D+E GT   LYPGI  GE+ LRWGF+RKVYGI++AQ+LLTT V+ +TVL+  LN  L  S
Sbjct  31   DLEAGTGETLYPGISRGESALRWGFVRKVYGILAAQLLLTTAVSALTVLHPTLNATLSDS  90

Query  291  SAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALI  470
              L L L  LPF+L+ PL+ YQ +HP NF+FLGLFT  LSF + V+CANT G IVLEAL+
Sbjct  91   PGLALVLAVLPFILMIPLYHYQHKHPHNFVFLGLFTLCLSFSIGVACANTQGKIVLEALV  150

Query  471  LTSAVVLALTGYTFWAAKKG  530
            LT+ VV++LT Y FWA+KKG
Sbjct  151  LTAGVVVSLTAYAFWASKKG  170



>ref|XP_006349714.1| PREDICTED: BI1-like protein-like [Solanum tuberosum]
Length=242

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 124/174 (71%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E GT  LYP +     +LRW FIRKVY IIS Q+LLT  VA V V   P++     
Sbjct  8    KDDVEFGTAPLYPAM-LESPELRWSFIRKVYSIISIQLLLTIAVASVVVTVHPISHFFAA  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            ++A   L + L+  PF+ L PL+ Y Q+HP+N++ LGLFT SL+F + ++CA T G ++L
Sbjct  67   TNAGLALYIVLIITPFITLCPLYYYHQKHPVNYLLLGLFTVSLAFTIGLTCAFTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EA+ILT+AVV++LT YTFWAAK+G+DFNFLGP LF +L +L+L  FIQ+ FPLG
Sbjct  127  EAVILTTAVVISLTLYTFWAAKRGQDFNFLGPFLFGALIVLLLFSFIQILFPLG  180



>ref|XP_010326401.1| PREDICTED: BI1-like protein [Solanum lycopersicum]
 ref|XP_004253381.2| PREDICTED: BI1-like protein [Solanum lycopersicum]
Length=242

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 124/174 (71%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E GT  LYP +     +LRW FIRKVY IIS Q+LLT  VA V V   P++     
Sbjct  8    KDDVEFGTAPLYPAM-LESPELRWSFIRKVYSIISIQLLLTIAVASVVVTVHPISHFFAA  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            ++A   L + L+  PF+ L PL+ Y Q+HP+N++ LGLFT SL+F + ++CA T G ++L
Sbjct  67   TNAGLALYIVLIITPFITLCPLYYYHQKHPVNYLLLGLFTVSLAFTIGLTCAFTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EA+ILT+AVV++LT YTFWAAK+G+DFNFLGP LF +L +L+L  FIQ+ FPLG
Sbjct  127  EAVILTTAVVISLTLYTFWAAKRGQDFNFLGPFLFGALIVLLLFSFIQILFPLG  180



>gb|AIT42146.1| Bax inhibitor-like protein [Solanum tuberosum]
Length=242

 Score =   135 bits (340),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 124/174 (71%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E GT  LYP +     +LRW FIRKVY IIS Q+LLT  VA V V   P++     
Sbjct  8    KDDVEFGTAPLYPAM-LESPELRWSFIRKVYSIISIQLLLTIAVASVVVTVHPISHFFAA  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            ++A   L + L+  PF+ L PL+ Y Q+HP+N++ LGLFT SL+F + ++CA T G ++L
Sbjct  67   TNAGLALYIVLIITPFITLCPLYYYHQKHPVNYLLLGLFTVSLAFTIGLTCAFTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EA+ILT+AVV++LT YTFWAAK+G+DFNFLGP LF +L +L+L  FIQ+ FPLG
Sbjct  127  EAVILTTAVVISLTLYTFWAAKRGQDFNFLGPFLFGALIVLLLFSFIQILFPLG  180



>ref|XP_008786054.1| PREDICTED: BI1-like protein [Phoenix dactylifera]
Length=244

 Score =   135 bits (339),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 124/176 (70%), Gaps = 6/176 (3%)
 Frame = +3

Query  108  GMKGDIEEG--TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL  281
            G  GD+E G   LYP +     +LRW FIRK+Y I++AQ+ LT  VA V V   P++   
Sbjct  8    GKDGDVEAGPRLLYPMM-LESPELRWAFIRKIYVILTAQMALTVAVASVVVAVRPISHFF  66

Query  282  KGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
              S+A   L +FL+ LPF++L PL+ Y QRHP+NF+ LGLFT S+SF V ++CA T G +
Sbjct  67   VSSAAGLGLYIFLLILPFIVLCPLYYYHQRHPVNFLLLGLFTVSISFAVGLTCAFTSGKV  126

Query  453  VLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            +LEA ILT+ VV++LT YTFWAA++G DFNFLGP LF ++ +L++   IQMFFPLG
Sbjct  127  ILEAAILTAVVVVSLTLYTFWAARRGHDFNFLGPFLFAAVLVLLVFALIQMFFPLG  182



>ref|XP_004290629.1| PREDICTED: BI1-like protein [Fragaria vesca subsp. vesca]
Length=239

 Score =   134 bits (337),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 122/174 (70%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            KGD+E G+  LYP +     +LRW FIRK+Y II+ Q+L T  VA V V Y P+      
Sbjct  5    KGDVESGSAPLYPMM-LESPELRWSFIRKIYSIIAVQLLATIAVAAVVVSYHPIANFFVS  63

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF++L PL+ Y QRHP+NFI LG+FT SL+F V ++CA T G ++L
Sbjct  64   TGAGLALYIVLIITPFIVLCPLYYYYQRHPVNFILLGIFTISLAFVVGLTCAFTSGKVIL  123

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            E+ ILT+ VV+ALT YTFWAA++G+DFNFLGP L  +L +LI+ G IQ+FFPLG
Sbjct  124  ESAILTAVVVIALTLYTFWAARRGQDFNFLGPFLSGALLVLIVFGLIQIFFPLG  177



>ref|XP_001768467.1| predicted protein [Physcomitrella patens]
 gb|EDQ66829.1| predicted protein [Physcomitrella patens]
Length=250

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 123/185 (66%), Gaps = 6/185 (3%)
 Frame = +3

Query  84   RVSSSYDG-GMKGDIEEG-----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvag  245
            +  S Y G G   D+E G      LYPGI   EN+LRWG IRKVY I+S Q+LLT  V+ 
Sbjct  3    KCDSEYAGYGTSPDLEVGYGARPALYPGIYADENELRWGLIRKVYNILSIQVLLTAAVSA  62

Query  246  vtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAV  425
              V              +L F    P +L+ PL+ Y+Q+HP+N + LGLFTA++S  V +
Sbjct  63   FVVFTPAALSFFAVHPWILFFASITPLILMCPLYYYRQQHPVNLVLLGLFTATISLSVGI  122

Query  426  SCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQM  605
            SCA T+G IVLEAL+LT+ VVLALT YT +AA+KG DF+FLGPILFT+L I++L G IQ+
Sbjct  123  SCALTNGYIVLEALLLTAGVVLALTAYTLYAARKGHDFSFLGPILFTTLTIILLFGLIQV  182

Query  606  FFPLG  620
            FFPLG
Sbjct  183  FFPLG  187



>ref|XP_010923520.1| PREDICTED: BI1-like protein [Elaeis guineensis]
 gb|AEZ00913.1| putative transmembrane BAX inhibitor motif-containing protein 
[Elaeis guineensis]
Length=244

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 123/176 (70%), Gaps = 6/176 (3%)
 Frame = +3

Query  108  GMKGDIEEG--TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL  281
            G  GD+E G   LYP +      LRW FIRK+Y I++AQ+ LT  VA V V   P++   
Sbjct  8    GKDGDLEAGPRLLYPMM-LESPDLRWAFIRKIYVILTAQMALTVAVASVVVTVRPISHFF  66

Query  282  KGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
              S A   L +FL+ LPF++L PL+ Y QRHP+NF+ LGLFTAS+SF V ++CA T G +
Sbjct  67   VSSGAGLGLYIFLLILPFIVLCPLYYYHQRHPVNFLLLGLFTASISFAVGLTCAFTSGKV  126

Query  453  VLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            +LEA ILT+AVV++LT YTFWAA++G DFNFLGP LF ++ +L++   IQM FPLG
Sbjct  127  ILEAAILTTAVVVSLTLYTFWAARRGHDFNFLGPFLFAAVLVLLVFAVIQMLFPLG  182



>gb|KFK35489.1| hypothetical protein AALP_AA5G291100 [Arabis alpina]
Length=242

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 121/174 (70%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIE--EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E  +  LYP +     +LRW FIRKVY IIS Q+L+T  VA   V Y P++     
Sbjct  8    KHDLESAQTPLYPMMM-ESPELRWSFIRKVYSIISIQLLVTIAVAATVVAYHPISVFFTT  66

Query  288  SS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            +S   AL + L+  P +++ PL+ Y Q+HP+N++ LG+FT SL+F V ++CA T G ++L
Sbjct  67   TSLGFALYILLILTPLIVMCPLYYYHQKHPVNYLLLGIFTVSLAFAVGLTCAFTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EA+ILTS VV++LT YTFWAAK+G DFNFLGP LF ++ +L++  FIQ+ FPLG
Sbjct  127  EAVILTSVVVISLTLYTFWAAKRGHDFNFLGPFLFGAVIVLMVFSFIQILFPLG  180



>ref|XP_009618293.1| PREDICTED: BI1-like protein [Nicotiana tomentosiformis]
Length=242

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 124/174 (71%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E GT  LYP +     +LRW FIRKVY II+ Q+LLT  VA V V   P++     
Sbjct  8    KDDVEAGTRPLYPAM-LEAPELRWSFIRKVYSIITIQLLLTIAVASVVVTVHPISHFFAT  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            +SA   L + L+  PF+ L PL+ Y Q+HP+N++ LG+FT SL+F + ++CA T G ++L
Sbjct  67   TSAGLGLYIVLIITPFITLCPLYYYHQKHPVNYLLLGIFTVSLAFTIGLTCAFTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EA+ILT+AVV++LT YTFWAA++G+DFNFLGP LF +L +L++  FIQ+ FPLG
Sbjct  127  EAVILTTAVVISLTLYTFWAARRGQDFNFLGPFLFGALIVLLVFAFIQILFPLG  180



>ref|XP_009789970.1| PREDICTED: BI1-like protein [Nicotiana sylvestris]
Length=242

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 124/174 (71%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E GT  LYP +     +LRW FIRKVY II+ Q+LLT  VA V V   P++     
Sbjct  8    KDDVEAGTRPLYPAM-LEAPELRWSFIRKVYSIITIQLLLTIAVASVVVTVHPISHFFAT  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            +SA   L + L+  PF+ L PL+ Y Q+HP+N++ LG+FT SL+F + ++CA T G ++L
Sbjct  67   TSAGLGLYIVLIITPFITLCPLYYYHQKHPVNYLLLGVFTVSLAFTIGLTCAFTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EA+ILT+AVV++LT YTFWAA++G+DFNFLGP LF +L +L++  FIQ+ FPLG
Sbjct  127  EAVILTTAVVISLTLYTFWAARRGQDFNFLGPFLFGALIVLLVFAFIQILFPLG  180



>ref|XP_006303615.1| hypothetical protein CARUB_v10011301mg [Capsella rubella]
 gb|EOA36513.1| hypothetical protein CARUB_v10011301mg [Capsella rubella]
Length=247

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 119/178 (67%), Gaps = 10/178 (6%)
 Frame = +3

Query  114  KGDIE------EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNE  275
            K D+E      E TLYP +     QLRWGFIRKVY II+ Q+L T  VA   V   P+  
Sbjct  10   KDDVETGAGGGESTLYPTM-LESPQLRWGFIRKVYSIIAFQLLATIAVAATVVFVRPIAV  68

Query  276  VLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
                ++A   L + L+  P L++ PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T G
Sbjct  69   FFATTTAGLVLWIVLIITPLLVMCPLYYYHQKHPVNYLLLGIFTVALAFAVGLTCAFTSG  128

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
             ++LEA ILT+ VVL+LT YTFWAAKKG DFNFLGP LF +L +L++   IQ+FFPLG
Sbjct  129  KVILEAAILTTVVVLSLTFYTFWAAKKGYDFNFLGPFLFGALIVLMVFALIQIFFPLG  186



>ref|XP_006352761.1| PREDICTED: BI1-like protein-like [Solanum tuberosum]
Length=245

 Score =   132 bits (333),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 124/175 (71%), Gaps = 8/175 (5%)
 Frame = +3

Query  114  KGDIEEG--TLYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
            K D+E G   LYP +   EN QLRWGFIRKVY I+S Q+L+T  VA V V   P+     
Sbjct  12   KDDVEAGERPLYPAML--ENPQLRWGFIRKVYSILSFQLLITIGVAAVVVTVHPIAHFFV  69

Query  285  GSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
             + A   L + L+  PF+ LWPL+ Y Q+HP+NF+ LGLFT +L+F V ++CA T G ++
Sbjct  70   STGAGLALYILLIISPFITLWPLYYYHQKHPVNFLLLGLFTVTLAFAVGLTCAFTSGKVI  129

Query  456  LEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LE++ILT+AVVL+LT YTFWAA++G DFNFLGP LF +L +L+L  FIQ+ FPLG
Sbjct  130  LESVILTTAVVLSLTVYTFWAARRGHDFNFLGPFLFGALMVLMLFAFIQLLFPLG  184



>ref|XP_004242346.2| PREDICTED: BI1-like protein [Solanum lycopersicum]
Length=252

 Score =   132 bits (332),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 122/175 (70%), Gaps = 8/175 (5%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
            K D+E G   LYP +   EN QLRWGFIRKVY I+S Q+L+T  V  V V   P+     
Sbjct  19   KDDVEGGARPLYPAML--ENPQLRWGFIRKVYSILSLQLLITIAVGAVVVTVHPIAHFFV  76

Query  285  GSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
             + A   L + L+  PF+ L PL+ Y Q+HP+NF+ LGLFT +L+F V ++CA T G ++
Sbjct  77   STGAGLALYILLIIAPFITLSPLYYYHQKHPVNFLLLGLFTVTLAFAVGLTCAFTSGKVI  136

Query  456  LEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LE++ILT+AVVL+LT YTFWAA++G DFNFLGP LF +L +L+L  FIQ+ FPLG
Sbjct  137  LESVILTAAVVLSLTIYTFWAARRGHDFNFLGPFLFGALMVLMLFAFIQLLFPLG  191



>ref|XP_010457316.1| PREDICTED: BI1-like protein [Camelina sativa]
Length=247

 Score =   132 bits (331),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 118/178 (66%), Gaps = 10/178 (6%)
 Frame = +3

Query  114  KGDIEEG------TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNE  275
            K D+E G      TLYP +     +LRWGFIRKVY II  Q+L T  VA   V   P+  
Sbjct  10   KDDVETGASGGERTLYPTM-LESPELRWGFIRKVYSIIVFQLLATIAVAATVVFVRPIAV  68

Query  276  VLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
                +SA   L + L+  P L++ PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T G
Sbjct  69   FFATTSAGLALWIVLIITPLLVMCPLYYYHQKHPVNYLLLGIFTVTLAFAVGLTCAFTSG  128

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
             ++LEA ILT+ VVL+LT YTFWAAKKG DFNFLGP LF +L +L++   IQ+FFPLG
Sbjct  129  KVILEAAILTTVVVLSLTLYTFWAAKKGYDFNFLGPFLFGALIVLMVFALIQIFFPLG  186



>ref|XP_010481523.1| PREDICTED: BI1-like protein [Camelina sativa]
Length=247

 Score =   132 bits (331),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 118/178 (66%), Gaps = 10/178 (6%)
 Frame = +3

Query  114  KGDIEEG------TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNE  275
            K D+E G      TLYP +     +LRWGFIRKVY II  Q+L T  VA   V   P+  
Sbjct  10   KDDVETGAGGGERTLYPTM-LESPELRWGFIRKVYSIIVFQLLATIAVAATVVFVRPIAV  68

Query  276  VLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
                +SA   L + L+  P +++ PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T G
Sbjct  69   FFATTSAGLALWIVLIITPLIVMCPLYYYHQKHPVNYLLLGIFTVTLAFAVGLTCAFTSG  128

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
             ++LEA ILT+ VVL+LT YTFWAAKKG DFNFLGP LF +L +L++   IQ+FFPLG
Sbjct  129  KVILEAAILTTVVVLSLTLYTFWAAKKGYDFNFLGPFLFGALIVLMVFALIQIFFPLG  186



>ref|XP_009119572.1| PREDICTED: BI1-like protein [Brassica rapa]
Length=245

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 119/175 (68%), Gaps = 7/175 (4%)
 Frame = +3

Query  114  KGDIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
            K D+E G    LYP +     +LRWGFIRKVY II+ Q+LLT  VA   V   P+     
Sbjct  10   KDDVESGGERPLYPTM-LESPELRWGFIRKVYSIIAFQLLLTIAVAATVVTVRPIAVFFS  68

Query  285  GSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
             +SA   L + L+  P L+L PL+ Y Q+HP+N++ LG+FT +L+F V +SCA T G ++
Sbjct  69   TTSAGLALWIVLIITPLLVLCPLYYYHQKHPVNYLLLGVFTVALAFAVGLSCAFTSGKVI  128

Query  456  LEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LE+ ILT+ VVL+LT YTFWAAKKG DFNFLGP LF ++ +L++   IQ+FFPLG
Sbjct  129  LESAILTTVVVLSLTFYTFWAAKKGYDFNFLGPFLFGAIIVLMVFALIQIFFPLG  183



>ref|XP_002889434.1| glutamate binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65693.1| glutamate binding protein [Arabidopsis lyrata subsp. lyrata]
Length=246

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 119/177 (67%), Gaps = 9/177 (5%)
 Frame = +3

Query  114  KGDIEEG-----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEV  278
            K D+E G     +LYP +     +LRWGFIRKVY II+ Q+L T  VA   V   P+   
Sbjct  10   KDDVETGGGGERSLYPTM-LESPELRWGFIRKVYSIIAFQLLATIAVAATVVFVRPIAVF  68

Query  279  LKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGA  449
               +SA   L + L+  P +++ PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T G 
Sbjct  69   FATTSAGLALWIVLIITPLIVMCPLYYYHQKHPVNYLLLGIFTVALAFAVGLTCAFTSGK  128

Query  450  IVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            ++LEA ILT+ VVL+LT YTFWAAKKG DFNFLGP LF +L +L++   IQ+FFPLG
Sbjct  129  VILEAAILTTVVVLSLTFYTFWAAKKGYDFNFLGPFLFGALIVLMVFALIQIFFPLG  185



>emb|CDX89914.1| BnaA10g01680D [Brassica napus]
Length=245

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 119/175 (68%), Gaps = 7/175 (4%)
 Frame = +3

Query  114  KGDIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
            K D+E G    LYP +     +LRWGFIRKVY II+ Q+LLT  VA   V   P+     
Sbjct  10   KDDVESGGERPLYPTM-LESPELRWGFIRKVYSIIAFQLLLTIAVAATVVTVRPIAVFFS  68

Query  285  GSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
             +SA   L + L+  P L+L PL+ Y Q+HP+N++ LG+FT +L+F V +SCA T G ++
Sbjct  69   TTSAGLALWIVLIITPLLVLCPLYYYHQKHPVNYLLLGVFTVALAFAVGLSCAFTSGKVI  128

Query  456  LEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LE+ ILT+ VVL+LT YTFWAAKKG DFNFLGP LF ++ +L++   IQ+FFPLG
Sbjct  129  LESAILTTVVVLSLTFYTFWAAKKGYDFNFLGPFLFGAIIVLMVFALIQIFFPLG  183



>ref|NP_171806.1| protein lifeguard 4 [Arabidopsis thaliana]
 ref|NP_001184896.1| protein lifeguard 4 [Arabidopsis thaliana]
 gb|AAD25802.1|AC006550_10 Belongs to the PF|01027 Uncharacterized protein family UPF0005 
with 7 transmembrane domains [Arabidopsis thaliana]
 gb|AAR24681.1| At1g03070 [Arabidopsis thaliana]
 dbj|BAD43212.1| putative glutamate/aspartate-binding peptide [Arabidopsis thaliana]
 gb|AEE27524.1| BRZ-INSENSITIVE-LONG HYPOCOTYLS 4-like protein [Arabidopsis thaliana]
 gb|AEE27525.1| transmembrane BAX inhibitor motif-containing protein [Arabidopsis 
thaliana]
Length=247

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 119/178 (67%), Gaps = 10/178 (6%)
 Frame = +3

Query  114  KGDIEEG------TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNE  275
            K D+E G      +LYP +     +LRWGFIRKVY II+ Q+L T  VA   V   P+  
Sbjct  10   KDDVETGREGGERSLYPTM-LESPELRWGFIRKVYSIIAFQLLATIAVASTVVFVRPIAV  68

Query  276  VLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
                +SA   L + L+  P +++ PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T G
Sbjct  69   FFATTSAGLALWIVLIITPLIVMCPLYYYHQKHPVNYLLLGIFTVALAFAVGLTCAFTSG  128

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
             ++LEA ILT+ VVL+LT YTFWAAKKG DFNFLGP LF +L +L++   IQ+FFPLG
Sbjct  129  KVILEAAILTTVVVLSLTVYTFWAAKKGYDFNFLGPFLFGALIVLMVFALIQIFFPLG  186



>ref|XP_006402289.1| hypothetical protein EUTSA_v10006212mg [Eutrema salsugineum]
 gb|ESQ43742.1| hypothetical protein EUTSA_v10006212mg [Eutrema salsugineum]
Length=240

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 120/172 (70%), Gaps = 5/172 (3%)
 Frame = +3

Query  120  DIE--EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSS  293
            D+E  +  LYP +     +LRW FIRKVY IIS Q+L+T  VA   V + P++     + 
Sbjct  7    DLESAQTPLYPKMTTEPPELRWSFIRKVYSIISIQLLVTIAVAATVVKFPPISVFFTTTG  66

Query  294  A---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEA  464
            A   L + ++F P +++ PL+ Y Q+HP+N+I LG+FT SL+F V ++CA T G ++LE+
Sbjct  67   AGFALYILVIFTPLIVMCPLYYYHQKHPVNYILLGIFTVSLAFAVGLTCAFTSGKVILES  126

Query  465  LILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            +ILTS VV++LT YTFWAAK+G DFNFLGP LF ++ +L++  FIQ+ FPLG
Sbjct  127  VILTSVVVVSLTLYTFWAAKRGHDFNFLGPFLFGAVIVLMVFSFIQILFPLG  178



>ref|XP_007200360.1| hypothetical protein PRUPE_ppa010573mg [Prunus persica]
 gb|EMJ01559.1| hypothetical protein PRUPE_ppa010573mg [Prunus persica]
Length=244

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 120/176 (68%), Gaps = 8/176 (5%)
 Frame = +3

Query  114  KGDIEEGT----LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL  281
            K D+E G     LYP +     +LRW FIRK+Y II+ Q+L+T  VA   V Y P+    
Sbjct  8    KTDVEAGVGPSPLYPMM-LESPELRWSFIRKIYSIIAIQLLVTIAVAATVVSYRPVAHFF  66

Query  282  KGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
              +SA   L + L+ LPF++L PL+ Y Q+HP+N++ LG+FT SL+F V ++CA T G +
Sbjct  67   VSTSAGLALYIVLIILPFIVLCPLYYYHQKHPVNYLLLGVFTISLAFIVGLTCAFTSGKV  126

Query  453  VLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            +LE++ILT+ VVL LT YTFWAAK+G DFNFLGP L  ++ +LI+   IQ+FFPLG
Sbjct  127  ILESVILTAVVVLGLTLYTFWAAKRGHDFNFLGPFLSGAILVLIVFALIQVFFPLG  182



>ref|XP_010474912.1| PREDICTED: BI1-like protein [Camelina sativa]
Length=247

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 118/178 (66%), Gaps = 10/178 (6%)
 Frame = +3

Query  114  KGDIEEG------TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNE  275
            K D+E G      TLYP +     +LRWGFIRKVY II  Q+L T  VA   V   P+  
Sbjct  10   KDDVETGASGGERTLYPTM-LESPELRWGFIRKVYSIIVFQLLATIAVAATVVFVRPIAV  68

Query  276  VLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
                +SA   L + L+  P L++ PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T G
Sbjct  69   FFATTSAGLALWIVLIITPLLVMCPLYYYHQKHPVNYLLLGIFTVTLAFAVGLTCAFTSG  128

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
             ++LEA ILT+ V+L+LT YTFWAAKKG DFNFLGP LF +L +L++   IQ+FFPLG
Sbjct  129  KVILEAAILTTVVLLSLTLYTFWAAKKGYDFNFLGPFLFGALIVLMVFALIQIFFPLG  186



>ref|XP_010474910.1| PREDICTED: BI1-like protein [Camelina sativa]
Length=247

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 118/178 (66%), Gaps = 10/178 (6%)
 Frame = +3

Query  114  KGDIEEG------TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNE  275
            K D+E G      TLYP +     +LRWGFIRKVY II  Q+L T  VA   V   P+  
Sbjct  10   KDDVETGASGGERTLYPTM-LESPELRWGFIRKVYSIIVFQLLATIAVAATVVFVRPIAV  68

Query  276  VLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
                +SA   L + L+  P L++ PL+ Y Q+HP+N++ LG+FT +++F + ++CA T G
Sbjct  69   FFATTSAGLALWIVLIITPLLVMCPLYYYHQKHPVNYLLLGIFTVAMAFAIGLTCAFTSG  128

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
             ++LEA ILT+ VVL+LT YTFWAAKKG DFNFLGP LF +L +L++   IQ+FFPLG
Sbjct  129  KVILEAAILTTVVVLSLTLYTFWAAKKGYDFNFLGPFLFGALIVLMVFALIQIFFPLG  186



>ref|XP_009398556.1| PREDICTED: BI1-like protein [Musa acuminata subsp. malaccensis]
Length=244

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 120/173 (69%), Gaps = 6/173 (3%)
 Frame = +3

Query  117  GDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            GD+E GT  LYP +     +LRW FIRKVY II+ Q+ LT  VA V +   P++  L  S
Sbjct  11   GDLESGTQPLYPMMS-ESPELRWAFIRKVYSIIAVQLALTAAVAAVVIAVPPISHFLVSS  69

Query  291  SA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLE  461
            +A   +   L+FLP ++L PL+ Y QRHP+N + LGLFT S SF V +SCA TDG ++LE
Sbjct  70   TAGLAVYFLLIFLPLIVLCPLYYYHQRHPVNLLLLGLFTVSFSFAVGMSCAFTDGKVILE  129

Query  462  ALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            A ILT+ VV++LT YTFWA+++G DFNFLGP LF ++ +L++   IQ+ FPLG
Sbjct  130  AAILTAVVVVSLTLYTFWASRRGHDFNFLGPFLFAAILVLLVFSLIQILFPLG  182



>emb|CDY18147.1| BnaC05g01700D [Brassica napus]
Length=248

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 119/178 (67%), Gaps = 10/178 (6%)
 Frame = +3

Query  114  KGDIEEG------TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNE  275
            K D+E G       LYP +     +LRWGFIRKVY II+ Q+LLT  VA   V   P+  
Sbjct  10   KDDVESGGNSGERPLYPTM-LESPELRWGFIRKVYSIIAFQLLLTIAVAATVVTVRPIAV  68

Query  276  VLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
                +SA   L + L+  P L+L PL+ Y Q+HP+N++ LG+FT +L+F V +SCA T G
Sbjct  69   FFSTTSAGLALWIVLIITPLLVLCPLYYYHQKHPVNYLLLGIFTVALAFAVGLSCAFTSG  128

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
             ++LE+ ILT+ VVL+LT YTFWAAKKG DFNFLGP LF ++ +L++   IQ+FFPLG
Sbjct  129  KVILESAILTTVVVLSLTFYTFWAAKKGYDFNFLGPFLFGAIIVLMIFALIQIFFPLG  186



>ref|XP_006418268.1| hypothetical protein EUTSA_v10008600mg [Eutrema salsugineum]
 gb|ESQ36621.1| hypothetical protein EUTSA_v10008600mg [Eutrema salsugineum]
Length=246

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 118/176 (67%), Gaps = 8/176 (5%)
 Frame = +3

Query  114  KGDIEEG----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL  281
            K D+E G     LYP +     +LRWGFIRKVY II+ Q+L T  VA   V   P+    
Sbjct  10   KDDVESGGGESPLYPTMM-ESPELRWGFIRKVYSIIAFQLLATIAVAATVVTVRPIAVFF  68

Query  282  KGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
              +SA   L + L+  P +++ PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T G +
Sbjct  69   ATTSAGLALWILLIITPLIVMCPLYYYHQKHPVNYLLLGIFTVALAFAVGLTCAFTSGKV  128

Query  453  VLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            +LE+ ILT+ VVL+LT YTFWAAKKG DFNFLGP LF ++ +L++   IQ+FFPLG
Sbjct  129  ILESAILTTVVVLSLTFYTFWAAKKGYDFNFLGPFLFGAIIVLMVFALIQIFFPLG  184



>ref|XP_002463744.1| hypothetical protein SORBIDRAFT_01g005260 [Sorghum bicolor]
 gb|EER90742.1| hypothetical protein SORBIDRAFT_01g005260 [Sorghum bicolor]
Length=243

 Score =   129 bits (324),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 119/187 (64%), Gaps = 9/187 (5%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagv  248
            M+GF +     + G         LYPG+     +LRW F+RK+Y I++ Q+ +T  V+G 
Sbjct  1    MFGFRKADPDLEAG-----GASLLYPGMT-ESPELRWAFVRKIYVILAVQLAMTAAVSGF  54

Query  249  tvlYAPLNEVLKGSSAlllflvflpfl---llwplHVYQQRHPLNFIFLGLFTASLSFPV  419
             V    ++     S+A +   +FL  L   +L PLH Y Q+HP+N + LGLFT ++SF V
Sbjct  55   VVKVPAVSNFFVSSNAGIALYIFLIILPFIVLCPLHYYHQKHPVNLLLLGLFTVAISFAV  114

Query  420  AVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfi  599
             ++CA T G I+LEA ILT+ VV++LT YTFWAAK+G DFNFLGP LF ++ +L++   I
Sbjct  115  GMTCAFTSGKIILEAAILTAVVVISLTAYTFWAAKRGHDFNFLGPFLFAAIMVLMVFSLI  174

Query  600  QMFFPLG  620
            Q+FFPLG
Sbjct  175  QIFFPLG  181



>ref|XP_010256169.1| PREDICTED: BI1-like protein [Nelumbo nucifera]
Length=243

 Score =   129 bits (324),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 121/176 (69%), Gaps = 6/176 (3%)
 Frame = +3

Query  108  GMKGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL  281
            G  GD+E G+  LYP +     +LRW FIRKVY I++ Q+LLT  VA V V   P+    
Sbjct  7    GKAGDVEAGSRQLYPMM-LESPELRWAFIRKVYSILTIQLLLTIAVAAVVVSVHPIATFF  65

Query  282  KGSS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
              S    AL + ++ LPF++L PL+ Y QRHP+N + LGLFT SL+F V ++CA T G I
Sbjct  66   VSSGPGFALYIVIIILPFIVLCPLYYYYQRHPVNLLLLGLFTVSLAFAVGLTCAFTSGKI  125

Query  453  VLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            +LE+ ILT+AVVL+LT YTFWAAK+G DFNFLGP LF SL  L++  FIQ+ FPLG
Sbjct  126  ILESAILTAAVVLSLTLYTFWAAKRGHDFNFLGPFLFGSLLALMVFAFIQILFPLG  181



>gb|KFK42668.1| hypothetical protein AALP_AA1G024300 [Arabis alpina]
Length=247

 Score =   129 bits (324),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 120/177 (68%), Gaps = 9/177 (5%)
 Frame = +3

Query  114  KGDIE-----EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEV  278
            K D+E     E TLYP +     +LRWGFIRKVY II+ Q+L T  VA   V   P+   
Sbjct  10   KDDVESSGGGERTLYPTM-LESPELRWGFIRKVYSIIAFQLLATIAVAATVVTVRPIAVF  68

Query  279  LKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGA  449
               +SA   L + L+  PF+++ PL+ Y Q+HP+N++ LG+FT +L+F V +SCA T G 
Sbjct  69   FSTTSAGLALWIVLIITPFVVMCPLYYYHQKHPVNYLLLGIFTVTLAFGVGLSCAFTSGK  128

Query  450  IVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            ++LE+ ILT+ VVL+LT YTFWAAKKG DFNFLGP LF +L +LI+  FIQ+ FPLG
Sbjct  129  VILESAILTTVVVLSLTVYTFWAAKKGYDFNFLGPFLFGALIVLIVFAFIQILFPLG  185



>gb|KCW60898.1| hypothetical protein EUGRSUZ_H03636, partial [Eucalyptus grandis]
Length=310

 Score =   130 bits (327),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +3

Query  345  HVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAK  524
            H+YQQ+HPLNFIFLGLFT SLS  V VSCANT+G IVLEALILTS+VV ALTGYTFWA+K
Sbjct  157  HIYQQKHPLNFIFLGLFTLSLSLTVGVSCANTEGRIVLEALILTSSVVCALTGYTFWASK  216

Query  525  KGRDFNFLGPilftslfililtgfiQMFFPLG  620
            KG+DF++LGPILFT L +L++T F+QM FPLG
Sbjct  217  KGKDFSYLGPILFTGLIVLLMTSFMQMMFPLG  248



>ref|XP_004981439.1| PREDICTED: BI1-like protein-like [Setaria italica]
Length=242

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 120/173 (69%), Gaps = 7/173 (4%)
 Frame = +3

Query  120  DIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            D+E G    LYPG+    + LRW F+RK+Y I+S Q+ +T LV+   V    ++     S
Sbjct  9    DLEAGGSELLYPGMTESPD-LRWAFVRKIYVILSVQLAMTALVSAFVVKVPAISLFFVSS  67

Query  291  SA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLE  461
            +A   L +FL+ LPF++L PLH Y Q+HP+N + LGLFT ++SF V ++CA T G ++LE
Sbjct  68   NAGIALYIFLLILPFIVLCPLHYYHQKHPVNLLLLGLFTVAISFAVGMTCAFTSGKVILE  127

Query  462  ALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            A ILT+ VV++LT YTFWAAK+G DFNFLGP LF +L +L++   +Q+FFPLG
Sbjct  128  AAILTAVVVISLTAYTFWAAKRGHDFNFLGPFLFAALMVLMVFSLVQIFFPLG  180



>ref|XP_008235367.1| PREDICTED: BI1-like protein [Prunus mume]
Length=244

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 120/176 (68%), Gaps = 8/176 (5%)
 Frame = +3

Query  114  KGDIEEG----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL  281
            K D+E G     LYP +     +LRW FIRK+Y II+ Q+L+T  VA   V Y P+    
Sbjct  8    KTDVEAGGGPSPLYPMM-LESPELRWSFIRKIYSIIAIQLLVTIAVAAAVVSYRPVAHFF  66

Query  282  KGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
              +SA   L + L+ LPF++L PL+ Y Q+HP+N++ LG+FT SL+F V ++CA T G +
Sbjct  67   VSTSAGLALYIVLIILPFIVLCPLYYYHQKHPVNYLLLGVFTISLAFIVGLTCAFTSGKV  126

Query  453  VLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            +LE++ILT+ VVL LT YTFWAAK+G DFNFLGP L  ++ ILI+   IQ+FFPLG
Sbjct  127  ILESVILTAVVVLGLTLYTFWAAKRGHDFNFLGPFLSGAILILIVFALIQVFFPLG  182



>gb|ACG32419.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays]
Length=243

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 116/187 (62%), Gaps = 9/187 (5%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagv  248
            M+G+ +     + G         LYPG+     +LRW F+RK+Y I++ Q+ +T  V+  
Sbjct  1    MFGYRKADPDLEAG-----GSSLLYPGMT-ESPELRWAFVRKIYAILTVQLAMTAAVSAF  54

Query  249  tvlYAPLNEVLKGSSAlllflvflpfl---llwplHVYQQRHPLNFIFLGLFTASLSFPV  419
             V    ++     S+A +   +FL  L   +L PLH Y Q+HP+N + LGLFT ++SF V
Sbjct  55   VVKVPAVSNFFVSSNAGIALYIFLIVLPFIVLCPLHYYHQKHPVNLLLLGLFTVAISFAV  114

Query  420  AVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfi  599
             ++CA T G I+LEA ILT+ VV +LT YTFWAAK+G DFNFLGP L  ++ +L++   I
Sbjct  115  GMTCAFTSGKIILEAAILTAVVVNSLTAYTFWAAKRGHDFNFLGPFLIAAIMVLMVFSLI  174

Query  600  QMFFPLG  620
            Q+FFPLG
Sbjct  175  QIFFPLG  181



>ref|XP_010545100.1| PREDICTED: BI1-like protein [Tarenaya hassleriana]
Length=242

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 119/174 (68%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G   LYP +     +LRW FIRKVY IIS Q+L T  VA V V   P++     
Sbjct  8    KHDLESGPRPLYPMM-LESPELRWSFIRKVYSIISIQLLATIAVASVVVTVHPISTFFTT  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+F P ++L PL+ Y Q+HP+N++ L +FT SL+F V ++CA T G ++L
Sbjct  67   TGAGLALYVLLIFTPLIVLCPLYYYHQKHPVNYLLLSVFTISLAFAVGLTCAFTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            E++ILT+ VVL+LTGYTFWAAK+G DFNFLGP LF ++ +L++   IQ+ FPLG
Sbjct  127  ESVILTTVVVLSLTGYTFWAAKRGYDFNFLGPFLFGAILVLMVFALIQILFPLG  180



>gb|KDP21410.1| hypothetical protein JCGZ_21881 [Jatropha curcas]
Length=242

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 118/174 (68%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G   LYP +     QLRW FIRKVY II  Q+L T  VA V V Y P+      
Sbjct  8    KSDVEAGARPLYPMM-LESPQLRWAFIRKVYSIICFQLLATIAVAAVVVSYHPIAHFFVS  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+ +PF++L PL+ Y Q+HP+N+  LG+FT  LSF V ++CA T G ++L
Sbjct  67   TGAGLALYIVLIIMPFIVLCPLYYYHQKHPVNYFLLGIFTICLSFAVGLTCAFTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            E++ILT+ VVL+LT YTFWAA++G DFNFLGP LF ++ +L++  FIQ+ FPLG
Sbjct  127  ESVILTTVVVLSLTLYTFWAARRGHDFNFLGPFLFGAIIVLMVFAFIQILFPLG  180



>ref|XP_009804930.1| PREDICTED: BI1-like protein [Nicotiana sylvestris]
Length=245

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 120/174 (69%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G   LYP +     +LRWGFIRKVY I+S Q+LLT  VA V V   P+      
Sbjct  11   KDDVEGGARPLYPTM-LESPELRWGFIRKVYSILSLQLLLTIAVASVVVTVHPIAHFFVS  69

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF+ L PL+ Y Q+HP+N++ LGLFT +L+F V ++CA T G ++L
Sbjct  70   TGAGLALYIVLIITPFITLCPLYYYHQKHPVNYLLLGLFTVALAFAVGLTCAFTSGKVIL  129

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            E++ILT++VVL+LT YTFWAAK+G DFNFLGP LF +L +L+L  FIQ  FPLG
Sbjct  130  ESVILTTSVVLSLTVYTFWAAKRGHDFNFLGPFLFGALIVLMLFAFIQFLFPLG  183



>ref|XP_010259137.1| PREDICTED: BI1-like protein [Nelumbo nucifera]
Length=243

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 123/174 (71%), Gaps = 8/174 (5%)
 Frame = +3

Query  117  GDIEEG--TLYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            GDIE G   LYP +   EN QLRWGFIRKVY I++ Q LLT +V+ V V   P+      
Sbjct  10   GDIEAGGQQLYPKML--ENPQLRWGFIRKVYCILAVQFLLTVVVSAVIVFVRPIAVFFVT  67

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            ++A   L + L+ LPF+LL PL+ Y Q+HP+N I LGLFT ++SF V ++CA T G I+L
Sbjct  68   TAAGFALYIVLIILPFILLCPLYYYHQKHPVNLILLGLFTVAISFSVGLTCAFTKGKIIL  127

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EA ILT+ VV++LT YTFWAAKKG DF+FLGP LF +L +L + GFIQM FPLG
Sbjct  128  EAAILTAVVVVSLTIYTFWAAKKGHDFSFLGPFLFAALLVLTIFGFIQMLFPLG  181



>emb|CDP03667.1| unnamed protein product [Coffea canephora]
Length=242

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 122/174 (70%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G   LYP +     +LRW FIRK+Y II+AQ++LT  VA V V Y P+      
Sbjct  8    KDDLESGARPLYPMM-LESPELRWAFIRKIYSIITAQLVLTVAVAAVVVTYHPIARFFTT  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF++L PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T+G ++L
Sbjct  67   TGAGLALYIVLIITPFIVLCPLYYYHQKHPVNYLLLGVFTLTLAFAVGLTCAYTEGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            E++ILT AVV++LT YTFWAAK+G DFNFLGP LF ++ +L+L   IQ+ FPLG
Sbjct  127  ESVILTGAVVISLTLYTFWAAKRGHDFNFLGPFLFGAVVVLMLFAIIQILFPLG  180



>ref|NP_001149171.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays]
 gb|ACG34452.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays]
 gb|ACR38716.1| unknown [Zea mays]
 gb|AFW67367.1| transmembrane BAX inhibitor motif protein-containing protein 
4 [Zea mays]
Length=243

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 116/187 (62%), Gaps = 9/187 (5%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagv  248
            M+G+ +     + G         LYPG+     +LRW F+RK+Y I++ Q+ +T  V+  
Sbjct  1    MFGYRKADPDLEAG-----GSSLLYPGMT-ESPELRWAFVRKIYVILTVQLAMTAAVSAF  54

Query  249  tvlYAPLNEVLKGSSAlllflvflpfl---llwplHVYQQRHPLNFIFLGLFTASLSFPV  419
             V    ++     S+A +   +FL  L   +L PLH Y Q+HP+N + LGLFT ++SF V
Sbjct  55   VVKVPAVSNFFVSSNAGIALYIFLIVLPFIVLCPLHYYHQKHPINLLLLGLFTVAISFAV  114

Query  420  AVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfi  599
             ++CA T G I+LEA ILT+ VV +LT YTFWAAK+G DFNFLGP L  ++ +L++   I
Sbjct  115  GMTCAFTSGKIILEAAILTAVVVNSLTAYTFWAAKRGHDFNFLGPFLIAAIMVLMVFSLI  174

Query  600  QMFFPLG  620
            Q+FFPLG
Sbjct  175  QIFFPLG  181



>ref|XP_011082582.1| PREDICTED: BI1-like protein [Sesamum indicum]
Length=242

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 120/174 (69%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEG--TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G   LYP +     +LRW FIRK+Y IIS Q+LLT  VA + V   P++     
Sbjct  8    KYDVESGRQPLYPMM-LESPELRWSFIRKIYTIISIQLLLTVAVAALVVTVHPISHFFAT  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            +SA   L + L+  PF++L PL+ Y QRHPLN+  LGLFT SL+F V ++C+ T G ++L
Sbjct  67   TSAGLALYILLIITPFIVLCPLYYYYQRHPLNYFLLGLFTVSLAFAVGLTCSYTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EA +LT+ VV++LT YTFWAAK+G+DFNFLGP LF ++ +L+    IQ+FFPLG
Sbjct  127  EAALLTAVVVVSLTLYTFWAAKRGQDFNFLGPFLFGAVVVLMFFSIIQIFFPLG  180



>emb|CDX93913.1| BnaC04g20720D [Brassica napus]
Length=239

 Score =   127 bits (318),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 120/174 (69%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIE--EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E  +  LYP +     +LRW FIRKVY IIS Q+L+T  VA   V   P++     
Sbjct  5    KYDLESAQTPLYPMMM-ESPELRWSFIRKVYSIISIQLLVTIAVAATVVKVHPISVFFTT  63

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            +SA   L + ++F P +++ PL+ Y Q+HP+N++ L +FT SL+F V ++CA T G ++L
Sbjct  64   TSAGFALYILVIFTPLIVMCPLYYYHQKHPVNYLLLAIFTVSLAFAVGLTCAFTSGKVIL  123

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EA+ILT+ VV++LT YTFWAAK+G DFNFLGP LF ++ +L++  FIQ+ FPLG
Sbjct  124  EAVILTAVVVVSLTLYTFWAAKRGHDFNFLGPFLFGAVIVLMVFSFIQILFPLG  177



>ref|XP_010556773.1| PREDICTED: BI1-like protein [Tarenaya hassleriana]
Length=245

 Score =   126 bits (317),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 117/175 (67%), Gaps = 7/175 (4%)
 Frame = +3

Query  114  KGDIEEGT---LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
            K D+E G    LYP +     + RWGFIRKVY II+ Q+L T  VA   V   P+     
Sbjct  10   KNDVEFGVARPLYPTM-LESPEFRWGFIRKVYSIIAFQLLATIAVAATVVSVRPIALFFA  68

Query  285  GSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
             + A   L + L+  PF+++ PL+ Y Q+HP+N+  LG+FT +L+F V ++CA T G I+
Sbjct  69   TTGAGLALYIVLIITPFIVMCPLYYYHQKHPVNYFLLGIFTLALAFAVGLTCAFTSGKII  128

Query  456  LEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LE++ILT+AVVLALT YTFWA+KKG DFNFLGP LF S+ +LI+   +Q+ FPLG
Sbjct  129  LESVILTTAVVLALTFYTFWASKKGYDFNFLGPFLFASVIVLIVFALVQVLFPLG  183



>emb|CDY53716.1| BnaAnng12570D [Brassica napus]
Length=239

 Score =   126 bits (317),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 120/174 (69%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIE--EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E  +  LYP +     +LRW FIRKVY IIS Q+L+T  VA   V   P++     
Sbjct  5    KYDLESAQTPLYPMMM-ESPELRWSFIRKVYSIISIQLLVTIAVAATVVKVHPISVFFTT  63

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            +SA   L + L+  P +++WPL+ Y Q+HP+N++ L +FT SL+F V ++CA T G ++L
Sbjct  64   TSAGFALYILLIVTPLIVMWPLYYYHQKHPVNYLLLAIFTVSLAFAVGLTCAFTSGKVIL  123

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EA+ILT+ VV++LT YTFWAAK+G DFNFLGP LF ++ +L++  FIQ+ FPLG
Sbjct  124  EAVILTAVVVVSLTLYTFWAAKRGHDFNFLGPFLFGAVIVLMVFSFIQILFPLG  177



>ref|XP_003632329.1| PREDICTED: BI1-like protein [Vitis vinifera]
Length=242

 Score =   126 bits (317),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 123/175 (70%), Gaps = 8/175 (5%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
            K D+E G   LYP +   EN QLRW FIRK+Y I++ Q+LLT  VA V V   P+     
Sbjct  8    KSDVEAGARPLYPMML--ENPQLRWAFIRKIYSIVAVQLLLTIAVAAVVVTVHPIAYFFV  65

Query  285  GSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
             + A   L + L+F+PF++L PL+ Y QRHP+N++ LG+FT SL+F V ++CA T G ++
Sbjct  66   STGAGLALYIVLIFVPFIVLCPLYYYHQRHPVNYLLLGVFTVSLAFVVGLTCAFTSGKVI  125

Query  456  LEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LE++ILT+ VV++LT YTFWAAK+G DFNFLGP LF ++ +L++   IQ+ FPLG
Sbjct  126  LESVILTTVVVVSLTLYTFWAAKRGYDFNFLGPFLFGAILVLMVFALIQILFPLG  180



>ref|XP_010070336.1| PREDICTED: BI1-like protein [Eucalyptus grandis]
 gb|KCW59012.1| hypothetical protein EUGRSUZ_H01638 [Eucalyptus grandis]
Length=242

 Score =   126 bits (317),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 119/174 (68%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEG--TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK-  284
            K D E G   LYP +     QLRW FIRKVY I++ Q+L T  V  V V   P+      
Sbjct  8    KSDPEAGDRPLYPAM-LESPQLRWAFIRKVYSIVAFQLLATIAVGAVVVYVHPIAHFFTS  66

Query  285  --GSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
              G  AL + L+ +PF++L PL+ Y QRHP+N++ LG+FT SL+F V ++CA T G I+L
Sbjct  67   TPGGLALYIVLIIVPFIVLCPLYYYHQRHPVNYLLLGIFTISLAFVVGLTCAFTSGKIIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            E++ILT+AVV++LT YTFWAA++G DFNFLGP LF ++F L++  FIQ+ FPLG
Sbjct  127  ESVILTTAVVVSLTLYTFWAARRGHDFNFLGPFLFGAIFALMIFAFIQLLFPLG  180



>ref|XP_010038064.1| PREDICTED: BI1-like protein [Eucalyptus grandis]
 gb|KCW49862.1| hypothetical protein EUGRSUZ_K03330 [Eucalyptus grandis]
Length=241

 Score =   126 bits (317),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 120/174 (69%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            + D+E G   LYP +     +LRW FIRK+Y I++ Q+L T  V  V V   P++     
Sbjct  7    RKDVESGARPLYPMM-LESPELRWAFIRKIYSIVALQLLATIAVGAVVVSVHPISRFFVS  65

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            ++A   L + L+  PF++L PL+ Y QRHP+N++ LG+FT +L+F + ++CA T G ++L
Sbjct  66   TTAGLALYIVLIITPFIVLCPLYYYHQRHPVNYLLLGIFTVTLAFAIGLTCAFTSGKVIL  125

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EA+ILT+ VV++LT YTFWAA++G+DFNFLGP LF ++ +L++   IQ+ FPLG
Sbjct  126  EAVILTAVVVVSLTLYTFWAARRGQDFNFLGPFLFGAVIVLMVFAMIQILFPLG  179



>ref|XP_003553470.1| PREDICTED: BI1-like protein-like isoform X1 [Glycine max]
 ref|XP_006604458.1| PREDICTED: BI1-like protein-like isoform X2 [Glycine max]
Length=243

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 120/182 (66%), Gaps = 14/182 (8%)
 Frame = +3

Query  111  MKGDIEEG--------TLYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYA  263
            MK D+E G         LYP +   EN QLRW FIRKVY I++ Q+LLT  VA V V   
Sbjct  3    MKRDVESGGDGNANPRPLYPAML--ENPQLRWAFIRKVYTILTIQLLLTIAVASVVVFVR  60

Query  264  PLNEVLKGSS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCA  434
            P+      S    AL + L+  P + + PL+ Y Q+HPLN+I L +FT +L+F V ++CA
Sbjct  61   PIALFFVSSPGGLALYIVLLIAPLITVCPLYYYHQKHPLNYILLFIFTVTLAFAVGLTCA  120

Query  435  NTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFP  614
             T G I+LE++ILT+ VV++LT YTFWAAK+G DFNFLGP LF +L +L+L  FIQ+ FP
Sbjct  121  FTSGRIILESVILTTIVVVSLTLYTFWAAKRGHDFNFLGPFLFGALLVLMLFAFIQLLFP  180

Query  615  LG  620
            LG
Sbjct  181  LG  182



>gb|EYU46520.1| hypothetical protein MIMGU_mgv11b010581mg [Erythranthe guttata]
Length=243

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 120/176 (68%), Gaps = 6/176 (3%)
 Frame = +3

Query  108  GMKGDIEEG--TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL  281
            G K D+E G   LYP +     +LRW FIRK+Y I++ Q+L T  V  V V   P++   
Sbjct  7    GGKYDVESGGRPLYPMM-LESPELRWSFIRKIYTIVAIQLLCTIAVGAVVVTIHPISLFF  65

Query  282  KGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
              + A   L + L+  PF++L PL+ Y QRHP N++ LG+FT SL+F V ++CA T G +
Sbjct  66   TTTGAGLALYIILIITPFIVLCPLYYYYQRHPWNYLLLGIFTLSLAFSVGLTCAFTSGKV  125

Query  453  VLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            +LE++ILT+AVV++LT YTFWAAK+G DFNFLGP LF +L +L+L   IQ+FFPLG
Sbjct  126  ILESVILTAAVVISLTLYTFWAAKRGHDFNFLGPFLFGALMVLMLFAIIQIFFPLG  181



>ref|NP_192178.1| BAX inhibitor-1 motif-containing protein [Arabidopsis thaliana]
 gb|AAC78271.1| putative glutamate-/aspartate-binding peptide [Arabidopsis thaliana]
 emb|CAB77754.1| putative glutamate-/aspartate-binding peptide [Arabidopsis thaliana]
 gb|AAU44503.1| hypothetical protein AT4G02690 [Arabidopsis thaliana]
 gb|AAX23886.1| hypothetical protein At4g02690 [Arabidopsis thaliana]
 gb|AEE82214.1| BAX inhibitor-1 motif-containing protein [Arabidopsis thaliana]
Length=248

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 119/179 (66%), Gaps = 12/179 (7%)
 Frame = +3

Query  114  KGDIEEGT------LYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLN  272
            K D+E G       LYP +   EN +LRWGFIRKVY II+ Q+L T  VA   V   P+ 
Sbjct  10   KDDVETGVSSRRPLLYPAMH--ENPELRWGFIRKVYSIIAFQLLATVAVAATVVTVRPIA  67

Query  273  EVLKGSS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTD  443
                 +    AL + ++  P ++L PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T+
Sbjct  68   LFFATTGLGLALYIVIIITPLIVLCPLYYYHQKHPVNYLLLGIFTLALAFVVGLTCAFTN  127

Query  444  GAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            G ++LE++ILTS VVL+LT YTFWAA+KG DFNFLGP LF +L +LI    IQ+ FPLG
Sbjct  128  GKVILESVILTSVVVLSLTLYTFWAARKGYDFNFLGPFLFGALTVLIFFALIQILFPLG  186



>ref|NP_001149807.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays]
 gb|ACG36861.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays]
 gb|ACR37792.1| unknown [Zea mays]
 tpg|DAA51897.1| TPA: Transmembrane BAX inhibitor motif protein-containing protein 
4 [Zea mays]
Length=243

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 117/187 (63%), Gaps = 9/187 (5%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagv  248
            M+G+ +     + G         LYPG+     +LRW F+RK+Y I++ Q+ +T  V+  
Sbjct  1    MFGYRKADPDLEAG-----GSSLLYPGMT-ESPELRWAFVRKIYVILAVQLAMTAAVSAF  54

Query  249  tvlYAPLNEVLKGSSAlllflvflpfl---llwplHVYQQRHPLNFIFLGLFTASLSFPV  419
             V    ++     S+A +   +FL  L   +L PL  Y Q+HP+N + LGLFT ++SF V
Sbjct  55   VVKVPAVSNFFVSSNAGVALYIFLIILPFLVLCPLRYYHQKHPVNLLLLGLFTVAISFAV  114

Query  420  AVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfi  599
             ++CA T G I+LEA ILT+ VV++LT YTFWAAK+G DFNFLGP LF ++ +L++   I
Sbjct  115  GMTCAFTSGKIILEAAILTAVVVISLTAYTFWAAKRGHDFNFLGPFLFAAIMVLMVFSLI  174

Query  600  QMFFPLG  620
            Q+FFPLG
Sbjct  175  QIFFPLG  181



>ref|XP_004495172.1| PREDICTED: BI1-like protein-like [Cicer arietinum]
Length=244

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 121/176 (69%), Gaps = 8/176 (5%)
 Frame = +3

Query  114  KGDIEEGT----LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL  281
            K D+E G+    LYP +     +LRW FIRKVY II+ Q+L T  V  V V   P++   
Sbjct  8    KTDLESGSRTRPLYPMM-LESPELRWSFIRKVYVIIALQLLATIAVGAVVVTVHPISTFF  66

Query  282  KGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
              + A   L + LVF+PF+ L PL+ Y QRHP+N++ LG+FT SLSF V +SCA T   +
Sbjct  67   ATTGAGLALYIVLVFVPFITLCPLYYYYQRHPVNYLLLGVFTLSLSFVVGLSCAFTSEKV  126

Query  453  VLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            +LEA+ILT+ VV+ALT YTFWAA++G DFNFLGP LF ++ +L++ G IQ+FFPLG
Sbjct  127  ILEAVILTAVVVIALTLYTFWAARRGYDFNFLGPFLFGAVLVLMVFGLIQVFFPLG  182



>ref|XP_009144548.1| PREDICTED: BI1-like protein, partial [Brassica rapa]
Length=243

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 120/178 (67%), Gaps = 10/178 (6%)
 Frame = +3

Query  114  KGDIEEG------TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNE  275
            K D+E G       LYP + +   +LRWGFIRKVY II+ Q+L T  V+   V   P+  
Sbjct  5    KDDLEAGGGSRSRPLYPTM-HETPELRWGFIRKVYSIIAFQLLATIAVSATVVTVRPIAL  63

Query  276  VLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
                + A   L + ++  PF++L PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T+G
Sbjct  64   FFATTGAGLGLYIVIIITPFIVLCPLYYYHQKHPVNYLLLGVFTLALAFVVGLTCAFTNG  123

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
             ++LE+ ILT+ VVL+LT YTFWAAK+G DFNFLGP LF +L +L++   IQ+FFPLG
Sbjct  124  KVILESAILTTVVVLSLTVYTFWAAKRGYDFNFLGPFLFGALIVLVVFAMIQVFFPLG  181



>ref|XP_010092433.1| hypothetical protein L484_009115 [Morus notabilis]
 gb|EXB51151.1| hypothetical protein L484_009115 [Morus notabilis]
Length=247

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 113/186 (61%), Gaps = 15/186 (8%)
 Frame = +3

Query  105  GGMKGDIEEG-----------TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvt  251
            GG KGD+E G            LYP +     QLRW FIRKVY IIS Q+LLT  VA   
Sbjct  2    GGSKGDVESGYNVRHGNNNMDQLYPTM-LESPQLRWAFIRKVYVIISMQLLLTVAVAVAV  60

Query  252  vlYAPLNEVL---KGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
            + Y P+ +      G     + ++   FLL+  L+   +RHP+NF+ L LFT +++F V 
Sbjct  61   IFYRPIPDFFVKTTGGLIAYIAIIIFTFLLMIALYFLHKRHPVNFLLLTLFTIAIAFSVG  120

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQ  602
            +SCA T G ++LEA IL S VV++LT YTFWA K+G DF FLGP LF SL +L++   IQ
Sbjct  121  LSCAYTKGVVILEAAILCSIVVVSLTLYTFWAVKRGWDFTFLGPFLFASLLVLLIFALIQ  180

Query  603  MFFPLG  620
            +F PLG
Sbjct  181  VFLPLG  186



>emb|CDX91308.1| BnaC02g27190D [Brassica napus]
Length=248

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 120/178 (67%), Gaps = 10/178 (6%)
 Frame = +3

Query  114  KGDIEEG------TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNE  275
            K D+E G       LYP + +   +LRWGFIRKVY II+ Q+L T  V+   V   P+  
Sbjct  10   KDDLEAGGSSRSRPLYPTM-HETPELRWGFIRKVYSIIAFQLLATIAVSATVVTVRPIAL  68

Query  276  VLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
                + A   L + ++  PF++L PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T+G
Sbjct  69   FFATTGAGLGLYIVIIITPFIVLCPLYYYHQKHPVNYLLLGVFTLALAFVVGLTCAFTNG  128

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
             ++LE+ ILT+ VVL+LT YTFWAAK+G DFNFLGP LF +L +L++   IQ+FFPLG
Sbjct  129  KVILESAILTTVVVLSLTVYTFWAAKRGYDFNFLGPFLFGALIVLVVFAMIQVFFPLG  186



>gb|EMS49504.1| hypothetical protein TRIUR3_04678 [Triticum urartu]
Length=221

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 111/156 (71%), Gaps = 3/156 (2%)
 Frame = +3

Query  162  ENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA---lllflvflpfll  332
            + +LRW FIRK+Y I+S Q+ +T  VAG  V    ++E    S+A   L +FL+ LP ++
Sbjct  4    DVELRWAFIRKIYVILSVQLAMTAAVAGFVVKVPAVSEFFVSSNAGLGLYIFLLVLPLVV  63

Query  333  lwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILTSAVVLALTGYTF  512
            L PL  Y Q+HP+N I LG+FT S+SF V ++CA T G I+LEA ILT+ VV++LT YTF
Sbjct  64   LCPLRYYHQKHPVNLILLGIFTVSISFAVGMTCAFTSGKIILEAAILTAVVVISLTAYTF  123

Query  513  WAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            WAAK+G DFNFLGP LF +L +L++   IQ+FFPLG
Sbjct  124  WAAKRGHDFNFLGPFLFGALMVLMVFSLIQIFFPLG  159



>emb|CDX97282.1| BnaA02g20730D [Brassica napus]
Length=248

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 120/178 (67%), Gaps = 10/178 (6%)
 Frame = +3

Query  114  KGDIEEG------TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNE  275
            K D+E G       LYP + +   +LRWGFIRKVY II+ Q+L T  V+   V   P+  
Sbjct  10   KDDLEAGGGSRSRPLYPTM-HETPELRWGFIRKVYSIIAFQLLATIAVSATVVTVRPIAL  68

Query  276  VLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
                + A   L + ++  PF++L PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T+G
Sbjct  69   FFATTGAGLGLYIVIIITPFIVLCPLYYYHQKHPVNYLLLGVFTLALAFVVGLTCAFTNG  128

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
             ++LE+ ILT+ VVL+LT YTFWAAK+G DFNFLGP LF +L +L++   IQ+FFPLG
Sbjct  129  KVILESAILTTVVVLSLTVYTFWAAKRGYDFNFLGPFLFGALIVLVVFAMIQVFFPLG  186



>ref|XP_006396483.1| hypothetical protein EUTSA_v10028915mg [Eutrema salsugineum]
 gb|ESQ37936.1| hypothetical protein EUTSA_v10028915mg [Eutrema salsugineum]
Length=246

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 122/177 (69%), Gaps = 10/177 (6%)
 Frame = +3

Query  114  KGDIEEG----TLYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEV  278
            K D+E       LYP +   EN +LRWGFIRKVY II+ Q+L T  VA   V   P+   
Sbjct  10   KDDVEAAGGSRPLYPTML--ENPELRWGFIRKVYSIIAFQLLATVAVAATVVTVHPIALF  67

Query  279  LKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGA  449
               +SA   L + +V +P ++L PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T+G 
Sbjct  68   FATTSAGLALYIVIVIMPLIVLCPLYYYHQKHPVNYLLLGIFTLALAFVVGLTCAFTNGK  127

Query  450  IVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            +VLE+ ILT+ VVL+LT YTFWAAK+G DFNFLGP LF +L +LI+ G IQ+FFPLG
Sbjct  128  VVLESAILTTVVVLSLTLYTFWAAKRGYDFNFLGPFLFGALIVLIVFGIIQIFFPLG  184



>ref|XP_006292690.1| hypothetical protein CARUB_v10018936mg [Capsella rubella]
 gb|EOA25588.1| hypothetical protein CARUB_v10018936mg [Capsella rubella]
Length=239

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 120/174 (69%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIE--EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E  +  LYP +     +LRW FIRKVY IIS Q+L+T  VA   V    ++     
Sbjct  5    KYDLESAQTPLYPMM-LESPELRWSFIRKVYSIISIQLLVTIAVAATVVKINSISVFFTT  63

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            +SA   L + L+F P +++ PL+ Y Q+HP+N+I LG+FT SL+F V ++CA T G ++L
Sbjct  64   TSAGFALYILLIFTPLIVMCPLYYYHQKHPVNYILLGIFTVSLAFAVGLTCAFTSGKVIL  123

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            E++ILT+ VV++LT YTFWAAK+G DFNFLGP LF ++ +L++  FIQ+ FPLG
Sbjct  124  ESVILTAVVVISLTLYTFWAAKRGHDFNFLGPFLFGAVIVLMVFSFIQILFPLG  177



>gb|EYU40897.1| hypothetical protein MIMGU_mgv1a012728mg [Erythranthe guttata]
Length=242

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 120/174 (69%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEG--TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLN---EV  278
            K D+E G   LYP +     +LRW FIRK+Y I+S Q+LLT  V+ + V   P++     
Sbjct  8    KDDLESGREPLYPMMT-ESPELRWSFIRKIYTIVSIQLLLTIAVSALVVTVHPISLFFST  66

Query  279  LKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
             +   A+ + LV  PF++L PL+ Y Q+HP+N+I LG+FT +L+F V ++C+ T G ++L
Sbjct  67   TRAGLAVYIVLVITPFIVLCPLYYYYQKHPVNYILLGIFTVALAFSVGLTCSYTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EA ILT+ VV++LT YT+WAAK+G+DFNFLGP L  ++ +L++   IQ+F+PLG
Sbjct  127  EAAILTAVVVVSLTLYTYWAAKRGQDFNFLGPFLSGAIMVLLVFALIQIFYPLG  180



>ref|XP_006443997.1| hypothetical protein CICLE_v10021936mg [Citrus clementina]
 ref|XP_006479663.1| PREDICTED: BI1-like protein-like [Citrus sinensis]
 gb|ESR57237.1| hypothetical protein CICLE_v10021936mg [Citrus clementina]
 gb|KDO68644.1| hypothetical protein CISIN_1g026195mg [Citrus sinensis]
 gb|KDO68645.1| hypothetical protein CISIN_1g026195mg [Citrus sinensis]
Length=242

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 119/174 (68%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G   LYP +     QLRW FIRK+Y II+ Q+L T  VA V V   P++     
Sbjct  8    KSDVEAGATPLYPMMS-ESPQLRWAFIRKIYSIIAIQLLATIAVASVVVSVRPISHFFSS  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF++L PL+ Y Q+HP+N++ LG+FT +LSF V ++CA T G ++L
Sbjct  67   TGAGLALYIVLIITPFIVLCPLYYYYQKHPVNYLLLGVFTIALSFAVGLTCAYTKGEVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            E+ ILT+ VV++LT YTFWAA++G DFNFLGP LF ++ +L++  FIQ+ FPLG
Sbjct  127  ESAILTAVVVISLTLYTFWAARRGHDFNFLGPFLFGAVMVLLVFAFIQILFPLG  180



>ref|XP_010679114.1| PREDICTED: BI1-like protein [Beta vulgaris subsp. vulgaris]
Length=249

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 104/154 (68%), Gaps = 8/154 (5%)
 Frame = +3

Query  114  KGDIEEGT----LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL  281
            K D+E G+    LYP +     +LRW FIRKVY II+ Q++ T +V  + V Y P+    
Sbjct  13   KHDVESGSHSQQLYP-VMLESPELRWSFIRKVYSIIAIQLIATIIVGAIVVSYHPIAHFF  71

Query  282  KGSS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
              S+   A  + L+  P ++L PL+ Y Q HP+N++ LG+FT SL+F V ++CA T G +
Sbjct  72   TSSTGGFACYIILIITPLIVLCPLYYYHQSHPVNYVLLGIFTISLAFSVGLTCAFTSGKV  131

Query  453  VLEALILTSAVVLALTGYTFWAAKKGRDFNFLGP  554
            +LE++ILT+AVV++LT YTFWAAK+G DFNFLGP
Sbjct  132  ILESVILTAAVVVSLTLYTFWAAKRGHDFNFLGP  165



>ref|XP_002283304.2| PREDICTED: BI1-like protein [Vitis vinifera]
Length=242

 Score =   124 bits (312),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 119/175 (68%), Gaps = 7/175 (4%)
 Frame = +3

Query  114  KGDIE---EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
            KGDIE   EG LYP +      +RW FIRKVY I+S Q+LLT +VA + V+  P+++ + 
Sbjct  7    KGDIETGGEGHLYPMM-LESPPMRWAFIRKVYAILSMQLLLTVVVAAIVVVVDPISDFMV  65

Query  285  GSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
             + A   L LF+V L  +L+  L  + +RHP+N I LG+FT +++F + +SCA   G I+
Sbjct  66   HNRAGLGLYLFIVVLSLILMCALAAFHKRHPVNLILLGMFTLTMAFTMGLSCAFVKGKII  125

Query  456  LEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LEA ILTS V + LT YTFWAAK+G DF+FLGP LF SL +L++   IQMFFP+G
Sbjct  126  LEAAILTSVVTIGLTLYTFWAAKRGHDFSFLGPFLFASLLVLLVFSMIQMFFPMG  180



>gb|KJB22579.1| hypothetical protein B456_004G056000 [Gossypium raimondii]
Length=242

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 115/174 (66%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D E G   LYP +     ++RW FIRK+Y II+ Q+  T  VA   V   P++     
Sbjct  8    KNDTEAGPRPLYPMM-LEPPEMRWAFIRKIYSIIAVQLFATIAVAATVVTVHPISNFFVS  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF+ L PL+ Y Q+HP+N++ LG+FT SL+F V ++CA T G ++L
Sbjct  67   TGAGLALYIVLIITPFITLCPLYYYYQKHPVNYLLLGVFTVSLAFAVGLTCAFTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            E++ILT+ VV+ALT YTFWAAK+G DFNFLGP LF ++ +L++   IQ+ FPLG
Sbjct  127  ESVILTTVVVVALTLYTFWAAKRGHDFNFLGPFLFGAVLVLMVFALIQILFPLG  180



>ref|XP_002307607.1| hypothetical protein POPTR_0005s23570g [Populus trichocarpa]
 gb|EEE94603.1| hypothetical protein POPTR_0005s23570g [Populus trichocarpa]
Length=242

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 117/174 (67%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G   LYP +     QLRW FIRKVY I++ Q+LLT  VA V V   P+      
Sbjct  8    KNDVEVGARPLYPMM-LESPQLRWAFIRKVYSILAFQLLLTIAVAAVVVSVRPIAVFFST  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   + + L+ +P   L PL+ Y Q+HP+N+I LG+FT  L+F V ++CA T+G ++L
Sbjct  67   TVAGLGVYILLILMPLFTLLPLYYYHQKHPVNYILLGIFTICLAFAVGLTCAYTEGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            E++ILT+ VV++LT YTFWAA++G DFNFLGP LF ++ +L++   IQ+ FPLG
Sbjct  127  ESVILTTVVVVSLTLYTFWAARRGHDFNFLGPFLFGAIMVLMVFSLIQILFPLG  180



>ref|XP_003557479.1| PREDICTED: BI1-like protein [Brachypodium distachyon]
Length=242

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 118/173 (68%), Gaps = 7/173 (4%)
 Frame = +3

Query  120  DIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            D+E G    LYPG+    + LRW  IRK+Y I+S Q+ +T  VA   V    ++E    S
Sbjct  9    DLEAGGSEALYPGMVESPD-LRWALIRKIYVILSVQLAMTAAVAAFVVKVPAVSEFFVSS  67

Query  291  S---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLE  461
            +   AL +FL+ LP ++L PL  Y Q+HP+N + LGLFT S+SF V ++CA T G ++LE
Sbjct  68   NSGIALYIFLLILPLIVLCPLRYYHQKHPVNLLLLGLFTVSISFAVGMTCAFTSGKVILE  127

Query  462  ALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            A ILT+ VV++LT YTFWAAK+G DFNFLGP LF SL +LI+  FIQ+FFPLG
Sbjct  128  AAILTAVVVISLTAYTFWAAKRGHDFNFLGPFLFGSLMVLIVFSFIQIFFPLG  180



>gb|KJB34592.1| hypothetical protein B456_006G074200 [Gossypium raimondii]
Length=711

 Score =   129 bits (324),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 106/131 (81%), Gaps = 2/131 (2%)
 Frame = +3

Query  60   KAKMYGFERVS-SSYDGGMKGDIEEG-TLYPGIGYGENQLRWGFIRKVYGIISAQIlltt  233
            + KM+ ++RVS SS +   + D+E G TLYPG+ YGENQLRWGFIRKVYGI++AQ++LTT
Sbjct  581  REKMFAYDRVSHSSANKADEIDLESGETLYPGLSYGENQLRWGFIRKVYGILAAQLVLTT  640

Query  234  lvagvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSF  413
            +V+   VL AP+NE+L+G+S LLLFL  +PF+LLWPLHVY Q+HP+N + LGLFT SLS 
Sbjct  641  VVSAFVVLSAPVNELLRGNSGLLLFLCLIPFVLLWPLHVYHQKHPVNLVILGLFTVSLSL  700

Query  414  PVAVSCANTDG  446
             V VSCANTDG
Sbjct  701  TVGVSCANTDG  711



>ref|XP_009601840.1| PREDICTED: BI1-like protein isoform X1 [Nicotiana tomentosiformis]
Length=245

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 119/174 (68%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G   LYP +     +LRW FIRKVY I+S Q+LLT  VA V V   P+      
Sbjct  11   KDDVEGGARALYPTM-LESPELRWTFIRKVYSILSLQLLLTIAVASVVVTVHPIAHFFVS  69

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF+ L PL+ Y Q+HP+NF+ LGLFT +L+F V ++CA T G ++L
Sbjct  70   TGAGLALYIVLIITPFITLCPLYYYHQKHPVNFLILGLFTVALAFAVGLTCAFTSGKVIL  129

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            E++ILT+AVVL+LT YTF AAK+G DFNFLGP LF +L +L+L  FIQ+ FPLG
Sbjct  130  ESVILTTAVVLSLTVYTFCAAKRGHDFNFLGPFLFGALIVLMLFPFIQLLFPLG  183



>gb|EPS72667.1| hypothetical protein M569_02091, partial [Genlisea aurea]
Length=237

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 122/174 (70%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G+  LYP +     +LRW FIRK+Y II+ Q+LLT  VA V V   P++     
Sbjct  4    KNDVESGSQPLYPMM-LESPELRWSFIRKIYSIITIQLLLTIAVAAVVVNVHPISHFFVA  62

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   + + L+F PF++L+PL+ Y Q+HP+N+  LGLFT SLSF V ++CA T G ++L
Sbjct  63   TRAGLGIYIVLIFTPFIVLFPLYYYYQKHPVNYFLLGLFTLSLSFCVGLTCAFTSGKVIL  122

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            E+ ILT+ VV++LT YTFWAA++G+DFNFLG  LF +L +LI+   IQ+FFPLG
Sbjct  123  ESAILTATVVISLTLYTFWAARRGQDFNFLGTFLFAALIVLIVFALIQIFFPLG  176



>ref|XP_009138661.1| PREDICTED: BI1-like protein [Brassica rapa]
Length=239

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 120/174 (69%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIE--EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E  +  LYP +     +LRW FIRKVY IIS Q+L+T  VA   V   P++     
Sbjct  5    KYDLESAQTPLYPMMM-ESPELRWSFIRKVYSIISIQLLVTIAVAATVVKVHPISVFFTT  63

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            +SA   L + L+F P +++WPL+ Y + HP+N++ L +FT SL+F V ++CA T G ++L
Sbjct  64   TSAGFALYILLIFTPLIVMWPLYYYHETHPVNYLLLAIFTVSLAFAVGLTCAFTSGKVIL  123

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EA+ILT+ VV++LT YTFWAAK+G DFNFLGP LF ++ +L++  FIQ+ FPLG
Sbjct  124  EAVILTAVVVVSLTLYTFWAAKRGHDFNFLGPFLFGAVIVLMVFSFIQILFPLG  177



>ref|XP_010695291.1| PREDICTED: BI1-like protein [Beta vulgaris subsp. vulgaris]
Length=239

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 116/172 (67%), Gaps = 6/172 (3%)
 Frame = +3

Query  117  GDIEEGTLYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSS  293
             DIE G LYP +   EN Q RW FIRKVY II+ Q++LT  +A V +   P++  L  + 
Sbjct  8    SDIETGQLYPNME--ENPQFRWAFIRKVYVIIAIQMVLTAAIAAVVIFVRPISHYLVSTP  65

Query  294  A---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEA  464
            +   + + ++  P +++ PL+ Y +RHP+NF+ LGLFT +++F V ++CA   G +VLEA
Sbjct  66   SGLGIYIVILISPIIIMCPLYAYAKRHPINFVLLGLFTIAIAFGVGMTCAFVKGKVVLEA  125

Query  465  LILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LILT  VV++LT YTF AAK+G DF+FLGP LF  + +L++   IQ+F PLG
Sbjct  126  LILTCVVVVSLTIYTFLAAKRGVDFSFLGPFLFAGMMVLMVFMLIQIFIPLG  177



>ref|XP_002878509.1| glutamate binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54768.1| glutamate binding protein [Arabidopsis lyrata subsp. lyrata]
Length=239

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 120/174 (69%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIE--EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E  +  LYP +     +LRW FIRKVY IIS Q+L+T  VA   V    ++     
Sbjct  5    KHDLESAQTPLYPMM-LESPELRWSFIRKVYSIISIQLLVTIAVAATVVKVHSISVFFTT  63

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            ++A   L + ++F P +++ PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T G ++L
Sbjct  64   TTAGFALYILVIFTPLIVMCPLYYYHQKHPVNYLLLGIFTVALAFAVGLTCAFTSGKVIL  123

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            E++ILTS VV++LT YTFWAAK+G DFNFLGP LF ++ +L++  FIQ+ FPLG
Sbjct  124  ESVILTSVVVISLTLYTFWAAKRGHDFNFLGPFLFGAVIVLMVFSFIQILFPLG  177



>ref|XP_002874901.1| glutamate binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51160.1| glutamate binding protein [Arabidopsis lyrata subsp. lyrata]
Length=247

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 118/178 (66%), Gaps = 11/178 (6%)
 Frame = +3

Query  114  KGDIEEG-----TLYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNE  275
            K D+E G      LYP +   EN +LRWGFIRKVY II+ Q+L T  VA   V   P+  
Sbjct  10   KDDVETGFSSRRPLYPTML--ENPELRWGFIRKVYSIIAFQLLATVAVAATVVTVHPIAL  67

Query  276  VLKGSS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
                +    AL + ++  P ++L PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T+G
Sbjct  68   FFATTGLGLALYIVIIITPLIVLCPLYYYHQKHPVNYLLLGIFTLALAFVVGLTCAFTNG  127

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
             ++LE+ ILTS VVL+LT YTFWAA+KG DFNFLGP LF +L +LI    IQ+ FPLG
Sbjct  128  KVILESAILTSVVVLSLTLYTFWAARKGYDFNFLGPFLFGALTVLIFFALIQILFPLG  185



>ref|NP_191890.1| BRZ-INSENSITIVE-LONG HYPOCOTYLS 4 [Arabidopsis thaliana]
 emb|CAB86432.1| putative protein [Arabidopsis thaliana]
 gb|AAV74230.1| At3g63310 [Arabidopsis thaliana]
 gb|AAX22267.1| At3g63310 [Arabidopsis thaliana]
 gb|AEE80466.1| BRZ-INSENSITIVE-LONG HYPOCOTYLS 4 [Arabidopsis thaliana]
Length=239

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 119/174 (68%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIE--EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E  +  LYP +     +LRW FIRKVY IIS Q+L+T  VA   V    ++     
Sbjct  5    KHDLESAQTPLYPMMS-ESPELRWSFIRKVYSIISIQLLVTIAVAATVVKVHSISVFFTT  63

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            ++A   L + L+  P +++ PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T G ++L
Sbjct  64   TTAGFALYILLILTPLIVMCPLYYYHQKHPVNYLLLGIFTVALAFAVGLTCAFTSGKVIL  123

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            E++ILT+ VV++LT YTFWAAK+G DFNFLGP LF ++ +L++  FIQ+ FPLG
Sbjct  124  ESVILTAVVVISLTLYTFWAAKRGHDFNFLGPFLFGAVIVLMVFSFIQILFPLG  177



>ref|XP_002524726.1| Transmembrane BAX inhibitor motif-containing protein, putative 
[Ricinus communis]
 gb|EEF37569.1| Transmembrane BAX inhibitor motif-containing protein, putative 
[Ricinus communis]
Length=242

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 118/174 (68%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G   LYP +     +LRW FIRKVY I+  Q+L T  VA V V   P+      
Sbjct  8    KSDVEAGARPLYPMM-LESPELRWSFIRKVYSILCIQLLATIAVASVVVSVRPIATFFVT  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+ +PF+++ PL+ Y Q+HP+N++ LG+FT SL+F V ++CA T G ++L
Sbjct  67   TGAGLALYIVLIIMPFIVICPLYYYHQKHPVNYLLLGVFTISLAFAVGLTCAFTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            E++ILT+ VVL+LT YTFWAA++G DFNFLGP LF ++ +L++   IQ+ FPLG
Sbjct  127  ESVILTTVVVLSLTFYTFWAARRGHDFNFLGPFLFGAIMVLMVFALIQILFPLG  180



>ref|XP_010512744.1| PREDICTED: BI1-like protein [Camelina sativa]
 ref|XP_010413166.1| PREDICTED: BI1-like protein [Camelina sativa]
Length=239

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 119/174 (68%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIE--EGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E  +  LYP +     +LRW FIRKVY IIS Q+L+T  VA   V    ++     
Sbjct  5    KYDLESAQTPLYPMM-LESPELRWSFIRKVYSIISIQLLVTIAVAATVVKVHSISVFFTT  63

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            ++A   L + L+F P +++ PL+ Y Q+HP+N++ L +FT SL+F V ++CA T G ++L
Sbjct  64   TNAGLALYILLIFTPLIVMCPLYYYHQKHPVNYLLLAIFTVSLAFAVGLTCAFTSGKVIL  123

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EA+ILTS VV++LT YTFWAAK+G DFNFLGP LF ++ +L++  FIQ+ FPLG
Sbjct  124  EAVILTSVVVISLTLYTFWAAKRGHDFNFLGPFLFGAVIVLMVFSFIQILFPLG  177



>ref|XP_002300819.1| hypothetical protein POPTR_0002s04980g [Populus trichocarpa]
 gb|EEE80092.1| hypothetical protein POPTR_0002s04980g [Populus trichocarpa]
Length=242

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 117/174 (67%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G   LYP +     QLRW FIRKVY I+  Q+L+T  VA + V   P+      
Sbjct  8    KTDLEAGARPLYPMM-LESPQLRWAFIRKVYSILCFQLLITIAVAAMVVSIRPIAVFFST  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF+ L P++ Y Q+HP+N+  LG+FT SL+F V ++CA T+G ++L
Sbjct  67   TGAGLALYIVLILTPFITLLPMYYYHQKHPVNYFLLGIFTISLAFAVGLTCAFTEGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            E+ ILT+ VV++LT YTFWAA++G DFNFLGP LF ++ +L++  FIQ+ FPLG
Sbjct  127  ESAILTTVVVVSLTMYTFWAARRGHDFNFLGPFLFGAVMVLMVFAFIQILFPLG  180



>ref|XP_011032646.1| PREDICTED: BI1-like protein [Populus euphratica]
Length=242

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 117/174 (67%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEG--TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G   LYP +     QLRW FIRKVY I++ Q+LLT  VA V V   P+      
Sbjct  8    KNDLEVGGRPLYPMM-LESPQLRWAFIRKVYSILAFQLLLTIAVAAVVVSVRPIAVFFST  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   + + L+ +P   L PL+ Y Q+HP+N+I LG+FT  L+F V ++CA T+G ++L
Sbjct  67   TGAGLGVYILLILMPLFTLLPLYYYHQKHPVNYILLGIFTICLAFAVGLTCAYTEGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            E++ILT+ VV++LT YTFWAA++G DFNFLGP LF ++ IL++   IQ+ FPLG
Sbjct  127  ESVILTTVVVVSLTLYTFWAARRGHDFNFLGPFLFGAIMILMIFALIQILFPLG  180



>ref|NP_001059026.1| Os07g0177300 [Oryza sativa Japonica Group]
 dbj|BAC83445.1| putative z-protein [Oryza sativa Japonica Group]
 dbj|BAD30317.1| putative z-protein [Oryza sativa Japonica Group]
 dbj|BAF20940.1| Os07g0177300 [Oryza sativa Japonica Group]
 gb|EAZ02960.1| hypothetical protein OsI_25100 [Oryza sativa Indica Group]
 gb|EAZ38886.1| hypothetical protein OsJ_23305 [Oryza sativa Japonica Group]
Length=244

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 121/177 (68%), Gaps = 10/177 (6%)
 Frame = +3

Query  117  GDIEEGT------LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEV  278
            GD+E GT      LYPG+     ++RW  IRK+Y I+S Q+LLT  VA V V    ++  
Sbjct  8    GDVEAGTSGGARELYPGMT-EPPEMRWALIRKIYVILSMQLLLTAAVAAVVVKVRAISHF  66

Query  279  LKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGA  449
               S A   L +FL+ LPF++L PL+ Y Q+HP+N I LGLFT ++SF V ++CA T G 
Sbjct  67   FVSSHAGLGLYIFLIILPFIVLCPLYYYHQKHPVNLILLGLFTVAISFAVGMTCAFTSGK  126

Query  450  IVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            ++LE+ ILT+ VV +LT YTFWAAK+GRDF+FLGP LF SL +L++  FIQ+ FPLG
Sbjct  127  VILESAILTTVVVFSLTAYTFWAAKRGRDFSFLGPFLFASLIVLLVFAFIQILFPLG  183



>ref|XP_002312548.2| hypothetical protein POPTR_0008s15690g [Populus trichocarpa]
 gb|EEE89915.2| hypothetical protein POPTR_0008s15690g [Populus trichocarpa]
Length=205

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 116/173 (67%), Gaps = 7/173 (4%)
 Frame = +3

Query  120  DIEEGT---LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            D+E G    LYP +     QLRW FIRKVY I++ Q+LLT  VA   V   P+   +  +
Sbjct  10   DMEAGISNQLYPMMQ-EPPQLRWAFIRKVYIILAMQLLLTVGVAATVVFVPPIPRFILHT  68

Query  291  S---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLE  461
            +   A+ +  + L  +LLWPLHVY +RHP N+ F+ LFT  ++F V +SCA T G IVLE
Sbjct  69   TPGLAIYIVSLILTLILLWPLHVYSKRHPWNYFFMALFTICIAFAVGLSCALTKGRIVLE  128

Query  462  ALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            A ILTS VV+ LT YTFWAAK+G+DF+FLGP LF+++ +LI+ G IQ  FPLG
Sbjct  129  AAILTSVVVVGLTLYTFWAAKRGQDFSFLGPFLFSAVLVLIVFGLIQFLFPLG  181



>ref|XP_007050515.1| Bax inhibitor-1 family protein [Theobroma cacao]
 gb|EOX94672.1| Bax inhibitor-1 family protein [Theobroma cacao]
Length=243

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 116/174 (67%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D E G   LYP +     ++RW FIRK+Y I++ Q+L T  VA   V   P+      
Sbjct  9    KNDTEAGPRPLYPMM-LEPPEMRWAFIRKIYSIVAIQLLATIAVASTVVTVRPIAHFFVS  67

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF++L PL+ Y QRHP+N++ LG+FT SL+F V ++C+ T G ++L
Sbjct  68   TGAGLALYIVLIITPFIVLCPLYYYHQRHPVNYLLLGVFTVSLAFAVGLTCSFTSGKVIL  127

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            E++ILT+ VV+ALT YTFWAA++G DFNFLGP LF ++ +L++   IQ+ FPLG
Sbjct  128  ESVILTAVVVVALTLYTFWAARRGHDFNFLGPFLFGAILVLMVFALIQILFPLG  181



>ref|XP_010422556.1| PREDICTED: BI1-like protein [Camelina sativa]
Length=246

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 119/177 (67%), Gaps = 10/177 (6%)
 Frame = +3

Query  114  KGDIEEG----TLYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEV  278
            K D+E G     LYP +   EN  LRWGFIRKVY II+ Q+L T  VA   V   P+   
Sbjct  10   KDDVEAGGSSRALYPTML--ENPDLRWGFIRKVYSIIAFQLLATVAVAATVVTVRPIALF  67

Query  279  LKGSS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGA  449
               +    AL + L+  PF++L PL+ Y Q+HP+N++ LG+FT +L+F V +SCA T+G 
Sbjct  68   FATTGLGLALYIVLIITPFIVLCPLYYYHQKHPVNYLLLGVFTLALAFVVGLSCAFTNGK  127

Query  450  IVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            ++LE+ ILT+ VVL+LT YTFWAA+KG DFNFLGP LF +L +LI+   IQ+ FPLG
Sbjct  128  VILESAILTTVVVLSLTLYTFWAARKGYDFNFLGPFLFGALIVLIVFAIIQVLFPLG  184



>emb|CDM85340.1| unnamed protein product [Triticum aestivum]
Length=242

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 122/178 (69%), Gaps = 11/178 (6%)
 Frame = +3

Query  117  GDIEEGT-------LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNE  275
            GDIE GT       LYPG+     +LRW  IRK+Y I+S Q+LLT  VA V V    +  
Sbjct  4    GDIEAGTSAAPAGALYPGMA-ESPELRWALIRKIYVILSLQLLLTAAVAAVVVKVPAIPH  62

Query  276  VLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
                S A   L +FL+ LPF++L PL++Y+Q+HPLN + LG+FT ++SF V ++CA T G
Sbjct  63   FFASSYAGLGLYIFLLILPFIVLCPLYIYRQKHPLNLLLLGVFTVAISFAVGMTCAFTSG  122

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
             ++LEA ILT+ VV +LT YTFWA K+G+DF+FLGP LF SL +L++ GFIQ+ FPLG
Sbjct  123  KVILEAAILTTVVVFSLTAYTFWAVKRGKDFSFLGPFLFASLIMLLVFGFIQILFPLG  180



>gb|AFK43813.1| unknown [Medicago truncatula]
Length=207

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 118/174 (68%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G+  LYP +     +LRW FIRKVY II+ Q+L T  V  V V   P++     
Sbjct  10   KTDVETGSRPLYPMM-LESPELRWSFIRKVYVIIALQLLATIAVGAVVVTVRPISTFFAT  68

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+F+PF+ L PL+ Y Q HP+N++ L +FT SLSF V +SCA T   ++L
Sbjct  69   TGAGLALYIVLIFVPFITLCPLYYYYQTHPINYLLLAVFTLSLSFVVGLSCAFTSEKVIL  128

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EA+ILT+ VV+ALT YTFWAA +G DFNFLGP LF ++ +L++ G IQ+FFPLG
Sbjct  129  EAVILTAVVVIALTLYTFWAASRGYDFNFLGPFLFGAILVLMVFGMIQIFFPLG  182



>ref|XP_006288281.1| hypothetical protein CARUB_v10001524mg [Capsella rubella]
 gb|EOA21179.1| hypothetical protein CARUB_v10001524mg [Capsella rubella]
Length=309

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 130/204 (64%), Gaps = 17/204 (8%)
 Frame = +3

Query  42   ERDLRAKAKMYGFERVSSSYDGGM---KGDIEEG----TLYPGIGYGEN-QLRWGFIRKV  197
            +RD+++      F  +S  Y   +   K D+E G     LYP +   EN  LRWGFIRK+
Sbjct  50   DRDIQSS----NFPALSVMYQWNLPYRKDDVETGGSSRPLYPTML--ENPDLRWGFIRKI  103

Query  198  YGIISAQIllttlvagvtvlYAPLNEVLKGSS---AlllflvflpflllwplHVYQQRHP  368
            Y II+ Q+L T  VA   V   P+      +    AL + ++  PFL++ PL+ Y Q+HP
Sbjct  104  YSIIAFQLLATVAVAATVVTVHPIALFFATTGLGLALYIVIIITPFLVMCPLYYYHQKHP  163

Query  369  LNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFL  548
            +N++ LG+FT +L+F V ++CA T+G ++LE+ ILT+ VVL+LT YTFWAAKKG DFNFL
Sbjct  164  VNYLLLGVFTLALAFVVGLTCAFTNGKVILESAILTTVVVLSLTLYTFWAAKKGYDFNFL  223

Query  549  GPilftslfililtgfiQMFFPLG  620
            GP LF +L +LI+   IQ+ FPLG
Sbjct  224  GPFLFGALIVLIVFALIQVLFPLG  247



>ref|XP_010026938.1| PREDICTED: BI1-like protein [Eucalyptus grandis]
Length=256

 Score =   122 bits (307),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 115/176 (65%), Gaps = 4/176 (2%)
 Frame = +3

Query  102  DGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL  281
            DG  +   +   LYP +     QLRW FIRKVY II AQ+LLT  +A    L  P+   +
Sbjct  20   DGDNESGRDATALYPNM-LESPQLRWAFIRKVYVIILAQLLLTVGIASAVFLAKPMKRFV  78

Query  282  ---KGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
               K  SA+ + L+ LP +L+ PL  Y +RHP+NF+ LGLFT +++F +  SCA T   I
Sbjct  79   AETKLGSAIFIVLLVLPLILICPLRAYHKRHPVNFVLLGLFTVTMAFGLCFSCAFTKEKI  138

Query  453  VLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            +LE+ ILTS VV+ALT YTFWA K+G DF+FLGP LF SL ++I+   IQ+FFPLG
Sbjct  139  ILESAILTSVVVVALTLYTFWAVKRGHDFSFLGPFLFASLLVIIVFALIQIFFPLG  194



>gb|KHG09280.1| hypothetical protein F383_07618 [Gossypium arboreum]
Length=243

 Score =   122 bits (306),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 114/172 (66%), Gaps = 6/172 (3%)
 Frame = +3

Query  120  DIEEG--TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSS  293
            D E G   LYP +     ++RW FIRK+Y I+  Q+L T  VA   V   P+      + 
Sbjct  11   DAEAGGRPLYPMM-LERPEMRWAFIRKIYSIVVIQLLATIAVAATVVTVHPIAHFFVSTG  69

Query  294  ---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEA  464
               AL + L+  PF+ L PL+ Y QRHP+N++ LG+FT SL+F V ++CA T G ++LE+
Sbjct  70   TGFALYIVLIITPFITLCPLYYYHQRHPVNYLLLGVFTISLAFAVGLTCAFTSGKVILES  129

Query  465  LILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            +ILT+ VV+ALT YTFWAA++G DFNFLGP LF ++ +L++   IQ+FFPLG
Sbjct  130  VILTAVVVVALTLYTFWAARRGHDFNFLGPFLFGAVIVLMVFSLIQIFFPLG  181



>ref|XP_011079906.1| PREDICTED: BI1-like protein [Sesamum indicum]
Length=242

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 118/174 (68%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G   LYP +     +LRW FIRK+Y I+S Q+LLT  VA V V   P+      
Sbjct  8    KNDVEVGARPLYPMM-LESPELRWSFIRKIYTIVSIQLLLTIAVAAVVVTVHPIAHFFAT  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF++L PL+ Y QRHP+N+  LG+FT +L+F V ++CA T G ++L
Sbjct  67   TGAGLALYIVLIITPFIVLCPLYYYYQRHPVNYFLLGVFTLALAFAVGLTCAYTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            E++ILT+ VV++LT YTFWAAK+G DFNFLGP LF ++ +L+L   IQ+ FPLG
Sbjct  127  ESVILTAVVVVSLTLYTFWAAKRGHDFNFLGPFLFGAVVVLMLFALIQILFPLG  180



>gb|KFK30873.1| hypothetical protein AALP_AA6G036900 [Arabis alpina]
Length=246

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 121/176 (69%), Gaps = 8/176 (5%)
 Frame = +3

Query  114  KGDIEEG----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL  281
            K D+E G     LYP +     +LRWGFIRKVY II+ Q+L T  VA V V   P++   
Sbjct  10   KDDVETGGGSRPLYPAME-ESPELRWGFIRKVYSIIAFQLLATVAVAAVVVTVRPISLFF  68

Query  282  KGSS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
              +    +L + ++  P +++ PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T+G +
Sbjct  69   ATTGVGLSLYILIIITPLIVMCPLYYYHQKHPVNYLLLGVFTLALAFAVGLTCAFTNGKV  128

Query  453  VLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            +LE+ ILT+ VVL+LT YTFWAAK+G DFNFLGP LF +L +LI+ GFIQ+ FPLG
Sbjct  129  ILESAILTTVVVLSLTFYTFWAAKRGHDFNFLGPFLFGALIVLIVFGFIQILFPLG  184



>ref|XP_003590585.1| BI1-like protein [Medicago truncatula]
 gb|AES60836.1| inhibitor of apoptosis-promoting Bax1 protein [Medicago truncatula]
Length=244

 Score =   122 bits (305),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 118/174 (68%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G+  LYP +     +LRW FIRKVY II+ Q+L T  V  V V   P++     
Sbjct  10   KTDVETGSRPLYPMM-LESPELRWSFIRKVYVIIALQLLATIAVGAVVVTVRPISTFFAT  68

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+F+PF+ L PL+ Y Q HP+N++ L +FT SLSF V +SCA T   ++L
Sbjct  69   TGAGLALYIVLIFVPFITLCPLYYYYQTHPINYLLLAVFTLSLSFVVGLSCAFTSEKVIL  128

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EA+ILT+ VV+ALT YTFWAA +G DFNFLGP LF ++ +L++ G IQ+FFPLG
Sbjct  129  EAVILTAVVVIALTLYTFWAASRGYDFNFLGPFLFGAILVLMVFGMIQIFFPLG  182



>ref|XP_003559738.1| PREDICTED: BI1-like protein [Brachypodium distachyon]
Length=249

 Score =   122 bits (305),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 120/175 (69%), Gaps = 8/175 (5%)
 Frame = +3

Query  117  GDIEEGT----LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
            GD E G+    LYP +     QLRW F+RKVY I+S Q+LLT  VA V V   P+     
Sbjct  14   GDPEAGSAARPLYPMM-LESPQLRWAFVRKVYTILSIQMLLTIAVASVVVFVRPVALFFV  72

Query  285  GSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
             + A   L +FL+ LPF++L PL+ Y QRHP+N + LGLFT ++SF V ++CA T G ++
Sbjct  73   STPAGFGLYIFLIILPFIVLCPLYYYYQRHPVNLLLLGLFTVAISFAVGLTCAFTKGEVI  132

Query  456  LEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LE+ ILT+ VV++LT YTFWAA++G DF+FLGP LF ++ IL++   IQ+FFPLG
Sbjct  133  LESAILTAVVVVSLTAYTFWAARRGHDFSFLGPFLFAAVMILMVFALIQIFFPLG  187



>ref|XP_006657498.1| PREDICTED: BI1-like protein-like [Oryza brachyantha]
Length=247

 Score =   122 bits (305),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 121/180 (67%), Gaps = 13/180 (7%)
 Frame = +3

Query  117  GDIEEGT---------LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPL  269
            GD+E GT         LYPG+     ++RW  IRK+Y I+S Q+LLT  VA V V    +
Sbjct  8    GDVEAGTSGGVAGARELYPGMT-EPPEMRWALIRKIYVILSMQLLLTAAVAAVVVKVRAI  66

Query  270  NEVLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANT  440
            +     S A   L +FL+ LPF++L PL+ Y Q+HP+N I LGLFT ++SF V ++CA T
Sbjct  67   SHFFVSSHAGIGLYIFLIILPFIVLCPLYFYHQKHPVNLILLGLFTVAISFAVGMTCAFT  126

Query  441  DGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
             G ++LE+ ILT+ VV +LT YTFWAAK+GRDF+FLGP LF SL +L++  FIQ+ FPLG
Sbjct  127  SGKVILESAILTTVVVFSLTAYTFWAAKRGRDFSFLGPFLFASLIVLLVFAFIQILFPLG  186



>ref|XP_007144660.1| hypothetical protein PHAVU_007G174500g [Phaseolus vulgaris]
 gb|ESW16654.1| hypothetical protein PHAVU_007G174500g [Phaseolus vulgaris]
Length=242

 Score =   121 bits (304),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 118/174 (68%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G   LYP +      LRW FIRKVY II+ Q+L+T ++  V V   P+      
Sbjct  8    KTDLESGARPLYPMM-LESPDLRWSFIRKVYSIIAIQLLVTIVIGAVVVTVRPIGVFFAT  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+F+PF+ L PL+ Y Q+HP+N++ LG+FT SLSF V +SCA T   ++L
Sbjct  67   TGAGLALYIVLIFVPFITLCPLYYYYQKHPINYLLLGVFTVSLSFVVGLSCAFTSEKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EA+ILT+ VV+ LT YTFWAA++G+DFNFLGP LF ++ +L++   IQ+ FPLG
Sbjct  127  EAVILTAVVVIGLTLYTFWAARRGQDFNFLGPFLFGAVLVLMVFALIQVLFPLG  180



>ref|XP_010932816.1| PREDICTED: BI1-like protein [Elaeis guineensis]
Length=244

 Score =   121 bits (304),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 120/172 (70%), Gaps = 6/172 (3%)
 Frame = +3

Query  120  DIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSS  293
            D+E G   LYP +     +LRW FIRK+Y I++ Q+LLT  VA V V   P++     S 
Sbjct  12   DVESGPRPLYPMM-LESPELRWAFIRKIYAILTVQMLLTVAVAAVVVTVRPISHFFVSSG  70

Query  294  A---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEA  464
            A   L +FL+ LPF++L PL+ Y Q HP+N++ LG+FT SLSF V ++CA T G ++LE+
Sbjct  71   AGLGLYIFLIILPFIVLCPLYYYHQTHPVNYLLLGIFTVSLSFAVGLTCAFTSGKVILES  130

Query  465  LILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            +ILTS VV++LT YTFWAA++G DF+FLGP LF ++ ILI+   IQ+ FPLG
Sbjct  131  VILTSVVVVSLTLYTFWAARRGHDFSFLGPFLFAAVMILIVFALIQILFPLG  182



>ref|XP_009367582.1| PREDICTED: BI1-like protein [Pyrus x bretschneideri]
 ref|XP_009367583.1| PREDICTED: BI1-like protein [Pyrus x bretschneideri]
Length=242

 Score =   121 bits (304),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 119/174 (68%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D E G   LYP +     +LRW FIRK+Y I++ Q+L T  V  V V   P+      
Sbjct  8    KSDPEAGLRPLYPMM-LESPELRWSFIRKIYAIVAIQLLATIAVGAVVVSVRPVANFFVS  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            ++A   L + L+ +PF++L PL+ Y Q+HP+N++ LG+FT SL+F V ++CA T G ++L
Sbjct  67   TAAGLALYIVLIIMPFIVLCPLYYYHQKHPVNYLLLGIFTISLAFVVGLTCAFTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            E++ILT+ VV+ LT YTFWAA++G DFNFLGP LF +L +LI+ G IQ+FFPLG
Sbjct  127  ESVILTAVVVIGLTLYTFWAARRGHDFNFLGPFLFGALLVLIVFGLIQVFFPLG  180



>emb|CBI28738.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   121 bits (303),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 114/157 (73%), Gaps = 4/157 (3%)
 Frame = +3

Query  162  EN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA---lllflvflpfl  329
            EN QLRW FIRK+Y I++ Q+LLT  VA V V   P+      + A   L + L+F+PF+
Sbjct  3    ENPQLRWAFIRKIYSIVAVQLLLTIAVAAVVVTVHPIAYFFVSTGAGLALYIVLIFVPFI  62

Query  330  llwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILTSAVVLALTGYT  509
            +L PL+ Y QRHP+N++ LG+FT SL+F V ++CA T G ++LE++ILT+ VV++LT YT
Sbjct  63   VLCPLYYYHQRHPVNYLLLGVFTVSLAFVVGLTCAFTSGKVILESVILTTVVVVSLTLYT  122

Query  510  FWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            FWAAK+G DFNFLGP LF ++ +L++   IQ+ FPLG
Sbjct  123  FWAAKRGYDFNFLGPFLFGAILVLMVFALIQILFPLG  159



>ref|XP_004145423.1| PREDICTED: BI1-like protein-like [Cucumis sativus]
 ref|XP_004168546.1| PREDICTED: BI1-like protein-like [Cucumis sativus]
 gb|KGN61667.1| hypothetical protein Csa_2G222100 [Cucumis sativus]
Length=238

 Score =   121 bits (304),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 114/170 (67%), Gaps = 4/170 (2%)
 Frame = +3

Query  120  DIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPL-NEVLKGSSA  296
            D+E   +YP +     QLRWGFIRKVY IIS Q+LLT  VA   V   P+ N  +K +  
Sbjct  8    DLENDQIYPMM-MESPQLRWGFIRKVYAIISMQLLLTAAVAAAVVFIRPIPNFFVKTTPG  66

Query  297  lllf--lvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALI  470
            ++ +  +V + F++L PL+ Y + HP NFI L LFT  ++F V +SCA T G I+LEA  
Sbjct  67   IIAYIGIVIVTFIVLCPLYAYHKHHPWNFILLTLFTIGIAFSVGISCAFTKGEIILEAAG  126

Query  471  LTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LTS VVL LT YTFWA K+G+DFNFLGP LF S+ +L + G IQ+FFPLG
Sbjct  127  LTSGVVLGLTLYTFWAVKRGQDFNFLGPFLFASVLVLFMFGLIQIFFPLG  176



>ref|XP_010455996.1| PREDICTED: BI1-like protein [Camelina sativa]
Length=246

 Score =   121 bits (304),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 119/177 (67%), Gaps = 10/177 (6%)
 Frame = +3

Query  114  KGDIEEG----TLYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEV  278
            K D+E G     LYP +   EN  LRWGFIRKVY II+ Q+L T  VA   V   P+   
Sbjct  10   KDDVEAGGSSRALYPTML--ENPDLRWGFIRKVYSIIAFQLLATVAVAATVVTVRPIALF  67

Query  279  LKGSS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGA  449
               +    AL + L+  PF++L PL+ Y Q+HP+N++ LG+FT +L+F V ++CA T+G 
Sbjct  68   FATTGLGLALYIVLIITPFIVLCPLYYYHQKHPVNYLLLGVFTLALAFVVGLTCAFTNGK  127

Query  450  IVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            ++LE+ ILT+ VVL+LT YTFWAA+KG DFNFLGP LF +L +LI+   IQ+ FPLG
Sbjct  128  VILESAILTTVVVLSLTLYTFWAARKGYDFNFLGPFLFGALIVLIVFAIIQIVFPLG  184



>ref|XP_011026112.1| PREDICTED: BI1-like protein isoform X1 [Populus euphratica]
Length=242

 Score =   121 bits (304),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 116/174 (67%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G   LYP +     QLRW FIRKVY I+  Q+LLT  VA + V   P+      
Sbjct  8    KTDLEAGARPLYPMM-LESPQLRWAFIRKVYSILCFQLLLTIAVAAMVVSIRPIAVFFST  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF+ L PL+ Y Q+HP+N+  LG+FT  L+F V ++CA T+G ++L
Sbjct  67   TGAGLALYIVLILTPFITLLPLYYYHQKHPVNYFLLGIFTIFLAFAVGLTCAFTEGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            E++ILT+ VV++LT YTFWAA++G DFNFLGP LF ++ +L++   IQ+ FPLG
Sbjct  127  ESVILTTVVVVSLTMYTFWAARRGHDFNFLGPFLFGAVMVLMVFALIQILFPLG  180



>ref|XP_010430038.1| PREDICTED: BI1-like protein [Camelina sativa]
Length=246

 Score =   121 bits (304),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 119/177 (67%), Gaps = 10/177 (6%)
 Frame = +3

Query  114  KGDIEEGT----LYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEV  278
            K D+E G     LYP +   EN  LRWGFIRKVY II+ Q+L T  VA   V   P+   
Sbjct  10   KDDVEAGASSRALYPTML--ENPDLRWGFIRKVYSIIAFQLLATVAVAATVVTVRPIALF  67

Query  279  LKGSS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGA  449
               +    AL + ++  P ++L PL+ Y Q+HP+N++ LG+FT +L+F V +SCA T+G 
Sbjct  68   FATTGLGLALYIVIIITPLIVLCPLYYYHQKHPVNYLLLGVFTLALAFVVGLSCAFTNGK  127

Query  450  IVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            ++LE+ ILT+ VVL+LT YTFWAA++G DFNFLGP LF +L +LI+ G IQ+ FPLG
Sbjct  128  VILESAILTTVVVLSLTLYTFWAARRGYDFNFLGPFLFGALIVLIVFGIIQILFPLG  184



>ref|XP_002466473.1| hypothetical protein SORBIDRAFT_01g008350 [Sorghum bicolor]
 gb|EER93471.1| hypothetical protein SORBIDRAFT_01g008350 [Sorghum bicolor]
Length=250

 Score =   121 bits (304),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 118/175 (67%), Gaps = 8/175 (5%)
 Frame = +3

Query  117  GDIEEG----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL-  281
            GD E G     LYP +   + +LRW FIRKVY I+S Q+LLT  VA V V   P+     
Sbjct  15   GDAETGQAARPLYPMM-LEDPRLRWSFIRKVYSILSIQMLLTVAVAAVVVYVRPIALFFV  73

Query  282  --KGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
               G   L +FL+ LPF++L PL+ Y Q HP+N + LGLFT ++SF V ++CA T G ++
Sbjct  74   STPGGFGLYIFLIILPFIVLCPLYYYYQHHPVNLLLLGLFTVAISFAVGLTCAFTKGEVI  133

Query  456  LEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LE+ ILT+ VVL+LT YTFWAAK+G DFNFLGP LF ++ IL+L   IQ+FFPLG
Sbjct  134  LESAILTAVVVLSLTAYTFWAAKRGHDFNFLGPFLFAAVMILMLFALIQLFFPLG  188



>gb|KEH23825.1| inhibitor of apoptosis-promoting Bax1 protein [Medicago truncatula]
Length=237

 Score =   121 bits (303),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 117/174 (67%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEG--TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G  TLYP +     +LRW FIRKVY II+ Q+LLT  VA V V   P+      
Sbjct  4    KRDVESGERTLYPTM-LESPELRWSFIRKVYSIITFQLLLTVAVASVVVFVPPIPRFFVS  62

Query  288  SS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            ++    L + L+F+P + L PL+ Y  +HPLN+  L +FT +++FPV +SCA   G ++L
Sbjct  63   TTPGLVLYIVLIFIPLITLCPLYYYHNKHPLNYFLLLIFTVTMAFPVGLSCAFVSGKVIL  122

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EA+ILT+ VV +LT YTFWAAK+G DF+FLGP LF +L +L++  FIQ+ FPLG
Sbjct  123  EAVILTTVVVFSLTLYTFWAAKRGHDFSFLGPFLFAALLVLLVFAFIQILFPLG  176



>ref|XP_009402334.1| PREDICTED: BI1-like protein [Musa acuminata subsp. malaccensis]
Length=244

 Score =   121 bits (303),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 119/173 (69%), Gaps = 6/173 (3%)
 Frame = +3

Query  117  GDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            GD+E G   LYP +     +LRW FIRK+Y I+  Q+LLT  VA V V   P+++    S
Sbjct  11   GDVESGAQPLYPAM-LERPELRWAFIRKIYSILVVQMLLTVAVASVVVAVRPVSQFFVSS  69

Query  291  SA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLE  461
             A   L +FL+ LPF++L PL+ Y Q HP NF+ LG+FT S+SF V ++CA T G ++LE
Sbjct  70   GAGLGLYIFLIILPFIVLCPLYYYYQHHPWNFLLLGVFTVSISFAVGLTCAFTSGKVILE  129

Query  462  ALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            + ILT+ VV++LT YTFWAA +G DFNFLGP LF+++  L++  FIQ+ FP+G
Sbjct  130  SAILTTVVVVSLTLYTFWAASRGHDFNFLGPFLFSAMLALMVFAFIQLLFPMG  182



>ref|XP_008665403.1| PREDICTED: BI1-like protein [Zea mays]
 tpg|DAA51301.1| TPA: hypothetical protein ZEAMMB73_665176 [Zea mays]
Length=250

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 121/175 (69%), Gaps = 8/175 (5%)
 Frame = +3

Query  117  GDIEEGT----LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
            GD E G     LYP +   + +LRW FIRKVY I+S Q+LLT  VA V V   P+     
Sbjct  15   GDAETGQAARPLYPMM-LEDPRLRWAFIRKVYSILSIQMLLTVAVAAVVVYVRPVALFFV  73

Query  285  GSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
             ++A   L +FL+ LPF++L PL+ Y QRHP+N + LGLFT ++SF V ++CA T G ++
Sbjct  74   STAAGFGLYIFLIILPFIVLCPLYYYYQRHPVNLLLLGLFTVAISFAVGLTCAFTKGEVI  133

Query  456  LEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LE+ +LT+ VVL+LT YTFWAAK+G DFNFLGP LF ++ IL+L   IQ+FFPLG
Sbjct  134  LESAVLTAVVVLSLTAYTFWAAKRGHDFNFLGPFLFAAVMILMLFALIQLFFPLG  188



>ref|XP_011027040.1| PREDICTED: BI1-like protein [Populus euphratica]
Length=243

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 116/173 (67%), Gaps = 7/173 (4%)
 Frame = +3

Query  120  DIEEGT---LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            D+E G    LYP +     Q+RW FIRKVY I++ Q+LLT  VA   V   P+   +  +
Sbjct  10   DMEAGISNQLYPMMQ-EPPQIRWAFIRKVYMILAMQLLLTVGVAATVVFVPPIPRFILHT  68

Query  291  S---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLE  461
            +   A+ +  + L  +LLWPLHVY +RHP N+ F+ LFT  ++F V +SCA T G IVLE
Sbjct  69   TPGLAIYIVSLILTLILLWPLHVYSKRHPWNYFFMALFTICIAFAVGLSCALTKGRIVLE  128

Query  462  ALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            A ILTS VV+ LT YTFWAAK+G+DF+FLGP LF+++ +LI+ G IQ  FPLG
Sbjct  129  AAILTSVVVVGLTLYTFWAAKRGQDFSFLGPFLFSAVLVLIVFGLIQFLFPLG  181



>ref|XP_008449318.1| PREDICTED: BI1-like protein [Cucumis melo]
Length=238

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 111/170 (65%), Gaps = 4/170 (2%)
 Frame = +3

Query  120  DIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPL-NEVLKGSSA  296
            D+E   +YP +     QLRWGFIRKVY IIS Q+LLT  VA   V   P+ N  +K +  
Sbjct  8    DVENDEIYPMM-MESPQLRWGFIRKVYAIISMQLLLTAAVAAAVVFIRPIPNFFVKTTPG  66

Query  297  lllf--lvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALI  470
            ++ +  +V   F++L PL+ Y + HP NFI L LFT  ++F V ++CA T G I+LEA  
Sbjct  67   IIAYIGIVIFTFIVLCPLYAYHRHHPWNFILLTLFTIGIAFSVGITCAFTKGEIILEAAA  126

Query  471  LTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LTS VV+ LT YTFWA K+G DFNFLGP LF SL +L +   IQ+FFPLG
Sbjct  127  LTSGVVVGLTLYTFWAVKRGHDFNFLGPFLFASLLVLFMFSLIQIFFPLG  176



>ref|XP_008789734.1| PREDICTED: BI1-like protein [Phoenix dactylifera]
Length=243

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 122/176 (69%), Gaps = 7/176 (4%)
 Frame = +3

Query  108  GMKGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL  281
            G  GD+E G   LYP +     + RW FIRK+Y I++AQ+ LT  VA + +   P++   
Sbjct  8    GKDGDVEAGLRPLYPMM-LESPEFRWVFIRKIYVILTAQLALTVAVASIVIAVRPISHFF  66

Query  282  KGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
              SSA   L +FL+ LPF++L PL+ Y QRHP+NF+ LGLFTAS+SF V ++CA T G I
Sbjct  67   VSSSAGLGLYIFLLILPFIVLCPLYYYHQRHPVNFLLLGLFTASISFAVGLTCAFTSGKI  126

Query  453  VLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            +LEA ILT AVV++LT YTF AA++G DFNFLGP LF S+F+L++   IQM F LG
Sbjct  127  ILEAAILT-AVVVSLTLYTFRAARRGHDFNFLGPFLFASVFVLLVFALIQMSFSLG  181



>ref|XP_008386439.1| PREDICTED: BI1-like protein [Malus domestica]
 ref|XP_008386440.1| PREDICTED: BI1-like protein [Malus domestica]
Length=241

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 116/174 (67%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D E G   LYP +     +LRW FIRK+Y I++ Q+L T  V  V V   P+      
Sbjct  8    KSDPEAGARLLYP-VMLESPELRWSFIRKIYAIVAIQLLATIAVGAVVVSVRPVANFFVS  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF++L PL+ Y Q+HP+N++ LG+FT SL+F V ++CA T G ++L
Sbjct  67   TGAGLALYIVLIITPFIVLCPLYYYHQKHPVNYLLLGIFTISLAFVVGLTCAFTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            E++ILT+ VV+ LT YTFWAA++G+DF+FLGP L  +L +LI+   IQ+FFPLG
Sbjct  127  ESVILTAVVVIGLTLYTFWAARRGQDFHFLGPFLSGALLVLIVFALIQVFFPLG  180



>ref|NP_001237340.1| uncharacterized protein LOC100527528 [Glycine max]
 gb|ACU16623.1| unknown [Glycine max]
 gb|KHN03822.1| BI1-like protein [Glycine soja]
Length=242

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 119/174 (68%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G+  LYP +     +LRW FIRKVY II+ Q+L+T +V  V V   P++     
Sbjct  8    KTDLESGSRPLYPMM-LESPELRWSFIRKVYSIIAIQLLVTIVVGAVVVTVRPISVFFAT  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+F+PF+ L PL+ Y Q+HP+N++ L +FT SL F V +SCA T   ++L
Sbjct  67   TGAGLALYIVLIFVPFITLCPLYYYSQKHPVNYLLLAVFTVSLGFVVGLSCAFTSEKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EA+ILT+ VV+ALT YTFWAA++G DFNFLGP LF ++ +L++   IQ+ FPLG
Sbjct  127  EAVILTAVVVIALTLYTFWAARRGHDFNFLGPFLFGAVLVLMVFALIQVLFPLG  180



>gb|ABK27003.1| unknown [Picea sitchensis]
Length=243

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 118/172 (69%), Gaps = 5/172 (3%)
 Frame = +3

Query  120  DIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSS  293
            D+E G+  LYPGI   +N  RW FIRK+Y I+S Q++LT  +  + V   P+      S 
Sbjct  10   DLEGGSIPLYPGISLEDNVFRWAFIRKIYTILSLQLILTVAIGSIVVFVRPVAVFFVSSP  69

Query  294  A---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEA  464
            A   L + LV LPF+LL PL+ Y Q+HP+N I L LFT ++ F V ++ + T G I+LE+
Sbjct  70   AGLALYIVLVILPFILLCPLYYYSQKHPVNLILLSLFTVAIGFAVGLTFSFTAGKIILES  129

Query  465  LILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            +ILT+ VV++LT YTFWAA++G DF+FLGPILF+++ +LI  G IQ FFPLG
Sbjct  130  VILTALVVVSLTAYTFWAARRGHDFSFLGPILFSAIMVLIFFGLIQAFFPLG  181



>gb|KDO74482.1| hypothetical protein CISIN_1g026616mg [Citrus sinensis]
Length=236

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 113/174 (65%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            KGD+E GT  LYPG+     ++RW FIRKVY I++ QILLT  VA V V   P+++ L  
Sbjct  3    KGDVERGTTELYPGM-IEPPEIRWAFIRKVYAIVAMQILLTIAVASVVVFVKPIHKFLAS  61

Query  288  SS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
             +    LL+ +  L  LL+ PL  Y++RHP NF+ L LFT  LSF + V+CA + G I+L
Sbjct  62   GTPGLVLLIVVFILTLLLICPLFAYRKRHPWNFVLLVLFTILLSFTLGVACAFSKGKIIL  121

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EA ILT A V  LT YTFWA K+G+DF+FLGP L  SL +LI+ G    FF +G
Sbjct  122  EAFILTGAAVAGLTLYTFWAVKRGKDFSFLGPFLSASLLVLIVFGIFMFFFRVG  175



>ref|XP_008775649.1| PREDICTED: BI1-like protein [Phoenix dactylifera]
Length=244

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 120/172 (70%), Gaps = 6/172 (3%)
 Frame = +3

Query  120  DIEEG--TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSS  293
            D+E G   LYP +     +LRW FIRK+Y I++ Q+LLT  VA V V   P++     S 
Sbjct  12   DVESGPQALYPTM-LESPELRWAFIRKIYAILTVQMLLTVAVAAVVVSVRPISHFFVSSG  70

Query  294  A---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEA  464
            A   L +FL+ LPF++L PL+ Y Q HP+N++ LG+FT SLSF V ++CA T G ++LE+
Sbjct  71   AGLGLYIFLIILPFIVLCPLYYYYQTHPVNYLLLGVFTVSLSFVVGLTCAFTSGKVILES  130

Query  465  LILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            +ILT+ VV++LT YTFWAA++G DF+FLGP LF ++ ILI+   IQ+ FPLG
Sbjct  131  VILTAVVVVSLTLYTFWAARRGHDFSFLGPFLFAAVMILIVFALIQILFPLG  182



>ref|XP_003518904.1| PREDICTED: BI1-like protein-like [Glycine max]
 gb|KHN18858.1| BI1-like protein [Glycine soja]
Length=242

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 119/174 (68%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G+  LYP +     +LRW FIRKVY II+ Q+L+T +V  V V   P++     
Sbjct  8    KTDLESGSRPLYPMM-LESPELRWSFIRKVYSIIAIQLLVTIVVGAVVVTVRPISVFFAT  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+F+PF+ L PL+ Y Q+HP+N++ LG+FT SL F V +SCA T   ++L
Sbjct  67   TGAGLALYIVLIFVPFITLCPLYYYSQKHPVNYLLLGVFTVSLGFVVGLSCAFTSEKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EA+ILT+ VV+ LT YTFWAA++G DFNFLGP LF ++ +L++   IQ+ FPLG
Sbjct  127  EAVILTAVVVIGLTLYTFWAARRGHDFNFLGPFLFGAVLVLMVFALIQVLFPLG  180



>gb|EMS50944.1| hypothetical protein TRIUR3_13925 [Triticum urartu]
Length=272

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 123/182 (68%), Gaps = 15/182 (8%)
 Frame = +3

Query  117  GDIEEGT-----------LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYA  263
            GDIE GT           LYPG+     +LRW  IRK+Y IIS Q+LLT +VA V V   
Sbjct  30   GDIEAGTSGRTAAAPAGALYPGMA-ESPELRWALIRKIYVIISLQLLLTAVVAAVVVKVH  88

Query  264  PLNEVLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCA  434
             +      S A   L +FL+ LPF++L PL++Y+Q+HP+N + LG+FT ++SF V ++CA
Sbjct  89   AIPHFFASSYAGLGLYIFLLILPFIVLCPLYIYRQKHPVNLLLLGVFTVAISFAVGMTCA  148

Query  435  NTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFP  614
             T G ++LEA ILT+ VV +LT YTFWA K+G+DF+FLGP LF SL +L++ GFIQ+ FP
Sbjct  149  FTSGKVILEAAILTTVVVFSLTAYTFWAVKRGKDFSFLGPFLFASLIMLLVFGFIQILFP  208

Query  615  LG  620
            LG
Sbjct  209  LG  210



>gb|EMT30807.1| hypothetical protein F775_10013 [Aegilops tauschii]
Length=249

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 117/175 (67%), Gaps = 8/175 (5%)
 Frame = +3

Query  117  GDIEEG----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
            GD E G     LYP +     QLRW F+RKVY I+S Q+LLT  VA V V   P+     
Sbjct  14   GDAEAGQAARPLYPMM-LESPQLRWAFVRKVYTILSIQMLLTIAVASVVVFVRPVALFFV  72

Query  285  GSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
             S A   L +FL+ LPF++L PL+ Y QRHP+N + L LFT ++SF V ++CA T G ++
Sbjct  73   SSPAGFGLYIFLIILPFIVLCPLYYYYQRHPVNLLLLALFTVAISFAVGLTCAFTKGEVI  132

Query  456  LEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LE+ ILT+ VV++LT YTFWAA++G DF+FLGP LF ++ IL++   IQ FFPLG
Sbjct  133  LESAILTAVVVVSLTAYTFWAARRGHDFSFLGPFLFAAVMILMVFALIQAFFPLG  187



>ref|XP_006420012.1| hypothetical protein CICLE_v10006442mg [Citrus clementina]
 ref|XP_006489444.1| PREDICTED: BI1-like protein-like [Citrus sinensis]
 gb|ESR33252.1| hypothetical protein CICLE_v10006442mg [Citrus clementina]
Length=236

 Score =   119 bits (297),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 112/174 (64%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            KGD E GT  LYPG+     ++RW FIRKVY I++ QILLT  VA V V   P+++ L  
Sbjct  3    KGDAERGTTELYPGM-IEPPEIRWAFIRKVYAIVAMQILLTIAVASVVVFVKPIHKFLAS  61

Query  288  SS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
             +    LL+ +  L  LL+ PL  Y++RHP NF+ L LFT  LSF V V+CA + G I+L
Sbjct  62   GTPGLVLLIVVFILTLLLICPLFAYRKRHPWNFVLLVLFTILLSFTVGVACAFSKGKIIL  121

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EA ILT A V  LT YTFWA K+G+DF+FLGP L  SL +LI+ G    FF +G
Sbjct  122  EAFILTGAAVAGLTLYTFWAVKRGKDFSFLGPFLSASLLVLIVFGIFMFFFRVG  175



>ref|XP_006650573.1| PREDICTED: BI1-like protein-like [Oryza brachyantha]
Length=247

 Score =   119 bits (297),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 115/164 (70%), Gaps = 4/164 (2%)
 Frame = +3

Query  138  LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA---lllf  308
            LYP +     QLRW FIRKVY I+S Q+LLT  VA V V   P+      +S    L +F
Sbjct  23   LYPMM-LESPQLRWAFIRKVYTILSIQMLLTVAVASVVVYVRPVALFFVSTSGGFGLYIF  81

Query  309  lvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILTSAVV  488
            L+ LPF++L PL+ Y QRHP+N + LGLFT ++SF V ++CA T G ++LE+ ILT+ VV
Sbjct  82   LIILPFIVLCPLYYYYQRHPVNLLLLGLFTVAISFAVGLTCAFTKGEVILESAILTAVVV  141

Query  489  LALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            ++LT YTFWAA++G DF+FLGP LF ++ IL++   IQ+FFPLG
Sbjct  142  VSLTAYTFWAARRGHDFSFLGPFLFAAVMILMVFALIQIFFPLG  185



>ref|XP_006650725.1| PREDICTED: BI1-like protein-like [Oryza brachyantha]
Length=241

 Score =   118 bits (296),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 115/174 (66%), Gaps = 8/174 (5%)
 Frame = +3

Query  120  DIEEG----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL--  281
            D+E G     LYPG+    + LRW  I K+Y I+S QI +T  VA   V    ++E    
Sbjct  7    DLEAGGASEPLYPGMVESPD-LRWALIHKIYVILSVQIAMTAAVAAFVVKVRGVSEFFVS  65

Query  282  -KGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
             K   AL +FL+ LP ++L PL  Y Q+HP+N + LG+FT ++SF V ++CA T G ++ 
Sbjct  66   SKAGLALYIFLLVLPLIVLCPLRYYHQKHPVNLLLLGVFTVAISFAVGMTCAYTSGKVIF  125

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EA ILT+ VV++LT YTFWAAK+G DFNFLGP LF+++ +LIL   IQ+FFPLG
Sbjct  126  EAAILTAVVVISLTAYTFWAAKRGHDFNFLGPFLFSAVMVLILFSLIQVFFPLG  179



>gb|EMS57375.1| hypothetical protein TRIUR3_34180 [Triticum urartu]
Length=249

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 116/175 (66%), Gaps = 8/175 (5%)
 Frame = +3

Query  117  GDIEEG----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
            GD E G     LYP +     QLRW F+RKVY I+S Q+LLT  VA V V   P+     
Sbjct  14   GDAEAGQAARPLYPMM-LESPQLRWAFVRKVYTILSIQMLLTIAVASVVVFVRPVALFFV  72

Query  285  GSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
             S A   L +FL+ LPF++L PL+ Y QRHP+N + L LFT ++SF V ++CA T G ++
Sbjct  73   SSPAGFGLYIFLIILPFIVLCPLYYYYQRHPVNLLLLALFTVAISFAVGLTCAFTKGEVI  132

Query  456  LEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LE+ ILT+ VV++LT YTFWAA +G DF+FLGP LF ++ IL++   IQ FFPLG
Sbjct  133  LESAILTAVVVVSLTAYTFWAASRGHDFSFLGPFLFAAVMILMVFALIQAFFPLG  187



>ref|XP_010096442.1| hypothetical protein L484_002350 [Morus notabilis]
 gb|EXB64217.1| hypothetical protein L484_002350 [Morus notabilis]
Length=242

 Score =   118 bits (296),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 115/174 (66%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D E G   LYP +     +LRW FIRK+Y I+  Q+L T  VA + V   P+      
Sbjct  8    KTDEEVGARPLYPMM-LESPELRWSFIRKIYSIVCIQLLATIAVAAIVVSVRPIAHFFAS  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF+ L PL+ Y ++HP+N++ LG+FT SL+F V ++CA T G ++L
Sbjct  67   TGAGLALYIVLIITPFITLCPLYYYYRKHPVNYLLLGIFTISLAFAVGLTCAFTSGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            E++ILT+ VV++LT YTFWAAK+G DFNFLGP LF ++ +L++   IQ+ FP+G
Sbjct  127  ESVILTTVVVVSLTLYTFWAAKRGHDFNFLGPFLFGAVMVLMVFALIQILFPMG  180



>gb|KHG20710.1| hypothetical protein F383_10571 [Gossypium arboreum]
Length=242

 Score =   118 bits (296),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 112/174 (64%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            KGD E G   LYP +      LRW FIRKVY I++ Q+L T  VA   V   P+      
Sbjct  8    KGDAEAGPQPLYPMM-LEPPALRWAFIRKVYSIVALQLLATAGVAATVVFVHPIARFFVS  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF+ L PL+ + Q+HP N++ LG+FT SL+F + ++CA T G ++L
Sbjct  67   TGAGLALYIVLIVTPFITLCPLYYFHQKHPWNYLLLGIFTISLAFAIGLTCAFTQGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EA ILT+ VV+ LT YTFWAAK+G DF+FLGP LF +L + I+   IQ+FFPLG
Sbjct  127  EATILTATVVVGLTLYTFWAAKRGHDFSFLGPFLFGALLVCIVFALIQIFFPLG  180



>ref|XP_011399245.1| BI1-like protein [Auxenochlorella protothecoides]
 gb|KFM26349.1| BI1-like protein [Auxenochlorella protothecoides]
Length=247

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 109/175 (62%), Gaps = 3/175 (2%)
 Frame = +3

Query  96   SYDGGMKGDIEE---GTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAP  266
            S  G   GD  E   G LYPGI   +N LRWGF+RKVYGI++ Q+ LT  VA V  L   
Sbjct  8    SNSGAKYGDDLESGGGLLYPGIDATDNSLRWGFVRKVYGIVTIQLALTAAVALVVTLVPS  67

Query  267  LNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
            +N  L  S A  + L+ L  L L PL +Y+ RHPLN   LGL+T +++  V V+C+  + 
Sbjct  68   VNAFLARSLAANIGLMVLSLLALIPLFIYKDRHPLNLALLGLWTLTMATTVGVACSFYEP  127

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFF  611
            AIVLEAL LT+ VV ALT Y+FWA  +G DF+ +GP+L   L+ ++  G  Q+FF
Sbjct  128  AIVLEALALTTTVVAALTAYSFWATARGVDFSPVGPLLAGLLWAMLAWGLFQIFF  182



>gb|EMT04950.1| hypothetical protein F775_18737 [Aegilops tauschii]
Length=243

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 120/172 (70%), Gaps = 4/172 (2%)
 Frame = +3

Query  117  GDIEEGTLYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSS  293
            GD+E GT  P     E+ +LRW  IRK+Y ++  Q+LLT +VA V V    +      S 
Sbjct  10   GDVEAGTAAPYPATTESPELRWALIRKIYVVLCLQLLLTAVVAVVVVKVRAIPHFFVSSY  69

Query  294  A---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEA  464
            A   L + ++  PF++++PLH Y+Q+HP+N + LG+FT ++SF V ++CA T G ++LEA
Sbjct  70   AGLGLYISILIFPFIVMFPLHFYRQKHPVNLLLLGVFTVAISFSVGLTCAFTSGKVILEA  129

Query  465  LILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
             ILT  VVL+LT YTFWAA++G+DF+FLGP LF SL IL++ GFIQ+FFPLG
Sbjct  130  GILTIVVVLSLTAYTFWAARRGKDFSFLGPFLFASLMILLVFGFIQIFFPLG  181



>gb|KJB23000.1| hypothetical protein B456_004G077400 [Gossypium raimondii]
Length=242

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 108/174 (62%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            KGD E G   LYP +     +LRW FIRKVY I++ Q+L T  VA   V   P+      
Sbjct  8    KGDAEAGPQPLYPMM-LEPPELRWAFIRKVYSIVALQLLATAGVAATVVFVHPIARFFVS  66

Query  288  SSAlllflvflpfl---llwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A L   + L       L PL+ + Q+HP N++ LG FT SL+F + ++CA T G ++L
Sbjct  67   TGAGLALYMVLIVTPFITLCPLYYFHQKHPWNYLLLGTFTISLAFAIGLTCAFTQGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EA ILT+ VV+ LT YTFWAAK+G DF+FLGP LF +L + I+   IQ+FFPLG
Sbjct  127  EAAILTATVVVGLTLYTFWAAKRGHDFSFLGPFLFGALLVCIVFALIQIFFPLG  180



>gb|ACU19259.1| unknown [Glycine max]
Length=242

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 119/174 (68%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D+E G+  LYP +     +LRW FIRKVY II+ Q+L+T +V  V V   P++     
Sbjct  8    KTDLESGSRPLYPMM-LESPELRWSFIRKVYSIIAIQLLVTIVVGAVVVTVRPISVFFAT  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+F+PF+ L PL+ Y Q+HP+N++ LG+FT SL F V +SCA T   ++L
Sbjct  67   TGAGLALYIVLIFVPFITLCPLYYYSQKHPVNYLLLGVFTVSLGFVVGLSCAFTSEKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EA+ILT+ VV+ LT YTFWAA++G DFNFLGP LF ++ +L++   IQ+ FPLG
Sbjct  127  EAVILTAVVVIGLTLYTFWAARRGHDFNFLGPFLFGAVLVLMVFALIQVQFPLG  180



>ref|XP_002971406.1| hypothetical protein SELMODRAFT_95705 [Selaginella moellendorffii]
 gb|EFJ27155.1| hypothetical protein SELMODRAFT_95705 [Selaginella moellendorffii]
Length=229

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 109/171 (64%), Gaps = 5/171 (3%)
 Frame = +3

Query  105  GGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
             G  GDIE           +  LRWGFIRKVYGI+ +Q++LT +VAG+ V   P+N  L 
Sbjct  2    AGGSGDIESAR-----STSDLDLRWGFIRKVYGILMSQLVLTAIVAGIVVAVKPINRALG  56

Query  285  GSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEA  464
             +  + L L     +LL PL++Y+Q+HPLN I LG FT  LS  V   CA T G IVL+A
Sbjct  57   HTPWISLALGVFALILLCPLYIYRQKHPLNLILLGFFTILLSLTVGFVCAYTRGNIVLQA  116

Query  465  LILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPL  617
            LILT+ + + LT +TFWA  +G DF FLGP+LF S+ +LI+ G IQ FFP+
Sbjct  117  LILTATITIGLTLFTFWAVNRGYDFGFLGPLLFASVLVLIVWGIIQAFFPI  167



>ref|XP_002966079.1| hypothetical protein SELMODRAFT_84281 [Selaginella moellendorffii]
 gb|EFJ33499.1| hypothetical protein SELMODRAFT_84281 [Selaginella moellendorffii]
Length=229

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 109/171 (64%), Gaps = 5/171 (3%)
 Frame = +3

Query  105  GGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
             G  GDIE           +  LRWGFIRKVYGI+ +Q++LT +VAG+ V   P+N  L 
Sbjct  2    AGGSGDIESAR-----STSDLSLRWGFIRKVYGILMSQLVLTAIVAGIVVAVKPINRALG  56

Query  285  GSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEA  464
             +  + L L     +LL PL++Y+Q+HPLN I LG FT  LS  V   CA T G IVL+A
Sbjct  57   HTPWISLALGVFALILLCPLYIYRQKHPLNLILLGFFTILLSLTVGFVCAYTRGNIVLQA  116

Query  465  LILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPL  617
            LILT+ + + LT +TFWA  +G DF FLGP+LF S+ +LI+ G IQ FFP+
Sbjct  117  LILTATITIGLTLFTFWAVNRGYDFGFLGPLLFASVLVLIVWGIIQAFFPI  167



>gb|EMT04947.1| hypothetical protein F775_08799 [Aegilops tauschii]
Length=245

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 122/181 (67%), Gaps = 14/181 (8%)
 Frame = +3

Query  117  GDIEEGT----------LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAP  266
            GDIE GT          LYPG+     +LRW  IRK+Y IIS Q+LLT +VA V V    
Sbjct  4    GDIEAGTSGGAAAPAQVLYPGMA-ESPELRWALIRKIYVIISLQLLLTAVVAAVVVKVPA  62

Query  267  LNEVLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCAN  437
            +      S A   L +FL+ LPF++L PL++Y+Q+HP+N + LG+FT ++SF V ++CA 
Sbjct  63   IPHFFASSYAGLGLYIFLLILPFIVLCPLYIYRQKHPVNLLLLGVFTVAISFAVGMTCAF  122

Query  438  TDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPL  617
            T G ++LEA ILT+ VV +LT YTFWA K+G+DF+FLGP LF SL +L++ GFIQ+ FP 
Sbjct  123  TSGKVILEAAILTTVVVFSLTAYTFWAVKRGKDFSFLGPFLFASLIMLLVFGFIQILFPP  182

Query  618  G  620
            G
Sbjct  183  G  183



>emb|CDM85336.1| unnamed protein product [Triticum aestivum]
Length=248

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 119/176 (68%), Gaps = 8/176 (5%)
 Frame = +3

Query  117  GDIEEGTLYP-GIGYG----ENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL  281
            GDIE GT  P G  Y       +LRW  IRK+Y ++  Q+LLT  VA V V    +    
Sbjct  11   GDIEAGTAAPKGAPYAGTTESPELRWALIRKIYVVLCLQLLLTAAVAAVFVTVTAIPHFF  70

Query  282  KGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
              S A   L +F++  PF++L PLH+Y+Q+HP+N + LG+FT ++SF V ++CA T G +
Sbjct  71   VSSYAGLGLYIFILVFPFIVLCPLHIYRQKHPINLLLLGVFTVAISFSVGLTCAFTSGKV  130

Query  453  VLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            +L+A ILT  VVL+LT YTFWAA++G+DF+FLGP LF SL IL++  FIQ+FFPLG
Sbjct  131  ILQAGILTIVVVLSLTAYTFWAARRGKDFSFLGPFLFASLMILLVFAFIQIFFPLG  186



>ref|XP_004493722.1| PREDICTED: BI1-like protein-like [Cicer arietinum]
Length=240

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 117/172 (68%), Gaps = 4/172 (2%)
 Frame = +3

Query  114  KGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSS  293
             G+ E  TLYP +     QLRW FIRKVY II+ Q+LLT  VA V V   P++     S+
Sbjct  9    NGETETRTLYPTM-LESPQLRWSFIRKVYSIITFQLLLTVAVASVVVFVPPVSHFFVSST  67

Query  294  ---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEA  464
                L + L+F+PF+ L PL+ Y Q+HPLN+  L +FT +L+ P+ ++CA   G ++LE+
Sbjct  68   QGLILYIVLIFVPFITLCPLYYYHQKHPLNYFLLLIFTVTLAIPIGLTCAFVSGKVILES  127

Query  465  LILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            +ILT+AVV +LT YTFWAA++G DF+FLGP LF +L +L++   IQ+ FPLG
Sbjct  128  VILTTAVVFSLTLYTFWAARRGHDFSFLGPFLFGALLVLMIFALIQILFPLG  179



>gb|EPS70625.1| hypothetical protein M569_04132, partial [Genlisea aurea]
Length=231

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 108/170 (64%), Gaps = 3/170 (2%)
 Frame = +3

Query  120  DIEEGTLYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA  296
            DIE G LYPG G  EN QLRWGFIRKVY I+S Q+LLT  V  V +L+ P+ + ++ ++ 
Sbjct  1    DIETGQLYPGQGMYENPQLRWGFIRKVYSILSMQLLLTVAVGLVMILFDPVRQFMQTTTG  60

Query  297  --lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALI  470
              +++  + L  +L + +  + QRHP N I L LFT +LS+ V  +C    G  VL A  
Sbjct  61   LYVMIAAMVLTVMLCFMMSCFSQRHPWNIILLILFTLALSWMVGATCTQRKGQAVLMAAT  120

Query  471  LTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LT  V  +LT +TF AAK+G DFNFLGP L  ++ +L+  G I++ FP+G
Sbjct  121  LTLLVTFSLTLFTFLAAKRGYDFNFLGPFLLCAVLLLMAFGIIRIIFPMG  170



>ref|XP_010024226.1| PREDICTED: BI1-like protein [Eucalyptus grandis]
 gb|KCW60687.1| hypothetical protein EUGRSUZ_H03417 [Eucalyptus grandis]
Length=239

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 114/175 (65%), Gaps = 8/175 (5%)
 Frame = +3

Query  117  GDIEEG----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
            GD+E G     LYPG+     QLRW FIRKVY II  Q+LLT  VA    L  P++  + 
Sbjct  6    GDVESGQAAAALYPGM-LESPQLRWAFIRKVYAIILVQLLLTAGVATAVGLVKPVSRFIA  64

Query  285  GS---SAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
             +     +L+ L+ L F+++  L  Y  R+P+NF+ LGLFT +++  V +SCA ++  ++
Sbjct  65   KTWPGFGVLMALIVLSFIIVIVLRAYHNRYPVNFVLLGLFTVTMASMVGLSCAFSEEKVI  124

Query  456  LEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LE+ ILTS V++ALT YTFW  K+G DF+FLGP LF SL +L++   IQ+FFPLG
Sbjct  125  LESAILTSVVIVALTFYTFWVVKRGGDFSFLGPFLFASLLVLLVFALIQIFFPLG  179



>ref|XP_004955618.1| PREDICTED: BI1-like protein-like [Setaria italica]
Length=249

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 125/189 (66%), Gaps = 12/189 (6%)
 Frame = +3

Query  87   VSSSYDGGMKGDIEEGT--------LYPGIGYGENQLRWGFIRKVYGIISAQIllttlva  242
            +SS++     GD+E GT        LYPG+     ++RW  IRK+Y I+S Q+LLT  VA
Sbjct  1    MSSAFGYQKGGDLEAGTSGAPGPRALYPGMQ-ESPEMRWALIRKIYVILSLQLLLTAAVA  59

Query  243  gvtvlYAPLNEVLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSF  413
             V V    +      + A   L +FL+ LPF++L PL+ Y +RHP+N I LGLFT ++SF
Sbjct  60   AVVVKVRAIPHFFTTTHAGLGLYIFLIILPFIVLCPLYYYHERHPVNLILLGLFTLAISF  119

Query  414  PVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtg  593
             V ++CA T G ++LE+ ILT+ VVL+LT YTFWA ++G+DF+FLGP LF SL +L++  
Sbjct  120  AVGMTCAFTSGKVILESAILTTVVVLSLTAYTFWAVRRGKDFSFLGPFLFASLIVLLVFA  179

Query  594  fiQMFFPLG  620
            FIQ+ FPLG
Sbjct  180  FIQILFPLG  188



>emb|CDM85345.1| unnamed protein product [Triticum aestivum]
Length=249

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 125/186 (67%), Gaps = 15/186 (8%)
 Frame = +3

Query  105  GGMKG-DIEEGT----------LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvt  251
            G  KG DIE GT          LYPG+     +LRW  IRK+Y I+S Q+LLT +VA V 
Sbjct  3    GYQKGVDIEAGTSGGAAAPTRGLYPGMT-ESPELRWALIRKIYVILSLQLLLTAVVAAVV  61

Query  252  vlYAPLNEVLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
            V    +      SSA   L +FL+  PF++L PL+ Y+Q+HP+N + LG+FT ++SF V 
Sbjct  62   VKVRAIPHFFVSSSAGLGLYIFLIIFPFIVLCPLYFYRQKHPVNLLLLGVFTVAISFAVG  121

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQ  602
            ++CA T G ++LEA ILT+ VV +LT YTFWAAK+G+DF+FLGP LF SL +L++ GFIQ
Sbjct  122  MTCAFTSGKVILEAAILTTVVVFSLTAYTFWAAKRGQDFSFLGPFLFASLIMLLVFGFIQ  181

Query  603  MFFPLG  620
            + FP+G
Sbjct  182  ILFPMG  187



>ref|XP_007162464.1| hypothetical protein PHAVU_001G154500g [Phaseolus vulgaris]
 gb|ESW34458.1| hypothetical protein PHAVU_001G154500g [Phaseolus vulgaris]
Length=241

 Score =   116 bits (291),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 120/179 (67%), Gaps = 11/179 (6%)
 Frame = +3

Query  111  MKGDIEEG-----TLYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLN  272
            MK D+E G      LYP +   EN QLRW FIRKVY I++ Q+LLT  VA V V   P+ 
Sbjct  3    MKRDVESGGGSERPLYPSML--ENPQLRWSFIRKVYSILTFQLLLTIAVAAVVVFVRPIP  60

Query  273  EVLKGSS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTD  443
              +  ++    + + L+F+PF+ L PL+ Y Q+HPLN+  L +FT +L+F V ++CA T 
Sbjct  61   HFIVSTTPGLVIYIILIFVPFITLCPLYYYHQKHPLNYFLLLIFTVTLAFSVGLTCAFTS  120

Query  444  GAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            G I+LE++ILT+ VV +LT YTF+AA++G DFNFLGP LF +L +LI+   IQ+  PLG
Sbjct  121  GKIILESVILTTVVVFSLTLYTFFAARRGHDFNFLGPFLFGALLVLIVFSLIQILIPLG  179



>ref|XP_009410985.1| PREDICTED: BI1-like protein [Musa acuminata subsp. malaccensis]
Length=245

 Score =   116 bits (291),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 124/179 (69%), Gaps = 8/179 (4%)
 Frame = +3

Query  105  GGMKG-DIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLN  272
            G  KG D+E      LYP +     QLRW FIRK+Y I++ Q+LLT  VA V V   P++
Sbjct  6    GYWKGRDVEAAGAPPLYPMM-LEPPQLRWAFIRKIYTILAVQMLLTVAVAAVVVSVPPVS  64

Query  273  EVLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTD  443
                 S A   L +FL+ LPF++L PL+ Y Q+HPLNF+ LG+FT S+SF V ++CA T 
Sbjct  65   RFFVSSGAGLGLYIFLIILPFIVLCPLYYYYQKHPLNFLLLGVFTVSISFAVGLTCAFTS  124

Query  444  GAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            G ++LE++ILT+ VV++LT YTFWAA KG DF+FLGP LF+++ IL++   IQ+FFP+G
Sbjct  125  GKVILESVILTAVVVVSLTLYTFWAASKGHDFSFLGPFLFSAVMILMVFALIQVFFPMG  183



>ref|NP_001051551.1| Os03g0795800 [Oryza sativa Japonica Group]
 gb|AAT76424.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99337.1| Uncharacterized protein family UPF0005 containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13465.1| Os03g0795800 [Oryza sativa Japonica Group]
 gb|EAY92173.1| hypothetical protein OsI_13887 [Oryza sativa Indica Group]
 gb|EAZ28904.1| hypothetical protein OsJ_12944 [Oryza sativa Japonica Group]
 dbj|BAG95443.1| unnamed protein product [Oryza sativa Japonica Group]
Length=241

 Score =   116 bits (290),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 116/174 (67%), Gaps = 8/174 (5%)
 Frame = +3

Query  120  DIEEG----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            D+E G     LYPG+    + LRW  I K+Y I+S Q+ +T  VA   V    ++E    
Sbjct  7    DLEAGGSSEPLYPGMVESPD-LRWALIHKIYVILSVQLAMTAAVAAFVVKVRGVSEFFVS  65

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            S+A   L +FL+FLP ++L PL  Y Q+HP+N + LGLFT ++SF V ++CA T G ++ 
Sbjct  66   SNAGFALYIFLLFLPLIVLCPLRYYHQKHPVNLLLLGLFTVAISFAVGMTCAYTSGKVIF  125

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            EA  LT+ VV++LT YTFWAAK+G DFNFLGP LF+++ +LIL   IQ+FFPLG
Sbjct  126  EAAALTAVVVISLTAYTFWAAKRGHDFNFLGPFLFSAVMVLILFSLIQIFFPLG  179



>emb|CBI26304.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   115 bits (288),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 108/153 (71%), Gaps = 3/153 (2%)
 Frame = +3

Query  171  LRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA---lllflvflpflllwp  341
            +RW FIRKVY I+S Q+LLT +VA + V+  P+++ +  + A   L LF+V L  +L+  
Sbjct  7    MRWAFIRKVYAILSMQLLLTVVVAAIVVVVDPISDFMVHNRAGLGLYLFIVVLSLILMCA  66

Query  342  lHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAA  521
            L  + +RHP+N I LG+FT +++F + +SCA   G I+LEA ILTS V + LT YTFWAA
Sbjct  67   LAAFHKRHPVNLILLGMFTLTMAFTMGLSCAFVKGKIILEAAILTSVVTIGLTLYTFWAA  126

Query  522  KKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            K+G DF+FLGP LF SL +L++   IQMFFP+G
Sbjct  127  KRGHDFSFLGPFLFASLLVLLVFSMIQMFFPMG  159



>ref|XP_003557492.1| PREDICTED: BI1-like protein [Brachypodium distachyon]
Length=251

 Score =   116 bits (290),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 117/164 (71%), Gaps = 4/164 (2%)
 Frame = +3

Query  138  LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGSSA---lllf  308
            LYPG+     +LRW  IRK+Y I+S Q+LLT  VA V V    ++     S+A   L +F
Sbjct  27   LYPGMT-ESPELRWALIRKIYTILSLQLLLTAAVAAVVVKVRAISHFFVSSNAGLGLYIF  85

Query  309  lvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLEALILTSAVV  488
            LV  PF++L PL+ Y+Q+HP+N + LG+FT ++SF V ++CA T G ++LEA ILT+ VV
Sbjct  86   LVIFPFIVLCPLYFYRQKHPVNLLLLGIFTVAISFAVGMTCAFTSGKVILEAAILTAVVV  145

Query  489  LALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            ++LT YTFWAAK+G+DF+FLGP LF SL +LI+  FIQ+ FP+G
Sbjct  146  VSLTAYTFWAAKRGQDFSFLGPFLFASLIVLIVFAFIQILFPMG  189



>gb|KJB23003.1| hypothetical protein B456_004G077400 [Gossypium raimondii]
Length=249

 Score =   115 bits (289),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 109/181 (60%), Gaps = 13/181 (7%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            KGD E G   LYP +     +LRW FIRKVY I++ Q+L T  VA   V   P+      
Sbjct  8    KGDAEAGPQPLYPMM-LEPPELRWAFIRKVYSIVALQLLATAGVAATVVFVHPIARFFVS  66

Query  288  SSAlllflvfl----------pflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCAN  437
            + A L   + L            + L PL+ + Q+HP N++ LG FT SL+F + ++CA 
Sbjct  67   TGAGLALYMVLIVTPFIKMCLALVALCPLYYFHQKHPWNYLLLGTFTISLAFAIGLTCAF  126

Query  438  TDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPL  617
            T G ++LEA ILT+ VV+ LT YTFWAAK+G DF+FLGP LF +L + I+   IQ+FFPL
Sbjct  127  TQGKVILEAAILTATVVVGLTLYTFWAAKRGHDFSFLGPFLFGALLVCIVFALIQIFFPL  186

Query  618  G  620
            G
Sbjct  187  G  187



>ref|NP_001130584.1| uncharacterized protein LOC100191683 [Zea mays]
 gb|ACF78861.1| unknown [Zea mays]
 tpg|DAA59751.1| TPA: transmembrane BAX inhibitor motif protein-containing protein 
4 [Zea mays]
Length=249

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 85/190 (45%), Positives = 124/190 (65%), Gaps = 8/190 (4%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlv  239
            M+G+++     + G  G    G    LYPG+     +LRW  IRK+Y I+S Q+LLT +V
Sbjct  1    MFGYQK-GLDVEAGTSGAAATGGARQLYPGMQ-ESPELRWALIRKIYVILSLQLLLTAVV  58

Query  240  agvtvlYAPLNEVLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLS  410
            A V V    +      +SA   L +FL+ LPF++L PL+ Y ++HP+N I LGLFT ++S
Sbjct  59   AAVVVKVRAIPHFFTTTSAGLGLYIFLIILPFIVLCPLYFYHEKHPVNLILLGLFTVAIS  118

Query  411  FPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililt  590
            F V ++CA T G ++LE+ ILT+ VVL+LT YTFWA  +G+DF+FLGP LF ++ +L++ 
Sbjct  119  FAVGMTCAFTSGKVILESAILTTVVVLSLTAYTFWAVNRGKDFSFLGPFLFAAIIVLLVF  178

Query  591  gfiQMFFPLG  620
              IQ+ FPLG
Sbjct  179  ALIQILFPLG  188



>gb|ACG33000.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays]
Length=249

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 124/190 (65%), Gaps = 8/190 (4%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlv  239
            M+G+++     + G  G    G    LYPG+     +LRW  IRK+Y I+S Q+LLT +V
Sbjct  1    MFGYQK-GLDVEAGTSGAAATGGARQLYPGMQ-ESPELRWALIRKIYVILSLQLLLTAVV  58

Query  240  agvtvlYAPLNEVLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLS  410
            A V V    +      +SA   L +FL+ LPF++L PL+ Y ++HP+N I LGLFT ++S
Sbjct  59   AAVVVKVRAIPHFFTTTSAGLGLYIFLIILPFIVLCPLYFYHEKHPVNLILLGLFTVAIS  118

Query  411  FPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililt  590
            F V ++CA T G ++LE+ ILT+ VVL+LT YTFWA  +G+DF+FLGP LF +L +L++ 
Sbjct  119  FAVGMTCAFTSGKVILESAILTTVVVLSLTAYTFWAVNRGKDFSFLGPFLFAALIVLLVF  178

Query  591  gfiQMFFPLG  620
              IQ+ FPLG
Sbjct  179  ALIQILFPLG  188



>ref|XP_008355439.1| PREDICTED: BI1-like protein [Malus domestica]
Length=245

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 111/174 (64%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D E     LYP +     +LRW FIRK+Y I++ Q+L T  +  V V   P+      
Sbjct  11   KSDPEAQARPLYPTM-LESPELRWSFIRKIYAIVAMQLLATIAIGAVVVSVRPVAHFFVS  69

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF++L PL+ Y Q+HP+N++ LG+FT SL+  V ++CA T G ++L
Sbjct  70   TGAGLALYIVLIITPFIVLCPLYYYHQKHPVNYLLLGIFTLSLACVVGLTCAFTSGKVIL  129

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            E++ILT+ VV+ LT YTFWAAK+G DFNFLGP L  ++ +L +   IQ+ FPLG
Sbjct  130  ESVILTAVVVIGLTLYTFWAAKRGHDFNFLGPFLAGAILVLFVFALIQILFPLG  183



>dbj|BAK00103.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=250

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 127/190 (67%), Gaps = 7/190 (4%)
 Frame = +3

Query  69   MYGFER---VSSSYDGGMKGDIEEGTLYPGIGYGENQLRWGFIRKVYGIISAQIllttlv  239
            M+G+++   V +   GG         LYPG+     ++RW  IRK+Y I+S Q+LLT +V
Sbjct  1    MFGYQKGVDVEAGPSGGTGAAAPTRGLYPGMT-ESPEMRWALIRKIYVILSLQLLLTAVV  59

Query  240  agvtvlYAPLNEVLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLS  410
            A V V    +      SSA   L +FL+  PF++L PL+ Y+Q+HP+N + LG+FT ++S
Sbjct  60   AAVVVKVRAIPHFFVSSSAGLGLYIFLIIFPFIVLCPLYFYRQKHPVNLLLLGVFTVAIS  119

Query  411  FPVAVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililt  590
            F V ++CA T G ++LEA ILT+ VV +LT YTFWAA++G+DF+FLGP LF SL +L++ 
Sbjct  120  FAVGMTCAFTSGKVILEAAILTTVVVFSLTAYTFWAARRGQDFSFLGPFLFASLIMLLVF  179

Query  591  gfiQMFFPLG  620
            GFIQ+ FP+G
Sbjct  180  GFIQILFPMG  189



>ref|NP_193209.2| Bax inhibitor-1 family protein [Arabidopsis thaliana]
 gb|AEE83489.1| Bax inhibitor-1 family protein [Arabidopsis thaliana]
Length=235

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 115/175 (66%), Gaps = 7/175 (4%)
 Frame = +3

Query  114  KGDIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLK  284
            K DIE G    LYPG+    ++LRW FIRK+Y I+S Q+L+T  V+ V     P+ E + 
Sbjct  3    KSDIETGGGNELYPGMK-ESSELRWAFIRKLYSILSLQLLVTVGVSAVVYFVRPIPEFIT  61

Query  285  GSS---AlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
             +    A+   ++ LP LLLWPL  ++++HP+N I L +FT S+SF V + C+ + G IV
Sbjct  62   ETHRGLAVFFVILLLPLLLLWPLLAFEKKHPINCIVLSIFTLSISFSVGICCSLSQGRIV  121

Query  456  LEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LEA ILT+ +V  LT YTFWA K+G DF+FLGP LF +L I+++   +Q+F PLG
Sbjct  122  LEAAILTAVMVFGLTIYTFWAVKRGHDFSFLGPFLFGALLIILVFTLLQIFHPLG  176



>emb|CDM86339.1| unnamed protein product [Triticum aestivum]
Length=254

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 119/186 (64%), Gaps = 19/186 (10%)
 Frame = +3

Query  117  GDIEEGT---------------LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvt  251
            GDIE GT               LYP +     +LRW  IRK+Y I+S Q+LLT +VA V 
Sbjct  8    GDIEAGTSGGTAMAPPPAPAQVLYPWMA-ESPELRWALIRKIYVILSLQLLLTAVVAAVV  66

Query  252  vlYAPLNEVLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
            V    +      S A   L + ++  PF++L PL+ Y+Q+HP+N + LG+FT ++SF V 
Sbjct  67   VKVWAIPHFFVSSYAGLGLYISILIFPFIVLCPLYCYRQKHPVNLLLLGVFTVAISFAVG  126

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQ  602
            ++CA T G ++LEA ILT  VVL+LT YTFWA KKG+DF+FLGP LF SL +L++ GFIQ
Sbjct  127  MTCAFTSGKVILEAAILTMVVVLSLTAYTFWAVKKGKDFSFLGPFLFASLVMLLVFGFIQ  186

Query  603  MFFPLG  620
            + FPLG
Sbjct  187  ILFPLG  192



>ref|XP_002870289.1| hypothetical protein ARALYDRAFT_355323 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46548.1| hypothetical protein ARALYDRAFT_355323 [Arabidopsis lyrata subsp. 
lyrata]
Length=249

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 111/187 (59%), Gaps = 19/187 (10%)
 Frame = +3

Query  114  KGDIEEG---TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL-  281
            K DIE G    LYPG+    ++LRW FIRKVY I+S Q+LLT  V+ +     P+ E + 
Sbjct  3    KSDIETGGGNELYPGMK-ESSELRWAFIRKVYSILSLQMLLTVGVSALVYFVRPIPEFIT  61

Query  282  ---KGSSAlllflvflpflllwplHV-----------YQQRHPLNFIFLGLFTASLSFPV  419
               +G +   + L+      +  LH+           ++++HP+N I L +FT S+SF V
Sbjct  62   ETHRGLAVFFVILILPFLRYVSFLHISFFFVLWPLLAFEKKHPINCIVLSIFTLSISFAV  121

Query  420  AVSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfi  599
             + C+ + G IVLEA ILTS +V  LT YTFWA K+G DF+FLGP LF +L I++    +
Sbjct  122  GICCSLSKGRIVLEAAILTSVMVFGLTIYTFWAVKRGHDFSFLGPFLFGALLIILAFTLL  181

Query  600  QMFFPLG  620
            Q+F PLG
Sbjct  182  QIFHPLG  188



>gb|ABR16790.1| unknown [Picea sitchensis]
Length=244

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 105/176 (60%), Gaps = 5/176 (3%)
 Frame = +3

Query  108  GMKGDIEEG--TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL  281
            G   D+E G   LYP     E  LRW FIRK+Y I++ Q+LLT  VA V V   P+    
Sbjct  7    GPYADLETGNSALYPAQASDEIPLRWAFIRKIYSILTIQLLLTIAVASVVVFVRPVAHFF  66

Query  282  KGSSAlllflvflpflllwp---lHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
              + A L   +F     L     L+ Y Q+HP+N+I L  FT  + F V ++CA T G +
Sbjct  67   VSTPAGLALYIFAIIFPLILIWPLYYYSQKHPVNYILLATFTVFMGFSVGLTCAFTAGKV  126

Query  453  VLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            +LE+ ILT+ VV++LT YTFWAAK+G DF+FL PILF    +L++   IQ+F PLG
Sbjct  127  ILESAILTAVVVVSLTLYTFWAAKRGHDFSFLAPILFAGFMVLLVFILIQIFIPLG  182



>ref|NP_001151352.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays]
 gb|ACG42484.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays]
Length=250

 Score =   114 bits (285),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 118/175 (67%), Gaps = 8/175 (5%)
 Frame = +3

Query  117  GDIEEG----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL-  281
             D E G     LYP +   + +LRW FIRKVY I+S Q+LLT  VA V V   P+     
Sbjct  15   SDAETGQAARPLYPMM-LEDPRLRWAFIRKVYSILSIQMLLTVAVAAVVVFVRPVALFFV  73

Query  282  --KGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
               G   L +FL+ LPF++L PL+ Y Q HP+N + LGLFT ++SF V ++CA T G ++
Sbjct  74   STPGGFGLYIFLLILPFIVLCPLYYYYQHHPVNLLLLGLFTVAISFAVGLTCAFTKGEVI  133

Query  456  LEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LE+ +LT+AVVL+LT YTFWAAK+G DF+FLGP LF ++ IL+L   IQ+FFPLG
Sbjct  134  LESAVLTAAVVLSLTAYTFWAAKRGHDFSFLGPFLFAAVMILMLFALIQLFFPLG  188



>gb|AFW67649.1| transmembrane BAX inhibitor motif protein-containing protein 
4 [Zea mays]
Length=250

 Score =   114 bits (285),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 118/175 (67%), Gaps = 8/175 (5%)
 Frame = +3

Query  117  GDIEEG----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL-  281
             D E G     LYP +   + +LRW FIRKVY I+S Q+LLT  VA V V   P+     
Sbjct  15   SDAETGQAARPLYPMM-LEDPRLRWAFIRKVYSILSIQMLLTVAVAAVVVYVRPVALFFV  73

Query  282  --KGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
               G   L +FL+ LPF++L PL+ Y Q HP+N + LGLFT ++SF V ++CA T G ++
Sbjct  74   STPGGFGLYIFLLILPFIVLCPLYYYYQHHPVNLLLLGLFTVAISFAVGLTCAFTKGEVI  133

Query  456  LEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LE+ +LT+AVVL+LT YTFWAAK+G DF+FLGP LF ++ IL+L   IQ+FFPLG
Sbjct  134  LESAVLTAAVVLSLTAYTFWAAKRGHDFSFLGPFLFAAVMILMLFALIQLFFPLG  188



>ref|XP_002461535.1| hypothetical protein SORBIDRAFT_02g004350 [Sorghum bicolor]
 gb|EER98056.1| hypothetical protein SORBIDRAFT_02g004350 [Sorghum bicolor]
Length=248

 Score =   114 bits (285),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 122/186 (66%), Gaps = 15/186 (8%)
 Frame = +3

Query  105  GGMKG-DIEEGT----------LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvt  251
            G  KG D+E GT          LYPG+     +LRW  IRK+Y I+S Q+LLT +VA V 
Sbjct  3    GYQKGVDVEAGTSAATGGGARQLYPGMQ-ESPELRWALIRKIYVILSLQLLLTAVVAAVV  61

Query  252  vlYAPLNEVLKGSSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVA  422
            V    +      ++A   L +FL+ LPF++L PL+ Y ++HP+N I LGLFT ++SF V 
Sbjct  62   VKVRAIPHFFTTTNAGLGLYIFLIILPFIVLCPLYFYHEKHPVNLILLGLFTVAISFSVG  121

Query  423  VSCANTDGAIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQ  602
            ++CA T G ++LE+ ILT+ VVL+LT YTFWA  +G+DF+FLGP LF SL +L++   IQ
Sbjct  122  LTCAFTSGKVILESAILTTVVVLSLTAYTFWAVNRGKDFSFLGPFLFASLIVLLVFALIQ  181

Query  603  MFFPLG  620
            + FPLG
Sbjct  182  ILFPLG  187



>ref|XP_004981803.1| PREDICTED: BI1-like protein-like [Setaria italica]
Length=250

 Score =   114 bits (285),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 117/175 (67%), Gaps = 8/175 (5%)
 Frame = +3

Query  117  GDIEEG----TLYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL-  281
            GD E G     LYP +   + +LRW FIRKVY I+S Q+LLT  VA V V   P+     
Sbjct  15   GDAEAGQAARPLYPMM-LEDPRLRWSFIRKVYSILSIQMLLTVAVAAVVVYVRPVALFFV  73

Query  282  --KGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIV  455
               G   L +FL+ LPF++L PL+ Y Q HP+N + LGLFT ++SF V ++CA T G ++
Sbjct  74   STPGGFGLYIFLIILPFIVLCPLYYYYQHHPVNLLLLGLFTVAISFAVGLTCAFTKGQVI  133

Query  456  LEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            LE+ ILTS VV++LT YTFWAAK+G DF+FLGP LF  + IL++   IQ+FFPLG
Sbjct  134  LESAILTSVVVVSLTAYTFWAAKRGHDFSFLGPFLFAGVMILVVFSLIQLFFPLG  188



>ref|XP_010923521.1| PREDICTED: BI1-like protein [Elaeis guineensis]
Length=243

 Score =   113 bits (283),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 112/176 (64%), Gaps = 11/176 (6%)
 Frame = +3

Query  120  DIEEGT----LYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVL-  281
            DIE G     LYP +   EN Q+RW F+RKVY I+  QILLT  VA V +   P++  L 
Sbjct  8    DIEAGVGGGALYPNMI--ENPQIRWAFVRKVYTIVVIQILLTIAVACVVIFVPPISRFLL  65

Query  282  ---KGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAI  452
                 S A+L+ +   P L++ P+  +++RHP+N + L LFT  +S  V ++CA   G +
Sbjct  66   ARTPASLAVLILISIAPLLVMLPMIYFRERHPINLVLLILFTICISLTVGLACATRSGKV  125

Query  453  VLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            +LEA  LT+ VV+ LT YTFWAAK+G DFNFLGP LF +L +L++  F+Q+F P G
Sbjct  126  ILEAASLTAVVVVGLTMYTFWAAKRGHDFNFLGPFLFAALLVLMIYCFVQIFIPFG  181



>ref|XP_009419748.1| PREDICTED: BI1-like protein [Musa acuminata subsp. malaccensis]
Length=245

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 117/173 (68%), Gaps = 6/173 (3%)
 Frame = +3

Query  117  GDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKGS  290
            G +E G   LYP +     +LRW FIRK+Y I+SAQ+L+T  VA   V   P++     S
Sbjct  12   GGVEAGIRALYP-VMLEPPELRWSFIRKIYSILSAQMLITVAVAAAVVSIHPVSHFFVSS  70

Query  291  SA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVLE  461
            SA   L +FL+ LPF ++ PL+ Y Q +PLN++ LG+FT SL F V ++CA T G ++LE
Sbjct  71   SAGLGLYVFLIILPFFVICPLYYYYQHYPLNYLLLGIFTVSLGFAVGLTCAFTSGKVILE  130

Query  462  ALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            +++LT+ VV++LT YTFWAA +  DF FLGP LF+S+ IL + G IQ+ FP+G
Sbjct  131  SVVLTALVVVSLTIYTFWAAARAYDFTFLGPFLFSSIMILFVFGLIQVLFPVG  183



>ref|XP_008786053.1| PREDICTED: BI1-like protein [Phoenix dactylifera]
Length=243

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 112/178 (63%), Gaps = 11/178 (6%)
 Frame = +3

Query  102  DGGMKGDIEEGTLYPGIGYGEN-QLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEV  278
            + GM G    G LYP +   EN Q+RW F+RKVY I+  QILLT  VA V +    ++  
Sbjct  10   EAGMGG----GALYPNMM--ENPQIRWAFVRKVYTIVVIQILLTIAVACVVIFVPAISRF  63

Query  279  L----KGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDG  446
            L      S A+ + ++  PFL++ P+  ++QRHP+N I L LFT  +S  V ++CA   G
Sbjct  64   LLAHTPASLAVFILIIIAPFLVMLPMIYFRQRHPINLILLMLFTVCISLTVGLACATRSG  123

Query  447  AIVLEALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
             ++LEA  LT  VV+ LT YTFWAAK+G DFNFLGP LF +L +L++  FIQ+F P G
Sbjct  124  KVILEAASLTVVVVIGLTLYTFWAAKRGHDFNFLGPFLFAALLVLMIYCFIQIFIPFG  181



>gb|KJB23001.1| hypothetical protein B456_004G077400 [Gossypium raimondii]
Length=172

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 97/152 (64%), Gaps = 6/152 (4%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            KGD E G   LYP +     +LRW FIRKVY I++ Q+L T  VA   V   P+      
Sbjct  8    KGDAEAGPQPLYPMM-LEPPELRWAFIRKVYSIVALQLLATAGVAATVVFVHPIARFFVS  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF+ L PL+ + Q+HP N++ LG FT SL+F + ++CA T G ++L
Sbjct  67   TGAGLALYMVLIVTPFITLCPLYYFHQKHPWNYLLLGTFTISLAFAIGLTCAFTQGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGP  554
            EA ILT+ VV+ LT YTFWAAK+G DF+FLGP
Sbjct  127  EAAILTATVVVGLTLYTFWAAKRGHDFSFLGP  158



>ref|XP_009370780.1| PREDICTED: BI1-like protein [Pyrus x bretschneideri]
Length=245

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 113/174 (65%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            K D E G   LYP +     +LRW FIRK+Y I++ Q+L T  VA V V   P+      
Sbjct  11   KSDPEAGARPLYPTM-LESPELRWSFIRKIYAIVAMQLLATIAVAAVVVSVRPVAHFFVS  69

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF++L PL+ Y Q+HP+N++ LG+FT SL+  V ++CA T G ++L
Sbjct  70   TGAGLALYIVLIITPFIVLCPLYYYHQKHPVNYLLLGIFTLSLACVVGLTCAFTSGKVIL  129

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGPilftslfililtgfiQMFFPLG  620
            E++ILT+ VV+ LT YTFWAA++G DFNFLGP L  ++ +L +   IQ+ FPLG
Sbjct  130  ESVILTAVVVIGLTLYTFWAARRGHDFNFLGPFLTGAILVLFVFALIQILFPLG  183



>gb|KDO74902.1| hypothetical protein CISIN_1g0265232mg, partial [Citrus sinensis]
Length=116

 Score =   108 bits (269),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 93/116 (80%), Gaps = 3/116 (3%)
 Frame = +3

Query  69   MYGFERVSSSYDGGMKGDIEEGT---LYPGIGYGENQLRWGFIRKVYGIISAQIllttlv  239
            M G+E V S  DG  + D+E G    LYPG+ YGENQLRWGFIRKVYGI++AQI+LTTLV
Sbjct  1    MLGYEGVRSKDDGKFEVDLEGGDGERLYPGLSYGENQLRWGFIRKVYGILTAQIVLTTLV  60

Query  240  agvtvlYAPLNEVLKGSSAlllflvflpflllwplHVYQQRHPLNFIFLGLFTASL  407
            + +TVLY P+N++L+G+S LLLFL  LPF+LLWPLHVY Q+HP+N I LGLFT SL
Sbjct  61   SSITVLYNPINDLLRGNSGLLLFLSILPFILLWPLHVYHQKHPVNLIVLGLFTVSL  116



>gb|KJB23002.1| hypothetical protein B456_004G077400 [Gossypium raimondii]
Length=187

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 97/152 (64%), Gaps = 6/152 (4%)
 Frame = +3

Query  114  KGDIEEGT--LYPGIGYGENQLRWGFIRKVYGIISAQIllttlvagvtvlYAPLNEVLKG  287
            KGD E G   LYP +     +LRW FIRKVY I++ Q+L T  VA   V   P+      
Sbjct  8    KGDAEAGPQPLYPMM-LEPPELRWAFIRKVYSIVALQLLATAGVAATVVFVHPIARFFVS  66

Query  288  SSA---lllflvflpflllwplHVYQQRHPLNFIFLGLFTASLSFPVAVSCANTDGAIVL  458
            + A   L + L+  PF+ L PL+ + Q+HP N++ LG FT SL+F + ++CA T G ++L
Sbjct  67   TGAGLALYMVLIVTPFITLCPLYYFHQKHPWNYLLLGTFTISLAFAIGLTCAFTQGKVIL  126

Query  459  EALILTSAVVLALTGYTFWAAKKGRDFNFLGP  554
            EA ILT+ VV+ LT YTFWAAK+G DF+FLGP
Sbjct  127  EAAILTATVVVGLTLYTFWAAKRGHDFSFLGP  158



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950