BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP007G05 658 bp,

Length=623
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011470186.1|  PREDICTED: cytochrome b5 isoform E                 168   4e-49   Fragaria vesca subsp. vesca
ref|XP_007039163.1|  Cytochrome B5, n2,ATCB5-E,CB5-E isoform 1          167   1e-48   Theobroma cacao [chocolate]
ref|XP_006444773.1|  hypothetical protein CICLE_v10022828mg             166   2e-48   Citrus clementina
ref|XP_007218582.1|  hypothetical protein PRUPE_ppa013232mg             164   1e-47   Prunus persica
ref|XP_007039165.1|  Cytochrome B5, n2,ATCB5-E,CB5-E isoform 3          164   2e-47   Theobroma cacao [chocolate]
ref|XP_010692750.1|  PREDICTED: cytochrome b5-like                      163   2e-47   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_008381360.1|  PREDICTED: cytochrome b5-like                      163   4e-47   Malus domestica [apple tree]
ref|XP_008234680.1|  PREDICTED: cytochrome b5 isoform A                 162   8e-47   Prunus mume [ume]
gb|AFP55583.1|  yellow stripe-like protein                              174   2e-46   Rosa rugosa [Japanese rose]
gb|AEC11004.1|  cytochrome b5                                           161   2e-46   Camellia sinensis [black tea]
ref|XP_009351942.1|  PREDICTED: cytochrome b5 isoform A-like            161   2e-46   Pyrus x bretschneideri [bai li]
ref|XP_010090895.1|  Cytochrome b5 isoform 1                            160   3e-46   Morus notabilis
ref|NP_001281054.1|  cytochrome b5-like                                 160   4e-46   Malus domestica [apple tree]
gb|KJB46858.1|  hypothetical protein B456_008G266200                    161   4e-46   Gossypium raimondii
ref|XP_006367355.1|  PREDICTED: cytochrome b5 isoform A-like            160   5e-46   Solanum tuberosum [potatoes]
ref|XP_011084546.1|  PREDICTED: cytochrome b5 isoform E-like            160   5e-46   Sesamum indicum [beniseed]
gb|KJB46854.1|  hypothetical protein B456_008G266200                    160   6e-46   Gossypium raimondii
ref|XP_009798397.1|  PREDICTED: cytochrome b5 isoform A-like            159   1e-45   Nicotiana sylvestris
ref|XP_010671362.1|  PREDICTED: cytochrome b5 isoform E                 159   1e-45   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009375446.1|  PREDICTED: cytochrome b5-like                      158   3e-45   Pyrus x bretschneideri [bai li]
ref|XP_002518220.1|  cytochrome B5 isoform 1, putative                  157   4e-45   Ricinus communis
ref|XP_010318050.1|  PREDICTED: cytochrome b5 isoform A                 157   4e-45   
ref|NP_001235088.1|  uncharacterized protein LOC100305929               157   5e-45   Glycine max [soybeans]
ref|XP_009803510.1|  PREDICTED: cytochrome b5-like                      157   5e-45   Nicotiana sylvestris
ref|XP_010933787.1|  PREDICTED: cytochrome b5 isoform E-like            157   5e-45   Elaeis guineensis
ref|XP_009796903.1|  PREDICTED: cytochrome b5 isoform A-like            157   6e-45   Nicotiana sylvestris
ref|XP_006577772.1|  PREDICTED: uncharacterized protein LOC100499...    157   6e-45   Glycine max [soybeans]
ref|XP_009593163.1|  PREDICTED: cytochrome b5 isoform A                 157   9e-45   Nicotiana tomentosiformis
gb|KJB19874.1|  hypothetical protein B456_003G122800                    157   1e-44   Gossypium raimondii
gb|AFK43559.1|  unknown                                                 156   1e-44   Lotus japonicus
ref|XP_004306632.1|  PREDICTED: cytochrome b5                           156   1e-44   Fragaria vesca subsp. vesca
ref|XP_008351951.1|  PREDICTED: cytochrome b5 isoform A-like            156   1e-44   Malus domestica [apple tree]
ref|XP_004145949.1|  PREDICTED: cytochrome b5 isoform A-like            156   2e-44   
ref|NP_001236501.1|  uncharacterized protein LOC100499823               156   2e-44   Glycine max [soybeans]
ref|XP_010252345.1|  PREDICTED: cytochrome b5 isoform A                 155   2e-44   Nelumbo nucifera [Indian lotus]
ref|XP_011075921.1|  PREDICTED: cytochrome b5 isoform E                 155   2e-44   Sesamum indicum [beniseed]
ref|XP_006493156.1|  PREDICTED: cytochrome b5 isoform A-like isof...    155   2e-44   Citrus sinensis [Valencia orange]
gb|EYU45298.1|  hypothetical protein MIMGU_mgv1a016099mg                155   3e-44   Erythranthe guttata [common monkey flower]
gb|AFK39502.1|  unknown                                                 155   3e-44   Medicago truncatula
ref|XP_007136483.1|  hypothetical protein PHAVU_009G048900g             155   3e-44   Phaseolus vulgaris [French bean]
ref|XP_006849131.1|  hypothetical protein AMTR_s00027p00071500          155   4e-44   Amborella trichopoda
ref|XP_004230012.1|  PREDICTED: cytochrome b5                           155   4e-44   Solanum lycopersicum
ref|XP_008437642.1|  PREDICTED: cytochrome b5 isoform A                 155   5e-44   Cucumis melo [Oriental melon]
ref|XP_009607109.1|  PREDICTED: cytochrome b5-like                      154   7e-44   Nicotiana tomentosiformis
gb|AJO70762.1|  cytochrome b5                                           154   8e-44   Catharanthus roseus [chatas]
emb|CDY20247.1|  BnaC09g29920D                                          156   8e-44   Brassica napus [oilseed rape]
gb|KHG21565.1|  Cytochrome b5                                           154   8e-44   Gossypium arboreum [tree cotton]
ref|XP_009602193.1|  PREDICTED: cytochrome b5 isoform A-like            155   9e-44   Nicotiana tomentosiformis
gb|KHN23327.1|  Cytochrome b5 isoform 1                                 154   9e-44   Glycine soja [wild soybean]
ref|XP_003602315.1|  YSL transporter                                    166   9e-44   
gb|AAT84458.1|  cytochrome b5 isoform Cb5-A                             154   1e-43   Vernicia fordii [tung oil tree]
ref|XP_010520941.1|  PREDICTED: cytochrome b5                           154   1e-43   Tarenaya hassleriana [spider flower]
gb|EYU19677.1|  hypothetical protein MIMGU_mgv1a016108mg                154   1e-43   Erythranthe guttata [common monkey flower]
ref|XP_006350625.1|  PREDICTED: metal-nicotianamine transporter Y...    165   2e-43   
sp|P40934.1|CYB5_BRAOB  RecName: Full=Cytochrome b5                     152   4e-43   Brassica oleracea var. botrytis [cauliflower]
gb|AFK36070.1|  unknown                                                 152   5e-43   Lotus japonicus
ref|NP_200168.1|  cytochrome B5 isoform E                               152   8e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006401690.1|  hypothetical protein EUTSA_v10014996mg             152   9e-43   Eutrema salsugineum
ref|XP_009127155.1|  PREDICTED: cytochrome b5-like                      152   9e-43   Brassica rapa
ref|XP_002273913.1|  PREDICTED: cytochrome b5 isoform E                 151   1e-42   Vitis vinifera
gb|KDP22680.1|  hypothetical protein JCGZ_02465                         151   1e-42   Jatropha curcas
emb|CDY14370.1|  BnaA10g06850D                                          152   1e-42   Brassica napus [oilseed rape]
emb|CAA04703.1|  cytochome b5                                           151   1e-42   Olea europaea
gb|KHG25542.1|  Cytochrome b5                                           152   1e-42   Gossypium arboreum [tree cotton]
ref|XP_006441191.1|  hypothetical protein CICLE_v10022811mg             151   1e-42   Citrus clementina
ref|XP_006281477.1|  hypothetical protein CARUB_v10027561mg             151   2e-42   Capsella rubella
ref|XP_009119906.1|  PREDICTED: cytochrome b5                           150   2e-42   Brassica rapa
gb|KJB46876.1|  hypothetical protein B456_008G127700                    150   2e-42   Gossypium raimondii
gb|ADB85108.1|  cytochrome b5                                           150   2e-42   Jatropha curcas
ref|XP_010482757.1|  PREDICTED: cytochrome b5 isoform A-like            150   3e-42   Camelina sativa [gold-of-pleasure]
emb|CDP05012.1|  unnamed protein product                                150   3e-42   Coffea canephora [robusta coffee]
gb|AAM28288.1|  cytochrome b5                                           150   3e-42   Ananas comosus
gb|AFK40091.1|  unknown                                                 150   3e-42   Medicago truncatula
ref|XP_007218583.1|  hypothetical protein PRUPE_ppa013234mg             150   4e-42   Prunus persica
gb|KFK26373.1|  hypothetical protein AALP_AA8G240100                    150   5e-42   Arabis alpina [alpine rockcress]
ref|XP_011093011.1|  PREDICTED: cytochrome b5                           149   5e-42   Sesamum indicum [beniseed]
ref|XP_006339753.1|  PREDICTED: cytochrome b5-like                      149   6e-42   Solanum tuberosum [potatoes]
gb|EMS59648.1|  Cytochrome b5                                           149   6e-42   Triticum urartu
gb|EMT06977.1|  Cytochrome b5                                           149   8e-42   Aegilops tauschii
ref|XP_002864250.1|  ATB5-A                                             149   1e-41   Arabidopsis lyrata subsp. lyrata
ref|XP_008790560.1|  PREDICTED: cytochrome b5 isoform A-like            148   2e-41   Phoenix dactylifera
ref|XP_009397516.1|  PREDICTED: cytochrome b5 isoform A-like            148   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
gb|KGN56742.1|  hypothetical protein Csa_3G131950                       148   2e-41   Cucumis sativus [cucumbers]
ref|XP_004138957.1|  PREDICTED: cytochrome b5 isoform B-like            148   3e-41   Cucumis sativus [cucumbers]
ref|XP_008233085.1|  PREDICTED: cytochrome b5-like                      148   3e-41   Prunus mume [ume]
ref|XP_004510632.1|  PREDICTED: cytochrome b5-like isoform X1           148   3e-41   Cicer arietinum [garbanzo]
ref|XP_009132870.1|  PREDICTED: cytochrome b5 isoform B                 147   4e-41   Brassica rapa
ref|XP_010919339.1|  PREDICTED: cytochrome b5 isoform E                 147   4e-41   Elaeis guineensis
dbj|BAK03168.1|  predicted protein                                      147   4e-41   Hordeum vulgare subsp. vulgare [barley]
ref|XP_010445931.1|  PREDICTED: cytochrome b5 isoform A-like            147   4e-41   Camelina sativa [gold-of-pleasure]
ref|XP_008438367.1|  PREDICTED: cytochrome b5 isoform B-like            147   5e-41   Cucumis melo [Oriental melon]
gb|EPS71800.1|  hypothetical protein M569_02962                         147   6e-41   Genlisea aurea
ref|XP_009361312.1|  PREDICTED: cytochrome b5 isoform A                 147   6e-41   Pyrus x bretschneideri [bai li]
ref|XP_010442925.1|  PREDICTED: cytochrome b5 isoform A                 147   8e-41   Camelina sativa [gold-of-pleasure]
ref|XP_008376183.1|  PREDICTED: cytochrome b5-like                      146   1e-40   Malus domestica [apple tree]
ref|XP_006645329.1|  PREDICTED: cytochrome b5-like                      146   1e-40   Oryza brachyantha
ref|XP_008376797.1|  PREDICTED: cytochrome b5                           146   1e-40   Malus domestica [apple tree]
gb|ACG37757.1|  cytochrome b5                                           146   1e-40   Zea mays [maize]
ref|XP_008457249.1|  PREDICTED: cytochrome b5 isoform B-like            146   2e-40   Cucumis melo [Oriental melon]
gb|ACG44497.1|  cytochrome b5                                           146   2e-40   Zea mays [maize]
ref|XP_004133998.1|  PREDICTED: cytochrome b5 isoform B-like            148   2e-40   Cucumis sativus [cucumbers]
ref|NP_001169183.1|  uncharacterized protein LOC100383035               145   2e-40   Zea mays [maize]
ref|XP_010107764.1|  putative cytochrome b5 isoform 2                   145   2e-40   Morus notabilis
ref|XP_002881239.1|  B5 #4                                              145   2e-40   Arabidopsis lyrata subsp. lyrata
gb|KJB09607.1|  hypothetical protein B456_001G152300                    145   2e-40   Gossypium raimondii
ref|XP_003574201.1|  PREDICTED: cytochrome b5                           145   3e-40   Brachypodium distachyon [annual false brome]
ref|XP_009334383.1|  PREDICTED: cytochrome b5-like                      145   3e-40   Pyrus x bretschneideri [bai li]
ref|NP_180831.1|  cytochrome B5 isoform B                               145   3e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010048740.1|  PREDICTED: cytochrome b5 isoform A                 144   5e-40   Eucalyptus grandis [rose gum]
gb|KHN06340.1|  Cytochrome b5 isoform 1                                 145   6e-40   Glycine soja [wild soybean]
gb|AFX82679.1|  cytochrome b5                                           144   6e-40   synthetic construct
ref|XP_010555748.1|  PREDICTED: cytochrome b5 isoform E-like            144   7e-40   Tarenaya hassleriana [spider flower]
ref|XP_006295218.1|  hypothetical protein CARUB_v10024300mg             144   7e-40   Capsella rubella
gb|ACG47454.1|  cytochrome b5                                           144   9e-40   Zea mays [maize]
gb|ABK93631.1|  unknown                                                 144   1e-39   Populus trichocarpa [western balsam poplar]
emb|CDX79471.1|  BnaC03g18070D                                          144   1e-39   Brassica napus [oilseed rape]
ref|XP_010469554.1|  PREDICTED: cytochrome b5 isoform B                 144   1e-39   Camelina sativa [gold-of-pleasure]
ref|NP_001236891.1|  uncharacterized protein LOC100305546               144   1e-39   Glycine max [soybeans]
ref|XP_011043723.1|  PREDICTED: cytochrome b5-like                      144   1e-39   Populus euphratica
gb|ABA54491.1|  cytochrome b5 type 28                                   144   1e-39   Crepis alpina
ref|XP_008793730.1|  PREDICTED: cytochrome b5-like                      143   1e-39   Phoenix dactylifera
gb|ABK23699.1|  unknown                                                 143   1e-39   Picea sitchensis
emb|CDY23792.1|  BnaC04g43300D                                          143   1e-39   Brassica napus [oilseed rape]
ref|NP_001236379.1|  uncharacterized protein LOC100500069               144   2e-39   Glycine max [soybeans]
ref|NP_001045534.1|  Os01g0971500                                       143   2e-39   
emb|CDX84725.1|  BnaA03g15050D                                          143   2e-39   Brassica napus [oilseed rape]
ref|XP_002464365.1|  hypothetical protein SORBIDRAFT_01g017020          143   2e-39   Sorghum bicolor [broomcorn]
ref|XP_006598693.1|  PREDICTED: uncharacterized protein LOC100305...    143   2e-39   Glycine max [soybeans]
ref|XP_006410400.1|  hypothetical protein EUTSA_v10017407mg             142   3e-39   Eutrema salsugineum
ref|XP_004982596.1|  PREDICTED: cytochrome b5-like isoform X1           142   4e-39   Setaria italica
ref|XP_010413956.1|  PREDICTED: cytochrome b5 isoform B-like            142   4e-39   Camelina sativa [gold-of-pleasure]
ref|XP_002318471.2|  cytochrome b5 isoform Cb5-C family protein         142   4e-39   Populus trichocarpa [western balsam poplar]
ref|XP_004240459.1|  PREDICTED: cytochrome b5-like                      142   5e-39   Solanum lycopersicum
ref|NP_001054434.1|  Os05g0108800                                       142   5e-39   
gb|ACG48334.1|  cytochrome b5                                           142   6e-39   Zea mays [maize]
ref|XP_010929918.1|  PREDICTED: cytochrome b5-like                      141   7e-39   Elaeis guineensis
ref|XP_009141270.1|  PREDICTED: cytochrome b5 isoform B                 141   9e-39   Brassica rapa
ref|XP_006653959.1|  PREDICTED: cytochrome b5-like                      141   9e-39   Oryza brachyantha
emb|CAA53366.1|  cytochrome b5                                          141   1e-38   Oryza sativa [red rice]
ref|XP_002457023.1|  hypothetical protein SORBIDRAFT_03g047300          141   1e-38   Sorghum bicolor [broomcorn]
ref|XP_009143942.1|  PREDICTED: cytochrome b5 isoform B-like            142   1e-38   Brassica rapa
ref|XP_009599430.1|  PREDICTED: cytochrome b5-like                      141   1e-38   Nicotiana tomentosiformis
ref|XP_010509977.1|  PREDICTED: cytochrome b5 isoform B-like            141   1e-38   Camelina sativa [gold-of-pleasure]
ref|XP_009766798.1|  PREDICTED: cytochrome b5-like                      141   1e-38   Nicotiana sylvestris
ref|NP_001239968.1|  uncharacterized protein LOC100788796               141   2e-38   Glycine max [soybeans]
ref|XP_009393770.1|  PREDICTED: cytochrome b5 isoform B                 140   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS45540.1|  Cytochrome b5                                           140   2e-38   Triticum urartu
gb|ACG44032.1|  cytochrome b5                                           140   2e-38   Zea mays [maize]
gb|EPS57444.1|  hypothetical protein M569_17373                         140   2e-38   Genlisea aurea
ref|XP_007140599.1|  hypothetical protein PHAVU_008G125800g             140   2e-38   Phaseolus vulgaris [French bean]
emb|CAA50575.1|  cytochrome b5                                          140   2e-38   Nicotiana tabacum [American tobacco]
ref|XP_004247085.1|  PREDICTED: cytochrome b5                           140   2e-38   Solanum lycopersicum
ref|XP_009792131.1|  PREDICTED: cytochrome b5                           140   2e-38   Nicotiana sylvestris
ref|XP_008791612.1|  PREDICTED: cytochrome b5 isoform A                 140   3e-38   Phoenix dactylifera
dbj|BAJ94749.1|  predicted protein                                      140   3e-38   Hordeum vulgare subsp. vulgare [barley]
gb|KHN35403.1|  Cytochrome b5 isoform 1                                 140   3e-38   Glycine soja [wild soybean]
ref|XP_006443603.1|  hypothetical protein CICLE_v10022818mg             140   3e-38   Citrus clementina
emb|CDY47080.1|  BnaA03g12180D                                          140   4e-38   Brassica napus [oilseed rape]
ref|XP_006356775.1|  PREDICTED: cytochrome b5-like                      139   4e-38   Solanum tuberosum [potatoes]
gb|ACF84051.1|  unknown                                                 140   4e-38   Zea mays [maize]
emb|CDJ26519.1|  unnamed protein product                                140   4e-38   Triticum aestivum [Canadian hard winter wheat]
gb|ABA54490.1|  cytochrome b5 type 11                                   139   5e-38   Crepis alpina
ref|XP_009611133.1|  PREDICTED: cytochrome b5                           139   5e-38   Nicotiana tomentosiformis
ref|XP_010245991.1|  PREDICTED: cytochrome b5                           139   5e-38   Nelumbo nucifera [Indian lotus]
ref|XP_003565166.1|  PREDICTED: cytochrome b5                           139   6e-38   Brachypodium distachyon [annual false brome]
ref|XP_007049778.1|  Cytochrome B5, n4,ATCB5-B,CB5-B                    139   6e-38   Theobroma cacao [chocolate]
ref|XP_006352692.1|  PREDICTED: cytochrome b5-like                      139   9e-38   Solanum tuberosum [potatoes]
gb|ACG40422.1|  cytochrome b5                                           140   9e-38   Zea mays [maize]
gb|AFK34591.1|  unknown                                                 139   9e-38   Lotus japonicus
ref|NP_001136781.1|  uncharacterized protein LOC100216924               139   1e-37   Zea mays [maize]
ref|XP_008811745.1|  PREDICTED: cytochrome b5-like                      138   1e-37   Phoenix dactylifera
ref|XP_010264100.1|  PREDICTED: cytochrome b5                           138   1e-37   Nelumbo nucifera [Indian lotus]
gb|AET01997.2|  cytochrome b5-like heme/steroid-binding domain pr...    139   1e-37   Medicago truncatula
gb|AET01996.2|  cytochrome b5-like heme/steroid-binding domain pr...    139   1e-37   Medicago truncatula
gb|KEH18604.1|  cytochrome b5-like heme/steroid-binding domain pr...    139   2e-37   Medicago truncatula
ref|XP_003627519.1|  Cytochrome b5                                      138   2e-37   Medicago truncatula
ref|XP_003626585.1|  Cytochrome b5                                      138   2e-37   Medicago truncatula
ref|XP_008656842.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome b5      140   2e-37   Zea mays [maize]
ref|XP_004296652.1|  PREDICTED: cytochrome b5 isoform B                 138   2e-37   Fragaria vesca subsp. vesca
ref|XP_004133794.1|  PREDICTED: cytochrome b5-like                      138   2e-37   Cucumis sativus [cucumbers]
ref|XP_009371627.1|  PREDICTED: cytochrome b5-like                      138   2e-37   Pyrus x bretschneideri [bai li]
gb|AAT84460.1|  cytochrome b5 isoform Cb5-C                             137   2e-37   Vernicia fordii [tung oil tree]
dbj|BAJ92137.1|  predicted protein                                      137   3e-37   Hordeum vulgare subsp. vulgare [barley]
ref|XP_004971419.1|  PREDICTED: cytochrome b5-like                      137   4e-37   Setaria italica
gb|EMT13800.1|  Cytochrome b5                                           137   4e-37   Aegilops tauschii
ref|XP_009389266.1|  PREDICTED: cytochrome b5 isoform A-like            137   4e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006420893.1|  hypothetical protein CICLE_v10006192mg             137   4e-37   Citrus clementina
ref|XP_008372473.1|  PREDICTED: cytochrome b5                           137   5e-37   Malus domestica [apple tree]
ref|XP_009611358.1|  PREDICTED: cytochrome b5, seed isoform             137   5e-37   Nicotiana tomentosiformis
gb|EMS64911.1|  Cytochrome b5                                           137   6e-37   Triticum urartu
emb|CDY12180.1|  BnaC04g12100D                                          137   6e-37   Brassica napus [oilseed rape]
gb|AAT84459.1|  cytochrome b5 isoform Cb5-B                             136   6e-37   Vernicia fordii [tung oil tree]
ref|XP_009348240.1|  PREDICTED: cytochrome b5 isoform B-like            136   7e-37   Pyrus x bretschneideri [bai li]
ref|XP_006661960.1|  PREDICTED: cytochrome b5-like                      136   7e-37   Oryza brachyantha
ref|XP_010522424.1|  PREDICTED: cytochrome b5 isoform B                 136   7e-37   Tarenaya hassleriana [spider flower]
ref|XP_010100688.1|  Cytochrome b5, seed isoform                        136   7e-37   Morus notabilis
gb|KJB42467.1|  hypothetical protein B456_007G154500                    136   8e-37   Gossypium raimondii
ref|NP_001237928.1|  uncharacterized protein LOC100306380               136   8e-37   Glycine max [soybeans]
ref|NP_001065073.2|  Os10g0518200                                       136   8e-37   
ref|NP_199692.1|  cytochrome B5 isoform D                               136   9e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007223823.1|  hypothetical protein PRUPE_ppa013221mg             136   9e-37   Prunus persica
ref|XP_002323982.1|  hypothetical protein POPTR_0017s08140g             136   9e-37   Populus trichocarpa [western balsam poplar]
emb|CDY59638.1|  BnaAnng16110D                                          136   1e-36   Brassica napus [oilseed rape]
ref|XP_004242405.1|  PREDICTED: cytochrome b5-like                      136   1e-36   Solanum lycopersicum
ref|XP_007133998.1|  hypothetical protein PHAVU_010G010400g             136   1e-36   Phaseolus vulgaris [French bean]
ref|XP_002300176.1|  cytochrome b5 isoform 2 family protein             136   1e-36   Populus trichocarpa [western balsam poplar]
ref|XP_007201359.1|  hypothetical protein PRUPE_ppa013179mg             136   1e-36   Prunus persica
ref|XP_010552054.1|  PREDICTED: cytochrome b5-like                      135   1e-36   Tarenaya hassleriana [spider flower]
ref|XP_006395118.1|  hypothetical protein EUTSA_v10005107mg             135   1e-36   Eutrema salsugineum
emb|CDX86279.1|  BnaA06g29960D                                          135   2e-36   Brassica napus [oilseed rape]
ref|XP_003552132.1|  PREDICTED: cytochrome b5-like isoform X1           135   2e-36   Glycine max [soybeans]
ref|XP_002865680.1|  ATB5-B                                             135   2e-36   Arabidopsis lyrata subsp. lyrata
ref|XP_002321974.1|  cytochrome b5 isoform Cb5-C family protein         135   2e-36   Populus trichocarpa [western balsam poplar]
ref|XP_011041869.1|  PREDICTED: cytochrome b5-like                      135   2e-36   Populus euphratica
ref|XP_008437843.1|  PREDICTED: cytochrome b5-like                      135   2e-36   Cucumis melo [Oriental melon]
gb|KHG15837.1|  Cytochrome b5                                           135   2e-36   Gossypium arboreum [tree cotton]
gb|KDP26389.1|  hypothetical protein JCGZ_17547                         135   3e-36   Jatropha curcas
ref|XP_008380573.1|  PREDICTED: cytochrome b5-like                      135   3e-36   Malus domestica [apple tree]
ref|XP_010685005.1|  PREDICTED: cytochrome b5                           135   3e-36   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|EYU40608.1|  hypothetical protein MIMGU_mgv1a016092mg                135   3e-36   Erythranthe guttata [common monkey flower]
ref|XP_008376513.1|  PREDICTED: cytochrome b5 isoform B-like            135   3e-36   Malus domestica [apple tree]
ref|XP_002521096.1|  cytochrome B5 isoform 1, putative                  135   4e-36   Ricinus communis
gb|KHN37769.1|  Cytochrome b5                                           134   4e-36   Glycine soja [wild soybean]
gb|EEC67315.1|  hypothetical protein OsI_34332                          136   4e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_006601762.1|  PREDICTED: uncharacterized protein LOC100500...    134   4e-36   Glycine max [soybeans]
ref|XP_009403628.1|  PREDICTED: cytochrome b5 isoform B-like            134   4e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009374604.1|  PREDICTED: cytochrome b5-like                      134   4e-36   Pyrus x bretschneideri [bai li]
ref|XP_002265677.1|  PREDICTED: cytochrome b5                           134   4e-36   Vitis vinifera
emb|CDY19937.1|  BnaA09g03140D                                          134   4e-36   Brassica napus [oilseed rape]
ref|XP_006847492.1|  hypothetical protein AMTR_s00163p00076750          134   4e-36   Amborella trichopoda
ref|XP_002986043.1|  hypothetical protein SELMODRAFT_271829             134   5e-36   Selaginella moellendorffii
gb|ABA54489.1|  cytochrome b5 type 06                                   134   6e-36   Crepis alpina
gb|AJE26127.1|  nitrate reductase                                       134   6e-36   Salix matsudana [tortured willow]
ref|XP_010912953.1|  PREDICTED: cytochrome b5-like                      134   6e-36   Elaeis guineensis
gb|KHG05589.1|  Cytochrome b5                                           134   7e-36   Gossypium arboreum [tree cotton]
emb|CDX85364.1|  BnaC07g26750D                                          134   7e-36   Brassica napus [oilseed rape]
ref|XP_008224490.1|  PREDICTED: cytochrome b5 isoform B                 134   7e-36   Prunus mume [ume]
ref|XP_002893406.1|  B5 #6                                              134   8e-36   Arabidopsis lyrata subsp. lyrata
gb|ABK23501.1|  unknown                                                 134   8e-36   Picea sitchensis
ref|XP_010069046.1|  PREDICTED: cytochrome b5                           134   9e-36   Eucalyptus grandis [rose gum]
ref|XP_011044704.1|  PREDICTED: cytochrome b5 isoform X2                134   9e-36   Populus euphratica
ref|XP_004960538.1|  PREDICTED: cytochrome b5-like                      133   9e-36   Setaria italica
ref|XP_002439129.1|  hypothetical protein SORBIDRAFT_09g000970          133   1e-35   Sorghum bicolor [broomcorn]
ref|XP_010109733.1|  Cytochrome b5                                      133   1e-35   Morus notabilis
ref|XP_011044703.1|  PREDICTED: cytochrome b5 isoform X1                134   1e-35   Populus euphratica
ref|XP_008235483.1|  PREDICTED: cytochrome b5                           133   1e-35   Prunus mume [ume]
ref|XP_006304208.1|  hypothetical protein CARUB_v10010310mg             135   1e-35   Capsella rubella
gb|KDP20335.1|  hypothetical protein JCGZ_06421                         133   1e-35   Jatropha curcas
ref|XP_009151679.1|  PREDICTED: cytochrome B5 isoform D                 133   1e-35   Brassica rapa
emb|CDY61721.1|  BnaA04g27110D                                          133   1e-35   Brassica napus [oilseed rape]
gb|KJB37822.1|  hypothetical protein B456_006G222000                    132   2e-35   Gossypium raimondii
gb|ABK94417.1|  unknown                                                 133   2e-35   Populus trichocarpa [western balsam poplar]
ref|XP_002518143.1|  cytochrome B5 isoform 1, putative                  133   2e-35   
ref|XP_010477866.1|  PREDICTED: cytochrome b5-like                      133   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010460321.1|  PREDICTED: cytochrome b5-like isoform X2           133   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_009142432.1|  PREDICTED: cytochrome B5 isoform C-like            132   2e-35   Brassica rapa
ref|XP_003569109.1|  PREDICTED: cytochrome b5-like                      133   2e-35   Brachypodium distachyon [annual false brome]
emb|CDY00045.1|  BnaC09g02560D                                          133   2e-35   Brassica napus [oilseed rape]
ref|XP_010036819.1|  PREDICTED: cytochrome b5-like                      132   2e-35   Eucalyptus grandis [rose gum]
ref|XP_009334928.1|  PREDICTED: cytochrome b5-like                      132   2e-35   Pyrus x bretschneideri [bai li]
ref|XP_011089685.1|  PREDICTED: cytochrome b5-like                      132   2e-35   Sesamum indicum [beniseed]
ref|XP_010439683.1|  PREDICTED: cytochrome B5 isoform D                 132   2e-35   Camelina sativa [gold-of-pleasure]
gb|EYU39233.1|  hypothetical protein MIMGU_mgv1a016179mg                132   3e-35   Erythranthe guttata [common monkey flower]
gb|KJB06636.1|  hypothetical protein B456_001G233900                    132   4e-35   Gossypium raimondii
ref|XP_003569990.1|  PREDICTED: cytochrome b5 isoform A-like            132   4e-35   Brachypodium distachyon [annual false brome]
emb|CDX85016.1|  BnaC05g20390D                                          132   4e-35   Brassica napus [oilseed rape]
ref|XP_001770042.1|  predicted protein                                  132   5e-35   Physcomitrella patens
ref|XP_010499050.1|  PREDICTED: cytochrome b5 isoform B-like            132   5e-35   Camelina sativa [gold-of-pleasure]
ref|NP_001238196.1|  uncharacterized protein LOC100306652               132   5e-35   Glycine max [soybeans]
ref|XP_009111854.1|  PREDICTED: cytochrome B5 isoform D-like            132   5e-35   Brassica rapa
ref|XP_006279708.1|  hypothetical protein CARUB_v10027337mg             132   5e-35   Capsella rubella
ref|XP_010460320.1|  PREDICTED: cytochrome b5-like isoform X1           131   5e-35   Camelina sativa [gold-of-pleasure]
gb|KCW57256.1|  hypothetical protein EUGRSUZ_H00059                     134   6e-35   Eucalyptus grandis [rose gum]
ref|NP_001236788.1|  uncharacterized protein LOC100500611               130   6e-35   Glycine max [soybeans]
ref|XP_009115356.1|  PREDICTED: cytochrome b5 isoform A                 131   6e-35   Brassica rapa
ref|XP_003532293.1|  PREDICTED: cytochrome b5-like                      131   7e-35   Glycine max [soybeans]
gb|KJB37819.1|  hypothetical protein B456_006G222000                    131   7e-35   Gossypium raimondii
ref|NP_001047585.1|  Os02g0649800                                       131   8e-35   
ref|XP_008382631.1|  PREDICTED: cytochrome b5-like                      131   8e-35   Malus domestica [apple tree]
gb|KJB37820.1|  hypothetical protein B456_006G222000                    131   9e-35   
sp|O04354.1|CYB5_BOROF  RecName: Full=Cytochrome b5                     131   9e-35   
ref|XP_007051468.1|  Cytochrome B5, n2,ATCB5-E,CB5-E, putative          131   1e-34   
gb|KEH29077.1|  cytochrome b5-like heme/steroid-binding domain pr...    131   1e-34   
gb|EPS67151.1|  hypothetical protein M569_07627                         130   1e-34   
emb|CAA04702.1|  cytochrome b5                                          130   1e-34   
emb|CAA48240.1|  cytochrome b5                                          129   1e-34   
ref|XP_003604969.1|  Cytochrome b5                                      130   1e-34   
ref|XP_011089100.1|  PREDICTED: cytochrome b5-like                      130   1e-34   
ref|XP_004506597.1|  PREDICTED: cytochrome b5-like                      130   1e-34   
ref|XP_007147342.1|  hypothetical protein PHAVU_006G115900g             130   2e-34   
ref|XP_001764653.1|  predicted protein                                  130   2e-34   
gb|ACG33225.1|  cytochrome b5                                           130   2e-34   
gb|KHN07183.1|  Cytochrome b5                                           130   2e-34   
sp|P49097.1|CYB5_CUSRE  RecName: Full=Cytochrome b5                     130   3e-34   
ref|XP_002303038.1|  cytochrome b5 isoform Cb5-C family protein         130   3e-34   
gb|KFK31291.1|  hypothetical protein AALP_AA6G093400                    130   3e-34   
dbj|BAJ93859.1|  predicted protein                                      129   3e-34   
ref|XP_010069657.1|  PREDICTED: cytochrome b5                           129   4e-34   
emb|CDP03875.1|  unnamed protein product                                129   6e-34   
emb|CDX80035.1|  BnaA05g01210D                                          129   7e-34   
ref|XP_006397857.1|  hypothetical protein EUTSA_v10001679mg             129   8e-34   
ref|NP_173958.1|  cytochrome B5 isoform A                               128   1e-33   
gb|ABK94544.1|  unknown                                                 128   1e-33   
gb|AFK43806.1|  unknown                                                 128   1e-33   
ref|XP_010550884.1|  PREDICTED: cytochrome b5-like                      128   1e-33   
ref|XP_009142617.1|  PREDICTED: cytochrome B5 isoform C                 127   2e-33   
gb|KJB06638.1|  hypothetical protein B456_001G233900                    127   2e-33   
ref|XP_006648885.1|  PREDICTED: cytochrome b5-like                      127   4e-33   
gb|ABA54492.1|  cytochrome b5 type 56                                   126   5e-33   
gb|ACG25851.1|  cytochrome b5                                           126   5e-33   
gb|KJB26006.1|  hypothetical protein B456_004G225700                    125   6e-33   
ref|XP_010523828.1|  PREDICTED: cytochrome B5 isoform C-like            126   7e-33   
ref|XP_004953293.1|  PREDICTED: cytochrome b5 isoform A-like            126   9e-33   
ref|XP_009388909.1|  PREDICTED: cytochrome b5                           125   1e-32   
gb|AFK33484.1|  unknown                                                 125   1e-32   
ref|XP_009415974.1|  PREDICTED: cytochrome b5 isoform B-like            125   2e-32   
gb|EYU38867.1|  hypothetical protein MIMGU_mgv1a016071mg                125   2e-32   
ref|XP_002880257.1|  B5 #1                                              125   2e-32   
dbj|BAD43205.1|  putative cytochrome b5                                 124   3e-32   
gb|KFK28993.1|  hypothetical protein AALP_AA7G074900                    124   3e-32   
ref|XP_004140502.1|  PREDICTED: cytochrome b5 isoform A-like            124   4e-32   
ref|XP_007034387.1|  Cytochrome B5, n4,ATCB5-B,CB5-B                    124   4e-32   
ref|NP_182188.1|  cytochrome B5 isoform C                               124   4e-32   
gb|ABK22670.1|  unknown                                                 124   4e-32   
ref|XP_004494850.1|  PREDICTED: cytochrome b5 isoform A-like            124   4e-32   
ref|XP_002452836.1|  hypothetical protein SORBIDRAFT_04g033350          124   5e-32   
ref|NP_001288535.1|  uncharacterized protein LOC103627487               124   6e-32   
ref|XP_004144166.1|  PREDICTED: cytochrome b5-like                      123   7e-32   
ref|XP_010257977.1|  PREDICTED: cytochrome b5 isoform B-like            123   8e-32   
ref|XP_008445442.1|  PREDICTED: cytochrome B5 isoform D                 123   8e-32   
ref|XP_006295223.1|  hypothetical protein CARUB_v10024306mg             123   9e-32   
ref|XP_009628358.1|  PREDICTED: cytochrome b5 isoform B                 123   9e-32   
gb|KJB46878.1|  hypothetical protein B456_008G127700                    122   1e-31   
ref|XP_009786222.1|  PREDICTED: cytochrome b5 isoform B                 122   1e-31   
ref|XP_010532510.1|  PREDICTED: cytochrome b5                           122   2e-31   
ref|XP_008465053.1|  PREDICTED: cytochrome b5, seed isoform-like        122   2e-31   
ref|XP_004290210.1|  PREDICTED: cytochrome b5                           122   2e-31   
ref|XP_010260586.1|  PREDICTED: cytochrome b5 isoform B isoform X1      122   2e-31   
ref|XP_010506679.1|  PREDICTED: cytochrome B5 isoform C-like            122   3e-31   
gb|EMT17049.1|  Cytochrome b5                                           123   3e-31   
gb|KJB27468.1|  hypothetical protein B456_005G146500                    122   3e-31   
ref|XP_010507987.1|  PREDICTED: cytochrome B5 isoform C-like            122   3e-31   
ref|XP_004144383.1|  PREDICTED: cytochrome b5, seed isoform-like        122   3e-31   
ref|XP_010518344.1|  PREDICTED: cytochrome B5 isoform C                 122   4e-31   
ref|XP_006415913.1|  hypothetical protein EUTSA_v10009081mg             122   4e-31   
gb|KFK37426.1|  cytochrome b5                                           121   6e-31   
ref|XP_002972657.1|  hypothetical protein SELMODRAFT_148632             121   1e-30   
ref|XP_009356430.1|  PREDICTED: cytochrome b5                           120   1e-30   
ref|XP_002264175.1|  PREDICTED: cytochrome b5 isoform A                 120   1e-30   
gb|AFK48600.1|  unknown                                                 120   2e-30   
ref|XP_002533333.1|  cytochrome B5 isoform 1, putative                  120   2e-30   
gb|EPB83691.1|  hypothetical protein HMPREF1544_09541                   118   3e-30   
gb|EYU42285.1|  hypothetical protein MIMGU_mgv1a017250mg                118   3e-30   
ref|XP_002988153.1|  hypothetical protein SELMODRAFT_229336             119   3e-30   
ref|XP_004239033.1|  PREDICTED: cytochrome b5 isoform B                 119   3e-30   
gb|EPS63893.1|  hypothetical protein M569_10892                         119   5e-30   
ref|XP_011070917.1|  PREDICTED: cytochrome b5 isoform A                 119   6e-30   
gb|KDP28439.1|  hypothetical protein JCGZ_14210                         118   7e-30   
ref|XP_008459741.1|  PREDICTED: cytochrome b5 isoform A-like            118   8e-30   
ref|XP_010044383.1|  PREDICTED: cytochrome b5                           118   8e-30   
ref|XP_009386687.1|  PREDICTED: cytochrome b5-like                      118   9e-30   
ref|XP_006348668.1|  PREDICTED: cytochrome b5 isoform B-like            118   9e-30   
ref|XP_010091602.1|  putative cytochrome b5 isoform 2                   118   9e-30   
ref|XP_003614164.1|  Cytochrome b5                                      117   1e-29   
emb|CDS12559.1|  hypothetical protein LRAMOSA04753                      117   1e-29   
emb|CDY47078.1|  BnaA03g12200D                                          117   1e-29   
ref|XP_002512059.1|  cytochrome B5 isoform 1, putative                  117   1e-29   
gb|EIE82469.1|  hypothetical protein RO3G_07174                         117   1e-29   
emb|CDP00455.1|  unnamed protein product                                117   1e-29   
ref|XP_004490217.1|  PREDICTED: cytochrome b5-like                      117   1e-29   
ref|XP_010524689.1|  PREDICTED: cytochrome b5                           117   2e-29   
emb|CDH54286.1|  cytochrome b5                                          117   2e-29   
ref|XP_007045813.1|  Cytochrome B5, n6,ATCB5-A,CB5-A                    117   2e-29   
ref|XP_010464293.1|  PREDICTED: cytochrome b5-like                      117   2e-29   
gb|KJB46857.1|  hypothetical protein B456_008G266200                    116   2e-29   
gb|AAT84461.1|  cytochrome b5 isoform Cb5-D                             117   2e-29   
emb|CDH57385.1|  cytochrome b5                                          116   3e-29   
ref|XP_010680659.1|  PREDICTED: cytochrome b5 isoform A                 116   3e-29   
gb|KHG03127.1|  hypothetical protein F383_27157                         116   4e-29   
gb|KFK38164.1|  hypothetical protein AALP_AA3G077400                    116   4e-29   
emb|CDP08637.1|  unnamed protein product                                118   4e-29   
ref|XP_008360086.1|  PREDICTED: cytochrome b5-like                      116   6e-29   
gb|ACG49215.1|  cytochrome b5                                           116   6e-29   
ref|XP_010544869.1|  PREDICTED: cytochrome B5 isoform C                 115   7e-29   
ref|XP_008810951.1|  PREDICTED: cytochrome b5                           115   7e-29   
gb|KJB79809.1|  hypothetical protein B456_013G095300                    115   7e-29   
gb|KJB46855.1|  hypothetical protein B456_008G266200                    115   1e-28   
ref|XP_002884627.1|  hypothetical protein ARALYDRAFT_896865             115   1e-28   
ref|XP_008352951.1|  PREDICTED: cytochrome b5-like                      115   1e-28   
ref|XP_008339788.1|  PREDICTED: cytochrome b5                           115   1e-28   
ref|XP_010486251.1|  PREDICTED: cytochrome B5 isoform D-like            115   2e-28   
emb|CDS11312.1|  hypothetical protein LRAMOSA03575                      114   2e-28   
ref|XP_001644095.1|  hypothetical protein Kpol_505p14                   114   2e-28   
ref|XP_007153493.1|  hypothetical protein PHAVU_003G040400g             114   2e-28   
ref|XP_006437888.1|  hypothetical protein CICLE_v10033049mg             114   2e-28   
ref|XP_009382320.1|  PREDICTED: cytochrome b5 isoform A-like            114   2e-28   
gb|AGC26410.1|  CYB5                                                    114   2e-28   
dbj|BAK07446.1|  predicted protein                                      114   2e-28   
ref|XP_004297217.1|  PREDICTED: cytochrome b5 isoform A                 114   3e-28   
gb|ACG45610.1|  cytochrome b5                                           114   3e-28   
dbj|GAN02683.1|  conserved hypothetical protein                         113   4e-28   
ref|XP_011011719.1|  PREDICTED: cytochrome b5 isoform A                 113   5e-28   
ref|NP_001288487.1|  cytochrome b5                                      114   5e-28   
ref|XP_002314997.2|  cytochrome b5 isoform Cb5-D family protein         113   5e-28   
emb|CDO99453.1|  unnamed protein product                                114   5e-28   
gb|AAO86521.1|  cytochrome B5                                           113   6e-28   
ref|XP_010937875.1|  PREDICTED: cytochrome b5 isoform A                 113   6e-28   
gb|KDP41326.1|  hypothetical protein JCGZ_15733                         113   6e-28   
ref|XP_006856406.1|  hypothetical protein AMTR_s00047p00213630          113   8e-28   
ref|NP_001235769.1|  uncharacterized protein LOC100500537               112   8e-28   
gb|EMS58621.1|  Cytochrome b5                                           115   2e-27   
gb|EIE76242.1|  hypothetical protein RO3G_00946                         111   2e-27   
emb|CEP19529.1|  hypothetical protein                                   117   2e-27   
emb|CEI87779.1|  Putative Cytochrome-b5 reductase                       111   3e-27   
emb|CEG84248.1|  Putative Cytochrome-b5 reductase                       111   4e-27   
gb|KDO40571.1|  hypothetical protein CISIN_1g032745mg                   111   4e-27   
gb|EPS64889.1|  hypothetical protein M569_09892                         110   4e-27   
ref|XP_003559382.1|  PREDICTED: cytochrome b5                           111   5e-27   
gb|ACG41888.1|  cytochrome b5                                           111   5e-27   
emb|CDS06811.1|  hypothetical protein LRAMOSA09336                      110   5e-27   
ref|XP_002466437.1|  hypothetical protein SORBIDRAFT_01g007770          110   5e-27   
gb|EAY91897.1|  hypothetical protein OsI_13549                          112   8e-27   
emb|CDH55944.1|  cytochrome b5                                          110   9e-27   
gb|EYU42121.1|  hypothetical protein MIMGU_mgv1a016165mg                110   9e-27   
ref|XP_011091691.1|  PREDICTED: cytochrome b5, seed isoform-like        110   9e-27   
emb|CCL99402.1|  predicted protein                                      110   1e-26   
gb|EYU32657.1|  hypothetical protein MIMGU_mgv1a017734mg                109   1e-26   
ref|XP_005537823.1|  similar to cytochrome B5                           110   2e-26   
gb|KJB79810.1|  hypothetical protein B456_013G095300                    109   2e-26   
emb|CEG65289.1|  Putative Cytochrome-b5 reductase                       107   2e-26   
gb|EPB86099.1|  cytochrome-b5 reductase                                 108   2e-26   
ref|XP_003686097.1|  hypothetical protein TPHA_0F01790                  110   4e-26   
gb|EMS68958.1|  Cytochrome b5 isoform 1                                 108   4e-26   
ref|XP_001754123.1|  predicted protein                                  108   5e-26   
ref|XP_007224672.1|  hypothetical protein PRUPE_ppa025894mg             108   6e-26   
emb|CDH55943.1|  cytochrome b5                                          107   7e-26   
gb|KDQ08244.1|  hypothetical protein BOTBODRAFT_139111                  107   1e-25   
ref|XP_006441194.1|  hypothetical protein CICLE_v10022811mg             107   1e-25   
gb|KDD75358.1|  hypothetical protein H632_c725p2                        106   2e-25   
ref|XP_004353646.1|  cytochrome b-like heme/steroid binding domai...    107   2e-25   
dbj|GAN09314.1|  conserved hypothetical protein                         106   2e-25   
ref|XP_005707529.1|  cytochrome b5                                      106   2e-25   
ref|XP_006582856.1|  PREDICTED: uncharacterized protein LOC100500...    107   2e-25   
ref|XP_001523711.1|  cytochrome b5                                      106   3e-25   
ref|XP_008243822.1|  PREDICTED: cytochrome b5                           106   3e-25   
ref|XP_011203218.1|  PREDICTED: cytochrome b5 isoform X1                106   4e-25   
ref|XP_003677496.1|  hypothetical protein NCAS_0G02570                  105   7e-25   
ref|XP_002508645.1|  cytochrome b5 isoform cb5-d                        105   7e-25   
ref|XP_011176992.1|  PREDICTED: cytochrome b5 isoform X1                105   8e-25   
ref|XP_009089044.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome b5      105   8e-25   
ref|XP_005643210.1|  cytochrome b5                                      105   8e-25   
dbj|BAO41524.1|  cytochrome b5                                          104   9e-25   
ref|XP_003670834.1|  hypothetical protein NDAI_0F02730                  104   1e-24   
ref|XP_006420894.1|  hypothetical protein CICLE_v10006192mg             104   1e-24   
ref|XP_004981737.1|  PREDICTED: cytochrome b5 isoform B-like            104   1e-24   
gb|KDO61158.1|  hypothetical protein CISIN_1g0326972mg                  103   1e-24   
ref|XP_004875986.1|  PREDICTED: cytochrome b5 type B-like isoform X1    105   1e-24   
emb|CCK71989.1|  hypothetical protein KNAG_0I02040                      104   1e-24   
gb|KCW48471.1|  hypothetical protein EUGRSUZ_K02164                     103   2e-24   
ref|XP_005531962.1|  PREDICTED: cytochrome b5 type B-like               104   2e-24   
ref|XP_456135.1|  hypothetical protein                                  103   2e-24   
gb|EMT31495.1|  Putative cytochrome b5 isoform 2                        104   2e-24   
ref|XP_007382470.1|  cytochrome b5                                      103   2e-24   
dbj|GAN06956.1|  cytochrome b5 type B-like isoform X1                   103   2e-24   
ref|XP_448940.1|  hypothetical protein                                  103   2e-24   
ref|XP_001697920.1|  cytochrome b5 protein                              103   3e-24   
ref|XP_003627521.1|  Cytochrome b5                                      103   3e-24   
ref|XP_006420892.1|  hypothetical protein CICLE_v10006192mg             103   3e-24   
ref|NP_001232778.1|  uncharacterized protein LOC100219971               103   3e-24   
gb|EPB92130.1|  cytochrome b5                                           103   3e-24   
ref|XP_010577839.1|  PREDICTED: cytochrome b5 isoform X2                103   4e-24   
ref|XP_002618291.1|  hypothetical protein CLUG_01750                    103   4e-24   
ref|XP_006602525.1|  PREDICTED: cytochrome b5-like isoform X2           102   4e-24   
ref|XP_011207274.1|  PREDICTED: cytochrome b5                           103   4e-24   
gb|ABK21817.1|  unknown                                                 103   4e-24   
ref|XP_002553115.1|  KLTH0D09284p                                       103   4e-24   
ref|XP_001867082.1|  cytochrome B5                                      103   5e-24   
ref|XP_003472031.1|  PREDICTED: cytochrome b5 type B-like               103   5e-24   
gb|EJT47101.1|  hypothetical protein A1Q1_04175                         102   5e-24   
emb|CBY24561.1|  unnamed protein product                                102   5e-24   
ref|XP_004875987.1|  PREDICTED: cytochrome b5 type B-like isoform X2    103   6e-24   
ref|XP_002115968.1|  expressed hypothetical protein                     102   6e-24   
gb|EPT03657.1|  hypothetical protein FOMPIDRAFT_1022249                 102   6e-24   
gb|KJB46853.1|  hypothetical protein B456_008G266200                    102   6e-24   
ref|XP_006878715.1|  PREDICTED: cytochrome b5 type B-like               103   6e-24   
gb|KJB37821.1|  hypothetical protein B456_006G222000                    102   7e-24   
ref|XP_006407869.1|  hypothetical protein EUTSA_v10021984mg             103   7e-24   
ref|XP_011176993.1|  PREDICTED: cytochrome b5 isoform X2                102   7e-24   
emb|CEP16182.1|  hypothetical protein                                   102   7e-24   
ref|XP_010577838.1|  PREDICTED: cytochrome b5 isoform X1                102   8e-24   
ref|XP_011203219.1|  PREDICTED: cytochrome b5 isoform X2                102   8e-24   
ref|XP_005958034.1|  PREDICTED: cytochrome b5 type B-like               102   8e-24   
ref|XP_008797237.1|  PREDICTED: uncharacterized protein LOC103712486    105   9e-24   
emb|CEP63890.1|  LALA0S09e04786g1_1                                     102   9e-24   
ref|XP_005956923.1|  PREDICTED: cytochrome b5 type B-like               102   9e-24   
gb|EKD03682.1|  hypothetical protein A1Q2_02028                         102   1e-23   
gb|EHA97401.1|  Cytochrome b5 type B                                    102   1e-23   
gb|AAW27705.1|  SJCHGC03671 protein                                     102   1e-23   
ref|XP_002954556.1|  hypothetical protein VOLCADRAFT_106432             102   1e-23   
gb|KHG08427.1|  hypothetical protein F383_13300                         101   1e-23   



>ref|XP_011470186.1| PREDICTED: cytochrome b5 isoform E [Fragaria vesca subsp. vesca]
Length=133

 Score =   168 bits (425),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD KVH FEEV+KHN+  DCW+IISGKVY+VTP+++DHPGGD+VLL ATGKD TNDFE
Sbjct  1    MASDLKVHVFEEVAKHNQTKDCWLIISGKVYDVTPFMEDHPGGDEVLLAATGKDGTNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllpllil  464
            D+GHSD ARE M KYYIG+ID++TVP K  + PPP +  P + S  ++ +LQFL+PLLIL
Sbjct  61   DVGHSDSAREMMDKYYIGEIDASTVPLKRTFVPPPQTYNPDKTSEFVIKILQFLVPLLIL  120

Query  465  GFAVGFRYFNKKE  503
            G A   R+F KKE
Sbjct  121  GLAFAVRHFTKKE  133



>ref|XP_007039163.1| Cytochrome B5, n2,ATCB5-E,CB5-E isoform 1 [Theobroma cacao]
 ref|XP_007039164.1| Cytochrome B5, n2,ATCB5-E,CB5-E isoform 1 [Theobroma cacao]
 gb|EOY23664.1| Cytochrome B5, n2,ATCB5-E,CB5-E isoform 1 [Theobroma cacao]
 gb|EOY23665.1| Cytochrome B5, n2,ATCB5-E,CB5-E isoform 1 [Theobroma cacao]
Length=134

 Score =   167 bits (422),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 108/134 (81%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M++D K+H+FEEVSKHNK  DCW+IISGKVY+VTP++DDHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MATDPKMHTFEEVSKHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPP-PTSSAPKQKSGGMMTllqfllplli  461
            D+GHSD AR+ MKKYYIGDIDS TVP K  Y PP  T   P +    ++ +LQFL+PLLI
Sbjct  61   DVGHSDSARDMMKKYYIGDIDSKTVPAKRTYIPPLQTPYNPDKTPEFIIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A+  R F KKE
Sbjct  121  LGLAIAVRNFTKKE  134



>ref|XP_006444773.1| hypothetical protein CICLE_v10022828mg [Citrus clementina]
 ref|XP_006444774.1| hypothetical protein CICLE_v10022828mg [Citrus clementina]
 ref|XP_006491337.1| PREDICTED: cytochrome b5 isoform A-like isoform X1 [Citrus sinensis]
 ref|XP_006491338.1| PREDICTED: cytochrome b5 isoform A-like isoform X2 [Citrus sinensis]
 gb|ESR58013.1| hypothetical protein CICLE_v10022828mg [Citrus clementina]
 gb|ESR58014.1| hypothetical protein CICLE_v10022828mg [Citrus clementina]
 gb|KDO86563.1| hypothetical protein CISIN_1g032893mg [Citrus sinensis]
Length=131

 Score =   166 bits (420),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = +3

Query  117  AKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIGH  296
            AKVH F+EV+KHN +DDCW++ISGKVYNVTP+L+DHPGGD+VLL AT KDAT+DFED+GH
Sbjct  2    AKVHDFQEVAKHNNRDDCWLVISGKVYNVTPFLEDHPGGDEVLLAATEKDATDDFEDVGH  61

Query  297  SDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllpllilGFAV  476
            SD ARE M+KY+IG+IDS++VP K  YTPP  +    + +G    +LQFL+P+LILG A 
Sbjct  62   SDSAREMMEKYHIGEIDSSSVPAKRKYTPPQQAVNSPEDTGSAAKILQFLVPMLILGIAF  121

Query  477  GFRYFNKKE  503
             FRYF+KKE
Sbjct  122  AFRYFSKKE  130



>ref|XP_007218582.1| hypothetical protein PRUPE_ppa013232mg [Prunus persica]
 gb|EMJ19781.1| hypothetical protein PRUPE_ppa013232mg [Prunus persica]
Length=134

 Score =   164 bits (416),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 110/134 (82%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD KVH FEEV+KHNK  DCW++ISGKV++VTP++DDHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MASDPKVHIFEEVAKHNKTKDCWLVISGKVFDVTPFMDDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSS-APKQKSGGMMTllqfllplli  461
            D+GHSD AR+ M+KYYIG++D +TVP K IY PPP +   P + S  ++ +LQFL+PLLI
Sbjct  61   DVGHSDSARDMMEKYYIGEVDPSTVPLKRIYIPPPQARYNPDKISEFVIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R++ KKE
Sbjct  121  LGLAFAVRHYTKKE  134



>ref|XP_007039165.1| Cytochrome B5, n2,ATCB5-E,CB5-E isoform 3, partial [Theobroma 
cacao]
 gb|EOY23666.1| Cytochrome B5, n2,ATCB5-E,CB5-E isoform 3, partial [Theobroma 
cacao]
Length=160

 Score =   164 bits (416),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 107/139 (77%), Gaps = 1/139 (1%)
 Frame = +3

Query  90   LFKLKMSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDA  269
             F++      K+H+FEEVSKHNK  DCW+IISGKVY+VTP++DDHPGGD+VLL+ATGKDA
Sbjct  22   FFRISQKPHPKMHTFEEVSKHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSATGKDA  81

Query  270  TNDFEDIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPP-PTSSAPKQKSGGMMTllqfl  446
            TNDFED+GHSD AR+ MKKYYIGDIDS TVP K  Y PP  T   P +    ++ +LQFL
Sbjct  82   TNDFEDVGHSDSARDMMKKYYIGDIDSKTVPAKRTYIPPLQTPYNPDKTPEFIIKILQFL  141

Query  447  lpllilGFAVGFRYFNKKE  503
            +PLLILG A+  R F KKE
Sbjct  142  VPLLILGLAIAVRNFTKKE  160



>ref|XP_010692750.1| PREDICTED: cytochrome b5-like [Beta vulgaris subsp. vulgaris]
Length=138

 Score =   163 bits (413),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 107/135 (79%), Gaps = 3/135 (2%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            MS+D KVH FEEV+KHN KDDCW+IISGK YNVT +LDDHPGGDDVLLTATGKDAT+DFE
Sbjct  1    MSTDPKVHVFEEVAKHNTKDDCWLIISGKTYNVTSFLDDHPGGDDVLLTATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVP--EKPIYTPPPTSSA-PKQKSGGMMTllqfllpl  455
            DIGHSD AR+ +K YY+GDID +T+P   KPI + PP  +A   Q SG ++  LQFLLPL
Sbjct  61   DIGHSDTARDMLKNYYVGDIDVSTIPTKNKPIKSQPPRDTAQTNQTSGFLIKFLQFLLPL  120

Query  456  lilGFAVGFRYFNKK  500
            +ILG A G + F K+
Sbjct  121  IILGLAFGLKNFKKE  135



>ref|XP_008381360.1| PREDICTED: cytochrome b5-like [Malus domestica]
Length=134

 Score =   163 bits (412),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 107/134 (80%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD KVH FEEV+KHNK  DCW+II+GKVY+VTP++DDHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MASDPKVHVFEEVAKHNKTKDCWLIIAGKVYDVTPFMDDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSS-APKQKSGGMMTllqfllplli  461
            D+GHSD AR+ M+KYYIG++D +TVP K  Y PPP     P + S   + +LQFL+PLLI
Sbjct  61   DVGHSDSARDMMEKYYIGEVDQSTVPLKRTYIPPPXGQYNPDKTSEFXIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R++ KKE
Sbjct  121  LGLAFAVRHYTKKE  134



>ref|XP_008234680.1| PREDICTED: cytochrome b5 isoform A [Prunus mume]
 ref|XP_008234681.1| PREDICTED: cytochrome b5 isoform A [Prunus mume]
 ref|XP_008234682.1| PREDICTED: cytochrome b5 isoform A [Prunus mume]
Length=134

 Score =   162 bits (410),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 109/134 (81%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD KVH FEEV+KHNK  DCW++ISGKV++VTP++DDHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MASDPKVHIFEEVAKHNKTKDCWLVISGKVFDVTPFMDDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSS-APKQKSGGMMTllqfllplli  461
            D+GHSD AR+ M+KYYIG++D +TVP K  Y PPP +   P + S  ++ +LQFL+PLLI
Sbjct  61   DVGHSDSARDMMEKYYIGEVDPSTVPLKRTYIPPPQARYNPDKISEFVIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R++ KKE
Sbjct  121  LGLAFAVRHYTKKE  134



>gb|AFP55583.1| yellow stripe-like protein [Rosa rugosa]
Length=832

 Score =   174 bits (440),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 98/168 (58%), Positives = 125/168 (74%), Gaps = 7/168 (4%)
 Frame = +3

Query  21   QILGSFSEFCCLSCEREPE---PHSR-LFKLK--MSSDAKVHSFEEVSKHNKKDDCWIII  182
            ++L S +E    S +++ E   P S+ LF L   M+SD KVH FEEV+KHN+  DCW++I
Sbjct  665  KVLHSTNEHQLTSPDKDRETTFPISQSLFSLSLVMASDPKVHVFEEVAKHNQTKDCWLVI  724

Query  183  SGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIGHSDDARETMKKYYIGDIDSNTVP  362
            SGKVY+VTP++DDHPGGD+VLL+ATGKDATNDFED+GHSD AR+ M KYYIG+ID +TVP
Sbjct  725  SGKVYDVTPFMDDHPGGDEVLLSATGKDATNDFEDVGHSDAARDMMDKYYIGEIDPSTVP  784

Query  363  EKPIYTPPP-TSSAPKQKSGGMMTllqfllpllilGFAVGFRYFNKKE  503
             K  Y PPP T   P + S  ++ +LQFL+PLLILG A   R+F KKE
Sbjct  785  LKRTYIPPPQTQYNPDKTSEFVIKILQFLVPLLILGLAFAVRHFTKKE  832



>gb|AEC11004.1| cytochrome b5 (chloroplast) [Camellia sinensis]
Length=134

 Score =   161 bits (407),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 108/134 (81%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD K+H+FEEV+KHNK  DCW+I+SGKVY+VTP++DDHPGGD+VLL++TGKDATNDFE
Sbjct  1    MASDPKIHTFEEVAKHNKTKDCWLILSGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSS-APKQKSGGMMTllqfllplli  461
            D+GHSD ARE M+KYYIG IDS+TVP K  Y PP  S   P +    ++ + QFL+PLLI
Sbjct  61   DVGHSDSAREMMEKYYIGGIDSSTVPLKRSYIPPQQSHYKPDKTPEFVIKIFQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A G RY+ K++
Sbjct  121  LGLAFGVRYYTKEK  134



>ref|XP_009351942.1| PREDICTED: cytochrome b5 isoform A-like [Pyrus x bretschneideri]
Length=134

 Score =   161 bits (407),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 108/134 (81%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD KVH FEEV+KHNK  DCW+I++GKVY+VTP++DDHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MASDPKVHVFEEVAKHNKTKDCWLIVAGKVYDVTPFMDDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSS-APKQKSGGMMTllqfllplli  461
            D+GHSD ARE M+KYYIG++D +TVP K  Y PPP     P + S  ++ +LQFL+PLLI
Sbjct  61   DVGHSDSAREMMEKYYIGEVDQSTVPLKRTYIPPPQGRYNPDKTSEFVIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R++ +K+
Sbjct  121  LGLAFVVRHYTRKD  134



>ref|XP_010090895.1| Cytochrome b5 isoform 1 [Morus notabilis]
 gb|EXB41100.1| Cytochrome b5 isoform 1 [Morus notabilis]
Length=135

 Score =   160 bits (406),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 108/134 (81%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD+KVH FEEV+KHNK  DCW+IISGKVY+VT ++DDHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MASDSKVHVFEEVAKHNKTKDCWLIISGKVYDVTTFMDDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSS-APKQKSGGMMTllqfllplli  461
            D+GHSD AR+ MKKYYIG+IDS+TVP K  Y PP  +   P +    ++ +LQFL+PLLI
Sbjct  61   DVGHSDSARDMMKKYYIGEIDSSTVPLKRTYIPPQQAPYNPDKTPEFVIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R+F KK+
Sbjct  121  LGLAFAVRHFTKKD  134



>ref|NP_001281054.1| cytochrome b5-like [Malus domestica]
 gb|ABR04092.2| cytochrome b5 [Malus domestica]
Length=134

 Score =   160 bits (405),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 107/134 (80%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD KVH FEEV+KHNK  DCW+II+GKVY+VTP++DDHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MASDPKVHVFEEVAKHNKTKDCWLIIAGKVYDVTPFMDDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSS-APKQKSGGMMTllqfllplli  461
            D+GHSD AR+ M+KYYIG++D +TVP K  Y PPP     P + S  ++ +LQFL+PLLI
Sbjct  61   DVGHSDSARDMMEKYYIGEVDQSTVPLKRTYIPPPHGQYNPDKTSEFVIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            L  A   R++ KKE
Sbjct  121  LELAFAVRHYTKKE  134



>gb|KJB46858.1| hypothetical protein B456_008G266200, partial [Gossypium raimondii]
Length=164

 Score =   161 bits (408),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 107/135 (79%), Gaps = 1/135 (1%)
 Frame = +3

Query  102  KMSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDF  281
            +M+SD KVH FEEV+ HNK  DCW+IISGKVY+VTP++DDHPGGD+VLL+ATGKDAT+DF
Sbjct  30   RMASDPKVHIFEEVANHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSATGKDATDDF  89

Query  282  EDIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPP-PTSSAPKQKSGGMMTllqfllpll  458
            ED+GHSD ARE M+KYYIG+ID  TVP K  Y PP  T   P +    ++ +LQFL+PLL
Sbjct  90   EDVGHSDSAREMMEKYYIGEIDPKTVPAKRTYIPPQQTPYNPDKTPEFVIKILQFLVPLL  149

Query  459  ilGFAVGFRYFNKKE  503
            ILG A+  R++ KKE
Sbjct  150  ILGLAIAVRHYTKKE  164



>ref|XP_006367355.1| PREDICTED: cytochrome b5 isoform A-like [Solanum tuberosum]
Length=134

 Score =   160 bits (405),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 105/134 (78%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M SD KVH FEEV+KHNK  DCW+IISGKVY+VTP+++DHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MGSDQKVHVFEEVAKHNKTKDCWLIISGKVYDVTPFMEDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSS-APKQKSGGMMTllqfllplli  461
            D+GHSD ARE M KYYIGDID +TVP K  Y PP  +   P + S  ++ +LQ L+PLLI
Sbjct  61   DVGHSDSAREMMDKYYIGDIDQSTVPLKRAYIPPQQAPYNPDKTSEFVIKILQILVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R++ K++
Sbjct  121  LGLAFAVRHYTKEK  134



>ref|XP_011084546.1| PREDICTED: cytochrome b5 isoform E-like [Sesamum indicum]
Length=136

 Score =   160 bits (404),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 107/134 (80%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD KVH+FEEV+KHNK  DCW+IISGKVY+VTP++DDHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MASDPKVHTFEEVAKHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSA-PKQKSGGMMTllqfllplli  461
            D+GHSD ARE M KYYIG+ID  TVP K  YTPP  +   P +    ++ +LQFL+PLLI
Sbjct  61   DVGHSDSAREMMDKYYIGEIDMATVPLKRAYTPPQQAHYNPDKTPEFVIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R++ K++
Sbjct  121  LGLAFAVRHYTKEK  134



>gb|KJB46854.1| hypothetical protein B456_008G266200 [Gossypium raimondii]
 gb|KJB46856.1| hypothetical protein B456_008G266200 [Gossypium raimondii]
 gb|KJB46859.1| hypothetical protein B456_008G266200 [Gossypium raimondii]
 gb|KJB46860.1| hypothetical protein B456_008G266200 [Gossypium raimondii]
 gb|KJB46861.1| hypothetical protein B456_008G266200 [Gossypium raimondii]
Length=134

 Score =   160 bits (404),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 106/134 (79%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD KVH FEEV+ HNK  DCW+IISGKVY+VTP++DDHPGGD+VLL+ATGKDAT+DFE
Sbjct  1    MASDPKVHIFEEVANHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPP-PTSSAPKQKSGGMMTllqfllplli  461
            D+GHSD ARE M+KYYIG+ID  TVP K  Y PP  T   P +    ++ +LQFL+PLLI
Sbjct  61   DVGHSDSAREMMEKYYIGEIDPKTVPAKRTYIPPQQTPYNPDKTPEFVIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A+  R++ KKE
Sbjct  121  LGLAIAVRHYTKKE  134



>ref|XP_009798397.1| PREDICTED: cytochrome b5 isoform A-like [Nicotiana sylvestris]
Length=134

 Score =   159 bits (402),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 106/134 (79%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD KVH FEEV+KHNK  DCW+IISGKVY+VTP++DDHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MASDGKVHGFEEVAKHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTS-SAPKQKSGGMMTllqfllplli  461
            D+GHSD ARE M KYYIGDID +TVP K  Y PP  +   P +    ++ +LQFL+PLLI
Sbjct  61   DVGHSDSAREMMDKYYIGDIDVSTVPLKRSYVPPQQAPYNPDKTPEFIIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R++ K++
Sbjct  121  LGLAFAVRHYTKEK  134



>ref|XP_010671362.1| PREDICTED: cytochrome b5 isoform E [Beta vulgaris subsp. vulgaris]
Length=135

 Score =   159 bits (401),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 100/134 (75%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD KVH+FEEVSKHN   DCW+IISGKVY+V+P++DDHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MASDRKVHTFEEVSKHNSNKDCWLIISGKVYDVSPFMDDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD ARE M KYYIG++D +TVP K  Y PP  +     K+   +  +   +  LLI
Sbjct  61   DVGHSDSAREMMDKYYIGEVDVSTVPLKRSYVPPQQAHYNHDKTSEFIIKILQFVVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R++ KKE
Sbjct  121  LGLAFVVRHYTKKE  134



>ref|XP_009375446.1| PREDICTED: cytochrome b5-like [Pyrus x bretschneideri]
 ref|XP_009375447.1| PREDICTED: cytochrome b5-like [Pyrus x bretschneideri]
Length=133

 Score =   158 bits (399),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M S+++V+ F+EV+KHN K DCWIIISGKVY+VTP+L++HPGGD+VLL A  KDAT+DF 
Sbjct  1    MGSNSEVYLFDEVAKHNHKKDCWIIISGKVYDVTPFLEEHPGGDEVLLLAVEKDATDDFN  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTl-lqfllplli  461
            D+GHSD ARE M+KYY+G +D++T+P +P Y  PP ++AP ++S G+M   LQFLLPLLI
Sbjct  61   DVGHSDSAREQMEKYYVGKVDTSTIPAQPNYKLPPQAAAPAEQSSGLMVKLLQFLLPLLI  120

Query  462  lGFAVGFRYFNKK  500
            LG A   +Y+NKK
Sbjct  121  LGAAFALQYYNKK  133



>ref|XP_002518220.1| cytochrome B5 isoform 1, putative [Ricinus communis]
 gb|EEF44163.1| cytochrome B5 isoform 1, putative [Ricinus communis]
Length=134

 Score =   157 bits (398),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 103/134 (77%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD K+ +FEEV+KHNK  DCW++ISGKVY+VTP++DDHPGGDDVLL++TGKDATNDFE
Sbjct  1    MASDPKILNFEEVAKHNKLKDCWLVISGKVYDVTPFMDDHPGGDDVLLSSTGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD AR+ M+KYYIG+IDS T+P +  + P P ++  + KS   +  +   L  LLI
Sbjct  61   DVGHSDSARDMMEKYYIGEIDSATIPLRRTHIPKPQANYNQDKSSEFLIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R++ KKE
Sbjct  121  LGLAFAVRHYTKKE  134



>ref|XP_010318050.1| PREDICTED: cytochrome b5 isoform A [Solanum lycopersicum]
 ref|XP_010318051.1| PREDICTED: cytochrome b5 isoform A [Solanum lycopersicum]
Length=134

 Score =   157 bits (398),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 107/134 (80%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD K+H+FEEV+KHNK  DCW+IISGKVY+VTP++DDHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MASDRKIHAFEEVAKHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPP-PTSSAPKQKSGGMMTllqfllplli  461
            D+GHSD ARE M KYYIG+ID +TVP K  Y P   T+  P +    ++ +LQFL+P+LI
Sbjct  61   DVGHSDSAREMMDKYYIGEIDMSTVPLKRAYIPSEQTAYNPDKTPEFIIKILQFLVPILI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R++ K++
Sbjct  121  LGLAFTVRHYTKEQ  134



>ref|NP_001235088.1| uncharacterized protein LOC100305929 [Glycine max]
 gb|ACU13851.1| unknown [Glycine max]
Length=134

 Score =   157 bits (398),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 108/134 (81%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD K+H+FEEV+KHN+  DCW+IISGKVY+VTP+++DHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MASDRKLHTFEEVAKHNQTKDCWLIISGKVYDVTPFMEDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSS-APKQKSGGMMTllqfllplli  461
            D+GHSD AR+ M+KYYIG+ID+ TVP K  Y PP  +   P +    ++ +LQFL+PLLI
Sbjct  61   DVGHSDSARDMMEKYYIGEIDALTVPLKRTYIPPQQAQYNPDKTPEFVIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R++ KKE
Sbjct  121  LGLAFVVRHYTKKE  134



>ref|XP_009803510.1| PREDICTED: cytochrome b5-like [Nicotiana sylvestris]
 ref|XP_009803511.1| PREDICTED: cytochrome b5-like [Nicotiana sylvestris]
Length=131

 Score =   157 bits (397),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 105/130 (81%), Gaps = 1/130 (1%)
 Frame = +3

Query  117  AKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIGH  296
            +KVH+F EV++HNKKDDCW+II GKVYNVT +LDDHPGGDDVLLTATGKDAT+DFED+GH
Sbjct  2    SKVHAFNEVAEHNKKDDCWLIIFGKVYNVTSFLDDHPGGDDVLLTATGKDATDDFEDVGH  61

Query  297  SDDARETMKKYYIGDIDSNTVP-EKPIYTPPPTSSAPKQKSGGMMTllqfllpllilGFA  473
            SDDARE MKKYY+G+IDS+T+P E+    P     A  Q SG +  +LQFLLPLLILG A
Sbjct  62   SDDAREMMKKYYVGEIDSSTLPVERKYTPPATPPPAGNQGSGNLSKILQFLLPLLILGVA  121

Query  474  VGFRYFNKKE  503
            +  R F +KE
Sbjct  122  LALRSFYQKE  131



>ref|XP_010933787.1| PREDICTED: cytochrome b5 isoform E-like [Elaeis guineensis]
 ref|XP_010933788.1| PREDICTED: cytochrome b5 isoform E-like [Elaeis guineensis]
 ref|XP_010933789.1| PREDICTED: cytochrome b5 isoform E-like [Elaeis guineensis]
Length=134

 Score =   157 bits (397),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 106/134 (79%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M++D K ++F+EV+KHN  +DCW+IISGKVYNVTP++D+HPGGDDVLL ATGKDA NDFE
Sbjct  1    MATDPKTYNFDEVAKHNVAEDCWLIISGKVYNVTPFMDEHPGGDDVLLAATGKDAANDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTS-SAPKQKSGGMMTllqfllplli  461
            DIGHS  ARE M KY+IG++DS+T+P K  Y PP  + S P +    ++T+LQFL+P+LI
Sbjct  61   DIGHSTSAREMMAKYFIGELDSSTIPTKHTYAPPQEAPSNPDKTPQLIITILQFLVPILI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A+  R+F K E
Sbjct  121  LGLALAVRHFTKAE  134



>ref|XP_009796903.1| PREDICTED: cytochrome b5 isoform A-like [Nicotiana sylvestris]
 ref|XP_009796904.1| PREDICTED: cytochrome b5 isoform A-like [Nicotiana sylvestris]
Length=134

 Score =   157 bits (397),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 107/134 (80%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M SD KVH FEEVSKHNK  DCW+IISGKVY+VTP+++DHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MDSDQKVHVFEEVSKHNKTKDCWLIISGKVYDVTPFMEDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPP-PTSSAPKQKSGGMMTllqfllplli  461
            D+GHSDDAR+ M KYYIG+ID++TVP K  Y PP  T   P +    ++ +LQFL+PLLI
Sbjct  61   DVGHSDDARKMMDKYYIGEIDASTVPLKHAYVPPQQTPYNPDKTPEFVIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R++ K++
Sbjct  121  LGLAFVVRHYTKEK  134



>ref|XP_006577772.1| PREDICTED: uncharacterized protein LOC100499823 isoform X1 [Glycine 
max]
 gb|KHN19531.1| Cytochrome b5 isoform 1 [Glycine soja]
Length=134

 Score =   157 bits (397),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 109/134 (81%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD K+H+FEEV+KH++  DCW+IISGKVY+VTP+++DHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MASDRKLHTFEEVAKHDQTKDCWLIISGKVYDVTPFMEDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSS-APKQKSGGMMTllqfllplli  461
            D+GHSD AR+ M+KYYIG+IDS+TVP K  Y PP  +   P +    ++ +LQFL+PLLI
Sbjct  61   DVGHSDSARDMMEKYYIGEIDSSTVPLKRTYIPPQQAQYNPDKTPEFVIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R++ KKE
Sbjct  121  LGLAFVVRHYTKKE  134



>ref|XP_009593163.1| PREDICTED: cytochrome b5 isoform A [Nicotiana tomentosiformis]
Length=134

 Score =   157 bits (396),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 106/134 (79%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD KVH FEEV+KHNK  DCW+II+GKVY+VTP+++DHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MASDGKVHGFEEVAKHNKTKDCWLIINGKVYDVTPFMEDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTS-SAPKQKSGGMMTllqfllplli  461
            D+GHSD ARE M KYYIGDID +TVP K  Y PP  +   P +    ++ +LQFL+PLLI
Sbjct  61   DVGHSDSAREMMDKYYIGDIDVSTVPLKRAYIPPQQAPYNPDKTPEFIIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R++ K++
Sbjct  121  LGLAFAVRHYTKEK  134



>gb|KJB19874.1| hypothetical protein B456_003G122800 [Gossypium raimondii]
 gb|KJB19875.1| hypothetical protein B456_003G122800 [Gossypium raimondii]
Length=132

 Score =   157 bits (396),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M SD+K+H+FEEV+KHNK +DCW+IISGKVY+VTP++ DHPGG +VLL+ATGKD TNDFE
Sbjct  1    MGSDSKIHTFEEVAKHNKNEDCWLIISGKVYDVTPFMSDHPGGGEVLLSATGKDGTNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPP  386
            DIGHS+DARE M+KYYIG+ID  TVP+K  Y PP
Sbjct  61   DIGHSEDAREMMEKYYIGEIDEETVPQKRTYIPP  94



>gb|AFK43559.1| unknown [Lotus japonicus]
 gb|AFK48398.1| unknown [Lotus japonicus]
Length=135

 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 107/134 (80%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD KVH FE+V KH++  DCW+II GKVY+VTP+++DHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MASDPKVHLFEDVVKHSEIKDCWLIIDGKVYDVTPFMEDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPP-TSSAPKQKSGGMMTllqfllplli  461
            D+GHSD AR+ M+KYYIG+ID +TVP K  Y PPP T   P + S  ++ +LQFL+PLLI
Sbjct  61   DVGHSDSARDMMEKYYIGEIDPSTVPLKRTYVPPPHTQYNPDKTSEFVIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R++ KKE
Sbjct  121  LGLAFAVRHYTKKE  134



>ref|XP_004306632.1| PREDICTED: cytochrome b5 [Fragaria vesca subsp. vesca]
 ref|XP_004306633.1| PREDICTED: cytochrome b5 [Fragaria vesca subsp. vesca]
Length=134

 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 112/134 (84%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD+KV+ F+EV++H  K DCWII+SGKVY+VTP+L++HPGGD+VLL A  +DAT+DF 
Sbjct  1    MASDSKVYHFDEVAQHKYKKDCWIIVSGKVYDVTPFLEEHPGGDEVLLLAADRDATDDFN  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPK-QKSGGMMTllqfllplli  461
            D+GHSDDA+E M KYYIG+ID++T+PE+P Y  PP ++AP+ Q SG ++ LLQFLLPLLI
Sbjct  61   DVGHSDDAKEMMAKYYIGEIDTSTIPEQPSYKLPPQATAPQDQSSGFLVKLLQFLLPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   +Y++KK+
Sbjct  121  LGGAFALQYYSKKK  134



>ref|XP_008351951.1| PREDICTED: cytochrome b5 isoform A-like [Malus domestica]
 ref|XP_008360954.1| PREDICTED: cytochrome b5 isoform A-like [Malus domestica]
 ref|XP_008360956.1| PREDICTED: cytochrome b5 isoform A-like [Malus domestica]
Length=133

 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M S+++V+ F+EV+KHN K DCWIIISGKVY+VTP+L++HPGGD+VLL A  KDAT+DF 
Sbjct  1    MGSNSEVYLFDEVAKHNHKKDCWIIISGKVYDVTPFLEEHPGGDEVLLLAVEKDATDDFN  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTl-lqfllplli  461
            D+GHSD ARE M+KYY+G +D++T+P +P Y  PP ++AP ++S G++   LQFLLPLLI
Sbjct  61   DVGHSDSAREQMEKYYVGKVDTSTIPAQPNYKLPPQAAAPAEQSSGLVVKLLQFLLPLLI  120

Query  462  lGFAVGFRYFNKK  500
            LG A   +Y+NKK
Sbjct  121  LGAAFALQYYNKK  133



>ref|XP_004145949.1| PREDICTED: cytochrome b5 isoform A-like [Cucumis sativus]
 ref|XP_004160392.1| PREDICTED: cytochrome b5 isoform A-like [Cucumis sativus]
 gb|KGN49837.1| hypothetical protein Csa_5G139160 [Cucumis sativus]
Length=134

 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 105/134 (78%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD KVH FEEV+KHNK  DCW++ISGKVY+VTP+++DHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MASDPKVHLFEEVAKHNKTKDCWLVISGKVYDVTPFMEDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSS-APKQKSGGMMTllqfllplli  461
            D+GHSD ARE M KYYIG+ID +TVP K I+ P   S   P +    ++ +LQFL+P+LI
Sbjct  61   DVGHSDSAREMMDKYYIGEIDPSTVPLKKIFIPSQQSQHNPDKTPEFVIKILQFLVPILI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R++ K E
Sbjct  121  LGLAFAVRHYTKNE  134



>ref|NP_001236501.1| uncharacterized protein LOC100499823 [Glycine max]
 gb|ACU13805.1| unknown [Glycine max]
Length=134

 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 108/134 (81%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD K+H+FEEV+KH++  DCW+IISGKVY+VTP+++DHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MASDRKLHTFEEVAKHDQTKDCWLIISGKVYDVTPFMEDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSS-APKQKSGGMMTllqfllplli  461
            D+GHSD AR+ M+KYYIG IDS+TVP K  Y PP  +   P +    ++ +LQFL+PLLI
Sbjct  61   DVGHSDSARDMMEKYYIGKIDSSTVPLKRTYIPPQQAQYNPDKTPEFVIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R++ KKE
Sbjct  121  LGLAFVVRHYTKKE  134



>ref|XP_010252345.1| PREDICTED: cytochrome b5 isoform A [Nelumbo nucifera]
 ref|XP_010252353.1| PREDICTED: cytochrome b5 isoform A [Nelumbo nucifera]
Length=133

 Score =   155 bits (393),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD+K + FEEV++HNK  DCW+IISGKVY+VT ++DDHPGGD+VLL ATGKDATNDFE
Sbjct  1    MASDSKTYLFEEVAEHNKTKDCWLIISGKVYDVTSFMDDHPGGDEVLLAATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllpllil  464
            D+GHSD ARE M+KYYIG+IDS+T+P K  Y PP  +     K+  ++ ++QFL+P+LIL
Sbjct  61   DVGHSDSAREIMEKYYIGEIDSSTIPLKRTYIPPQQTPYNSDKTQFVIKIMQFLVPILIL  120

Query  465  GFAVGFRYFNKKE  503
              A   R F K++
Sbjct  121  ALAFAVRNFTKRD  133



>ref|XP_011075921.1| PREDICTED: cytochrome b5 isoform E [Sesamum indicum]
 ref|XP_011075922.1| PREDICTED: cytochrome b5 isoform E [Sesamum indicum]
Length=134

 Score =   155 bits (393),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 105/134 (78%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD KVH FEEV+KHN+  DCW+II+GKVY+VTP++DDHPGGD+VLL A GKDATNDFE
Sbjct  1    MASDPKVHLFEEVAKHNEVKDCWLIINGKVYDVTPFMDDHPGGDEVLLAAVGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSS-APKQKSGGMMTllqfllplli  461
            D+GHSD ARE M KYYIG+ID  TVP K  Y PP  +S  P +    ++ +LQFL+PLLI
Sbjct  61   DVGHSDSAREMMDKYYIGEIDMATVPLKRAYVPPKQASYNPDKTPEFVIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A G R++ K++
Sbjct  121  LGLAYGVRHYTKEK  134



>ref|XP_006493156.1| PREDICTED: cytochrome b5 isoform A-like isoform X1 [Citrus sinensis]
 ref|XP_006493157.1| PREDICTED: cytochrome b5 isoform A-like isoform X2 [Citrus sinensis]
 ref|XP_006493158.1| PREDICTED: cytochrome b5 isoform A-like isoform X3 [Citrus sinensis]
 gb|KDO40567.1| hypothetical protein CISIN_1g032745mg [Citrus sinensis]
 gb|KDO40568.1| hypothetical protein CISIN_1g032745mg [Citrus sinensis]
 gb|KDO40569.1| hypothetical protein CISIN_1g032745mg [Citrus sinensis]
 gb|KDO40570.1| hypothetical protein CISIN_1g032745mg [Citrus sinensis]
Length=134

 Score =   155 bits (393),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 100/134 (75%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD K+H FEEV+ HNK  DCW+IISGKVY+V+ ++DDHPGGD+VL++ATGKDATNDFE
Sbjct  1    MASDPKIHQFEEVATHNKTKDCWLIISGKVYDVSSFMDDHPGGDEVLISATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD ARE M KYYIGDID +TVP K  Y PP   +  + K+   +  +  +L  LLI
Sbjct  61   DVGHSDSAREMMDKYYIGDIDPSTVPRKRAYIPPQQPAYNQDKTPEFIIKILQILVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R++ KKE
Sbjct  121  LGLAFAVRHYTKKE  134



>gb|EYU45298.1| hypothetical protein MIMGU_mgv1a016099mg [Erythranthe guttata]
 gb|EYU45299.1| hypothetical protein MIMGU_mgv1a016099mg [Erythranthe guttata]
 gb|EYU45300.1| hypothetical protein MIMGU_mgv1a016099mg [Erythranthe guttata]
 gb|EYU45301.1| hypothetical protein MIMGU_mgv1a016099mg [Erythranthe guttata]
Length=134

 Score =   155 bits (393),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 105/134 (78%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD+KVH FEEVSKHNK  DCW+II GKVY+VTP++DDHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MTSDSKVHLFEEVSKHNKTKDCWLIIDGKVYDVTPFMDDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSS-APKQKSGGMMTllqfllplli  461
            D+GHSD ARE M KYYIG+ID  TVP K  Y  P   +  P +    ++ +LQFL+PLLI
Sbjct  61   DVGHSDSAREMMDKYYIGEIDKATVPLKRTYVAPQQPAYNPDKTPEFVIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A+  R++ K++
Sbjct  121  LGLALAVRHYTKEK  134



>gb|AFK39502.1| unknown [Medicago truncatula]
 gb|KEH35476.1| cytochrome b5-like heme/steroid-binding domain protein [Medicago 
truncatula]
Length=134

 Score =   155 bits (393),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 107/134 (80%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD K+H+F++VSKHNK  DCW+I+SGKVY+V+P+++DHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MASDPKLHTFDDVSKHNKTKDCWLILSGKVYDVSPFMEDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSS-APKQKSGGMMTllqfllplli  461
            D+GHSD ARE M KYYIG+ID +TVP K  Y PP  S   P + S  ++ +LQFL+PLLI
Sbjct  61   DVGHSDSAREMMDKYYIGEIDPSTVPLKRTYVPPQQSQYNPDKTSEFVIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R + KKE
Sbjct  121  LGLAFVVRNYTKKE  134



>ref|XP_007136483.1| hypothetical protein PHAVU_009G048900g [Phaseolus vulgaris]
 gb|ESW08477.1| hypothetical protein PHAVU_009G048900g [Phaseolus vulgaris]
Length=134

 Score =   155 bits (392),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 101/134 (75%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD K H+FEEV+KHN+  DCW++ISGKVY+VTP++++HPGGD+VLL+ TGKDATNDFE
Sbjct  1    MASDRKFHTFEEVAKHNQTKDCWLVISGKVYDVTPFMEEHPGGDEVLLSGTGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD AR+ M KYYIG+ID++TVP K  Y PP  S    +K+  ++  +   L  LLI
Sbjct  61   DVGHSDSARDMMAKYYIGEIDASTVPLKRTYVPPQQSLYNAEKTSDVVIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R + +KE
Sbjct  121  LGLAFVVRQYTRKE  134



>ref|XP_006849131.1| hypothetical protein AMTR_s00027p00071500 [Amborella trichopoda]
 gb|ERN10712.1| hypothetical protein AMTR_s00027p00071500 [Amborella trichopoda]
Length=134

 Score =   155 bits (392),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 106/134 (79%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD  VH FEE+ +HN+  DCW+II+GKVY+VTP++DDHPGGD+VLL++TGKDATNDFE
Sbjct  1    MASDPVVHRFEEIIRHNQTKDCWLIINGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSS-APKQKSGGMMTllqfllplli  461
            D+GHS DA+E M KYYIG+ID +T+P K +Y P   ++  P + S  ++ +LQFL+PLLI
Sbjct  61   DVGHSQDAKEMMNKYYIGEIDPSTIPAKRVYQPAKQAAYNPDKTSEFVIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG AV  RY+ K E
Sbjct  121  LGLAVTIRYYTKTE  134



>ref|XP_004230012.1| PREDICTED: cytochrome b5 [Solanum lycopersicum]
 ref|XP_010327261.1| PREDICTED: cytochrome b5 [Solanum lycopersicum]
Length=132

 Score =   155 bits (391),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 107/130 (82%), Gaps = 2/130 (2%)
 Frame = +3

Query  120  KVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIGHS  299
            K+H+F ++ +HN KDDCW++ISGKVY+VT +LDDHPGGD+VLLTATGKDAT+DFED+GHS
Sbjct  3    KLHAFNDLLEHNNKDDCWLLISGKVYDVTSFLDDHPGGDEVLLTATGKDATDDFEDVGHS  62

Query  300  DDARETMKKYYIGDIDSNTVPEKPIYTPPP--TSSAPKQKSGGMMTllqfllpllilGFA  473
            DDARE +KKY+IG+IDS+T+P +  +TPPP  T SA  Q SG    LLQFLLPLLIL  A
Sbjct  63   DDAREMLKKYFIGEIDSSTIPAERKHTPPPSATPSAGGQGSGNSWKLLQFLLPLLILVAA  122

Query  474  VGFRYFNKKE  503
            + FR F +KE
Sbjct  123  LAFRSFYQKE  132



>ref|XP_008437642.1| PREDICTED: cytochrome b5 isoform A [Cucumis melo]
Length=134

 Score =   155 bits (391),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 104/134 (78%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD KV  FEEV+KHNK  DCW++ISGKVY+VTP+++DHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MASDPKVRLFEEVAKHNKTKDCWLVISGKVYDVTPFMEDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPP-PTSSAPKQKSGGMMTllqfllplli  461
            D+GHSD ARE M KYYIG+ID +TVP K IY P   T   P +    ++ +LQFL+P+LI
Sbjct  61   DVGHSDSAREMMDKYYIGEIDPSTVPLKKIYIPSQQTQHNPDKTPEFVIKILQFLVPMLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R++ K E
Sbjct  121  LGLAFAVRHYTKNE  134



>ref|XP_009607109.1| PREDICTED: cytochrome b5-like [Nicotiana tomentosiformis]
 ref|XP_009607110.1| PREDICTED: cytochrome b5-like [Nicotiana tomentosiformis]
Length=131

 Score =   154 bits (390),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 103/130 (79%), Gaps = 1/130 (1%)
 Frame = +3

Query  117  AKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIGH  296
            +KVH+F EV +HNKKDDCW+II GKVYNVT +LDDHPGGDDVLLTATGKDAT+DFED+GH
Sbjct  2    SKVHAFNEVVEHNKKDDCWLIIFGKVYNVTSFLDDHPGGDDVLLTATGKDATDDFEDVGH  61

Query  297  SDDARETMKKYYIGDIDSNTVP-EKPIYTPPPTSSAPKQKSGGMMTllqfllpllilGFA  473
            SDDARE MKKYY+G+ID +T+P E+    P     A  Q SG +  +LQFLLPLLILG A
Sbjct  62   SDDAREMMKKYYVGEIDRSTLPVERKYTPPATPPPAGNQGSGNLSKILQFLLPLLILGVA  121

Query  474  VGFRYFNKKE  503
            +  R F +KE
Sbjct  122  LALRSFYQKE  131



>gb|AJO70762.1| cytochrome b5 [Catharanthus roseus]
Length=134

 Score =   154 bits (390),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 105/134 (78%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD K+H F+EVSKHNK  DCW+II+GKVY+VTP++DDHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MASDQKLHKFDEVSKHNKTKDCWLIINGKVYDVTPFMDDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSA-PKQKSGGMMTllqfllplli  461
            D+GHSD ARE M KYYIG++D  TVP K  Y PP  +   P +    ++ +LQFL+PLLI
Sbjct  61   DVGHSDSAREMMDKYYIGEMDMATVPLKRTYIPPQQAQYNPDKTPEFVIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R++ K++
Sbjct  121  LGLAFAVRHYTKEK  134



>emb|CDY20247.1| BnaC09g29920D [Brassica napus]
Length=190

 Score =   156 bits (394),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 106/151 (70%), Gaps = 4/151 (3%)
 Frame = +3

Query  54   LSCEREPEPHSRLFKLKMSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGG  233
            L  ER P    R    +M+S+ KV  FEEVS+HNK  DCW+IISGKVY+VTP++DDHPGG
Sbjct  43   LKAERSPTFDLRR---EMASEKKVLGFEEVSQHNKTKDCWLIISGKVYDVTPFMDDHPGG  99

Query  234  DDVLLTATGKDATNDFEDIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQK  413
            D+VLL++TGKDATNDFED+GHSD AR+ M+KYYIG+IDS+TVP    Y  P   +  + K
Sbjct  100  DEVLLSSTGKDATNDFEDVGHSDTARDMMEKYYIGEIDSSTVPATRTYVAPVQPAYNQDK  159

Query  414  SGGMMTllqfllp-llilGFAVGFRYFNKKE  503
            +   M  +   L  +LILG A+  R + KKE
Sbjct  160  TPEFMIKILQFLVPILILGLALVVRQYTKKE  190



>gb|KHG21565.1| Cytochrome b5 [Gossypium arboreum]
Length=132

 Score =   154 bits (389),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M S++K+H+FEEV+KHNK  DCW+IISGKVY+VTP++ DHPGG +VLL+ATGKD TNDFE
Sbjct  1    MGSESKIHTFEEVAKHNKDKDCWLIISGKVYDVTPFMADHPGGGEVLLSATGKDGTNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSS  398
            DIGHS+DARE M+KYYIG+ID+ TVP+K  Y PP   S
Sbjct  61   DIGHSEDAREMMEKYYIGEIDAETVPQKRTYIPPQQMS  98



>ref|XP_009602193.1| PREDICTED: cytochrome b5 isoform A-like [Nicotiana tomentosiformis]
Length=169

 Score =   155 bits (392),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +3

Query  102  KMSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDF  281
            +M S+ KVH FEEV+KHNK  DCW+IISGKVY+VTP+++DHPGGD+VLL+ATGKDATNDF
Sbjct  35   EMGSNQKVHVFEEVAKHNKTKDCWLIISGKVYDVTPFMEDHPGGDEVLLSATGKDATNDF  94

Query  282  EDIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPP  386
            ED+GHSDDAR+ M KYYIG+ID++TVP K  Y PP
Sbjct  95   EDVGHSDDARKMMDKYYIGEIDTSTVPLKCAYVPP  129



>gb|KHN23327.1| Cytochrome b5 isoform 1 [Glycine soja]
Length=118

 Score =   154 bits (388),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD K+H+FEEV+KHN+  DCW+IISGKVY+VTP+++DHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MASDRKLHTFEEVAKHNQTKDCWLIISGKVYDVTPFMEDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPP  386
            D+GHSD AR+ M+KYYIG+ID++TVP K  Y PP
Sbjct  61   DVGHSDSARDMMEKYYIGEIDASTVPLKRTYIPP  94



>ref|XP_003602315.1| YSL transporter [Medicago truncatula]
Length=841

 Score =   166 bits (420),  Expect = 9e-44, Method: Composition-based stats.
 Identities = 85/137 (62%), Positives = 110/137 (80%), Gaps = 1/137 (1%)
 Frame = +3

Query  96   KLKMSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATN  275
            ++KM+SD K+H+F++VSKHNK  DCW+I+SGKVY+V+P+++DHPGGD+VLL+ATGKDATN
Sbjct  705  EVKMASDPKLHTFDDVSKHNKTKDCWLILSGKVYDVSPFMEDHPGGDEVLLSATGKDATN  764

Query  276  DFEDIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSS-APKQKSGGMMTllqfllp  452
            DFED+GHSD ARE M KYYIG+ID +TVP K  Y PP  S   P + S  ++ +LQFL+P
Sbjct  765  DFEDVGHSDSAREMMDKYYIGEIDPSTVPLKRTYVPPQQSQYNPDKTSEFVIKILQFLVP  824

Query  453  llilGFAVGFRYFNKKE  503
            LLILG A   R + KKE
Sbjct  825  LLILGLAFVVRNYTKKE  841



>gb|AAT84458.1| cytochrome b5 isoform Cb5-A [Vernicia fordii]
Length=133

 Score =   154 bits (389),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD K+H FE+V  HNK  DCW+IISGKVY+VTP+++DHPGGD+VLL++TGKDATNDFE
Sbjct  1    MASDPKIHKFEDVKVHNKIKDCWLIISGKVYDVTPFMEDHPGGDEVLLSSTGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllpllil  464
            D+GHSD AR+ M+KYYIG+IDS+TVP    + PP       + S   + +LQFL+PLLIL
Sbjct  61   DVGHSDSARDMMEKYYIGEIDSSTVPANRTHIPPKQVYNQDKSSEFFIKILQFLVPLLIL  120

Query  465  GFAVGFRYFNKKE  503
            G A   R+F KKE
Sbjct  121  GLAFAVRHFTKKE  133



>ref|XP_010520941.1| PREDICTED: cytochrome b5 [Tarenaya hassleriana]
 ref|XP_010520943.1| PREDICTED: cytochrome b5 [Tarenaya hassleriana]
Length=135

 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 103/135 (76%), Gaps = 2/135 (1%)
 Frame = +3

Query  105  MSSD-AKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDF  281
            M+SD  KV +F+EVS HNK  DCW+IISGKVY+VTP++DDHPGGD+VLL++TGKDATNDF
Sbjct  1    MASDEKKVLTFDEVSNHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDF  60

Query  282  EDIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-ll  458
            ED+GHSD AR+ MK+YYIG+IDS+TVP K  Y PP  ++  + K+   +  +   L  +L
Sbjct  61   EDVGHSDTARDMMKQYYIGEIDSSTVPAKRTYVPPQQAAYNQDKTQDFVIKILQFLVPIL  120

Query  459  ilGFAVGFRYFNKKE  503
            ILG A+  R + KKE
Sbjct  121  ILGLALVVRQYTKKE  135



>gb|EYU19677.1| hypothetical protein MIMGU_mgv1a016108mg [Erythranthe guttata]
Length=134

 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 105/134 (78%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD KVH+FEEV+ HNK  DCW+IISGKVY+VTP+++DHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MASDPKVHAFEEVANHNKTKDCWLIISGKVYDVTPFMEDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSA-PKQKSGGMMTllqfllplli  461
            D+GHSD ARE M+KYYIG+ID  TVP K  Y  P  +   P +    ++ +LQFL+PLLI
Sbjct  61   DVGHSDSAREMMEKYYIGEIDMATVPLKRTYVAPQQAHYNPDKTPEFVIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R++ K++
Sbjct  121  LGLAFAVRHYTKEK  134



>ref|XP_006350625.1| PREDICTED: metal-nicotianamine transporter YSL2-like [Solanum 
tuberosum]
Length=863

 Score =   165 bits (418),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 85/135 (63%), Positives = 109/135 (81%), Gaps = 1/135 (1%)
 Frame = +3

Query  102  KMSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDF  281
            KM+SD K+H+FEEV+KHNK  DCW+IISGKVY+VTP++DDHPGGD+VLL+ATGKDATNDF
Sbjct  729  KMASDRKLHAFEEVAKHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSATGKDATNDF  788

Query  282  EDIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPP-TSSAPKQKSGGMMTllqfllpll  458
            ED+GHSD ARE M KYYIG+ID +TVP K  Y P   T+  P +    ++ +LQFLLP+L
Sbjct  789  EDVGHSDSAREMMDKYYIGEIDMSTVPLKRAYIPSEQTAYNPDKTPEFIIKILQFLLPIL  848

Query  459  ilGFAVGFRYFNKKE  503
            ILG A+  R++ K++
Sbjct  849  ILGLALTVRHYTKEQ  863



>sp|P40934.1|CYB5_BRAOB RecName: Full=Cytochrome b5 [Brassica oleracea var. botrytis]
 gb|AAA32990.1| cytochrome b-5 [Brassica oleracea]
 prf||1905426A cytochrome b5
Length=134

 Score =   152 bits (385),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 100/134 (75%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+S+ KV  FEEVS+HNK  DCW+IISGKVY+VTP++DDHPGGD+VLL++TGKDATNDFE
Sbjct  1    MASEKKVLGFEEVSQHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD AR+ M+KYYIG+IDS+TVP    Y  P   +  + K+   M  +   L  +LI
Sbjct  61   DVGHSDTARDMMEKYYIGEIDSSTVPATRTYVAPVQPAYNQDKTPEFMIKILQFLVPILI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A+  R + KKE
Sbjct  121  LGLALVVRQYTKKE  134



>gb|AFK36070.1| unknown [Lotus japonicus]
Length=135

 Score =   152 bits (384),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 106/134 (79%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD KVH FE+V KH++  DCW+II GKV +VTP+++DHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MASDPKVHLFEDVVKHSEIKDCWLIIDGKVDDVTPFMEDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPP-TSSAPKQKSGGMMTllqfllplli  461
            D+GHSD AR+ M+KYYIG+ID +TVP K  Y PPP T   P + S  ++ +LQFL+PLLI
Sbjct  61   DVGHSDSARDMMEKYYIGEIDPSTVPLKRTYVPPPHTQYNPDKTSEFVIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R++ KKE
Sbjct  121  LGLAFAVRHYTKKE  134



>ref|NP_200168.1| cytochrome B5 isoform E [Arabidopsis thaliana]
 sp|Q42342.2|CYB5E_ARATH RecName: Full=Cytochrome b5 isoform E; Short=AtCb5-E; AltName: 
Full=Cytochrome b5 isoform 1; AltName: Full=Cytochrome b5 
isoform A; Short=AtCb5-A [Arabidopsis thaliana]
 dbj|BAA74839.1| cytochrome b5 [Arabidopsis thaliana]
 dbj|BAB09732.1| cytochrome b5 [Arabidopsis thaliana]
 gb|AAL87348.1| putative cytochrome b5 protein [Arabidopsis thaliana]
 gb|AAM45093.1| putative cytochrome b5 protein [Arabidopsis thaliana]
 gb|AAM64631.1| cytochrome b5 (dbj|BAA74839.1) [Arabidopsis thaliana]
 gb|AED96377.1| cytochrome B5 isoform E [Arabidopsis thaliana]
Length=134

 Score =   152 bits (383),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 101/134 (75%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            MSSD KV SFEEVSKHNK  DCW+IISGKVY+VTP++DDHPGGD+VLL++TGKDATNDFE
Sbjct  1    MSSDRKVLSFEEVSKHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD AR+ M KY+IG+IDS++VP    Y  P   +  + K+   +  +   L  +LI
Sbjct  61   DVGHSDTARDMMDKYFIGEIDSSSVPATRTYVAPQQPAYNQDKTPEFIIKILQFLVPILI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A+  R++ KK+
Sbjct  121  LGLALVVRHYTKKD  134



>ref|XP_006401690.1| hypothetical protein EUTSA_v10014996mg [Eutrema salsugineum]
 gb|ESQ43143.1| hypothetical protein EUTSA_v10014996mg [Eutrema salsugineum]
Length=134

 Score =   152 bits (383),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 101/134 (75%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD K+ +FEEVS+HNK  DCW+IISGKVY+VTP++DDHPGGD+VLL++TGKDATNDFE
Sbjct  1    MASDKKILAFEEVSQHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD AR+ M+KYYIG+IDS++VP    Y  P   +  + K+   +  +   L  +LI
Sbjct  61   DVGHSDTARDMMEKYYIGEIDSSSVPATRTYVAPQQPTYNQDKTPEFIIKILQFLVPILI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A+  R + KKE
Sbjct  121  LGLALVVRQYTKKE  134



>ref|XP_009127155.1| PREDICTED: cytochrome b5-like [Brassica rapa]
 emb|CDY28830.1| BnaA02g10220D [Brassica napus]
 emb|CDX96233.1| BnaC02g14180D [Brassica napus]
Length=134

 Score =   152 bits (383),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 101/134 (75%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD KV  FEEVS+HNK  DCW+IISGKVY+VTP++DDHPGGD+VLL++TGKDATNDFE
Sbjct  1    MASDKKVLGFEEVSQHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD AR+ M+KYYIG+IDS++VP+   Y  P   +  + K+   +  +   L  +LI
Sbjct  61   DVGHSDTARDMMEKYYIGEIDSSSVPKTRTYVAPAQPAYNQDKTPEFIIKILQFLVPILI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A+  R + KKE
Sbjct  121  LGLALVVRQYTKKE  134



>ref|XP_002273913.1| PREDICTED: cytochrome b5 isoform E [Vitis vinifera]
 emb|CBI23060.3| unnamed protein product [Vitis vinifera]
Length=134

 Score =   151 bits (382),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 100/134 (75%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD K+H FEEV+KHN+  DCW++ISGKVY+VTP++DDHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MASDPKIHLFEEVAKHNQTKDCWLVISGKVYDVTPFMDDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD AR+ M+KYYIG+ID ++VP K  + P   ++    K+   +  +   L  LLI
Sbjct  61   DVGHSDAARDMMEKYYIGEIDPSSVPLKRTFIPAQQAAYNHDKTSEFVIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R + KKE
Sbjct  121  LGLAFVVRQYTKKE  134



>gb|KDP22680.1| hypothetical protein JCGZ_02465 [Jatropha curcas]
Length=134

 Score =   151 bits (382),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 102/134 (76%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD K+H FE+V+ HNK  DCW+IISGKVY+VT ++DDHPGGD+VLL++TGKDATNDFE
Sbjct  1    MASDPKIHKFEDVAVHNKTKDCWLIISGKVYDVTSFMDDHPGGDEVLLSSTGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD AR+ M+KYYIG+ID++T+P+K    PP  ++  + KS  +   +   L  LLI
Sbjct  61   DVGHSDSARDMMEKYYIGEIDTSTIPKKRAPVPPRLAAHNQDKSSELFIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R++ KK+
Sbjct  121  LGLAFAVRHYTKKD  134



>emb|CDY14370.1| BnaA10g06850D [Brassica napus]
Length=156

 Score =   152 bits (383),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 107/149 (72%), Gaps = 1/149 (1%)
 Frame = +3

Query  60   CEREPEPHSRLFKLKMSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDD  239
              ++ +P +   + +M+S+ KV  FEEVS+HNK  DCW+IISGKVY+VTP++DDHPGGD+
Sbjct  8    LNKQKDPPTFDLRREMASEKKVLGFEEVSQHNKTKDCWLIISGKVYDVTPFMDDHPGGDE  67

Query  240  VLLTATGKDATNDFEDIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSG  419
            VLL++TGKDATNDFED+GHSD AR+ M+KYYIG+IDS+TVP    Y  P   +  + K+ 
Sbjct  68   VLLSSTGKDATNDFEDVGHSDTARDMMEKYYIGEIDSSTVPATRTYVAPVQPAYNQDKTP  127

Query  420  GMMTllqfllp-llilGFAVGFRYFNKKE  503
              +  +   L  +LILG A+  R + KKE
Sbjct  128  EFIIKILQFLVPILILGLALVVRQYTKKE  156



>emb|CAA04703.1| cytochome b5 [Olea europaea]
Length=134

 Score =   151 bits (382),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 106/134 (79%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD K++ +EEV KH+K  DCW++I+GKVY+VTP++DDHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MASDPKIYVYEEVEKHDKTKDCWLVINGKVYDVTPFMDDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSA-PKQKSGGMMTllqfllplli  461
            D+GHSD ARE M KYYIG+ID +TVP K  YTPP  +   P +    ++ +LQFL+PLLI
Sbjct  61   DVGHSDSAREMMDKYYIGEIDVSTVPTKRTYTPPQQAQYNPDKTPEFLIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R++ K++
Sbjct  121  LGLAFVVRHYTKEK  134



>gb|KHG25542.1| Cytochrome b5 [Gossypium arboreum]
Length=158

 Score =   152 bits (383),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 104/146 (71%), Gaps = 1/146 (1%)
 Frame = +3

Query  69   EPEPHSRLFKLKMSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLL  248
            E E    L   +M S  KV  +E++ KH  ++DCW++ISGKVYNVT +L+DHPGGD+VLL
Sbjct  9    EYEARVHLTVQEMGSGEKVFVYEDLVKHKDRNDCWLLISGKVYNVTQFLEDHPGGDEVLL  68

Query  249  TATGKDATNDFEDIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMM  428
             A+GKDAT+DFED+GHSDDARE M+KYYIG++D+ T+P +  Y    +++A +Q+  G +
Sbjct  69   AASGKDATDDFEDVGHSDDAREQMQKYYIGEVDATTIPARRTYKAQTSTAATQQEEPGFL  128

Query  429  Tllqfllp-llilGFAVGFRYFNKKE  503
              +   L  LLILGFA G ++  KKE
Sbjct  129  FKIIRFLVPLLILGFAFGLQFLGKKE  154



>ref|XP_006441191.1| hypothetical protein CICLE_v10022811mg [Citrus clementina]
 ref|XP_006441192.1| hypothetical protein CICLE_v10022811mg [Citrus clementina]
 ref|XP_006441193.1| hypothetical protein CICLE_v10022811mg [Citrus clementina]
 gb|ESR54431.1| hypothetical protein CICLE_v10022811mg [Citrus clementina]
 gb|ESR54432.1| hypothetical protein CICLE_v10022811mg [Citrus clementina]
 gb|ESR54433.1| hypothetical protein CICLE_v10022811mg [Citrus clementina]
Length=134

 Score =   151 bits (381),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 99/134 (74%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD K+H FEEV+ HNK  DCW+IISGKVY+V+ ++DDHPGGD+VL++ATGKDATNDFE
Sbjct  1    MASDPKIHQFEEVATHNKTKDCWLIISGKVYDVSSFMDDHPGGDEVLISATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD ARE M KYYIGDID +TVP K  Y P    +  + K+   +  +  +L  LLI
Sbjct  61   DVGHSDSAREMMDKYYIGDIDPSTVPRKRAYIPLEQPAYNQDKTPEFIIKILQILVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R++ KKE
Sbjct  121  LGLAFVVRHYTKKE  134



>ref|XP_006281477.1| hypothetical protein CARUB_v10027561mg [Capsella rubella]
 gb|EOA14375.1| hypothetical protein CARUB_v10027561mg [Capsella rubella]
Length=134

 Score =   151 bits (381),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 102/134 (76%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD KV +FE+VS+HNK  DCW+IISGKVY+VTP++DDHPGGD+VLL++TGKDATNDFE
Sbjct  1    MASDRKVLTFEDVSQHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD ARE M+KYYIG+IDS++VP    Y  P   +  + K+   +  +   L  +LI
Sbjct  61   DVGHSDTAREMMEKYYIGEIDSSSVPATRTYVAPQQPAYNQDKTPEFIIKILQFLVPILI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A+  R++ KK+
Sbjct  121  LGLALVVRHYTKKD  134



>ref|XP_009119906.1| PREDICTED: cytochrome b5 [Brassica rapa]
Length=134

 Score =   150 bits (380),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 100/134 (75%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+S+ KV  FEEVS+HNK  DCW+IISGKVY+VTP++DDHPGGD+VLL++TGKDATNDFE
Sbjct  1    MASEKKVLGFEEVSQHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD AR+ M+KYYIG+IDS+TVP    Y  P   +  + K+   +  +   L  +LI
Sbjct  61   DVGHSDTARDMMEKYYIGEIDSSTVPATRTYVAPVQPAYNQDKTPEFIIKILQFLVPILI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A+  R + KKE
Sbjct  121  LGLALVVRQYTKKE  134



>gb|KJB46876.1| hypothetical protein B456_008G127700 [Gossypium raimondii]
 gb|KJB46879.1| hypothetical protein B456_008G127700 [Gossypium raimondii]
Length=138

 Score =   150 bits (380),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 100/134 (75%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M S  KV  +E++ KH  ++DCW++IS KVYNVT +L+DHPGGD+VLL A+GKDATNDFE
Sbjct  1    MGSGEKVFVYEDLVKHKDRNDCWLLISRKVYNVTQFLEDHPGGDEVLLAASGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSDDARE M+KYYIG++D+ T+P + +Y    +++A +Q+  G +  +   L  LLI
Sbjct  61   DVGHSDDAREQMQKYYIGEVDATTIPARRMYKAQTSTAATQQEEPGFLFKIIQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LGFA G ++  KKE
Sbjct  121  LGFAFGLQFLGKKE  134



>gb|ADB85108.1| cytochrome b5 [Jatropha curcas]
Length=134

 Score =   150 bits (380),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 102/134 (76%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD K+H FE+V+ HNK  DCW+IISGKVY+VT ++DDHPGGD+VLL++TGKDATNDFE
Sbjct  1    MASDPKIHKFEDVAVHNKPKDCWLIISGKVYDVTSFMDDHPGGDEVLLSSTGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD AR+ M+KYYIG+ID++T+P+K    PP  ++  + KS  +   +   L  LLI
Sbjct  61   DVGHSDSARDMMEKYYIGEIDTSTIPKKRAPVPPRLAAHNQDKSSELFIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R++ KK+
Sbjct  121  LGLAFAVRHYTKKD  134



>ref|XP_010482757.1| PREDICTED: cytochrome b5 isoform A-like [Camelina sativa]
Length=134

 Score =   150 bits (379),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 102/134 (76%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD KV +FEEVS+HNK  DCW+IISGKVY+VTP++DDHPGGD+VLL++TGKDATNDFE
Sbjct  1    MASDRKVLTFEEVSQHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD AR+ M+KY+IG+IDS+TVP    Y  P   +  + K+   +  +   L  +LI
Sbjct  61   DVGHSDTARDMMEKYHIGEIDSSTVPATRTYVAPQQPAYNQDKTPEFIIKILQFLVPILI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A+  R++ KK+
Sbjct  121  LGLALVVRHYTKKD  134



>emb|CDP05012.1| unnamed protein product [Coffea canephora]
Length=134

 Score =   150 bits (379),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 106/134 (79%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD KVH+F+EV +HNK  DCW+II+GKVY+VTP++++HPGGD+VLL+ATGKDATNDFE
Sbjct  1    MASDQKVHTFDEVVQHNKTKDCWLIINGKVYDVTPFMEEHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSA-PKQKSGGMMTllqfllplli  461
            D+GHSD AR+ M +YYIG+ID  TVP K +Y PP  +   P +    ++ +LQFL+PLLI
Sbjct  61   DVGHSDSARDMMDQYYIGEIDKATVPLKRMYIPPQQAQYNPDKTPEFVIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            +G A   R++ K++
Sbjct  121  MGLAFAVRHYTKEK  134



>gb|AAM28288.1| cytochrome b5 [Ananas comosus]
Length=134

 Score =   150 bits (379),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 102/132 (77%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M++D K++ FEEV+KHN   DCW+IISGKVY+VTP++D+HPGGD+VLL ATGKDATNDFE
Sbjct  1    MATDHKIYGFEEVAKHNATKDCWLIISGKVYDVTPFMDEHPGGDEVLLAATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSS-APKQKSGGMMTllqfllplli  461
            D+GHS+ ARE M KY IG+ID+ TVP K  Y  P  +S  P + S  ++ +LQFL+P+LI
Sbjct  61   DVGHSNSAREMMAKYCIGEIDAATVPAKRAYIAPQQASYNPDKSSDFLIKILQFLVPILI  120

Query  462  lGFAVGFRYFNK  497
            LG A   R+F K
Sbjct  121  LGLAFAVRHFTK  132



>gb|AFK40091.1| unknown [Medicago truncatula]
Length=153

 Score =   150 bits (380),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD K+H+F++VSKHNK  DCW+I+SGKVY+V+P+++DHPGGD+VLL+ATGKDATNDFE
Sbjct  1    MASDPKLHTFDDVSKHNKTKDCWLILSGKVYDVSPFMEDHPGGDEVLLSATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTS  395
            D+GHSD ARE M KYYIG+ID +TVP K  Y PP  S
Sbjct  61   DVGHSDSAREMMDKYYIGEIDPSTVPLKRTYVPPQQS  97



>ref|XP_007218583.1| hypothetical protein PRUPE_ppa013234mg [Prunus persica]
 ref|XP_007218584.1| hypothetical protein PRUPE_ppa013234mg [Prunus persica]
 gb|EMJ19782.1| hypothetical protein PRUPE_ppa013234mg [Prunus persica]
 gb|EMJ19783.1| hypothetical protein PRUPE_ppa013234mg [Prunus persica]
Length=134

 Score =   150 bits (378),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 108/134 (81%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD++V+ F+EV+KHN K DCWIIISGKVY+VTP+L+DHPGGD+VLL A  KDAT+DF 
Sbjct  1    MASDSQVYHFDEVAKHNHKKDCWIIISGKVYDVTPFLEDHPGGDEVLLLAVEKDATDDFN  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPK-QKSGGMMTllqfllplli  461
            D+GHSD A+E M+K+Y+G +D++T+PE+P Y  P  ++ P  Q SG ++ LLQFLLPLLI
Sbjct  61   DVGHSDSAKEQMEKFYVGKVDTSTIPEQPSYKLPAQTTPPSGQSSGFVVKLLQFLLPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   +Y+ KK+
Sbjct  121  LGAAFALQYYGKKK  134



>gb|KFK26373.1| hypothetical protein AALP_AA8G240100 [Arabis alpina]
Length=134

 Score =   150 bits (378),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 98/132 (74%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  +AK+ +  EVS+HN+ DDCWIII+GKVYNVT +L+DHPGGDDVLL++TGKDAT+DFE
Sbjct  1    MGDEAKIFTLSEVSEHNQADDCWIIINGKVYNVTKFLEDHPGGDDVLLSSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS+ ARE M++YY+G+ID+ T+P+K  YTPP      + K+   +  L   L  L I
Sbjct  61   DVGHSESAREMMEQYYVGEIDTTTIPKKVKYTPPKQPHYNQDKTSEFIIKLLQFLVPLAI  120

Query  462  lGFAVGFRYFNK  497
            LG AVG R + K
Sbjct  121  LGLAVGIRIYTK  132



>ref|XP_011093011.1| PREDICTED: cytochrome b5 [Sesamum indicum]
Length=131

 Score =   149 bits (377),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = +3

Query  117  AKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIGH  296
             K+H FEEV KH++K DCW+IISGKVY+VT +L++HPGGD+VL+ A+GKDAT+DFED+GH
Sbjct  3    GKLHDFEEVVKHDQKGDCWLIISGKVYDVTAFLEEHPGGDEVLINASGKDATDDFEDVGH  62

Query  297  SDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllpllilGFAV  476
            SDDARE MK++YIG+ID +T+P K  YTPP  SS     SG    +L +++PLLIL  A 
Sbjct  63   SDDAREKMKEFYIGEIDKSTLPVKQSYTPPTVSSTANLDSGDSSKILLYIVPLLILTVAF  122

Query  477  GFRYFNKKE  503
              R+++KKE
Sbjct  123  LLRFYSKKE  131



>ref|XP_006339753.1| PREDICTED: cytochrome b5-like [Solanum tuberosum]
Length=132

 Score =   149 bits (377),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +3

Query  120  KVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIGHS  299
            K+H+F ++ +HN KDDCW++ISGKVY+VT +LDDHPGGD+VLLTATGKDAT+DFED+GHS
Sbjct  3    KLHAFSDLLEHNNKDDCWLLISGKVYDVTSFLDDHPGGDEVLLTATGKDATDDFEDVGHS  62

Query  300  DDARETMKKYYIGDIDSNTVPEKPIYTPPP--TSSAPKQKSGGMMTllqfllpllilGFA  473
            DDARE +KKY+IG+IDS+T+P +  +T P   T SA  Q SG    +LQFLLPLLIL  A
Sbjct  63   DDAREMLKKYFIGEIDSSTIPAERKHTLPSSTTPSAGVQGSGNSWKILQFLLPLLILVAA  122

Query  474  VGFRYFNKKE  503
            + FR F +KE
Sbjct  123  LAFRSFYQKE  132



>gb|EMS59648.1| Cytochrome b5 [Triticum urartu]
Length=134

 Score =   149 bits (377),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 99/134 (74%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+ + K+  FEEV+KHN   DCW++I+GKVY+VTP++D+HPGGD+VLL  TGKDAT+DFE
Sbjct  1    MAGEKKMFGFEEVAKHNVAKDCWLVIAGKVYDVTPFMDEHPGGDEVLLAVTGKDATSDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            DIGHSD ARE M+KY+IG+ID++T+P K  + PP   S  + K   ++  +   L  +LI
Sbjct  61   DIGHSDSAREMMEKYHIGEIDASTIPAKRTFVPPQQGSHVQAKDSDLLIKILQFLVPILI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A G R+++K E
Sbjct  121  LGLAFGIRHYSKSE  134



>gb|EMT06977.1| Cytochrome b5 [Aegilops tauschii]
Length=134

 Score =   149 bits (376),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 99/134 (74%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+ + K+  FEEV+KHN   DCW++I+GKVY+VTP++D+HPGGD+VLL  TGKDAT+DFE
Sbjct  1    MAGEKKMFGFEEVAKHNVTKDCWLVIAGKVYDVTPFMDEHPGGDEVLLAVTGKDATSDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            DIGHSD ARE M+KY+IG+ID++T+P K  + PP   S  + K   ++  +   L  +LI
Sbjct  61   DIGHSDSAREMMEKYHIGEIDASTIPAKRTFVPPQQGSHVQAKDSDLLIKILQFLVPILI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A G R+++K E
Sbjct  121  LGLAFGIRHYSKSE  134



>ref|XP_002864250.1| ATB5-A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40509.1| ATB5-A [Arabidopsis lyrata subsp. lyrata]
Length=134

 Score =   149 bits (375),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 101/134 (75%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD KV +FEEVS+HNK  DCW+IISGKVY+VTP++DDHPGGD+VLL++TGKDATNDFE
Sbjct  1    MASDRKVLTFEEVSQHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD AR+ M KY+IG+IDS++VP    Y  P   +  + K+   +  +   L  +LI
Sbjct  61   DVGHSDTARDMMDKYFIGEIDSSSVPATRTYVAPQQPAYNQDKTPEFIIKILQFLVPILI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A+  R++ KK+
Sbjct  121  LGLALVVRHYTKKD  134



>ref|XP_008790560.1| PREDICTED: cytochrome b5 isoform A-like [Phoenix dactylifera]
 ref|XP_008790561.1| PREDICTED: cytochrome b5 isoform A-like [Phoenix dactylifera]
Length=134

 Score =   148 bits (374),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 102/134 (76%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M++D K ++F+EV+KHN   DCW+IISGKVY+VTP++D+HPGGDDVLL ATGKDATNDFE
Sbjct  1    MAADPKTYNFDEVAKHNVTKDCWLIISGKVYDVTPFMDEHPGGDDVLLAATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKS-GGMMTllqfllplli  461
            DIGHS  ARE M KY IGDIDS+T+  K  Y P   +     K+   M+T+LQFL+P+LI
Sbjct  61   DIGHSTSAREMMAKYCIGDIDSSTLQAKRTYVPAQQAPYKADKTPDFMITILQFLVPILI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A+  R+F K E
Sbjct  121  LGLALAVRHFTKVE  134



>ref|XP_009397516.1| PREDICTED: cytochrome b5 isoform A-like [Musa acuminata subsp. 
malaccensis]
Length=133

 Score =   148 bits (374),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 101/132 (77%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  SDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDI  290
            +D+KV+ F+EVSKHN   DCW+IISGKVY+VTP+LD+HPGGD+VLL  TGKDATNDFEDI
Sbjct  2    ADSKVYRFDEVSKHNVAKDCWLIISGKVYDVTPFLDEHPGGDEVLLAVTGKDATNDFEDI  61

Query  291  GHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSS-APKQKSGGMMTllqfllpllilG  467
            GHS+ AR+ M KYYIG +D +TVP    Y PP  +S  P + S  ++ +LQFL+P++ILG
Sbjct  62   GHSNSARDMMAKYYIGQVDLSTVPTTRTYIPPQQASYNPDKTSEFVIRILQFLVPIMILG  121

Query  468  FAVGFRYFNKKE  503
             A   R+F K +
Sbjct  122  LAFAVRHFTKAD  133



>gb|KGN56742.1| hypothetical protein Csa_3G131950 [Cucumis sativus]
Length=134

 Score =   148 bits (373),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 98/133 (74%), Gaps = 1/133 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M S  KV + +EV++HN   DCW+IISGKVY+VT +L+DHPGGDDVLL+ATGKDAT+DFE
Sbjct  1    MGSGEKVFTLKEVAEHNNHKDCWLIISGKVYDVTKFLEDHPGGDDVLLSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD+ARE M +YY+G+IDS+T+P+K  YTPP      + K+   +  L   L  L I
Sbjct  61   DVGHSDNAREMMDQYYVGEIDSSTIPKKVAYTPPKQPHYNQDKTSEFIIKLLQFLVPLAI  120

Query  462  lGFAVGFRYFNKK  500
            LG AV  R++ K+
Sbjct  121  LGLAVAIRFYTKQ  133



>ref|XP_004138957.1| PREDICTED: cytochrome b5 isoform B-like [Cucumis sativus]
 ref|XP_004169544.1| PREDICTED: cytochrome b5 isoform B-like [Cucumis sativus]
 gb|KGN61465.1| hypothetical protein Csa_2G138200 [Cucumis sativus]
Length=134

 Score =   148 bits (373),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  D K+ +F EVS+HN   DCW+II+GKVYNVT +L+DHPGGD+VLL+ TGKDAT+DFE
Sbjct  1    MGGDGKLFTFAEVSQHNNPKDCWLIINGKVYNVTEFLEDHPGGDEVLLSGTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS+ ARETM KYY+G+ID +T+PE+  YT P      + K+   +  L   L  L I
Sbjct  61   DVGHSESARETMSKYYVGEIDISTLPERLTYTGPKQPHYNQDKTTEFIIKLLQFLVPLAI  120

Query  462  lGFAVGFRYFNK  497
            LG AVG R++NK
Sbjct  121  LGLAVGIRFYNK  132



>ref|XP_008233085.1| PREDICTED: cytochrome b5-like [Prunus mume]
 ref|XP_008233086.1| PREDICTED: cytochrome b5-like [Prunus mume]
Length=134

 Score =   148 bits (373),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 107/134 (80%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD++V+ F+EV+KHN K DCWIIISGKVY+VTP+L+DHPGGD+VLL A  KDAT+DF 
Sbjct  1    MASDSQVYHFDEVAKHNHKKDCWIIISGKVYDVTPFLEDHPGGDEVLLLAVEKDATDDFN  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPK-QKSGGMMTllqfllplli  461
            D+GHSD A+E M+ +Y+G +D++T+PE+P Y  P  ++ P  Q SG ++ LLQFLLPLLI
Sbjct  61   DVGHSDSAKEQMENFYVGKVDTSTIPEQPNYKLPAQTTPPSGQSSGFVVKLLQFLLPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   +Y+ KK+
Sbjct  121  LGAAFALQYYGKKK  134



>ref|XP_004510632.1| PREDICTED: cytochrome b5-like isoform X1 [Cicer arietinum]
 ref|XP_004510633.1| PREDICTED: cytochrome b5-like isoform X2 [Cicer arietinum]
Length=142

 Score =   148 bits (373),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 108/139 (78%), Gaps = 10/139 (7%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M S ++  +FEEV+KHN K+DCWII++GKVY+VTP+LDDHPGGD+ LL+ATGKDAT DFE
Sbjct  1    MGSKSETFTFEEVAKHNNKNDCWIIVNGKVYDVTPFLDDHPGGDESLLSATGKDATVDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVP----EKPIYTPPPTSSAP---KQKSGGMMTllqf  443
            D+GHSD A+ETM KY++G+ID+ T+P     KPI+   P++ AP    + SG  +  LQ+
Sbjct  61   DVGHSDSAQETMAKYFVGEIDNTTLPAVIKNKPIH---PSTQAPTISNESSGFFLKFLQY  117

Query  444  llpllilGFAVGFRYFNKK  500
            L+PLLILGFA G +Y+ K+
Sbjct  118  LVPLLILGFAFGLQYYGKE  136



>ref|XP_009132870.1| PREDICTED: cytochrome b5 isoform B [Brassica rapa]
Length=134

 Score =   147 bits (372),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  +AK+ +  EVSKHN  +DCWI+ISGKVYNVT +L+DHPGGD+VLL++TGKDAT+DFE
Sbjct  1    MREEAKIFTLSEVSKHNHANDCWIVISGKVYNVTKFLEDHPGGDEVLLSSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS+ ARE M++YY+G+ID  T+P+K  YTPP      + K+   +  +   L  L I
Sbjct  61   DVGHSESAREMMEQYYVGEIDPTTIPKKTKYTPPKQPHYNQDKTSEFIIKILQFLVPLAI  120

Query  462  lGFAVGFRYFNK  497
            LG AVG R + K
Sbjct  121  LGLAVGIRIYTK  132



>ref|XP_010919339.1| PREDICTED: cytochrome b5 isoform E [Elaeis guineensis]
 ref|XP_010919340.1| PREDICTED: cytochrome b5 isoform E [Elaeis guineensis]
Length=135

 Score =   147 bits (372),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 102/134 (76%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M++D+K + F+EV+KHN   DCW+IISGKVY+VTP++D+HPGGD+VLL ATGKDATNDFE
Sbjct  1    MATDSKTYHFDEVAKHNVTKDCWLIISGKVYDVTPFMDEHPGGDEVLLAATGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSS-APKQKSGGMMTllqfllplli  461
            D+GHS  ARE M KY IGDIDS T+P K +Y  P  +   P + S  ++ +LQFL+P+LI
Sbjct  61   DVGHSTSARELMIKYCIGDIDSPTIPTKRVYVAPQQAHYNPDKTSEFVIKILQFLVPVLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R+F K E
Sbjct  121  LGLAFAVRHFTKVE  134



>dbj|BAK03168.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99984.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00213.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=134

 Score =   147 bits (371),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 97/134 (72%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+ D KV  FEEV++HN   DCW++I+GKVY+VT ++D+HPGGD+VLL  TGKDAT+DFE
Sbjct  1    MAGDKKVFGFEEVARHNVTKDCWLVIAGKVYDVTSFMDEHPGGDEVLLAVTGKDATSDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            DIGHSD ARE M+KY+IG+ID++T+P K  + PP   S  + K   ++  +   L  + I
Sbjct  61   DIGHSDSAREMMEKYHIGEIDASTIPAKRTFVPPQQGSHVQAKDNDILIKILQFLVPIFI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A G R+++K E
Sbjct  121  LGLAFGIRHYSKSE  134



>ref|XP_010445931.1| PREDICTED: cytochrome b5 isoform A-like [Camelina sativa]
Length=134

 Score =   147 bits (371),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 101/134 (75%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD KV +FEEVS+HNK  DCW+IISGKVY+VTP+++DHPGGD+VLL++TGKDATNDFE
Sbjct  1    MASDRKVLTFEEVSQHNKTKDCWLIISGKVYDVTPFMEDHPGGDEVLLSSTGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD AR+ M KY+IG+IDS++VP    Y  P   +  + K+   +  +   L  +LI
Sbjct  61   DVGHSDTARDMMAKYHIGEIDSSSVPATRTYVAPQQPAYNQDKTPEFIIKILQFLVPILI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A+  R++ KK+
Sbjct  121  LGLALVVRHYTKKD  134



>ref|XP_008438367.1| PREDICTED: cytochrome b5 isoform B-like [Cucumis melo]
Length=134

 Score =   147 bits (371),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 98/133 (74%), Gaps = 1/133 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M S  KV + +EV++HN   DCW+IISGKVY+VT +L+DHPGGDDVLL+ATGKDAT+DFE
Sbjct  1    MGSGEKVFTLKEVAEHNNHKDCWLIISGKVYDVTKFLEDHPGGDDVLLSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD+ARE M +YY+G+ID++T+P+K  YTPP      + K+   +  L   L  L I
Sbjct  61   DVGHSDNAREMMDQYYVGEIDASTIPKKVAYTPPKQPHYNQDKTSEFIIKLLQFLVPLAI  120

Query  462  lGFAVGFRYFNKK  500
            LG AV  R++ K+
Sbjct  121  LGLAVAIRFYTKQ  133



>gb|EPS71800.1| hypothetical protein M569_02962, partial [Genlisea aurea]
Length=133

 Score =   147 bits (370),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 103/133 (77%), Gaps = 1/133 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD KV  F+E++KH    DCW+II+GKVY+VT +++DHPGGD+VLL ATGKDAT DFE
Sbjct  1    MASDPKVFVFDEIAKHKTSKDCWLIINGKVYDVTAFMEDHPGGDEVLLAATGKDATTDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSA-PKQKSGGMMTllqfllplli  461
            D+GHSD ARETM KYYIG++D+NTVP+K  YTPP  +   P +    ++ +LQF++PLLI
Sbjct  61   DVGHSDGARETMAKYYIGEVDANTVPQKRSYTPPQQAHYNPDKTPEFVIKILQFVVPLLI  120

Query  462  lGFAVGFRYFNKK  500
            LG A   R++ K+
Sbjct  121  LGLAFAVRHYTKE  133



>ref|XP_009361312.1| PREDICTED: cytochrome b5 isoform A [Pyrus x bretschneideri]
Length=134

 Score =   147 bits (370),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 101/134 (75%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD KVH F+EV+KHNK +DCW++I+GKVY++TP++DDHPGG +VLL AT KDATNDFE
Sbjct  1    MASDRKVHVFQEVAKHNKNEDCWVVIAGKVYDLTPFMDDHPGGGEVLLAATAKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPP-TSSAPKQKSGGMMTllqfllplli  461
            D+GHSD AR+ M+KYYIG+ID +T+P   I  P     + P + S   + +LQFL+PL I
Sbjct  61   DVGHSDSARDMMEKYYIGEIDPSTIPLNKISIPAQGGQNNPAKTSDFAIKILQFLVPLFI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R + KKE
Sbjct  121  LGLAFAVRNYTKKE  134



>ref|XP_010442925.1| PREDICTED: cytochrome b5 isoform A [Camelina sativa]
Length=134

 Score =   147 bits (370),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 101/134 (75%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD KV +FEEVS+HNK  DCW+IISGKVY+VTP+++DHPGGD+VLL++TGKDATNDFE
Sbjct  1    MASDRKVLTFEEVSQHNKTKDCWLIISGKVYDVTPFMEDHPGGDEVLLSSTGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD AR+ M KY+IG+IDS++VP    Y  P   +  + K+   +  +   L  +LI
Sbjct  61   DVGHSDTARDMMDKYHIGEIDSSSVPATRTYVAPQQPAYNQDKTPEFIIKILQFLVPILI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A+  R++ KK+
Sbjct  121  LGLALVVRHYTKKD  134



>ref|XP_008376183.1| PREDICTED: cytochrome b5-like [Malus domestica]
 ref|XP_008376184.1| PREDICTED: cytochrome b5-like [Malus domestica]
Length=133

 Score =   146 bits (368),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 104/133 (78%), Gaps = 1/133 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M S ++   ++EV+KHN K DCWIIISGKVY+VTP+L++HPGGD+VLL A  KDAT+DF 
Sbjct  1    MGSKSQJFQYDEVAKHNHKKDCWIIISGKVYDVTPFLEEHPGGDEVLLLAVEKDATDDFN  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSA-PKQKSGGMMTllqfllplli  461
            D+GHSD ARE M+KYY+G +D++T+P +P Y  P  ++A  +Q SG ++ LLQFLLPLLI
Sbjct  61   DVGHSDSAREQMEKYYVGKVDTSTIPAQPNYKLPAQAAAQSEQSSGLLVKLLQFLLPLLI  120

Query  462  lGFAVGFRYFNKK  500
            +G A   +Y+NKK
Sbjct  121  MGAAFALQYYNKK  133



>ref|XP_006645329.1| PREDICTED: cytochrome b5-like [Oryza brachyantha]
Length=136

 Score =   146 bits (369),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 93/134 (69%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            MSS  KV + EEVSKHN KDDCW++I GKVYNVT +L+DHPGGDDVLL++T KDAT+DFE
Sbjct  1    MSSSGKVLTLEEVSKHNTKDDCWLVIGGKVYNVTRFLEDHPGGDDVLLSSTAKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS  AR  M +YY+GDID+ T+P K  YTPP      + K+   +  +   L  L I
Sbjct  61   DVGHSTTARAMMDEYYVGDIDATTIPTKVKYTPPKQPHYNQDKTPEFIIKILQFLVPLAI  120

Query  462  lGFAVGFRYFNKKE  503
            LG AV  R + K E
Sbjct  121  LGLAVAVRIYTKSE  134



>ref|XP_008376797.1| PREDICTED: cytochrome b5 [Malus domestica]
Length=134

 Score =   146 bits (368),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 100/134 (75%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+S  KVH FEEV KHNK +DCWIII+GKVY+VTP++DDHPGG +VLL A GKDATNDFE
Sbjct  1    MASHPKVHVFEEVVKHNKNEDCWIIIAGKVYDVTPFMDDHPGGGEVLLAAIGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSA-PKQKSGGMMTllqfllplli  461
            DIGHSD A++ M+KYYIG+ID + +P K I  P       P + S  ++ +LQFL+PLLI
Sbjct  61   DIGHSDSAKDMMEKYYIGEIDPSNIPLKRISIPAQGGRKNPAKSSDFVIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R + KKE
Sbjct  121  LGLAFAVRNYTKKE  134



>gb|ACG37757.1| cytochrome b5 [Zea mays]
Length=134

 Score =   146 bits (368),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 97/134 (72%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+S+ KV  FEEV+KHN   DCWIII+GKVY+VTP++D+HPGGD+VLL  TGKDAT DFE
Sbjct  1    MASENKVFRFEEVAKHNVTKDCWIIIAGKVYDVTPFMDEHPGGDEVLLAVTGKDATADFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            DIGHSD AR+ M+KY+IG ID++T+P K  Y  P  + +   K+  ++  +   L  ++I
Sbjct  61   DIGHSDSARDMMEKYHIGQIDASTIPAKRTYVHPQQAPSHSDKNNDLLIKILQFLVPIMI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A G R ++K E
Sbjct  121  LGLAFGIRQYSKSE  134



>ref|XP_008457249.1| PREDICTED: cytochrome b5 isoform B-like [Cucumis melo]
Length=134

 Score =   146 bits (368),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  D K+++  EVS+HN   DCW+II+GKVYNVT +L+DHPGGD+VLL+ TGKDAT+DFE
Sbjct  1    MGGDGKLYTLAEVSQHNNPKDCWLIINGKVYNVTEFLEDHPGGDEVLLSGTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS+ ARE M KYYIG+ID +T+PE+  YT P      + K+   +  L   L  L I
Sbjct  61   DVGHSESAREMMSKYYIGEIDISTIPEQLTYTGPKQPHYNQDKTTEFIIKLLQFLVPLAI  120

Query  462  lGFAVGFRYFNK  497
            LG AVG R++NK
Sbjct  121  LGLAVGIRFYNK  132



>gb|ACG44497.1| cytochrome b5 [Zea mays]
Length=134

 Score =   146 bits (368),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+S+ KV  FEEV+KHN   DCWIII+GKVY+VTP++D+HPGGD+VLL  TGKDAT DFE
Sbjct  1    MASENKVFRFEEVAKHNVTKDCWIIIAGKVYDVTPFMDEHPGGDEVLLAVTGKDATADFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            DIGHSD AR+ M+KY+IG ID++T+P K  Y  P  + +   K+  ++  +   L  ++I
Sbjct  61   DIGHSDSARDMMEKYHIGQIDASTIPAKRTYVHPQQAPSHSDKNNDLLINILQFLVPIMI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A G R + K E
Sbjct  121  LGLAFGIRQYTKSE  134



>ref|XP_004133998.1| PREDICTED: cytochrome b5 isoform B-like [Cucumis sativus]
 ref|XP_004170095.1| PREDICTED: cytochrome b5 isoform B-like [Cucumis sativus]
Length=201

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 98/133 (74%), Gaps = 1/133 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M S  KV + +EV++HN   DCW+IISGKVY+VT +L+DHPGGDDVLL+ATGKDAT+DFE
Sbjct  68   MGSGEKVFTLKEVAEHNNHKDCWLIISGKVYDVTKFLEDHPGGDDVLLSATGKDATDDFE  127

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD+ARE M +YY+G+IDS+T+P+K  YTPP      + K+   +  L   L  L I
Sbjct  128  DVGHSDNAREMMDQYYVGEIDSSTIPKKVAYTPPKQPHYNQDKTSEFIIKLLQFLVPLAI  187

Query  462  lGFAVGFRYFNKK  500
            LG AV  R++ K+
Sbjct  188  LGLAVAIRFYTKQ  200



>ref|NP_001169183.1| uncharacterized protein LOC100383035 [Zea mays]
 ref|XP_008644032.1| PREDICTED: uncharacterized protein LOC100383035 isoform X1 [Zea 
mays]
 ref|XP_008644033.1| PREDICTED: uncharacterized protein LOC100383035 isoform X1 [Zea 
mays]
 ref|XP_008644034.1| PREDICTED: uncharacterized protein LOC100383035 isoform X1 [Zea 
mays]
 gb|ACG26422.1| cytochrome b5 [Zea mays]
 gb|ACN31878.1| unknown [Zea mays]
 gb|AFW68365.1| cytochrome b5 isoform 1 [Zea mays]
 gb|AFW68366.1| cytochrome b5 isoform 2 [Zea mays]
 gb|AFW68367.1| cytochrome b5 isoform 3 [Zea mays]
 gb|AFW68368.1| cytochrome b5 isoform 4 [Zea mays]
Length=134

 Score =   145 bits (367),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+S+ KV  FEEV+KHN   DCWIII+GKVY+VTP++D+HPGGD+VLL  TGKDAT DFE
Sbjct  1    MASENKVFRFEEVAKHNVTKDCWIIIAGKVYDVTPFMDEHPGGDEVLLAVTGKDATADFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            DIGHSD AR+ M+KY+IG ID++T+P K  Y  P  + +   K+  ++  +   L  ++I
Sbjct  61   DIGHSDSARDMMEKYHIGQIDASTIPAKRTYVHPQQAPSHSDKNNDLLIKILQFLVPIMI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A G R + K E
Sbjct  121  LGLAFGIRQYTKSE  134



>ref|XP_010107764.1| putative cytochrome b5 isoform 2 [Morus notabilis]
 gb|EXC16929.1| putative cytochrome b5 isoform 2 [Morus notabilis]
Length=134

 Score =   145 bits (367),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  D KV +  EVS HN   DCW+IISGKVY+VT +L+DHPGGD+VLL+ATGKDAT+DFE
Sbjct  1    MGGDGKVFTLAEVSDHNTSKDCWLIISGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD AR+ MK++Y+G+ID+ T+P+K  YTPP   +    K+   +  +   L  L I
Sbjct  61   DVGHSDSARDMMKEFYVGEIDATTIPKKTTYTPPKQPNYNHDKTSEFIIKILQFLVPLAI  120

Query  462  lGFAVGFRYFNK  497
            LG AVG R++ K
Sbjct  121  LGLAVGIRFYTK  132



>ref|XP_002881239.1| B5 #4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57498.1| B5 #4 [Arabidopsis lyrata subsp. lyrata]
Length=134

 Score =   145 bits (367),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  +AK+ +  EVS+HN+  DCWI+I+GKVYNVT +L+DHPGGDDVLL++TGKDAT+DFE
Sbjct  1    MGEEAKIFTLSEVSEHNQAHDCWIVINGKVYNVTKFLEDHPGGDDVLLSSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS+ ARE M++YY+G+ID  T+P+K  YTPP      + K+   +  +   L  L I
Sbjct  61   DVGHSESAREMMEQYYVGEIDPTTIPKKVKYTPPKQPHYNQDKTSEFIIKILQFLVPLAI  120

Query  462  lGFAVGFRYFNK  497
            LG AVG R + K
Sbjct  121  LGLAVGIRIYTK  132



>gb|KJB09607.1| hypothetical protein B456_001G152300 [Gossypium raimondii]
 gb|KJB09608.1| hypothetical protein B456_001G152300 [Gossypium raimondii]
Length=136

 Score =   145 bits (367),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 99/134 (74%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M S  +V  FEEV+K  ++DDCW++ISGKVY+VT +L+DHPGGD+VLL A+GKDAT DFE
Sbjct  1    MDSGEQVFVFEEVAKRKERDDCWLLISGKVYDVTQFLEDHPGGDEVLLAASGKDATQDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPK-QKSGGMMTllqfllplli  461
            D+GHSDDAR  MKKYYIG++DS TVP      P   S  PK  + G +  +LQ L+P+LI
Sbjct  61   DVGHSDDARNMMKKYYIGEVDSTTVPPSNKIKPQTYSVTPKDDEPGFLFKILQILVPILI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A GF++  KKE
Sbjct  121  LGLAFGFQFLGKKE  134



>ref|XP_003574201.1| PREDICTED: cytochrome b5 [Brachypodium distachyon]
 ref|XP_010234918.1| PREDICTED: cytochrome b5 [Brachypodium distachyon]
Length=134

 Score =   145 bits (366),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+ + KV  FEEV+KHN   DCW++I+GKVY+VTP++D+HPGGD+VLL  TGKDAT+DFE
Sbjct  1    MAGEKKVFGFEEVAKHNVAKDCWLVIAGKVYDVTPFMDEHPGGDEVLLAVTGKDATSDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            DIGHS+ ARE M+KY+IG+ID++T+P K  + PP  +   + K   ++  +   L  +LI
Sbjct  61   DIGHSESAREMMEKYHIGEIDASTIPAKRTFVPPQQAPHGQAKDNDLLIKILQFLVPILI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A G R++ K +
Sbjct  121  LGLAFGIRHYTKSD  134



>ref|XP_009334383.1| PREDICTED: cytochrome b5-like [Pyrus x bretschneideri]
 ref|XP_009334384.1| PREDICTED: cytochrome b5-like [Pyrus x bretschneideri]
Length=133

 Score =   145 bits (366),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 105/133 (79%), Gaps = 1/133 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M S +++  ++EV+KHN K DCWIIISGKVY+VTP+L+DHPGGD+VLL A  KDAT+DF 
Sbjct  1    MGSKSQLFHYDEVAKHNHKKDCWIIISGKVYDVTPFLEDHPGGDEVLLLAVEKDATDDFN  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSA-PKQKSGGMMTllqfllplli  461
            D+GHSD ARE M+K+Y+G +D++T+P +P Y  P  ++A  +Q SG ++ LLQFLLPLLI
Sbjct  61   DVGHSDSAREQMEKFYVGKVDTSTIPAQPNYKLPAQAAAQSEQSSGLLVKLLQFLLPLLI  120

Query  462  lGFAVGFRYFNKK  500
            +G A   +Y+NKK
Sbjct  121  MGAAFALQYYNKK  133



>ref|NP_180831.1| cytochrome B5 isoform B [Arabidopsis thaliana]
 sp|O48845.1|CYB5B_ARATH RecName: Full=Cytochrome b5 isoform B; Short=AtCb5-B; AltName: 
Full=Cytochrome b5 isoform 2; AltName: Full=Cytochrome b5 
isoform E; Short=AtCb5-E [Arabidopsis thaliana]
 gb|AAC04491.1| putative cytochrome b5 [Arabidopsis thaliana]
 gb|AAM91608.1| putative cytochrome b5 [Arabidopsis thaliana]
 gb|AAN15404.1| putative cytochrome b5 [Arabidopsis thaliana]
 dbj|BAE99419.1| putative cytochrome b5 [Arabidopsis thaliana]
 gb|AEC08729.1| cytochrome B5 isoform B [Arabidopsis thaliana]
Length=134

 Score =   145 bits (365),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  +AK+ +  EVS+HN+  DCWI+I+GKVYNVT +L+DHPGGDDVLL++TGKDAT+DFE
Sbjct  1    MGDEAKIFTLSEVSEHNQAHDCWIVINGKVYNVTKFLEDHPGGDDVLLSSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS+ ARE M++YY+G+ID  T+P+K  YTPP      + K+   +  L   L  L I
Sbjct  61   DVGHSESAREMMEQYYVGEIDPTTIPKKVKYTPPKQPHYNQDKTSEFIIKLLQFLVPLAI  120

Query  462  lGFAVGFRYFNK  497
            LG AVG R + K
Sbjct  121  LGLAVGIRIYTK  132



>ref|XP_010048740.1| PREDICTED: cytochrome b5 isoform A [Eucalyptus grandis]
 ref|XP_010048748.1| PREDICTED: cytochrome b5 isoform A [Eucalyptus grandis]
 ref|XP_010048756.1| PREDICTED: cytochrome b5 isoform A [Eucalyptus grandis]
 ref|XP_010048762.1| PREDICTED: cytochrome b5 isoform A [Eucalyptus grandis]
 gb|KCW89102.1| hypothetical protein EUGRSUZ_A01428 [Eucalyptus grandis]
Length=134

 Score =   144 bits (364),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD K+ +FEEV KH+K  DCW+IISGKVY+VT ++DDHPGGD+VLL+AT KDATNDFE
Sbjct  1    MASDRKLFNFEEVEKHDKTKDCWLIISGKVYDVTSFMDDHPGGDEVLLSATRKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD ARETMK+Y IG+ID +TVP K  + PP   +    K+   +  +   L  LLI
Sbjct  61   DVGHSDSARETMKEYCIGEIDESTVPAKRTHIPPQQPNYNHDKTPEFIIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R++ KKE
Sbjct  121  LGLAFVVRHYTKKE  134



>gb|KHN06340.1| Cytochrome b5 isoform 1 [Glycine soja]
Length=142

 Score =   145 bits (365),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 104/138 (75%), Gaps = 7/138 (5%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M S  K  +FEEV+KHN + DCWII+ GKVY+VTP+LDDHPGGD+VL+TAT KDAT DFE
Sbjct  1    MGSKTKTFTFEEVAKHNHRKDCWIIVKGKVYDVTPFLDDHPGGDEVLVTATEKDATTDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTP---PPTSSAP---KQKSGGMMTllqfl  446
            DIGHSD A E M+KY++G++D+NT+P +   +    PPT  AP    Q SG ++ +LQ++
Sbjct  61   DIGHSDSATEMMEKYFVGEVDTNTLPAQVTSSSSVRPPT-QAPVYNNQSSGFVVKILQYI  119

Query  447  lpllilGFAVGFRYFNKK  500
            +PLLIL FA G +Y+ KK
Sbjct  120  VPLLILAFAFGLQYYGKK  137



>gb|AFX82679.1| cytochrome b5, partial [synthetic construct]
Length=136

 Score =   144 bits (364),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD K   F+++SKHNK  DCW+II GKVY+VTP+++DHPGGD+VLL ATGKDAT+DFE
Sbjct  1    MASDPKNFVFDDISKHNKTKDCWLIIDGKVYDVTPFMEDHPGGDEVLLAATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPP  386
            D+GHSDDARE M KYYIG++D  TVP+K  Y PP
Sbjct  61   DVGHSDDAREMMHKYYIGEVDKATVPKKRAYVPP  94



>ref|XP_010555748.1| PREDICTED: cytochrome b5 isoform E-like [Tarenaya hassleriana]
 ref|XP_010555749.1| PREDICTED: cytochrome b5 isoform E-like [Tarenaya hassleriana]
Length=135

 Score =   144 bits (364),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 106/135 (79%), Gaps = 2/135 (1%)
 Frame = +3

Query  105  MSSDAK-VHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDF  281
            MSSD+K   +FEEVSKHNK +D W+IISGKVY+VTP++DDHPGGD+VLL++TGKDAT+DF
Sbjct  1    MSSDSKKFLTFEEVSKHNKTEDLWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATSDF  60

Query  282  EDIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSS-APKQKSGGMMTllqfllpll  458
            ED+GHSD  R+ M +Y+IG+IDS+TVP K  Y PP   +  P +    +M +LQFL+P+L
Sbjct  61   EDVGHSDTTRDMMHQYFIGEIDSSTVPTKRTYVPPQQPAYNPDKTPDFVMNILQFLVPIL  120

Query  459  ilGFAVGFRYFNKKE  503
            IL  A+  R +NKKE
Sbjct  121  ILCVALVVRRYNKKE  135



>ref|XP_006295218.1| hypothetical protein CARUB_v10024300mg [Capsella rubella]
 gb|EOA28116.1| hypothetical protein CARUB_v10024300mg [Capsella rubella]
Length=134

 Score =   144 bits (363),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M   AK+ +  EVS+HN+  DCW++I+GKVYNVT +L+DHPGGDDVLL++TGKDAT+DFE
Sbjct  1    MGDKAKIFTLSEVSEHNQAHDCWLVINGKVYNVTKFLEDHPGGDDVLLSSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS+ ARE M++YY+G+ID  T+P+K  YTPP      + K+   +  +   L  L I
Sbjct  61   DVGHSESAREMMEQYYVGEIDQTTIPKKVKYTPPKQPHYNQDKTSEFIIKILQFLVPLAI  120

Query  462  lGFAVGFRYFNK  497
            LG AVG R + K
Sbjct  121  LGLAVGIRIYTK  132



>gb|ACG47454.1| cytochrome b5 [Zea mays]
Length=134

 Score =   144 bits (363),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+S+ KV  FEEV+KHN   DCWIII+GKVY+VTP++D+HPGGD+VLL   GKDAT DFE
Sbjct  1    MASENKVFRFEEVAKHNVTKDCWIIIAGKVYDVTPFMDEHPGGDEVLLAVXGKDATADFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            DIGHSD AR+ M+KY+IG ID++T+P K  Y  P  + +   K+  ++  +   L  ++I
Sbjct  61   DIGHSDSARDMMEKYHIGQIDASTIPAKRTYVHPQQAPSHSDKNNDLLIKILQFLVPIMI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A G R ++K E
Sbjct  121  LGLAFGIRQYSKSE  134



>gb|ABK93631.1| unknown [Populus trichocarpa]
 gb|ABK96445.1| unknown [Populus trichocarpa x Populus deltoides]
Length=134

 Score =   144 bits (362),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 104/133 (78%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  SDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDI  290
            + +KV+ F+E+SKHNK  DCW+IISGKVY+VT ++DDHPGGD+VLL++TGKDATNDFED+
Sbjct  2    ASSKVYLFDEISKHNKTKDCWLIISGKVYDVTSFMDDHPGGDEVLLSSTGKDATNDFEDV  61

Query  291  GHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPT-SSAPK-QKSGGMMTllqfllpllil  464
            GHSDDARE M+KY IG++D  TVP K +Y  P    + PK  K G ++ +LQ L+PLLIL
Sbjct  62   GHSDDAREMMEKYVIGEVDVTTVPTKRLYVAPGLGGTNPKDDKPGFLIKILQLLVPLLIL  121

Query  465  GFAVGFRYFNKKE  503
            G A+  R + KKE
Sbjct  122  GLALAVRTYTKKE  134



>emb|CDX79471.1| BnaC03g18070D [Brassica napus]
Length=134

 Score =   144 bits (362),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  +AK+ +  EVS+HN   DCWI+I+GKVYNVT +L+DHPGGD+VLL++TGKDAT+DFE
Sbjct  1    MREEAKIFTLSEVSEHNHAHDCWIVINGKVYNVTKFLEDHPGGDEVLLSSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS+ ARE M++YY+G+ID  T+P+K  YTPP      + K+   +  +   L  L I
Sbjct  61   DVGHSESAREMMEQYYVGEIDPTTIPKKTKYTPPKQPHYNQDKTSEFIIKILQFLVPLAI  120

Query  462  lGFAVGFRYFNK  497
            LG AVG R + K
Sbjct  121  LGLAVGIRIYTK  132



>ref|XP_010469554.1| PREDICTED: cytochrome b5 isoform B [Camelina sativa]
Length=134

 Score =   144 bits (362),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  +AK+ +  +VS+HN+  DCW++I+GKVYNVT +L+DHPGGDDVLL++TGKDAT+DFE
Sbjct  1    MGDEAKIFTLSQVSEHNQPQDCWLVINGKVYNVTKFLEDHPGGDDVLLSSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS+ ARE M++YY+G+ID  T+P+K  YTPP      + K+   +  +   L  L I
Sbjct  61   DVGHSESAREMMEQYYVGEIDKTTIPKKVKYTPPKQPHYNQDKTSEFIIKILQFLVPLAI  120

Query  462  lGFAVGFRYFNK  497
            LG AVG R + K
Sbjct  121  LGLAVGIRIYTK  132



>ref|NP_001236891.1| uncharacterized protein LOC100305546 [Glycine max]
 gb|ACU13280.1| unknown [Glycine max]
Length=142

 Score =   144 bits (362),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 104/142 (73%), Gaps = 12/142 (8%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M S  K  +FEEV+KHN + DCWII+ GKVY+VTP+LDDHPGGD+VL+TAT KDAT DFE
Sbjct  1    MGSKTKTFTFEEVAKHNHRKDCWIIVKGKVYDVTPFLDDHPGGDEVLVTATEKDATTDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVP---------EKPIYTPPPTSSAPKQKSGGMMTll  437
            DIGHSD A + M+KY++G++D+NT+P          +P   PP  ++   Q SG ++ +L
Sbjct  61   DIGHSDSATQMMEKYFVGEVDTNTLPAQVTSNNSVRQPTQAPPAYNN---QSSGFVVKML  117

Query  438  qfllpllilGFAVGFRYFNKKE  503
            Q+++PLLIL FA G +Y+ KK+
Sbjct  118  QYIVPLLILAFAFGLQYYGKKK  139



>ref|XP_011043723.1| PREDICTED: cytochrome b5-like [Populus euphratica]
Length=134

 Score =   144 bits (362),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 104/133 (78%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  SDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDI  290
            + +KV+ F+E+SKHNK  DCW+IISGKVY+VT ++DDHPGGD+VLL++TGKDATNDFED+
Sbjct  2    ASSKVYLFDEISKHNKTKDCWLIISGKVYDVTSFMDDHPGGDEVLLSSTGKDATNDFEDV  61

Query  291  GHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPT-SSAPK-QKSGGMMTllqfllpllil  464
            GHSDDARE M+KY IG++D  TVP K +Y  P    + PK  K G ++ +LQ L+PLLIL
Sbjct  62   GHSDDAREMMEKYVIGEVDITTVPTKRLYVAPGLGGTNPKDDKPGFLIKILQLLVPLLIL  121

Query  465  GFAVGFRYFNKKE  503
            G A+  R + KKE
Sbjct  122  GLALAVRTYTKKE  134



>gb|ABA54491.1| cytochrome b5 type 28 [Crepis alpina]
Length=145

 Score =   144 bits (362),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 83/103 (81%), Gaps = 1/103 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M S+AKV S EEVSKH+ KDDCW+IISGKVY++TP+LDDHPGGD+VL+ AT KDAT DFE
Sbjct  1    MGSEAKVLSLEEVSKHDTKDDCWLIISGKVYDITPFLDDHPGGDEVLVLATKKDATEDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTS-SAPKQ  410
            D+GHS +AR+ +K YY+GDID N++P+K  Y P   S S P Q
Sbjct  61   DVGHSQNARDMLKDYYVGDIDVNSMPQKGQYKPASGSGSGPNQ  103



>ref|XP_008793730.1| PREDICTED: cytochrome b5-like [Phoenix dactylifera]
Length=134

 Score =   143 bits (361),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M SDAKV++ E+VSKHN  +DCW+II GKVYNVT +L+DHPGGD+VLL+ATGKDAT+DFE
Sbjct  1    MGSDAKVYTLEDVSKHNSNEDCWLIIGGKVYNVTKFLEDHPGGDEVLLSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS  AR  M +YY+G+ID+ T+P K  YT P      + K+   +  L   L  L I
Sbjct  61   DVGHSTTARAMMDEYYVGEIDATTIPTKVNYTAPKQPHYNQDKTSDFIIKLLQFLVPLAI  120

Query  462  lGFAVGFRYFNK  497
            LG AV  R + K
Sbjct  121  LGLAVAIRIYTK  132



>gb|ABK23699.1| unknown [Picea sitchensis]
Length=134

 Score =   143 bits (361),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 100/132 (76%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M SD KV+  E+VSKHN   DCW++I GKVY+VT +L+DHPGGD+VL++ATGKDAT+DFE
Sbjct  1    MDSDTKVYRLEDVSKHNTHQDCWLVIDGKVYDVTKFLEDHPGGDEVLISATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSS-APKQKSGGMMTllqfllplli  461
            D+GHS  AR  M +YY+GDID +T+P KP YTP   +   P + S  ++ +LQFL+PLLI
Sbjct  61   DVGHSSSARAMMDEYYVGDIDPSTIPSKPKYTPAKQAPYNPDKSSEFIIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNK  497
            LG AV  RY+ K
Sbjct  121  LGMAVAVRYYTK  132



>emb|CDY23792.1| BnaC04g43300D [Brassica napus]
Length=134

 Score =   143 bits (361),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  +AK+ +  EVS+HN   DCWI+I+ KVYNVT +L+DHPGGD+VLL++TGKDAT+DFE
Sbjct  1    MGEEAKIFTLSEVSEHNHAHDCWIVINAKVYNVTKFLEDHPGGDEVLLSSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS+ ARE M++YY+G+ID  T+P+K  YTPP      + K+   +  +   L  + I
Sbjct  61   DVGHSESAREMMEQYYVGEIDPTTIPKKTKYTPPKQPHYNQDKTSEFIIKILQFLVPIAI  120

Query  462  lGFAVGFRYFNKKE  503
            LG AVG R + K E
Sbjct  121  LGLAVGIRIYTKSE  134



>ref|NP_001236379.1| uncharacterized protein LOC100500069 [Glycine max]
 gb|ACU14816.1| unknown [Glycine max]
Length=142

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 103/137 (75%), Gaps = 5/137 (4%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M S  K  +FEEV+KHN + DCWII+ GKVY+VTP+LDDHPGGD+VL+TAT KDAT DFE
Sbjct  1    MGSKTKTFTFEEVAKHNHRKDCWIIVKGKVYDVTPFLDDHPGGDEVLVTATEKDATTDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTP---PPTSS--APKQKSGGMMTllqfll  449
            DIGHSD A E M+KY++G++D+NT+P +   +    PPT +     Q SG ++ +LQ+++
Sbjct  61   DIGHSDSATEMMEKYFVGEVDTNTLPAQVTSSSSVRPPTQAPVCNNQSSGFVVKILQYIV  120

Query  450  pllilGFAVGFRYFNKK  500
            PLLIL FA G +Y+ KK
Sbjct  121  PLLILVFAFGLQYYGKK  137



>ref|NP_001045534.1| Os01g0971500 [Oryza sativa Japonica Group]
 dbj|BAB63673.1| putative cytochrome b5 [Oryza sativa Japonica Group]
 dbj|BAF07448.1| Os01g0971500 [Oryza sativa Japonica Group]
 gb|EAY77397.1| hypothetical protein OsI_05385 [Oryza sativa Indica Group]
 gb|EAZ14988.1| hypothetical protein OsJ_04923 [Oryza sativa Japonica Group]
 gb|ABR25698.1| cytochrome b5 [Oryza sativa Indica Group]
 gb|ABR26100.1| cytochrome b5 [Oryza sativa Indica Group]
 dbj|BAH00198.1| unnamed protein product [Oryza sativa Japonica Group]
Length=135

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  SDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDI  290
            S+ KV + EEVSKHN KDDCW+II GKVYNVT +L+DHPGGDDVLL++T KDAT+DFED+
Sbjct  2    SNNKVLTLEEVSKHNTKDDCWLIIGGKVYNVTKFLEDHPGGDDVLLSSTAKDATDDFEDV  61

Query  291  GHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-llilG  467
            GHS  AR  M +YY+GDID+ T+P K  YTPP      + K+   +  +   L  L ILG
Sbjct  62   GHSTTARAMMDEYYVGDIDATTIPTKVKYTPPKQPHYNQDKTPEFIIKILQFLVPLAILG  121

Query  468  FAVGFRYFNKKE  503
             AV  R + K E
Sbjct  122  LAVAVRIYTKSE  133



>emb|CDX84725.1| BnaA03g15050D [Brassica napus]
Length=134

 Score =   143 bits (360),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M ++A + +  EVS+HN   DCWI+ISGKVYNVT +L+DHPGGD+VLL++TGKDAT+DFE
Sbjct  1    MGNEATIFTLSEVSEHNHAHDCWIVISGKVYNVTKFLEDHPGGDEVLLSSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS+ ARE M++YY+G+ID  T+P+K  YTPP      + K+   +  +   L  L I
Sbjct  61   DVGHSESAREMMEQYYVGEIDPTTIPKKTKYTPPKQPHYNQDKTSEFIIKILQFLVPLAI  120

Query  462  lGFAVGFRYFNK  497
            LG AVG R + K
Sbjct  121  LGLAVGIRIYTK  132



>ref|XP_002464365.1| hypothetical protein SORBIDRAFT_01g017020 [Sorghum bicolor]
 gb|EER91363.1| hypothetical protein SORBIDRAFT_01g017020 [Sorghum bicolor]
Length=134

 Score =   143 bits (360),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+ + KV  FEEV+KHN   DCWIII+GKVY+VTP++D+HPGGD+VLL  TGKDAT DFE
Sbjct  1    MAGENKVFGFEEVAKHNVTKDCWIIIAGKVYDVTPFMDEHPGGDEVLLAVTGKDATADFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            DIGHSD AR+ M+KY+IG ID++T+P K  Y  P  + +   K   ++  +   L  ++I
Sbjct  61   DIGHSDSARDMMEKYHIGQIDASTIPAKRTYVHPQQAPSHADKDNDLLIKILQFLVPIMI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A G R + K E
Sbjct  121  LGLAFGIRQYTKSE  134



>ref|XP_006598693.1| PREDICTED: uncharacterized protein LOC100305546 isoform X1 [Glycine 
max]
 ref|XP_006598694.1| PREDICTED: uncharacterized protein LOC100305546 isoform X2 [Glycine 
max]
 gb|KHN15904.1| Cytochrome b5 isoform 1 [Glycine soja]
Length=146

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 103/141 (73%), Gaps = 12/141 (9%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M S  K  +FEEV+KHN + DCWII+ GKVY+VTP+LDDHPGGD+VL+TAT KDAT DFE
Sbjct  1    MGSKTKTFTFEEVAKHNHRKDCWIIVKGKVYDVTPFLDDHPGGDEVLVTATEKDATTDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVP---------EKPIYTPPPTSSAPKQKSGGMMTll  437
            DIGHSD A + M+KY++G++D+NT+P          +P   PP  ++   Q SG ++ +L
Sbjct  61   DIGHSDSATQMMEKYFVGEVDTNTLPAQVTSNNSVRQPTQAPPAYNN---QSSGFVVKML  117

Query  438  qfllpllilGFAVGFRYFNKK  500
            Q+++PLLIL FA G +Y+ KK
Sbjct  118  QYIVPLLILAFAFGLQYYGKK  138



>ref|XP_006410400.1| hypothetical protein EUTSA_v10017407mg [Eutrema salsugineum]
 gb|ESQ51853.1| hypothetical protein EUTSA_v10017407mg [Eutrema salsugineum]
Length=134

 Score =   142 bits (359),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  +AK+ +  EVS+HN   DCWI+I+GKVYNVT +L+DHPGGD+VLL++TGKDAT+DFE
Sbjct  1    MGDEAKIFTLSEVSEHNHAHDCWIVINGKVYNVTKFLEDHPGGDEVLLSSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS+ ARE M++YY+G+ID  T+P+K  YTPP      + K+   +  +   L  L I
Sbjct  61   DVGHSESAREMMEQYYVGEIDPTTIPKKTKYTPPKQPHYNQDKTSEFIIKILQFLVPLAI  120

Query  462  lGFAVGFRYFNK  497
            LG AVG R + K
Sbjct  121  LGLAVGIRIYTK  132



>ref|XP_004982596.1| PREDICTED: cytochrome b5-like isoform X1 [Setaria italica]
 ref|XP_004982597.1| PREDICTED: cytochrome b5-like isoform X2 [Setaria italica]
Length=134

 Score =   142 bits (358),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 99/136 (73%), Gaps = 5/136 (4%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+ + KV  FEEV+KHN   DCWIII+GKVY+VTP++D+HPGGD+VLL  TGKDAT DFE
Sbjct  1    MADEKKVFGFEEVAKHNVTKDCWIIIAGKVYDVTPFMDEHPGGDEVLLAVTGKDATADFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPK---QKSGGMMTllqfllpl  455
            DIGHSD ARE M+KY+IG ID++T+P K  Y  P     P+     S  ++ +LQFL+P+
Sbjct  61   DIGHSDSAREMMEKYHIGQIDASTIPAKRTYVNP--QQVPRNVDNDSDLLIKILQFLVPI  118

Query  456  lilGFAVGFRYFNKKE  503
            LILG A G R + K E
Sbjct  119  LILGLAFGIRQYTKSE  134



>ref|XP_010413956.1| PREDICTED: cytochrome b5 isoform B-like [Camelina sativa]
Length=134

 Score =   142 bits (358),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  +AK+ +  +VS+HN+  DCW++++GKVYNVT +L+DHPGGDDVLL++TGKDAT+DFE
Sbjct  1    MGDEAKIFTLSQVSEHNQPQDCWLVMNGKVYNVTKFLEDHPGGDDVLLSSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS+ ARE M++YY+G+ID  T+P+K  YTPP      + K+   +  +   L  L I
Sbjct  61   DVGHSESAREMMEQYYVGEIDKTTIPKKVKYTPPKQPHYNQDKTSEFIIKILQFLVPLAI  120

Query  462  lGFAVGFRYFNK  497
            LG AVG R + K
Sbjct  121  LGLAVGIRIYTK  132



>ref|XP_002318471.2| cytochrome b5 isoform Cb5-C family protein [Populus trichocarpa]
 gb|ABK92912.1| unknown [Populus trichocarpa]
 gb|EEE96691.2| cytochrome b5 isoform Cb5-C family protein [Populus trichocarpa]
Length=134

 Score =   142 bits (358),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 104/133 (78%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  SDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDI  290
            + +KV+ F+E+SKHNK  DCW+IISGKVY+VT ++DDHPGGD+VLL++TGKDATNDFED+
Sbjct  2    ASSKVYLFDEISKHNKTKDCWLIISGKVYDVTSFMDDHPGGDEVLLSSTGKDATNDFEDV  61

Query  291  GHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPT-SSAPK-QKSGGMMTllqfllpllil  464
            GHSDDARE M+KY IG++D  TVP K +Y  P    + PK  K G ++ +LQ L+PLLIL
Sbjct  62   GHSDDAREMMEKYVIGEVDVTTVPTKRLYVAPGLGGTNPKDDKPGFLIKILQLLVPLLIL  121

Query  465  GFAVGFRYFNKKE  503
            G A+  R + KK+
Sbjct  122  GLALAVRTYTKKD  134



>ref|XP_004240459.1| PREDICTED: cytochrome b5-like [Solanum lycopersicum]
Length=135

 Score =   142 bits (358),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M S+ KV++ +EV+ HN   DCW++ISGKVY+VT +LDDHPGGD+VLL ATGKDAT+DFE
Sbjct  1    MGSETKVYTLQEVAPHNNAKDCWLVISGKVYDVTKFLDDHPGGDEVLLAATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS  AR  + +YY+GDIDS T+P K  YTPP      +  +   +  L   L  L+I
Sbjct  61   DVGHSSSARAMLDEYYVGDIDSATIPTKKAYTPPNQPHYNQDNTSEFIIKLLQFLVPLII  120

Query  462  lGFAVGFRYFNKK  500
            LG AVG R++ K+
Sbjct  121  LGVAVGIRFYTKQ  133



>ref|NP_001054434.1| Os05g0108800 [Oryza sativa Japonica Group]
 sp|P49100.2|CYB5_ORYSJ RecName: Full=Cytochrome b5 [Oryza sativa Japonica Group]
 gb|AAK73138.1|AC079022_11 cytochrome B5 [Oryza sativa]
 gb|AAU44139.1| cytochrome b5 [Oryza sativa Japonica Group]
 dbj|BAF16348.1| Os05g0108800 [Oryza sativa Japonica Group]
 gb|EAY96251.1| hypothetical protein OsI_18149 [Oryza sativa Indica Group]
 dbj|BAG89223.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62055.1| hypothetical protein OsJ_16839 [Oryza sativa Japonica Group]
 gb|AFI71841.1| cytochrome b5 protein [Oryza sativa]
Length=137

 Score =   142 bits (358),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 96/135 (71%), Gaps = 2/135 (1%)
 Frame = +3

Query  105  MSSD-AKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDF  281
            MS+D  KV++ EEV+KHN KDDCW+II GKVYNV+ +L+DHPGGDDVLL++TGKDAT+DF
Sbjct  1    MSNDNKKVYTLEEVAKHNSKDDCWLIIGGKVYNVSKFLEDHPGGDDVLLSSTGKDATDDF  60

Query  282  EDIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-ll  458
            ED+GHS  AR  M +YY+GDID++T+P +  Y PP      + K+   +  +   L  L 
Sbjct  61   EDVGHSTTARAMMDEYYVGDIDTSTIPARTKYVPPKQPHYNQDKTPEFIIKILQFLVPLA  120

Query  459  ilGFAVGFRYFNKKE  503
            ILG AV  R + K E
Sbjct  121  ILGLAVAIRIYTKSE  135



>gb|ACG48334.1| cytochrome b5 [Zea mays]
Length=134

 Score =   142 bits (357),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 100/134 (75%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+S+ KV  FEEV+KHN   DCWIII+GKVY+VTP++D+HPGGD+VLL  TGKDAT DFE
Sbjct  1    MASENKVFGFEEVAKHNVTKDCWIIIAGKVYDVTPFMDEHPGGDEVLLAVTGKDATADFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGM-MTllqfllplli  461
            DIGHSD AR+ M+KY+IG ID++T+P K  +  P  + +   K   + + +LQFL+P++I
Sbjct  61   DIGHSDSARDMMEKYHIGQIDASTIPAKRAHVQPQQAPSHADKDNDLPIKILQFLVPIMI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A G R + K E
Sbjct  121  LGLAFGIRQYTKSE  134



>ref|XP_010929918.1| PREDICTED: cytochrome b5-like [Elaeis guineensis]
Length=134

 Score =   141 bits (356),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M SD KV++  EVSKHN   DCW+II GKVY+VT +L+DHPGGD+VLL+ATGKDAT+DFE
Sbjct  1    MGSDTKVYTLAEVSKHNSNKDCWLIIDGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS  AR  M +YY+G+ID++TVP K  YTPP      + K+   +  L   L  L I
Sbjct  61   DVGHSTTARAMMDEYYVGEIDASTVPTKVKYTPPKQPRYNQDKTSDFIIKLLQFLVPLAI  120

Query  462  lGFAVGFRYFNK  497
            LG AV  R + K
Sbjct  121  LGLAVAIRIYTK  132



>ref|XP_009141270.1| PREDICTED: cytochrome b5 isoform B [Brassica rapa]
 emb|CDY19161.1| BnaA04g19010D [Brassica napus]
Length=134

 Score =   141 bits (356),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  +AK+ +  EVS+HN   DCWI+I+ KVYNVT +L+DHPGGD+VLL++TGKDAT+DFE
Sbjct  1    MGEEAKIFTLSEVSEHNHAHDCWIVINAKVYNVTKFLEDHPGGDEVLLSSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS+ ARE M++YY+G+ID  T+P+K  YTPP      + K+   +  +   L  + I
Sbjct  61   DVGHSESAREMMEQYYVGEIDPTTIPKKTKYTPPKQPHYNQDKTSEFIIKILQFLVPIAI  120

Query  462  lGFAVGFRYFNK  497
            LG AVG R + K
Sbjct  121  LGLAVGIRIYTK  132



>ref|XP_006653959.1| PREDICTED: cytochrome b5-like [Oryza brachyantha]
Length=134

 Score =   141 bits (356),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 93/130 (72%), Gaps = 1/130 (1%)
 Frame = +3

Query  117  AKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIGH  296
            +KV++ EEV+KHN KDDCW++I GKVYNV+ +L+DHPGGDDVLL++TGKDAT+DFED+GH
Sbjct  3    SKVYTLEEVAKHNSKDDCWLVIGGKVYNVSRFLEDHPGGDDVLLSSTGKDATDDFEDVGH  62

Query  297  SDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-llilGFA  473
            S  AR  M +YY+GDID++T+P +  Y PP      + K+   +  +   L  L ILG A
Sbjct  63   STTARAMMDEYYVGDIDASTIPARTKYVPPKQPHYNQDKTPEFIIKILQFLVPLAILGLA  122

Query  474  VGFRYFNKKE  503
            V  R + K E
Sbjct  123  VAIRIYTKSE  132



>emb|CAA53366.1| cytochrome b5 [Oryza sativa]
Length=137

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 96/135 (71%), Gaps = 2/135 (1%)
 Frame = +3

Query  105  MSSD-AKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDF  281
            MS+D  KV++ EEV+KHN KDDCW+II GKVYNV+ +L+DHPGGDDVLL++TGKDAT+DF
Sbjct  1    MSNDNKKVYTLEEVAKHNSKDDCWLIIGGKVYNVSKFLEDHPGGDDVLLSSTGKDATDDF  60

Query  282  EDIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-ll  458
            ED+GH+  AR  M +YY+GDID++T+P +  Y PP      + K+   +  +   L  L 
Sbjct  61   EDVGHTTTARAMMDEYYVGDIDTSTIPARTKYVPPKQPHYNQDKTPEFIIKILQFLVPLA  120

Query  459  ilGFAVGFRYFNKKE  503
            ILG AV  R + K E
Sbjct  121  ILGLAVAIRIYTKSE  135



>ref|XP_002457023.1| hypothetical protein SORBIDRAFT_03g047300 [Sorghum bicolor]
 gb|EES02143.1| hypothetical protein SORBIDRAFT_03g047300 [Sorghum bicolor]
Length=135

 Score =   141 bits (355),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  SDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDI  290
            S++KV++ EEV+KHN KDDCW++I GKVYNVT +LDDHPGGDDVLL++T KDAT+DFED+
Sbjct  2    SESKVYTLEEVAKHNTKDDCWLVIGGKVYNVTKFLDDHPGGDDVLLSSTAKDATDDFEDV  61

Query  291  GHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-llilG  467
            GHS  AR  M +Y +G+ID+ T+P K  YTPP      + K+   +  +   L  L ILG
Sbjct  62   GHSTTARAMMDEYLVGEIDAATIPTKVKYTPPKQPHYNQDKTPEFVIKILQFLVPLAILG  121

Query  468  FAVGFRYFNKKE  503
             AV  R + K E
Sbjct  122  LAVAVRIYTKSE  133



>ref|XP_009143942.1| PREDICTED: cytochrome b5 isoform B-like [Brassica rapa]
Length=150

 Score =   142 bits (357),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  +AK+ +  +VS+HNK  DCWI+I+GKVY+VT +L+DHPGGD+VLL++TGKDAT+DFE
Sbjct  17   MGDEAKIFTLSQVSEHNKAHDCWIVINGKVYDVTKFLEDHPGGDEVLLSSTGKDATDDFE  76

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS+ ARE M++YY+G+ID  T+P+K  YTPP      + K+   +  +   L  L I
Sbjct  77   DVGHSESAREMMEQYYVGEIDPTTIPKKTKYTPPKQPHYNQDKTSEFIIKILQFLVPLAI  136

Query  462  lGFAVGFRYFNK  497
            LG AVG R + K
Sbjct  137  LGLAVGIRIYTK  148



>ref|XP_009599430.1| PREDICTED: cytochrome b5-like [Nicotiana tomentosiformis]
Length=136

 Score =   141 bits (355),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  + KV++  EV+ HN   DCW++ISGKVY+VT +LDDHPGGD+VLL ATGKDAT+DFE
Sbjct  1    MGGETKVYTLAEVAPHNNNKDCWLVISGKVYDVTKFLDDHPGGDEVLLAATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS  AR  + +YY+GDIDS T+P K  YTPP      + K+   +  L   L  L+I
Sbjct  61   DVGHSSSARAMLDEYYVGDIDSATIPTKTKYTPPNQPHYNQDKTSEFVIKLLQFLVPLII  120

Query  462  lGFAVGFRYFNKKE  503
            LG AVG R++ K++
Sbjct  121  LGVAVGIRFYTKQQ  134



>ref|XP_010509977.1| PREDICTED: cytochrome b5 isoform B-like [Camelina sativa]
Length=134

 Score =   141 bits (355),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  +AK+ +  +VS+HN+  DCW++I+GKVYNVT +L+DHPGGDDVLL++TGKDAT+DFE
Sbjct  1    MGDEAKIFTLSQVSEHNQPQDCWLVINGKVYNVTKFLEDHPGGDDVLLSSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS+ AR  M++YY+G+ID  T+P+K  YTPP      + K+   +  +   L  L I
Sbjct  61   DVGHSESARLMMEQYYVGEIDKTTIPKKVKYTPPKQPHYNQDKTSEFIIKILQFLVPLAI  120

Query  462  lGFAVGFRYFNK  497
            LG AVG R + K
Sbjct  121  LGLAVGIRIYTK  132



>ref|XP_009766798.1| PREDICTED: cytochrome b5-like [Nicotiana sylvestris]
Length=136

 Score =   141 bits (355),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  + KV++  EV+ HN   DCW++ISGKVY+VT +LDDHPGGD+VLL ATGKDAT+DFE
Sbjct  1    MGGETKVYTLAEVAPHNNNKDCWLVISGKVYDVTKFLDDHPGGDEVLLAATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS  AR  + +YY+GDIDS T+P K  YTPP      + K+   +  L   L  L+I
Sbjct  61   DVGHSTSARAMLDEYYVGDIDSATIPTKTKYTPPNQPHYNQDKTSEFVIKLLQFLVPLII  120

Query  462  lGFAVGFRYFNKKE  503
            LG AVG R++ K++
Sbjct  121  LGVAVGIRFYTKQQ  134



>ref|NP_001239968.1| uncharacterized protein LOC100788796 [Glycine max]
 ref|XP_006576227.1| PREDICTED: uncharacterized protein LOC100788796 isoform X1 [Glycine 
max]
 gb|ACU20599.1| unknown [Glycine max]
 gb|KHN16415.1| Cytochrome b5 isoform 1 [Glycine soja]
Length=141

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 106/136 (78%), Gaps = 3/136 (2%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+S+ K  +FEEV+ HN K DCWIII+GKVY++TP+LD+HPGGD+VL+T+TGKDAT DFE
Sbjct  1    MASNPKPLTFEEVANHNNKKDCWIIINGKVYDITPFLDEHPGGDEVLVTSTGKDATIDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYT-PPPTSS--APKQKSGGMMTllqfllpl  455
            D+GHSD A E M+KY++G +D++T+P K  ++ P PT +  A  Q SG ++ +LQFLLP 
Sbjct  61   DVGHSDSAIEMMEKYFVGKVDTSTLPAKVNHSLPQPTQAGGAGNQSSGFVVKILQFLLPF  120

Query  456  lilGFAVGFRYFNKKE  503
            LILG A   +Y+ KK+
Sbjct  121  LILGLAFALQYYGKKK  136



>ref|XP_009393770.1| PREDICTED: cytochrome b5 isoform B [Musa acuminata subsp. malaccensis]
Length=134

 Score =   140 bits (354),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 93/134 (69%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M SDAKV++  EVS HN   DCW++++GKVY+VT +L+DHPGGDDVLL++TGKDAT+DFE
Sbjct  1    MGSDAKVYTLAEVSAHNTPQDCWLVVNGKVYDVTKFLEDHPGGDDVLLSSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS  AR  M +YYIG+ID+ T+PEK  YT P      + K+   +  L   L  L I
Sbjct  61   DVGHSTTARAMMDEYYIGEIDTATIPEKVKYTAPNQPHYNQDKTSEFIIKLLQFLVPLAI  120

Query  462  lGFAVGFRYFNKKE  503
            LG AV  R + K E
Sbjct  121  LGLAVAVRIYTKSE  134



>gb|EMS45540.1| Cytochrome b5 [Triticum urartu]
Length=137

 Score =   140 bits (354),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +3

Query  108  SSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFED  287
            SS  KV + EEV+KH  KDDCW++I GKVYNVT +LDDHPGGDDVLL++T KDAT+DFED
Sbjct  3    SSGGKVFTLEEVAKHTSKDDCWLVIGGKVYNVTKFLDDHPGGDDVLLSSTAKDATDDFED  62

Query  288  IGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-llil  464
            +GHS  AR  M +YY+G+ID+ T+P K  YTPP      + K+   +  +   L  L IL
Sbjct  63   VGHSTTARAMMDEYYVGEIDATTIPTKVKYTPPKQPHYNQDKTPEFVIKILQFLVPLAIL  122

Query  465  GFAVGFRYFNKKE  503
            G AV  R + K E
Sbjct  123  GLAVAVRIYTKAE  135



>gb|ACG44032.1| cytochrome b5 [Zea mays]
Length=134

 Score =   140 bits (354),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 100/134 (75%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+S+ KV  FEEV+KHN   DCWIII+GKVY+VTP++D+HPGGD+VLL  TGKDAT DFE
Sbjct  1    MASENKVFGFEEVAKHNVTKDCWIIIAGKVYDVTPFMDEHPGGDEVLLAVTGKDATADFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGM-MTllqfllplli  461
            DIGHSD AR+ M+KY+IG ID++T+P K  +  P  + +   K   + + +LQFL+P++I
Sbjct  61   DIGHSDSARDMMEKYHIGQIDASTIPPKRAHVHPQQAPSHADKDNDLPIKILQFLVPIMI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A G R + K E
Sbjct  121  LGLAFGIRQYTKSE  134



>gb|EPS57444.1| hypothetical protein M569_17373, partial [Genlisea aurea]
Length=137

 Score =   140 bits (354),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD K+ SFEE++KHN+ +DCW+II GKVY+VT +++DHPGGDDVLL++TGKDATNDF 
Sbjct  1    MASDLKLFSFEEIAKHNRSEDCWLIIDGKVYDVTEFMEDHPGGDDVLLSSTGKDATNDFL  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPP  386
            D+GHSD+ARETM+K+ +G++D++T+P K  +  P
Sbjct  61   DVGHSDNARETMEKFCVGEVDASTIPSKLTHASP  94



>ref|XP_007140599.1| hypothetical protein PHAVU_008G125800g [Phaseolus vulgaris]
 gb|ESW12593.1| hypothetical protein PHAVU_008G125800g [Phaseolus vulgaris]
Length=137

 Score =   140 bits (354),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 98/135 (73%), Gaps = 3/135 (2%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  +  V++  +VS+HN   DCW+II GKVYNVT +LDDHPGGDDVLL++TGKDAT+DFE
Sbjct  1    MGGERMVYTLAQVSEHNNSKDCWLIIDGKVYNVTKFLDDHPGGDDVLLSSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPP---PTSSAPKQKSGGMMTllqfllpl  455
            D+GHS  AR  +   Y+GDID  T+P KP  TPP     ++  K  SG M+ +LQFL+PL
Sbjct  61   DVGHSKSARAMLGDLYVGDIDPATMPAKPQPTPPKQLQNNNEKKTSSGFMIKMLQFLIPL  120

Query  456  lilGFAVGFRYFNKK  500
            ++LG AVG R++N K
Sbjct  121  IVLGLAVGVRFYNNK  135



>emb|CAA50575.1| cytochrome b5 [Nicotiana tabacum]
Length=139

 Score =   140 bits (354),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = +3

Query  99   LKMSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATND  278
            + M  + KV +  EVS+HN   DCW++ISGKVY+VT +LDDHPGGD+VLL+ATGKDAT+D
Sbjct  2    IIMGGETKVFTLAEVSQHNNAKDCWLVISGKVYDVTKFLDDHPGGDEVLLSATGKDATDD  61

Query  279  FEDIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-l  455
            FED+GHS  AR  + +YY+GDIDS T+P K  YTPP      + K+   +  L   L  L
Sbjct  62   FEDVGHSSSARAMLDEYYVGDIDSATIPTKTKYTPPNQPHYNQDKTSEFVVKLLQFLVPL  121

Query  456  lilGFAVGFRYFNKK  500
            +ILG A G R++ K+
Sbjct  122  IILGVAFGIRFYTKQ  136



>ref|XP_004247085.1| PREDICTED: cytochrome b5 [Solanum lycopersicum]
Length=133

 Score =   140 bits (353),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 93/129 (72%), Gaps = 1/129 (1%)
 Frame = +3

Query  117  AKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIGH  296
            AKV++  EVS+HN   DCW++I+GKVYNVT +LDDHPGGD+VL+++TGKDAT+DFED+GH
Sbjct  2    AKVYTLAEVSQHNSAKDCWLVINGKVYNVTKFLDDHPGGDEVLISSTGKDATDDFEDVGH  61

Query  297  SDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-llilGFA  473
            S  AR  + +YY+GDIDS T+P K  YTPP      + K+   +  L   L  L+ILG A
Sbjct  62   SSSARAMLDEYYVGDIDSATIPTKTKYTPPKQPQYNQDKTSEFVVKLLQFLVPLIILGVA  121

Query  474  VGFRYFNKK  500
             G R++ K+
Sbjct  122  FGIRFYTKQ  130



>ref|XP_009792131.1| PREDICTED: cytochrome b5 [Nicotiana sylvestris]
 sp|P49098.1|CYB5_TOBAC RecName: Full=Cytochrome b5 [Nicotiana tabacum]
Length=136

 Score =   140 bits (353),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  + KV +  EVS+HN   DCW++ISGKVY+VT +LDDHPGGD+VLL+ATGKDAT+DFE
Sbjct  1    MGGETKVFTLAEVSQHNNAKDCWLVISGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS  AR  + +YY+GDIDS T+P K  YTPP      + K+   +  L   L  L+I
Sbjct  61   DVGHSSSARAMLDEYYVGDIDSATIPTKTKYTPPNQPHYNQDKTSEFVVKLLQFLVPLII  120

Query  462  lGFAVGFRYFNKK  500
            LG A G R++ K+
Sbjct  121  LGVAFGIRFYTKQ  133



>ref|XP_008791612.1| PREDICTED: cytochrome b5 isoform A [Phoenix dactylifera]
 ref|XP_008791613.1| PREDICTED: cytochrome b5 isoform A [Phoenix dactylifera]
Length=135

 Score =   140 bits (353),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 102/132 (77%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M++ +K + F+EV+KHN   DCW++ISGKV++VTP++D+HPGGD+VLL  TGKDAT+DFE
Sbjct  1    MAAASKTYHFDEVAKHNVTKDCWVVISGKVFDVTPFMDEHPGGDEVLLAVTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSS-APKQKSGGMMTllqfllplli  461
            D+GHS  A+E M KY IG+IDS+++P K +Y PP  +S  P + S  ++ +LQFL+P+LI
Sbjct  61   DVGHSTSAKEMMSKYCIGEIDSSSIPTKRMYVPPQQASYNPDKTSEFVIKILQFLVPILI  120

Query  462  lGFAVGFRYFNK  497
            LG A   R+F K
Sbjct  121  LGLAFAVRHFTK  132



>dbj|BAJ94749.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87115.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99688.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03382.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=139

 Score =   140 bits (353),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +3

Query  108  SSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFED  287
            SS  KV + EEV+KH  KDDCW++I+GKVYNVT +LDDHPGGDDVLL++T KDAT+DFED
Sbjct  5    SSTTKVFTLEEVAKHASKDDCWLVIAGKVYNVTKFLDDHPGGDDVLLSSTAKDATDDFED  64

Query  288  IGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-llil  464
            +GHS  AR  M +YY+G+ID+ T+P K  Y PP      + K+   +  +   L  L IL
Sbjct  65   VGHSTTARAMMDEYYVGEIDATTIPTKVKYMPPKQPHYNQDKTPEFIIKILQFLVPLAIL  124

Query  465  GFAVGFRYFNKKE  503
            G AV  R + K E
Sbjct  125  GLAVAVRIYTKSE  137



>gb|KHN35403.1| Cytochrome b5 isoform 1 [Glycine soja]
Length=141

 Score =   140 bits (353),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 106/136 (78%), Gaps = 3/136 (2%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+S+ K  +FEEV+KHN K DCWIII+GKVY++TP+LD+HPGGD+VLLT+TGKDAT DFE
Sbjct  1    MASNPKTLTFEEVAKHNNKKDCWIIINGKVYDITPFLDEHPGGDEVLLTSTGKDATIDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYT---PPPTSSAPKQKSGGMMTllqfllpl  455
            D+GHSD A E M+KY+IG +D++T+P K  ++   P  T  A  Q SG ++ +LQFLLPL
Sbjct  61   DVGHSDSAIEMMEKYFIGKVDTSTLPPKVSHSLPQPTQTHGAGNQSSGFVVKILQFLLPL  120

Query  456  lilGFAVGFRYFNKKE  503
            LILG A   +Y+ +K+
Sbjct  121  LILGLAFALQYYGQKK  136



>ref|XP_006443603.1| hypothetical protein CICLE_v10022818mg [Citrus clementina]
 ref|XP_006479281.1| PREDICTED: cytochrome b5-like [Citrus sinensis]
 gb|ESR56843.1| hypothetical protein CICLE_v10022818mg [Citrus clementina]
 gb|KDO65927.1| hypothetical protein CISIN_1g032750mg [Citrus sinensis]
Length=134

 Score =   140 bits (352),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  + KV++  EVS HN + DCW+II GKVY+VT +LDDHPGGD+VLL+ATGKDAT+DFE
Sbjct  1    MGGEGKVYTLAEVSGHNDRKDCWLIIEGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS  A+  M ++Y+GDIDS+TVP K  YTPP      + K+   +  L   L  LLI
Sbjct  61   DVGHSSSAKAMMDEFYVGDIDSSTVPTKTKYTPPKQPHYNQDKTPEFIIKLLQFLVPLLI  120

Query  462  lGFAVGFRYFNK  497
            LG AVG R++ K
Sbjct  121  LGLAVGIRFYTK  132



>emb|CDY47080.1| BnaA03g12180D [Brassica napus]
Length=134

 Score =   140 bits (352),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 97/135 (72%), Gaps = 3/135 (2%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD KV +F+EVS+HNK+DDCW+IISGKVY+VTP++D HPGGDDVL    GKDAT DFE
Sbjct  1    MASD-KVFTFDEVSQHNKRDDCWLIISGKVYDVTPFMDVHPGGDDVLFAVAGKDATIDFE  59

Query  285  DIGHSDDARETMKKYYIGDIDSN-TVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-ll  458
            D+GHS+DARE MK+YYIG IDS+ TVP    Y  P   +  + K+   +  +   L  +L
Sbjct  60   DVGHSEDARELMKEYYIGGIDSSTTVPAARTYVAPVQPTFNQDKTPRFIIKILQFLLPIL  119

Query  459  ilGFAVGFRYFNKKE  503
            ILG A+  R + KKE
Sbjct  120  ILGLALFVRQYTKKE  134



>ref|XP_006356775.1| PREDICTED: cytochrome b5-like [Solanum tuberosum]
Length=133

 Score =   139 bits (351),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 93/129 (72%), Gaps = 1/129 (1%)
 Frame = +3

Query  117  AKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIGH  296
            AKV++  EVS+HN   DCW++ISGKVY+VT +LDDHPGGD+VL+++TGKDAT+DFED+GH
Sbjct  2    AKVYTLAEVSQHNSAKDCWLVISGKVYDVTKFLDDHPGGDEVLISSTGKDATDDFEDVGH  61

Query  297  SDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-llilGFA  473
            S  AR  + +YY+GDIDS T+P K  YTPP      + K+   +  L   L  L+ILG A
Sbjct  62   SSSARAMLDEYYVGDIDSATIPTKTKYTPPKQPQYNQDKTSEFVVKLLQFLVPLIILGVA  121

Query  474  VGFRYFNKK  500
             G R++ K+
Sbjct  122  FGIRFYTKQ  130



>gb|ACF84051.1| unknown [Zea mays]
 gb|ACG24679.1| cytochrome b5 [Zea mays]
 gb|ACG35561.1| cytochrome b5 [Zea mays]
 gb|AFW83857.1| cytochrome b5 [Zea mays]
Length=135

 Score =   140 bits (352),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  SDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDI  290
            S +KV++ EEV+KHN KDDCW++I GKVYNVT +L+DHPGGDDVLL++T KDAT+DFED+
Sbjct  2    SGSKVYTLEEVAKHNTKDDCWLVIGGKVYNVTKFLEDHPGGDDVLLSSTAKDATDDFEDV  61

Query  291  GHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-llilG  467
            GHS  AR  M +Y +G+ID+ T+P K  YTPP      + K+   +  +   L  L ILG
Sbjct  62   GHSSTARAMMDEYLVGEIDAATIPTKVKYTPPKQPHYNQDKTQEFVIKILQFLVPLAILG  121

Query  468  FAVGFRYFNKKE  503
             AV  R + K E
Sbjct  122  LAVAVRMYTKSE  133



>emb|CDJ26519.1| unnamed protein product [Triticum aestivum]
Length=137

 Score =   140 bits (352),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 92/133 (69%), Gaps = 1/133 (1%)
 Frame = +3

Query  108  SSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFED  287
            SS  K+ + EEV+KH+ KDDCW++I GKVYNVT +LDDHPGGDDVLL++T KDAT+DFED
Sbjct  3    SSGGKLFTLEEVAKHSSKDDCWLVIGGKVYNVTKFLDDHPGGDDVLLSSTAKDATDDFED  62

Query  288  IGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-llil  464
            +GHS  AR  M +YY+G+ID+ T+P K  YTPP      + K+   +  +   L  L IL
Sbjct  63   VGHSTTARAMMDEYYVGEIDATTIPTKVKYTPPKQPHYNQDKTPEFVIKILQFLVPLAIL  122

Query  465  GFAVGFRYFNKKE  503
            G AV  R + K E
Sbjct  123  GLAVAVRIYTKAE  135



>gb|ABA54490.1| cytochrome b5 type 11 [Crepis alpina]
Length=136

 Score =   139 bits (351),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD K   FE+V KHNK  DCW++I GKVY+VTP+++DHPGGD+VLL ATGKDAT+DFE
Sbjct  1    MASDPKNFVFEDVIKHNKTKDCWLVIDGKVYDVTPFMEDHPGGDEVLLAATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKS  416
            D+GHSDDAR  M KYYIG++D  TVP+K  Y  P  S+    K+
Sbjct  61   DVGHSDDARGMMHKYYIGEVDKATVPKKRAYVKPADSNYNHDKT  104



>ref|XP_009611133.1| PREDICTED: cytochrome b5 [Nicotiana tomentosiformis]
Length=136

 Score =   139 bits (351),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  + KV +  EVS+HN   DCW++ISGKVY+VT +LDDHPGGD+VLL+ATGKDAT+DFE
Sbjct  1    MGGETKVFTLAEVSQHNNAKDCWLVISGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS  AR  + +YY+GDIDS T+P K  YTPP      + K+   +  L   L  L+I
Sbjct  61   DVGHSSSARAMVDEYYVGDIDSATIPTKTKYTPPNQPHYNQDKTSEFVVKLLQFLVPLII  120

Query  462  lGFAVGFRYFNKK  500
            LG A G R++ K+
Sbjct  121  LGVAFGIRFYTKQ  133



>ref|XP_010245991.1| PREDICTED: cytochrome b5 [Nelumbo nucifera]
Length=135

 Score =   139 bits (351),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M +D KV++  EVS+HN   DCW++I GKVY+VT +L+DHPGGD+VLL+ATGKDAT+DFE
Sbjct  1    MGADGKVYTLAEVSQHNNSKDCWLVIGGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS  AR  M +Y++G+ID++T+P K  Y PP      + K+   +  L   L  L I
Sbjct  61   DVGHSSSARAMMDEYFVGEIDASTIPAKTKYIPPKQPHYNQDKTSEFIIKLLQFLVPLAI  120

Query  462  lGFAVGFRYFNK  497
            LG AVG R++ K
Sbjct  121  LGLAVGIRFYTK  132



>ref|XP_003565166.1| PREDICTED: cytochrome b5 [Brachypodium distachyon]
Length=138

 Score =   139 bits (351),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 91/130 (70%), Gaps = 1/130 (1%)
 Frame = +3

Query  117  AKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIGH  296
            +KV + EEV+KH+ KDDCW+IISGKVYNVT +LDDHPGGDDVLL++T KDAT+DFED+GH
Sbjct  7    SKVFTLEEVAKHSSKDDCWLIISGKVYNVTKFLDDHPGGDDVLLSSTAKDATDDFEDVGH  66

Query  297  SDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-llilGFA  473
            S  AR  M +YY+G+ID+ T+P K  YTP       + K+   +  +   L  L ILG A
Sbjct  67   STTARAMMDEYYVGEIDATTIPTKVKYTPAKQPHYNQDKTPEFVIKILQFLVPLAILGLA  126

Query  474  VGFRYFNKKE  503
            V  R + K E
Sbjct  127  VAVRIYTKSE  136



>ref|XP_007049778.1| Cytochrome B5, n4,ATCB5-B,CB5-B [Theobroma cacao]
 gb|EOX93935.1| Cytochrome B5, n4,ATCB5-B,CB5-B [Theobroma cacao]
Length=135

 Score =   139 bits (350),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M    KV++  EVS+HN   DCW++I GKVYNVT +L+DHPGGD+VLL+ATGKDAT+DFE
Sbjct  1    MGGRGKVYTLAEVSQHNNPKDCWLVIEGKVYNVTKFLEDHPGGDEVLLSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS  AR  M ++Y+GDID++T+P K  YTPP      + K+   +  L   L  LLI
Sbjct  61   DVGHSSSARAMMDEFYVGDIDTSTIPTKIKYTPPKQPHYDQDKTSEFVIKLLQFLVPLLI  120

Query  462  lGFAVGFRYFNK  497
            LG AVG R++ K
Sbjct  121  LGLAVGIRFYTK  132



>ref|XP_006352692.1| PREDICTED: cytochrome b5-like [Solanum tuberosum]
Length=132

 Score =   139 bits (349),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 92/129 (71%), Gaps = 1/129 (1%)
 Frame = +3

Query  117  AKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIGH  296
             KV +  EVS+HN   DCW+IISGKVY+VT +LDDHPGGDDVLL+ATGKDAT+DFED+GH
Sbjct  2    GKVFNLAEVSQHNNAKDCWLIISGKVYDVTKFLDDHPGGDDVLLSATGKDATDDFEDVGH  61

Query  297  SDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-llilGFA  473
            S  AR  + +YY+G+IDS+T+P    YTPP      + K+   +  +   L  L+ILG A
Sbjct  62   SSSARAMLDEYYVGEIDSSTIPTSVKYTPPKQPHYNQDKTTEFIIKILQFLVPLIILGVA  121

Query  474  VGFRYFNKK  500
            VG R++ K+
Sbjct  122  VGLRFYTKQ  130



>gb|ACG40422.1| cytochrome b5 [Zea mays]
Length=185

 Score =   140 bits (353),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 98/147 (67%), Gaps = 2/147 (1%)
 Frame = +3

Query  66   REPEPHSRLFKLKMSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVL  245
            R   P  +  K +MS  +KV++ EEV+KHN KDDCW++I GKVYNVT +L+DHPGGDDVL
Sbjct  38   RLLHPDRQQRKTRMSG-SKVYTLEEVAKHNTKDDCWLVIGGKVYNVTKFLEDHPGGDDVL  96

Query  246  LTATGKDATNDFEDIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGM  425
            L++T KDAT+DFED+GHS  AR  M +Y +G+ID+ T+P K  YTPP      + K+   
Sbjct  97   LSSTAKDATDDFEDVGHSSTARAMMDEYLVGEIDAATIPTKVKYTPPKQPHYNQDKTQEF  156

Query  426  MTllqfllp-llilGFAVGFRYFNKKE  503
            +  +   L  L ILG AV  R + K E
Sbjct  157  VIKILQFLVPLAILGLAVAVRMYTKSE  183



>gb|AFK34591.1| unknown [Lotus japonicus]
Length=141

 Score =   139 bits (350),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 103/135 (76%), Gaps = 3/135 (2%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+S++K+ +FE+V+ HN K DCWIII+GKVY+VTP+LDDHPGGD+ L+TAT KDAT DFE
Sbjct  1    MASNSKLLTFEDVALHNHKKDCWIIINGKVYDVTPFLDDHPGGDEALITATEKDATIDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEK---PIYTPPPTSSAPKQKSGGMMTllqfllpl  455
            D+GHSD A E M++Y++G++D+NT+P K       P   +++  + +G ++ +LQ+++PL
Sbjct  61   DVGHSDSAIEMMEQYFVGEVDTNTLPSKGGSSSAAPTQATASGNESAGALLKILQYVVPL  120

Query  456  lilGFAVGFRYFNKK  500
            L+LG A   +Y  KK
Sbjct  121  LLLGCAFALQYIGKK  135



>ref|NP_001136781.1| uncharacterized protein LOC100216924 [Zea mays]
 gb|ACF82620.1| unknown [Zea mays]
 gb|ACG32418.1| cytochrome b5 [Zea mays]
Length=135

 Score =   139 bits (349),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  SDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDI  290
            S +KV++ EEV+KHN KDDCW++I GKVYNVT +L+DHPGGDDVLL++T KDAT+DFED+
Sbjct  2    SGSKVYTLEEVAKHNTKDDCWLVIGGKVYNVTKFLEDHPGGDDVLLSSTAKDATDDFEDV  61

Query  291  GHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-llilG  467
            GHS  AR  M +Y +G+ID+ T+P K  YTPP      + K+   +  +   L  L ILG
Sbjct  62   GHSTTARAMMDEYLVGEIDAATIPSKVKYTPPKQPHYNQDKTPEFVIKILQFLVPLAILG  121

Query  468  FAVGFRYFNKKE  503
             AV  R + K E
Sbjct  122  LAVAVRIYTKSE  133



>ref|XP_008811745.1| PREDICTED: cytochrome b5-like [Phoenix dactylifera]
Length=132

 Score =   138 bits (348),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M SDAKV++ EE SKHN  +DCW++I GKVY+VT +L+DHPGGD+VLL++TGKDAT+DFE
Sbjct  1    MGSDAKVYTLEEASKHNSNEDCWLVIGGKVYDVTKFLEDHPGGDEVLLSSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS  AR  M +Y +G+ID++T+P K  YTPP      + ++   +  L   L  L I
Sbjct  61   DVGHSTTARAMMDEYCVGEIDASTIPTKVKYTPPKQPHYNQDRTSDFIIKLLQFLVPLAI  120

Query  462  lGFAVGFRYFNK  497
            LG AVG R + K
Sbjct  121  LGVAVGIRIYTK  132



>ref|XP_010264100.1| PREDICTED: cytochrome b5 [Nelumbo nucifera]
Length=135

 Score =   138 bits (348),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M +D KV++ EEVS+H    DCW+II GKVY++T +++DHPGGD+VLL+ATGKDAT+DFE
Sbjct  1    MGADGKVYTLEEVSQHRSSKDCWLIIGGKVYDLTKFMEDHPGGDEVLLSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS  AR  M ++YIG+ID++T+P+K  Y PP      + K+   +  L   L  L I
Sbjct  61   DVGHSSSARAMMDEFYIGEIDASTIPKKVKYAPPKQPHYNQDKTTEFIIKLLQFLVPLAI  120

Query  462  lGFAVGFRYFNK  497
            LG AVG R++ K
Sbjct  121  LGLAVGIRFYTK  132



>gb|AET01997.2| cytochrome b5-like heme/steroid-binding domain protein [Medicago 
truncatula]
Length=143

 Score =   139 bits (349),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 99/136 (73%), Gaps = 4/136 (3%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M S ++  +FE+V+KHN K+DCWII++ KVY+VTP+LDDHPGGD+ LL+ATGKDAT DFE
Sbjct  1    MGSKSETLTFEDVAKHNHKNDCWIIVNKKVYDVTPFLDDHPGGDEALLSATGKDATTDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSA----PKQKSGGMMTllqfllp  452
            D+GHSD A E M+KYY+G+ D+NT+P +    P     A      Q SG ++  LQ+L+P
Sbjct  61   DVGHSDSATEMMEKYYVGEFDANTLPVEARNNPTAPIQASTINSNQSSGVLLKFLQYLVP  120

Query  453  llilGFAVGFRYFNKK  500
            LLILG A   +Y+ K+
Sbjct  121  LLILGVAFALQYYGKR  136



>gb|AET01996.2| cytochrome b5-like heme/steroid-binding domain protein [Medicago 
truncatula]
Length=146

 Score =   139 bits (349),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 99/136 (73%), Gaps = 4/136 (3%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M S ++  +FE+V+KHN K+DCWII++ KVY+VTP+LDDHPGGD+ LL+ATGKDAT DFE
Sbjct  1    MGSKSETLTFEDVAKHNHKNDCWIIVNKKVYDVTPFLDDHPGGDEALLSATGKDATTDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSA----PKQKSGGMMTllqfllp  452
            D+GHSD A E M+KYY+G+ D+NT+P +    P     A      Q SG ++  LQ+L+P
Sbjct  61   DVGHSDSATEMMEKYYVGEFDANTLPVEARNNPTAPIQASTINSNQSSGVLLKFLQYLVP  120

Query  453  llilGFAVGFRYFNKK  500
            LLILG A   +Y+ K+
Sbjct  121  LLILGVAFALQYYGKR  136



>gb|KEH18604.1| cytochrome b5-like heme/steroid-binding domain protein [Medicago 
truncatula]
Length=177

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 99/136 (73%), Gaps = 4/136 (3%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M S ++  +FE+V+KHN K+DCWII++ KVY+VTP+LDDHPGGD+ LL+ATGKDAT DFE
Sbjct  1    MGSKSETLTFEDVAKHNHKNDCWIIVNKKVYDVTPFLDDHPGGDEALLSATGKDATTDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSA----PKQKSGGMMTllqfllp  452
            D+GHSD A E M+KYY+G+ D+NT+P +    P     A      Q SG ++  LQ+L+P
Sbjct  61   DVGHSDSATEMMEKYYVGEFDANTLPVEARNNPTAPIQASTINSNQSSGVLLKFLQYLVP  120

Query  453  llilGFAVGFRYFNKK  500
            LLILG A   +Y+ K+
Sbjct  121  LLILGVAFALQYYGKR  136



>ref|XP_003627519.1| Cytochrome b5 [Medicago truncatula]
 gb|ACJ84009.1| unknown [Medicago truncatula]
 gb|ACJ84172.1| unknown [Medicago truncatula]
 gb|AET01995.1| cytochrome b5-like heme/steroid-binding domain protein [Medicago 
truncatula]
 gb|AFK35757.1| unknown [Medicago truncatula]
Length=142

 Score =   138 bits (348),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 99/136 (73%), Gaps = 4/136 (3%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M S ++  +FE+V+KHN K+DCWII++ KVY+VTP+LDDHPGGD+ LL+ATGKDAT DFE
Sbjct  1    MGSKSETLTFEDVAKHNHKNDCWIIVNKKVYDVTPFLDDHPGGDEALLSATGKDATTDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSA----PKQKSGGMMTllqfllp  452
            D+GHSD A E M+KYY+G+ D+NT+P +    P     A      Q SG ++  LQ+L+P
Sbjct  61   DVGHSDSATEMMEKYYVGEFDANTLPVEARNNPTAPIQASTINSNQSSGVLLKFLQYLVP  120

Query  453  llilGFAVGFRYFNKK  500
            LLILG A   +Y+ K+
Sbjct  121  LLILGVAFALQYYGKR  136



>ref|XP_003626585.1| Cytochrome b5 [Medicago truncatula]
 gb|AES82803.1| cytochrome b5-like heme/steroid-binding domain protein [Medicago 
truncatula]
Length=142

 Score =   138 bits (348),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 102/135 (76%), Gaps = 3/135 (2%)
 Frame = +3

Query  108  SSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFED  287
            SS+AK   F+E++KHN K DCWIII+GKVY+VTP+LDDHPGG++ L+++TGKDAT DFED
Sbjct  3    SSNAKTFRFDEIAKHNNKTDCWIIINGKVYDVTPFLDDHPGGEESLISSTGKDATVDFED  62

Query  288  IGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPK---QKSGGMMTllqfllpll  458
            +GHSD A E M +Y++G +D++TVP K  +  PP++ A     Q SG +   LQFLLPLL
Sbjct  63   VGHSDSAIEMMHEYFVGHVDTSTVPTKVEHNSPPSTQAQSVRDQSSGFVTKTLQFLLPLL  122

Query  459  ilGFAVGFRYFNKKE  503
            IL FA   +++ KK+
Sbjct  123  ILAFAYAMQHYGKKK  137



>ref|XP_008656842.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome b5 [Zea mays]
Length=198

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 98/147 (67%), Gaps = 2/147 (1%)
 Frame = +3

Query  66   REPEPHSRLFKLKMSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVL  245
            R   P  +  K +MS  +KV++ EEV+KHN KDDCW++I GKVYNVT +L+DHPGGDDVL
Sbjct  51   RLLHPDRQQRKTRMSG-SKVYTLEEVAKHNTKDDCWLVIGGKVYNVTKFLEDHPGGDDVL  109

Query  246  LTATGKDATNDFEDIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGM  425
            L++T KDAT+DFED+GHS  AR  M +Y +G+ID+ T+P K  YTPP      + K+   
Sbjct  110  LSSTAKDATDDFEDVGHSSTARAMMDEYLVGEIDAATIPTKVKYTPPKQPHYNQDKTQEF  169

Query  426  MTllqfllp-llilGFAVGFRYFNKKE  503
            +  +   L  L ILG AV  R + K E
Sbjct  170  VIKILQFLVPLAILGLAVAVRMYTKSE  196



>ref|XP_004296652.1| PREDICTED: cytochrome b5 isoform B [Fragaria vesca subsp. vesca]
Length=134

 Score =   138 bits (347),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  D KV +  +VS HN   DCW+II+GKVY+VT +L+DHPGGDDVLL+ATGKDAT+DFE
Sbjct  1    MGGDEKVFTLAQVSDHNTPKDCWLIINGKVYDVTKFLEDHPGGDDVLLSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD+AR+ +K +Y+G+ID +T+P+K  YTPP      + K+   +  L   L  + I
Sbjct  61   DVGHSDNARDMLKDFYVGEIDVSTIPKKTAYTPPKQPHYNQDKTSEFIIKLLQFLVPIAI  120

Query  462  lGFAVGFRYFNK  497
            LG A G R + K
Sbjct  121  LGLAFGIRLYTK  132



>ref|XP_004133794.1| PREDICTED: cytochrome b5-like [Cucumis sativus]
 ref|XP_004155188.1| PREDICTED: cytochrome b5-like [Cucumis sativus]
 gb|KGN56392.1| hypothetical protein Csa_3G119260 [Cucumis sativus]
Length=145

 Score =   138 bits (348),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 102/145 (70%), Gaps = 12/145 (8%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD K+  F+EV+KHN + DCW+IISGKVY+VTP+L+DHPGGD+VLL AT KDAT DFE
Sbjct  1    MASDPKLFVFDEVAKHNHQADCWLIISGKVYDVTPFLEDHPGGDEVLLLATEKDATEDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSS------------APKQKSGGMM  428
             + HS DA E M+KYYIG+ID +T+P+   + PP + S            +  Q SG ++
Sbjct  61   TVSHSLDATEEMEKYYIGNIDMSTIPKPADHRPPASKSESAATEAATEKTSSAQSSGSLI  120

Query  429  TllqfllpllilGFAVGFRYFNKKE  503
             +LQ L+PLLI+G A   +Y+ KK+
Sbjct  121  KVLQVLIPLLIIGVAFYLQYYGKKQ  145



>ref|XP_009371627.1| PREDICTED: cytochrome b5-like [Pyrus x bretschneideri]
Length=136

 Score =   138 bits (347),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+ D KV++  EVS H+ + DCW++I GKVY+VT +L+DHPGGD+VLL ATGKDA+NDFE
Sbjct  1    MAGDKKVYTLAEVSTHSDRKDCWLVIDGKVYDVTKFLEDHPGGDEVLLAATGKDASNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            DIGHS  AR  M ++Y+GDIDS ++P K +YTPP      + K+   +  L   L  LLI
Sbjct  61   DIGHSSTARAMMDEFYVGDIDSASIPAKRMYTPPKQPHYNQDKTTDFVIKLLQFLVPLLI  120

Query  462  lGFAVGFRYFNK  497
            LG A G R++ K
Sbjct  121  LGLAFGVRFYTK  132



>gb|AAT84460.1| cytochrome b5 isoform Cb5-C [Vernicia fordii]
Length=136

 Score =   137 bits (346),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M S  KV +  EVS+HN   DCW++I GKVY+VT +L+DHPGGD+VLL+ATGKDAT+DFE
Sbjct  1    MGSSGKVFTLAEVSEHNNPKDCWLVIEGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS  AR  M ++Y+G+IDS+T+P +  YTPP      + K+   +      +  LLI
Sbjct  61   DVGHSSSARAMMDEFYVGEIDSSTIPSRMAYTPPKQPHYNQDKTMEFIIKFLQFVVPLLI  120

Query  462  lGFAVGFRYFNK  497
            LG AVG R++ K
Sbjct  121  LGLAVGIRFYTK  132



>dbj|BAJ92137.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=134

 Score =   137 bits (345),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 90/126 (71%), Gaps = 1/126 (1%)
 Frame = +3

Query  129  SFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIGHSDDA  308
            + EEVSKHN KDDCW+II+GKVY+VT +L+DHPGGDDVLL++TGKDAT+DFED+GHS  A
Sbjct  7    TLEEVSKHNTKDDCWLIIAGKVYDVTKFLEDHPGGDDVLLSSTGKDATDDFEDVGHSTTA  66

Query  309  RETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-llilGFAVGFR  485
            R  + ++Y+GD+D+ T+P +  YTPP      + K+   +  +   L  L ILG AV  R
Sbjct  67   RAMLDEFYVGDVDTTTIPARTKYTPPKQPHYNQDKTPEFIIKILQFLVPLAILGLAVAIR  126

Query  486  YFNKKE  503
             + K E
Sbjct  127  MYTKSE  132



>ref|XP_004971419.1| PREDICTED: cytochrome b5-like [Setaria italica]
Length=135

 Score =   137 bits (345),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  SDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDI  290
            S +KV + EEV+KHN KDDCW+II GKVYNVT +L+DHPGGDDVLL++T KDAT+DFED+
Sbjct  2    SSSKVFTLEEVAKHNTKDDCWLIIGGKVYNVTKFLEDHPGGDDVLLSSTAKDATDDFEDV  61

Query  291  GHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-llilG  467
            GHS  AR  M +Y +G+ID+ T+P K  Y PP      + K+   +  +   L  L ILG
Sbjct  62   GHSTTARAMMDEYLVGEIDATTIPTKVKYMPPKQPHYNQDKTPEFIIKILQFLVPLAILG  121

Query  468  FAVGFRYFNKKE  503
             AV  R + K E
Sbjct  122  LAVAVRIYTKSE  133



>gb|EMT13800.1| Cytochrome b5 [Aegilops tauschii]
Length=134

 Score =   137 bits (345),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 87/126 (69%), Gaps = 1/126 (1%)
 Frame = +3

Query  129  SFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIGHSDDA  308
            + EEVSKHN KDDCW+II+GKVYNVT +L+DHPGGDDVLL++T KDAT+DFED+GHS  A
Sbjct  7    TLEEVSKHNTKDDCWLIIAGKVYNVTKFLEDHPGGDDVLLSSTAKDATDDFEDVGHSSTA  66

Query  309  RETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-llilGFAVGFR  485
            R  + +YY+GDID  T+P +  Y PP      + K+   +  +   L  L ILG AV  R
Sbjct  67   RAMLDEYYVGDIDMATIPARTKYAPPKQPHYNQDKTPEFIIKILQFLVPLAILGLAVAIR  126

Query  486  YFNKKE  503
             + K E
Sbjct  127  MYTKSE  132



>ref|XP_009389266.1| PREDICTED: cytochrome b5 isoform A-like [Musa acuminata subsp. 
malaccensis]
Length=133

 Score =   137 bits (345),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 96/130 (74%), Gaps = 1/130 (1%)
 Frame = +3

Query  111  SDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDI  290
            +D+K++ F+EV+KH    DCW+IISGKVY+VT ++D+HPGGDDVLLTA+GKDATNDFEDI
Sbjct  2    ADSKIYHFDEVAKHKGAKDCWLIISGKVYDVTQFMDEHPGGDDVLLTASGKDATNDFEDI  61

Query  291  GHSDDARETMKKYYIGDIDSNTVPEKPIYTP-PPTSSAPKQKSGGMMTllqfllpllilG  467
            GHS+ ARE M KYYIG ID++T+P K  Y         P      ++ +LQFLLP++ILG
Sbjct  62   GHSNAAREMMDKYYIGKIDASTLPTKDSYVQKQQVIHKPDNSPEFVIKILQFLLPVMILG  121

Query  468  FAVGFRYFNK  497
             A   RYF K
Sbjct  122  LAFAVRYFTK  131



>ref|XP_006420893.1| hypothetical protein CICLE_v10006192mg [Citrus clementina]
 ref|XP_006493802.1| PREDICTED: cytochrome b5 isoform B-like [Citrus sinensis]
 gb|ESR34133.1| hypothetical protein CICLE_v10006192mg [Citrus clementina]
Length=135

 Score =   137 bits (345),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 91/129 (71%), Gaps = 1/129 (1%)
 Frame = +3

Query  114  DAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIG  293
            D KV +  EVS HN   DCW+II+GKVY+VT +L+DHPGGD+VLL+ATGKDAT+DFED+G
Sbjct  5    DGKVFTLAEVSDHNNMKDCWLIINGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVG  64

Query  294  HSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-llilGF  470
            HS  ARE M +YY+G+ID +T+P+K  YTPP      + K+   +  L   L  L ILG 
Sbjct  65   HSPSAREMMDQYYVGEIDVSTIPKKKEYTPPKQPHYNQDKTSEFIIRLLQFLVPLAILGL  124

Query  471  AVGFRYFNK  497
            AVG R + K
Sbjct  125  AVGIRIYTK  133



>ref|XP_008372473.1| PREDICTED: cytochrome b5 [Malus domestica]
Length=136

 Score =   137 bits (345),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+ D KV++  EVS H+ + DCW++I GKVY+VT +L+DHPGGD+VLL ATGKDA+NDFE
Sbjct  1    MAGDKKVYTLAEVSXHSDRKDCWLVIDGKVYDVTKFLEDHPGGDEVLLAATGKDASNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS  AR  M ++Y+GDI+S ++P K +YTPP      + K+   +  L   +  LLI
Sbjct  61   DVGHSSTARAMMDEFYVGDIBSASIPAKRMYTPPKQPHYNQDKTTDFVIKLLQFIVPLLI  120

Query  462  lGFAVGFRYFNK  497
            LG A G R++ K
Sbjct  121  LGLAFGVRFYTK  132



>ref|XP_009611358.1| PREDICTED: cytochrome b5, seed isoform [Nicotiana tomentosiformis]
 sp|P49099.1|CYB5S_TOBAC RecName: Full=Cytochrome b5, seed isoform [Nicotiana tabacum]
 emb|CAA56318.1| cytochrome b5 [Nicotiana tabacum]
Length=135

 Score =   137 bits (344),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M   +KV +  EVS HN   DCW+IISGKVYNVT +L+DHPGG +VLL+ATGKDAT+DFE
Sbjct  1    MGGQSKVFTLAEVSNHNNAKDCWLIISGKVYNVTKFLEDHPGGGEVLLSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPP  386
            DIGHS  AR  + +YY+GDIDS+T+P K  YTPP
Sbjct  61   DIGHSSSARAMLDEYYVGDIDSSTIPTKVKYTPP  94



>gb|EMS64911.1| Cytochrome b5 [Triticum urartu]
Length=134

 Score =   137 bits (344),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 89/126 (71%), Gaps = 1/126 (1%)
 Frame = +3

Query  129  SFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIGHSDDA  308
            + EEVSKHN KDDCW+II+GKVY+VT +L+DHPGGDDVLL++T KDAT+DFED+GHS  A
Sbjct  7    TLEEVSKHNTKDDCWLIIAGKVYDVTKFLEDHPGGDDVLLSSTAKDATDDFEDVGHSTTA  66

Query  309  RETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-llilGFAVGFR  485
            R  + +YY+GD+D+ T+P +  YTPP      + K+   +  +   L  L ILG AV  R
Sbjct  67   RAMLDEYYVGDVDTATIPARTKYTPPKQPHYNQDKTPEFIIKILQFLVPLAILGLAVAIR  126

Query  486  YFNKKE  503
             + K E
Sbjct  127  MYTKSE  132



>emb|CDY12180.1| BnaC04g12100D [Brassica napus]
Length=156

 Score =   137 bits (345),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  +AK+ +  +VS+HN+  DCWI+I+GKVY+VT +L+DHPGGD+VLL++TGKDAT+DFE
Sbjct  23   MGDEAKIFTLSQVSEHNQAHDCWIVINGKVYDVTKFLEDHPGGDEVLLSSTGKDATDDFE  82

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS+ ARE M++Y +G+ID  T+P+K  YTPP      + K+   +  +   L  L I
Sbjct  83   DVGHSESAREMMEQYCVGEIDPTTIPKKTKYTPPKQPHYNQDKTSEFIIKILQFLVPLAI  142

Query  462  lGFAVGFRYFNK  497
            LG AVG R + K
Sbjct  143  LGLAVGIRIYTK  154



>gb|AAT84459.1| cytochrome b5 isoform Cb5-B [Vernicia fordii]
Length=134

 Score =   136 bits (343),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 89/132 (67%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  D KV +  +VS+HN   DCW+II GKVY+VT +LDDHPGGD+VLL+ATGKDAT+DFE
Sbjct  1    MGGDKKVFTLAQVSQHNNPKDCWLIIGGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS  ARE M +YY+G+ID +TVP+K  Y PP      + K+   +  L   L    I
Sbjct  61   DVGHSLSAREMMDQYYVGEIDPSTVPKKATYKPPKQPHYNQDKTSEFIIKLLQFLVPFAI  120

Query  462  lGFAVGFRYFNK  497
            LG A G R + K
Sbjct  121  LGLAFGIRLYTK  132



>ref|XP_009348240.1| PREDICTED: cytochrome b5 isoform B-like [Pyrus x bretschneideri]
 ref|XP_009348243.1| PREDICTED: cytochrome b5 isoform B-like [Pyrus x bretschneideri]
Length=134

 Score =   136 bits (343),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M S  KV +  +VS+HN   DCW+II+GKVY+VT +L+DHPGGDDVL++ATGKDAT+DFE
Sbjct  1    MGSGGKVFTLAQVSEHNTPKDCWLIINGKVYDVTKFLEDHPGGDDVLVSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD+AR+ +K +Y+G+ID++T+P+   YTPP      + K+   +  L   L  + I
Sbjct  61   DVGHSDNARDMLKDFYVGEIDASTIPKSSTYTPPKQPYYNQDKTSEFIVKLLQFLVPIAI  120

Query  462  lGFAVGFRYFNK  497
            LG A G R + K
Sbjct  121  LGLAFGVRLYTK  132



>ref|XP_006661960.1| PREDICTED: cytochrome b5-like [Oryza brachyantha]
Length=133

 Score =   136 bits (343),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+ + KV  FEEV+ HN   DCW+II+GKVY+VT ++D+HPGGD+VLL  TGKDATNDFE
Sbjct  1    MAGEKKVFGFEEVAGHNVTKDCWLIIAGKVYDVTSFMDEHPGGDEVLLAVTGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllpllil  464
            DIGHS+ ARE M+KY IG+ID++T+P K  +  P    +  +    ++ +LQFL+P+LIL
Sbjct  61   DIGHSESAREMMEKYLIGEIDASTIPVKRTHVSPQQVPSNDKGDDMLIKILQFLVPILIL  120

Query  465  GFAVGFRYFNKKE  503
            G A   R + K E
Sbjct  121  GLAFAIRQYTKSE  133



>ref|XP_010522424.1| PREDICTED: cytochrome b5 isoform B [Tarenaya hassleriana]
Length=134

 Score =   136 bits (343),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+ + K+ +  EVS+HN   DCW++I+GKVY+VT +L+DHPGGD+VLL++TGKDAT+DFE
Sbjct  1    MADEGKIFALSEVSQHNHAKDCWLVINGKVYDVTKFLEDHPGGDEVLLSSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS+ ARE M +Y +G+ID+ T+P+K  YTPP      + K+   +  +   L  L I
Sbjct  61   DVGHSESAREMMGQYCVGEIDTETIPKKTKYTPPQQPHYNQDKTSEFIVKILQFLVPLAI  120

Query  462  lGFAVGFRYFNK  497
            LG AVG R + K
Sbjct  121  LGLAVGIRIYTK  132



>ref|XP_010100688.1| Cytochrome b5, seed isoform [Morus notabilis]
 gb|EXB83850.1| Cytochrome b5, seed isoform [Morus notabilis]
Length=134

 Score =   136 bits (343),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+ D+KV +F+EV+KHN K DCWIIISGKVYNVT +L++HPGGD+VLL A  KDAT+DFE
Sbjct  1    MARDSKVFAFDEVAKHNHKKDCWIIISGKVYNVTEFLEEHPGGDEVLLLAAEKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEK  368
            D+GHSD ARE M+KYY+G +D +T+PEK
Sbjct  61   DVGHSDTAREMMEKYYVGKVDVSTLPEK  88



>gb|KJB42467.1| hypothetical protein B456_007G154500 [Gossypium raimondii]
Length=135

 Score =   136 bits (343),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  + KV++  EVS+HN   DCW+II GKVY+VT +L+DHPGGD+VLL+ATGKDA++DFE
Sbjct  1    MGGEGKVYTLAEVSQHNNAKDCWLIIEGKVYDVTKFLEDHPGGDEVLLSATGKDASDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS  AR  M ++Y+GD+D++T+P K  YTPP      + K+   +  L   L  LLI
Sbjct  61   DVGHSSSARAMMDEFYVGDVDTSTIPTKTKYTPPKQPHYEQDKTSDFVIKLLQFLVPLLI  120

Query  462  lGFAVGFRYFNK  497
            LG A G R++ K
Sbjct  121  LGLAFGVRFYTK  132



>ref|NP_001237928.1| uncharacterized protein LOC100306380 [Glycine max]
 gb|ACU14522.1| unknown [Glycine max]
Length=141

 Score =   136 bits (343),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 105/136 (77%), Gaps = 3/136 (2%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+S+ K  +FEEV+KHN K DCWIII+GKV ++TP+LD+HPGGD+VLLT+TGKDAT DFE
Sbjct  1    MASNPKTLTFEEVAKHNNKKDCWIIINGKVCDITPFLDEHPGGDEVLLTSTGKDATIDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYT---PPPTSSAPKQKSGGMMTllqfllpl  455
            D+GHSD A E M+KY+IG +D++T+P K  ++   P  T  A  Q SG ++ +LQFLLPL
Sbjct  61   DVGHSDSAIEMMEKYFIGKVDTSTLPPKVSHSLPQPTQTHGAGNQSSGFVVKILQFLLPL  120

Query  456  lilGFAVGFRYFNKKE  503
            LILG A   +Y+ +K+
Sbjct  121  LILGLAFALQYYGQKK  136



>ref|NP_001065073.2| Os10g0518200 [Oryza sativa Japonica Group]
 gb|AAK39593.1|AC025296_28 putative cytochrome [Oryza sativa Japonica Group]
 gb|AAP54641.1| Cytochrome b5, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF26987.2| Os10g0518200 [Oryza sativa Japonica Group]
Length=134

 Score =   136 bits (343),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 91/134 (68%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+ + KV  FEEV+ HN   DCW+II+GKVY+VT ++D+HPGGD+VLL  TGKDATNDFE
Sbjct  1    MAGEKKVFGFEEVAGHNVTKDCWLIIAGKVYDVTSFMDEHPGGDEVLLAVTGKDATNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            DIGHS+ ARE M+KY IG+ID++T+P K  +  P  +     K   M+  +   L  +LI
Sbjct  61   DIGHSESAREMMEKYLIGEIDASTIPVKRTHVTPQQAPGNPDKGDDMLIKILQFLVPILI  120

Query  462  lGFAVGFRYFNKKE  503
            LG A   R + K E
Sbjct  121  LGLAFAIRQYTKSE  134



>ref|NP_199692.1| cytochrome B5 isoform D [Arabidopsis thaliana]
 sp|Q9ZWT2.1|CYB5D_ARATH RecName: Full=Cytochrome B5 isoform D; Short=AtCb5-D; AltName: 
Full=Cytochrome b5 isoform B; Short=AtCb5-B [Arabidopsis thaliana]
 gb|AAK44071.1|AF370256_1 putative cytochrome b5 protein [Arabidopsis thaliana]
 dbj|BAA74840.1| cytochrome b5 [Arabidopsis thaliana]
 dbj|BAB09434.1| cytochrome b5 [Arabidopsis thaliana]
 gb|AAL34247.1| putative cytochrome b5 protein [Arabidopsis thaliana]
 gb|AAM63789.1| cytochrome b5 (dbj|BAA74840.1) [Arabidopsis thaliana]
 gb|AED95727.1| cytochrome B5 isoform D [Arabidopsis thaliana]
Length=140

 Score =   136 bits (343),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 98/134 (73%), Gaps = 3/134 (2%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  D KV +  EVS+H+   DCWI+I GKVY+VT +LDDHPGGD+V+LT+TGKDAT+DFE
Sbjct  1    MGGDGKVFTLSEVSQHSSAKDCWIVIDGKVYDVTKFLDDHPGGDEVILTSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQK---SGGMMTllqfllpl  455
            D+GHS  A+  + +YY+GDID+ TVP K  + PP ++ A   +   S  ++ LLQFL+PL
Sbjct  61   DVGHSSTAKAMLDEYYVGDIDTATVPVKAKFVPPTSTKAVATQDKSSDFVIKLLQFLVPL  120

Query  456  lilGFAVGFRYFNK  497
            LILG A G RY+ K
Sbjct  121  LILGLAFGIRYYTK  134



>ref|XP_007223823.1| hypothetical protein PRUPE_ppa013221mg [Prunus persica]
 gb|EMJ25022.1| hypothetical protein PRUPE_ppa013221mg [Prunus persica]
Length=134

 Score =   136 bits (342),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  D K  +  +VS+HN   DCW+II+GKVY+VT +L+DHPGGDDVLL+ATGKDAT+DFE
Sbjct  1    MGVDGKFFTLAQVSEHNTPKDCWLIINGKVYDVTKFLEDHPGGDDVLLSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD+AR+ +K  Y+GDID++T+P    YTPP      + K+   +  L   L  + I
Sbjct  61   DVGHSDNARDMLKDMYVGDIDASTIPSSTTYTPPKQPHYNQDKTSEFIVKLLQFLVPIAI  120

Query  462  lGFAVGFRYFNK  497
            LG A G R + K
Sbjct  121  LGLAFGIRLYTK  132



>ref|XP_002323982.1| hypothetical protein POPTR_0017s08140g [Populus trichocarpa]
 gb|ABK94157.1| unknown [Populus trichocarpa]
 gb|EEF04115.1| hypothetical protein POPTR_0017s08140g [Populus trichocarpa]
Length=134

 Score =   136 bits (342),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  D KV +FEEV+ HN   DCW+II+GKVY+VT +++DHPGGD+VLL++TG+DAT+DFE
Sbjct  1    MGGDGKVFTFEEVTVHNNHKDCWLIINGKVYDVTKFMEDHPGGDEVLLSSTGQDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD ARE M +Y IGDID++TVP+K  Y  P      + K+   +  L   L  L I
Sbjct  61   DVGHSDSAREMMGEYCIGDIDASTVPQKTKYRTPKQPHYNQDKTSEFIIKLLQFLVPLAI  120

Query  462  lGFAVGFRYFNK  497
            LG A G R + K
Sbjct  121  LGLAFGLRLYTK  132



>emb|CDY59638.1| BnaAnng16110D [Brassica napus]
Length=134

 Score =   136 bits (342),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M   AK+ +  +VS+HN+  DCWI+I+GKVY+VT +L+DHPGGD+VLL++TGKDAT+DFE
Sbjct  1    MGDKAKIFTLSQVSEHNQAHDCWIVINGKVYDVTKFLEDHPGGDEVLLSSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS+ ARE M++Y +G+ID  T+P+K  YTPP      + K+   +  +   L  L I
Sbjct  61   DVGHSESAREMMEQYCVGEIDPTTIPKKTKYTPPKQPHYNQDKTSEFIIKILQFLVPLAI  120

Query  462  lGFAVGFRYFNK  497
            LG AVG R + K
Sbjct  121  LGLAVGIRIYTK  132



>ref|XP_004242405.1| PREDICTED: cytochrome b5-like [Solanum lycopersicum]
Length=133

 Score =   136 bits (342),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 92/129 (71%), Gaps = 1/129 (1%)
 Frame = +3

Query  117  AKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIGH  296
             KV +  EVS+HN   DCW+IISGKVY+VT +L+DHPGGDDVLL+ATGKDAT+DFED+GH
Sbjct  2    GKVFNLAEVSQHNNAKDCWLIISGKVYDVTKFLEDHPGGDDVLLSATGKDATDDFEDVGH  61

Query  297  SDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-llilGFA  473
            S  AR  + +YY+G+IDS+T+P    YTPP      + K+   +  +   L  L+ILG A
Sbjct  62   SSSARAMLDEYYVGEIDSSTIPTSVKYTPPKQPHYNQDKTTEFIIKILQFLVPLIILGGA  121

Query  474  VGFRYFNKK  500
            VG R++ K+
Sbjct  122  VGLRFYTKQ  130



>ref|XP_007133998.1| hypothetical protein PHAVU_010G010400g [Phaseolus vulgaris]
 gb|ESW05992.1| hypothetical protein PHAVU_010G010400g [Phaseolus vulgaris]
Length=135

 Score =   136 bits (342),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 91/130 (70%), Gaps = 1/130 (1%)
 Frame = +3

Query  117  AKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIGH  296
            +KV +  EVS+HN   DCW++I GKVYNVT +L+DHPGGDDVLL++TGKDATNDFEDIGH
Sbjct  6    SKVFTLAEVSQHNNVQDCWLVIHGKVYNVTKFLEDHPGGDDVLLSSTGKDATNDFEDIGH  65

Query  297  SDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-llilGFA  473
            S  A   M ++Y+GDID++++P K  YTPP      + K+   +  +   L  L ILG A
Sbjct  66   STSAVAMMDEFYVGDIDTSSIPSKVQYTPPKQPHYNQDKTPEFIIRILQFLVPLFILGLA  125

Query  474  VGFRYFNKKE  503
            VG R++ K +
Sbjct  126  VGIRFYTKSK  135



>ref|XP_002300176.1| cytochrome b5 isoform 2 family protein [Populus trichocarpa]
 ref|XP_011045662.1| PREDICTED: cytochrome b5 isoform B-like [Populus euphratica]
 gb|EEE84981.1| cytochrome b5 isoform 2 family protein [Populus trichocarpa]
Length=134

 Score =   136 bits (342),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  DAKV +FE+V+ HNK  DCW+II+GKVY+VT +++DHPGGD+VLL++TG+DAT+DFE
Sbjct  1    MGGDAKVFTFEDVTVHNKPKDCWLIINGKVYDVTKFMEDHPGGDEVLLSSTGQDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD ARE M +Y IGDID++TVP+K  Y  P      + K+   +  +   L  L I
Sbjct  61   DVGHSDSAREMMAEYCIGDIDASTVPKKTKYKTPQQPHYNQDKTSEFIIKILQFLVPLAI  120

Query  462  lGFAVGFRYFNK  497
            LG A G R + K
Sbjct  121  LGVAFGIRLYTK  132



>ref|XP_007201359.1| hypothetical protein PRUPE_ppa013179mg [Prunus persica]
 ref|XP_007201360.1| hypothetical protein PRUPE_ppa013179mg [Prunus persica]
 gb|EMJ02558.1| hypothetical protein PRUPE_ppa013179mg [Prunus persica]
 gb|EMJ02559.1| hypothetical protein PRUPE_ppa013179mg [Prunus persica]
Length=136

 Score =   136 bits (342),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+  +KV++  EVS H+ + DCW++I GKVY+VT +L+DHPGGD+VLL ATGKDA+NDFE
Sbjct  1    MAGGSKVYTLAEVSAHSDRKDCWLLIDGKVYDVTKFLEDHPGGDEVLLAATGKDASNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS  AR  M +YY+GDIDS+++P K  YTPP      + K+   +  +   L  LLI
Sbjct  61   DVGHSSTARAMMDEYYVGDIDSSSIPTKRAYTPPKQPYYNQDKTTDFIIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNK  497
            LG A G R++ K
Sbjct  121  LGLAFGVRFYTK  132



>ref|XP_010552054.1| PREDICTED: cytochrome b5-like [Tarenaya hassleriana]
Length=137

 Score =   135 bits (341),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 92/131 (70%), Gaps = 1/131 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  D KV +  EVS+H+ K DCW++I GKVY+VT +LDDHPGGD+VLL+ATGKDAT+DFE
Sbjct  1    MDGDGKVFTLAEVSQHSTKHDCWLVIGGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS  A+  + +YY+GDIDS ++P K  YTPP      + K+   +  +   L  LLI
Sbjct  61   DVGHSTTAKAMLDEYYVGDIDSASIPSKTSYTPPKQPQYDQDKTSEFIIKILQFLVPLLI  120

Query  462  lGFAVGFRYFN  494
            LG A+G R++ 
Sbjct  121  LGLALGVRFYT  131



>ref|XP_006395118.1| hypothetical protein EUTSA_v10005107mg [Eutrema salsugineum]
 gb|ESQ32404.1| hypothetical protein EUTSA_v10005107mg [Eutrema salsugineum]
Length=137

 Score =   135 bits (341),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  D KV +  EVS+H+   DCWI+I GKVY+VT +LDDHPGGD+V+LT+TGKDAT+DFE
Sbjct  1    MGGDGKVFTLAEVSQHSSTQDCWIVIDGKVYDVTKFLDDHPGGDEVILTSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQ  410
            D+GHS  A+  + +YY+GDIDS TVP K  +TPPP  +   Q
Sbjct  61   DVGHSSTAKAMLDEYYVGDIDSATVPAKTKFTPPPKQTESNQ  102



>emb|CDX86279.1| BnaA06g29960D [Brassica napus]
Length=138

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  D KV + EEVS+H    DCWI+I GKVY+VT +LDDHPGGD+V+LT+TGKDAT+DFE
Sbjct  1    MGGDGKVFTLEEVSQHTSNQDCWIVIDGKVYDVTKFLDDHPGGDEVILTSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTS  395
            D+GHS  A+  + +YY+GDIDS TVP K  + PPP++
Sbjct  61   DVGHSSTAKAMLDEYYVGDIDSATVPAKTKFVPPPSN  97



>ref|XP_003552132.1| PREDICTED: cytochrome b5-like isoform X1 [Glycine max]
 gb|KHN15374.1| Cytochrome b5 [Glycine soja]
Length=138

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 94/136 (69%), Gaps = 4/136 (3%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  + KV++  EVS+HN   DCW+II GKVYNVT +LDDHPGGDDVLL++TGKDAT+DFE
Sbjct  1    MGGERKVYTLAEVSEHNTSKDCWLIIDGKVYNVTKFLDDHPGGDDVLLSSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEK----PIYTPPPTSSAPKQKSGGMMTllqfllp  452
            D+GHS  AR  +   Y+GDID +T+P K    P+  P          S  M  +LQFLLP
Sbjct  61   DVGHSKGARAMLDDLYVGDIDPSTIPTKVQHTPLTQPQNNQDKTSSSSDSMTKMLQFLLP  120

Query  453  llilGFAVGFRYFNKK  500
            LLILG AVG R++N K
Sbjct  121  LLILGVAVGIRFYNTK  136



>ref|XP_002865680.1| ATB5-B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41939.1| ATB5-B [Arabidopsis lyrata subsp. lyrata]
Length=140

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 92/134 (69%), Gaps = 3/134 (2%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  D KV +  EVS+H+   DCWI+I GKVY+VT +LDDHPGGD+V+LT+TGKDAT+DFE
Sbjct  1    MGGDGKVFTLAEVSQHSSSQDCWIVIDGKVYDVTKFLDDHPGGDEVILTSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPP--TSSAPKQKSGGMMTllqfllp-l  455
            D+GHS  A+  + +YY+GDID+ TVP K  + PP   T  A + KS   +  L   L  L
Sbjct  61   DVGHSSTAKAMLDEYYVGDIDTATVPVKAKFVPPTSKTVKANQDKSSEFVIKLLQFLVPL  120

Query  456  lilGFAVGFRYFNK  497
            LILG A G RY+ K
Sbjct  121  LILGLAFGIRYYTK  134



>ref|XP_002321974.1| cytochrome b5 isoform Cb5-C family protein [Populus trichocarpa]
 gb|EEF06101.1| cytochrome b5 isoform Cb5-C family protein [Populus trichocarpa]
Length=134

 Score =   135 bits (340),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +3

Query  111  SDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDI  290
            + +KV+ F+E++KHNK +DCW+IISGKVY+VT ++DDHPGG +VLL++TGKDATNDFED+
Sbjct  2    ASSKVYLFDEIAKHNKTEDCWLIISGKVYDVTSFMDDHPGGGEVLLSSTGKDATNDFEDV  61

Query  291  GHSDDARETMKKYYIGDIDSNTVPEKPIYTPP  386
            GHSDDAR  M KY IG++D  TVP K +Y   
Sbjct  62   GHSDDARGMMGKYVIGEVDVTTVPTKRLYVAA  93



>ref|XP_011041869.1| PREDICTED: cytochrome b5-like [Populus euphratica]
Length=134

 Score =   135 bits (340),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  D KV +FEEV+ HN   DCW+II+GKVY+VT +++DHPGGD+VLL++TG+DAT+DFE
Sbjct  1    MGGDGKVFTFEEVTVHNNHKDCWLIINGKVYDVTKFMEDHPGGDEVLLSSTGQDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD ARE M +Y IGDID++TVP K  Y  P      + K+   +  L   L  L I
Sbjct  61   DVGHSDSAREMMGEYCIGDIDASTVPRKTKYRAPKQPHYNQDKTSEFIIKLLQFLVPLAI  120

Query  462  lGFAVGFRYFNK  497
            LG A G R + K
Sbjct  121  LGLAFGIRLYTK  132



>ref|XP_008437843.1| PREDICTED: cytochrome b5-like [Cucumis melo]
Length=144

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 101/145 (70%), Gaps = 13/145 (9%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+SD K+  F+EV+KHN + DCW+IISGKVY+VTP+L+DHPGGD+VLL AT KDAT DFE
Sbjct  1    MASDPKLFVFDEVAKHNHQGDCWLIISGKVYDVTPFLEDHPGGDEVLLLATEKDATEDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSA------------PKQKSGGMM  428
             +GHS  A E M+KYYIG+ID +TVP K  Y PP + SA              Q SG ++
Sbjct  61   TVGHSLSATEEMEKYYIGNIDMSTVP-KVDYRPPASKSASTETKAAAETTSSNQSSGSLI  119

Query  429  TllqfllpllilGFAVGFRYFNKKE  503
             +LQ L+PLLI+  A   +Y+ KK+
Sbjct  120  KVLQLLIPLLIIVVAFYLQYYGKKQ  144



>gb|KHG15837.1| Cytochrome b5 [Gossypium arboreum]
 gb|KHG17914.1| Cytochrome b5 [Gossypium arboreum]
Length=138

 Score =   135 bits (340),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 99/135 (73%), Gaps = 3/135 (2%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M    KV  FEE++K  ++DD W++ISGKVY+VT +L+DHPGGD+VLL A+GKDAT DFE
Sbjct  1    MDCGEKVFVFEELAKRKERDDRWLLISGKVYDVTQFLEDHPGGDEVLLAASGKDATQDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQ--KSGGMMTllqfllpll  458
            D+GHSDDAR  MKKYYIG++DS TVP  P    P T S  ++  + G +  +LQFL+PLL
Sbjct  61   DVGHSDDARNMMKKYYIGEVDSTTVP-PPNKIKPQTYSVTQKDDEPGFLFKILQFLVPLL  119

Query  459  ilGFAVGFRYFNKKE  503
            ILG A GF+   KKE
Sbjct  120  ILGLAFGFQLLGKKE  134



>gb|KDP26389.1| hypothetical protein JCGZ_17547 [Jatropha curcas]
Length=136

 Score =   135 bits (339),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M    K  +  EVS+HN   DCW++I GKVY+VT +L+DHPGGD+VLL+ATGKDAT+DFE
Sbjct  1    MGGQGKFFTLSEVSEHNNAKDCWLVIEGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS  AR  M ++Y+G+IDS+T+P +  YTPP      + K+   +  L  ++  LLI
Sbjct  61   DVGHSSSARAMMDEFYVGEIDSSTIPARKAYTPPKQPHYNQDKTPEFIIKLLQIVVPLLI  120

Query  462  lGFAVGFRYFNK  497
            LG AVG R++ K
Sbjct  121  LGLAVGIRFYTK  132



>ref|XP_008380573.1| PREDICTED: cytochrome b5-like [Malus domestica]
Length=134

 Score =   135 bits (339),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  D KV +  +VS+HN   DCW+IISGKVY+VT +L+DHPGGDDVL++ATGKDAT+DFE
Sbjct  1    MGGDGKVFTLAQVSEHNTPKDCWLIISGKVYDVTRFLEDHPGGDDVLVSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS++AR  +K +Y+G+ID++T+P+   Y PP   +  + K+   +  L   L  + I
Sbjct  61   DVGHSENARGMLKDFYVGEIDASTIPKSTTYAPPKQPNYNQDKTSEFIIKLLQFLVPIAI  120

Query  462  lGFAVGFRYFNK  497
            LG A G R ++K
Sbjct  121  LGLAFGIRLYSK  132



>ref|XP_010685005.1| PREDICTED: cytochrome b5 [Beta vulgaris subsp. vulgaris]
Length=136

 Score =   135 bits (339),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  + KV S  EV++HN   DCW++I GKVY+VT +L+DHPGGD+VLL+ATGKDAT+DFE
Sbjct  1    MGGEGKVFSLSEVAEHNSSKDCWLVIGGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS  AR  M + Y+GDI++ T+P K  YTPP        K+   +  +   L  +LI
Sbjct  61   DVGHSSTARAMMDEMYVGDINTATIPTKVRYTPPKQPQYNHDKTSEFIIKILQFLVPILI  120

Query  462  lGFAVGFRYFNKK  500
            LGFAV  R++ K+
Sbjct  121  LGFAVAMRFYTKQ  133



>gb|EYU40608.1| hypothetical protein MIMGU_mgv1a016092mg [Erythranthe guttata]
Length=134

 Score =   135 bits (339),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 96/128 (75%), Gaps = 1/128 (1%)
 Frame = +3

Query  117  AKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIGH  296
            +KV +  EVS+HN   DCW+II GKVY+VT +LDDHPGGD+VL+TATGKDAT+DFED+GH
Sbjct  2    SKVFTLAEVSQHNTNKDCWLIIDGKVYDVTKFLDDHPGGDEVLVTATGKDATDDFEDVGH  61

Query  297  SDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQK-SGGMMTllqfllpllilGFA  473
            S  A+  + +YY+GDIDS+T+  K  Y PP      +   SG ++ LLQFL+PL+ILG A
Sbjct  62   STTAKAMLDEYYVGDIDSSTITTKTSYVPPKQVQQNQDAPSGFIIKLLQFLVPLIILGLA  121

Query  474  VGFRYFNK  497
            VG R++ K
Sbjct  122  VGSRFYTK  129



>ref|XP_008376513.1| PREDICTED: cytochrome b5 isoform B-like [Malus domestica]
 ref|XP_008376520.1| PREDICTED: cytochrome b5 isoform B-like [Malus domestica]
Length=134

 Score =   135 bits (339),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M S  KV +  +VS+HN   DCW+II+GKVY+VT +L+DHPGGDDVL++ATGKDAT+DFE
Sbjct  1    MGSGGKVFTLAQVSEHNTPKDCWLIINGKVYDVTKFLEDHPGGDDVLVSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPP  386
            D+GHSD+AR+ +K +Y+G+ID++T+P+   YTPP
Sbjct  61   DVGHSDNARDMLKDFYVGEIDASTIPKSTTYTPP  94



>ref|XP_002521096.1| cytochrome B5 isoform 1, putative [Ricinus communis]
 gb|EEF41247.1| cytochrome B5 isoform 1, putative [Ricinus communis]
Length=136

 Score =   135 bits (339),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M    KV++  +VS+HN   DCW++I GKVY+VT +L+DHPGGD+VLL+ATGKDAT+DFE
Sbjct  1    MGGQGKVYTLADVSEHNSPKDCWLVIEGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS  AR  M ++Y+G+ID++T+P K  YTPP      + K+   +  L   +  LLI
Sbjct  61   DVGHSSSARAMMDEFYVGEIDTSTIPTKKAYTPPKQPHYNQDKTPEFIIKLLQFVVPLLI  120

Query  462  lGFAVGFRYFNK  497
            LG AVG R++ K
Sbjct  121  LGLAVGIRFYTK  132



>gb|KHN37769.1| Cytochrome b5 [Glycine soja]
Length=135

 Score =   134 bits (338),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 88/127 (69%), Gaps = 1/127 (1%)
 Frame = +3

Query  120  KVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIGHS  299
            KV S  EVS+HN   DCW++I GKVYNVT +L+DHPGGD+VLL++TGKDATNDFEDIGHS
Sbjct  7    KVFSLAEVSQHNNAKDCWLVIHGKVYNVTKFLEDHPGGDEVLLSSTGKDATNDFEDIGHS  66

Query  300  DDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-llilGFAV  476
              A   M ++Y+GDID++T+P K  YTPP      + K    +  +   L  L ILG AV
Sbjct  67   TSAVAMMDEFYVGDIDTSTIPSKVKYTPPKQPHYNQDKMPEFIIRILQFLVPLFILGLAV  126

Query  477  GFRYFNK  497
            G R++ K
Sbjct  127  GIRFYTK  133



>gb|EEC67315.1| hypothetical protein OsI_34332 [Oryza sativa Indica Group]
 gb|EEE51272.1| hypothetical protein OsJ_32170 [Oryza sativa Japonica Group]
Length=197

 Score =   136 bits (343),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 91/134 (68%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+ + KV  FEEV+ HN   DCW+II+GKVY+VT ++D+HPGGD+VLL  TGKDATNDFE
Sbjct  64   MAGEKKVFGFEEVAGHNVTKDCWLIIAGKVYDVTSFMDEHPGGDEVLLAVTGKDATNDFE  123

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            DIGHS+ ARE M+KY IG+ID++T+P K  +  P  +     K   M+  +   L  +LI
Sbjct  124  DIGHSESAREMMEKYLIGEIDASTIPVKRTHVTPQQAPGNPDKGDDMLIKILQFLVPILI  183

Query  462  lGFAVGFRYFNKKE  503
            LG A   R + K E
Sbjct  184  LGLAFAIRQYTKSE  197



>ref|XP_006601762.1| PREDICTED: uncharacterized protein LOC100500611 isoform X1 [Glycine 
max]
 gb|KHN15515.1| Cytochrome b5 [Glycine soja]
Length=135

 Score =   134 bits (338),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 89/127 (70%), Gaps = 1/127 (1%)
 Frame = +3

Query  120  KVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIGHS  299
            KV +  EVS+HN   DCW++I GKVYNVT +L+DHPGGD+VLL++TGKDATNDFEDIGHS
Sbjct  7    KVFTLAEVSQHNNAKDCWLVIHGKVYNVTKFLEDHPGGDEVLLSSTGKDATNDFEDIGHS  66

Query  300  DDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-llilGFAV  476
              A   M ++Y+GDID++T+P K  YTPP      + K+   +  +   L  L ILG AV
Sbjct  67   TSAVAMMDEFYVGDIDTSTIPSKVKYTPPKQPHYNQDKTPEFIIRILQFLVPLFILGLAV  126

Query  477  GFRYFNK  497
            G R++ K
Sbjct  127  GIRFYTK  133



>ref|XP_009403628.1| PREDICTED: cytochrome b5 isoform B-like [Musa acuminata subsp. 
malaccensis]
Length=134

 Score =   134 bits (338),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M S  KV++  EVS HN   DCW++I+GKVY+VT +L+DHPGGDDVLL++TGKDAT+DFE
Sbjct  1    MGSHGKVYTLAEVSTHNTHKDCWLVINGKVYDVTKFLEDHPGGDDVLLSSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPP  386
            DIGHS+ AR  M +Y+IG ID+ T+P+K  YTPP
Sbjct  61   DIGHSNTARAMMDEYFIGKIDAATIPQKVKYTPP  94



>ref|XP_009374604.1| PREDICTED: cytochrome b5-like [Pyrus x bretschneideri]
Length=134

 Score =   134 bits (338),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  + KV +  +VS+HN   DCW+IISGKVY+VT +L+DHPGGDDVL++ATGKDAT+DFE
Sbjct  1    MGGNGKVFTLAQVSEHNTPKDCWLIISGKVYDVTRFLEDHPGGDDVLVSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS++AR  +K +Y+G+ID++T+P+   YTPP   +  + K+   +  L   L  + I
Sbjct  61   DVGHSENARGMLKDFYVGEIDASTIPKSTTYTPPKQPNYNQDKTSEFIIKLLQFLVPIAI  120

Query  462  lGFAVGFRYFNK  497
            LG A G R + K
Sbjct  121  LGLAFGIRLYAK  132



>ref|XP_002265677.1| PREDICTED: cytochrome b5 [Vitis vinifera]
 emb|CAN78289.1| hypothetical protein VITISV_008139 [Vitis vinifera]
 emb|CBI37308.3| unnamed protein product [Vitis vinifera]
Length=133

 Score =   134 bits (338),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 92/129 (71%), Gaps = 1/129 (1%)
 Frame = +3

Query  114  DAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIG  293
            + KV++  EVS+HN   DCW+II GKVY+VT +L+DHPGGDDVLL+ATGKDAT+DFED+G
Sbjct  3    EGKVYTLAEVSEHNTPKDCWLIIDGKVYDVTKFLEDHPGGDDVLLSATGKDATDDFEDVG  62

Query  294  HSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-llilGF  470
            HS  AR  M ++++GDID+ T+P K  YTPP      + K+   +  L   L  L+ILG 
Sbjct  63   HSSSARAMMDEFHVGDIDTATIPSKVNYTPPKQPHYNQDKTSEFVIKLLQFLVPLIILGV  122

Query  471  AVGFRYFNK  497
            AVG R++ K
Sbjct  123  AVGIRFYTK  131



>emb|CDY19937.1| BnaA09g03140D [Brassica napus]
Length=140

 Score =   134 bits (338),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 97/135 (72%), Gaps = 4/135 (3%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  D KV++  EVS+H    DCWI+I GKVY+VT +LDDHPGGD+V+LT+TGKDAT+DFE
Sbjct  1    MGGDGKVYTLAEVSQHTTNQDCWIVIDGKVYDVTKFLDDHPGGDEVILTSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPP----TSSAPKQKSGGMMTllqfllp  452
            D+GHS  A+  + +YY+GDID+ TVP K  + PP     T S   + S  ++ +LQFL+P
Sbjct  61   DVGHSSTAKAMLDEYYVGDIDTATVPAKTKFVPPSPPKQTESNQSKSSDFLVKILQFLVP  120

Query  453  llilGFAVGFRYFNK  497
            LLILG A+G R + K
Sbjct  121  LLILGLALGVRSYTK  135



>ref|XP_006847492.1| hypothetical protein AMTR_s00163p00076750 [Amborella trichopoda]
 gb|ERN09073.1| hypothetical protein AMTR_s00163p00076750 [Amborella trichopoda]
Length=134

 Score =   134 bits (338),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M +D KV + ++VS HN   DCW++I+GKVYNVT +L+DHPGGD+VLL+ATGKDAT+DFE
Sbjct  1    MGADGKVFTLQDVSNHNTPQDCWLVINGKVYNVTEFLEDHPGGDEVLLSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS  AR  M ++Y+G+ID +T P K  YTPP      + K+   +  +      L+I
Sbjct  61   DVGHSTSARAMMDEFYVGEIDPSTFPTKLKYTPPKQPHYNQDKTTEFIVKILQFFVPLMI  120

Query  462  lGFAVGFRYFNKKE  503
            LG AV  R++ K +
Sbjct  121  LGLAVAIRFYTKSD  134



>ref|XP_002986043.1| hypothetical protein SELMODRAFT_271829 [Selaginella moellendorffii]
 ref|XP_002989614.1| hypothetical protein SELMODRAFT_272078 [Selaginella moellendorffii]
 gb|EFJ09284.1| hypothetical protein SELMODRAFT_272078 [Selaginella moellendorffii]
 gb|EFJ12862.1| hypothetical protein SELMODRAFT_271829 [Selaginella moellendorffii]
Length=131

 Score =   134 bits (337),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 98/129 (76%), Gaps = 1/129 (1%)
 Frame = +3

Query  117  AKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIGH  296
            +K+ ++ E+++HN + DCW++ISGK+Y+VT +L+DHPGGD+V+L+ATGKDAT+DFED+GH
Sbjct  2    SKIMAYSELAEHNNRKDCWLLISGKIYDVTKFLEDHPGGDEVILSATGKDATDDFEDVGH  61

Query  297  SDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSS-APKQKSGGMMTllqfllpllilGFA  473
            S  AR+ M  YYIG++DS T+P KP +      +  P + S  ++ +LQFL+PL ILG A
Sbjct  62   SSSARDMMHSYYIGEVDSATLPAKPTFKLATQDAYNPDKTSQFLIKILQFLVPLAILGLA  121

Query  474  VGFRYFNKK  500
            V  R+F K+
Sbjct  122  VAVRFFTKQ  130



>gb|ABA54489.1| cytochrome b5 type 06 [Crepis alpina]
Length=131

 Score =   134 bits (337),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 92/128 (72%), Gaps = 1/128 (1%)
 Frame = +3

Query  117  AKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIGH  296
             KV++ +EV++HN   DCW+II GKV++VT +LDDHPGGDDVLL+ATGKDAT+DFED+GH
Sbjct  2    GKVYTLKEVAEHNDPKDCWLIIDGKVFDVTKFLDDHPGGDDVLLSATGKDATDDFEDVGH  61

Query  297  SDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-llilGFA  473
            S  A+  M ++Y+GDIDS T+P K  Y PP  +   + K+   +  +   L  L+ILG A
Sbjct  62   STTAKSMMDEFYVGDIDSATIPSKVEYKPPKQAHYNQDKTSEFIIKILQFLVPLVILGVA  121

Query  474  VGFRYFNK  497
            VG R++ K
Sbjct  122  VGIRFYTK  129



>gb|AJE26127.1| nitrate reductase [Salix matsudana]
Length=134

 Score =   134 bits (337),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  D KV +FEEV+ HN   DCW+II+GKVY+VT +++DHPGGD+VLL++TG+DAT+DFE
Sbjct  1    MGGDGKVFTFEEVTVHNNHKDCWLIINGKVYDVTKFMEDHPGGDEVLLSSTGQDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD ARE M +Y IGD+D++TVP+K  Y  P      + K+   +  +   L  L I
Sbjct  61   DVGHSDSAREMMGEYCIGDVDASTVPQKKKYKIPNQPHYNQDKTSEFIIKILQFLVPLAI  120

Query  462  lGFAVGFRYFNK  497
            LG A G R + K
Sbjct  121  LGLAFGIRLYTK  132



>ref|XP_010912953.1| PREDICTED: cytochrome b5-like [Elaeis guineensis]
Length=134

 Score =   134 bits (337),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M SDAKV++ +EVS+HN   DCW++I GKVY+VT +L+DHPGGD+VLL++TGKDAT+DFE
Sbjct  1    MGSDAKVYTLKEVSQHNTNKDCWLVIGGKVYDVTKFLEDHPGGDEVLLSSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS  AR  M +Y +G ID++T+P K  YTPP      + K+   +  L   L  L I
Sbjct  61   DVGHSTTARAMMDEYCVGKIDTSTIPTKVKYTPPKQPHYNQDKTSDFIIKLLQFLVPLAI  120

Query  462  lGFAVGFRYFNK  497
            LG AV  R + K
Sbjct  121  LGVAVAIRAYTK  132



>gb|KHG05589.1| Cytochrome b5 [Gossypium arboreum]
Length=137

 Score =   134 bits (337),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  + KV++  EVS+HN   DCW++I GKV++VT +L+DHPGGDDVLL++TGKDAT+DFE
Sbjct  1    MGGERKVYTLAEVSQHNHAKDCWLVIEGKVFDVTKFLEDHPGGDDVLLSSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS  AR  M ++Y+GDID++T+P K  YTPP      + K+   +  L   L  LLI
Sbjct  61   DVGHSSSARAMMDEFYVGDIDTSTIPSKRKYTPPKQPHYEQDKTSEFVIKLLQFLVPLLI  120

Query  462  lGFAVGFRYFNK  497
            LG A G R + K
Sbjct  121  LGLAFGIRSYTK  132



>emb|CDX85364.1| BnaC07g26750D [Brassica napus]
Length=138

 Score =   134 bits (337),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  D KV + EEVS+H    DCWI I GKVY+VT +LDDHPGGD+V+LT+TGKDAT+DFE
Sbjct  1    MGGDGKVFTLEEVSQHTSNQDCWIAIDGKVYDVTKFLDDHPGGDEVILTSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTS  395
            D+GHS  A+  + +YY+GDIDS TVP K  + PPP++
Sbjct  61   DVGHSSTAKAMLDEYYVGDIDSATVPTKTKFVPPPSN  97



>ref|XP_008224490.1| PREDICTED: cytochrome b5 isoform B [Prunus mume]
Length=134

 Score =   134 bits (336),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  D K+ +  +VS+HN   DCW+II+GKVY+VT +L+DHPGGDDVLL+ATGKDAT+DFE
Sbjct  1    MGVDGKLFTLAQVSEHNTPKDCWLIINGKVYDVTKFLEDHPGGDDVLLSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHSD+AR+ +K   +GDID++T+P    YTPP      + K+   +  L   L  + I
Sbjct  61   DVGHSDNARDMLKDMCVGDIDASTIPSSTTYTPPKQPHYNQDKTSEFIVKLLQFLVPIAI  120

Query  462  lGFAVGFRYFNK  497
            LG A G R + K
Sbjct  121  LGLAFGIRLYTK  132



>ref|XP_002893406.1| B5 #6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69665.1| B5 #6 [Arabidopsis lyrata subsp. lyrata]
Length=135

 Score =   134 bits (336),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 81/105 (77%), Gaps = 4/105 (4%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M +  K++S EEV+ HNK+DDCW++I GKVY+VT Y+D+HPGGDDVLL  TGKDAT+DFE
Sbjct  1    MPTLTKLYSMEEVATHNKQDDCWVVIDGKVYDVTSYMDEHPGGDDVLLAVTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKP---IY-TPPPTSSAPK  407
            D GHS DARE M+KY+IG++D +++PE P   IY    PT S  K
Sbjct  61   DAGHSKDARELMEKYFIGELDESSLPEIPELKIYKKEQPTDSVQK  105



>gb|ABK23501.1| unknown [Picea sitchensis]
Length=134

 Score =   134 bits (336),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M SD KV+S  EVS+HN   DCW++I GKVY+VT +L++HPGGD+VLL+ATGKDAT+DFE
Sbjct  1    MGSDPKVYSLAEVSEHNYNKDCWLVIGGKVYDVTNFLEEHPGGDEVLLSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS+ ARE M +Y+IG+ID +T P+K  Y P   +   + K+   +  +   L  L I
Sbjct  61   DVGHSNSAREMMDQYHIGEIDPSTFPKKATYKPAKQAHYDQDKTSEFIIRILQFLVPLAI  120

Query  462  lGFAVGFRYFNK  497
            LG A   R++ K
Sbjct  121  LGLAFAVRFYTK  132



>ref|XP_010069046.1| PREDICTED: cytochrome b5 [Eucalyptus grandis]
Length=133

 Score =   134 bits (336),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 88/129 (68%), Gaps = 1/129 (1%)
 Frame = +3

Query  114  DAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIG  293
            + KV +  EVS+HN   DCWI+I GKVY+VT +L+DHPGGD+VLL+A GKDAT+DFED+G
Sbjct  3    EGKVFTLAEVSEHNNSKDCWIVIDGKVYDVTKFLEDHPGGDEVLLSAIGKDATDDFEDVG  62

Query  294  HSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-llilGF  470
            HS  AR  M +Y +GDIDS+T+P K  YTPP      + K+   +  L   L  L ILG 
Sbjct  63   HSSSARAMMDEYLVGDIDSSTIPTKRAYTPPKQPHYNQDKTSEFIIKLLQFLVPLAILGL  122

Query  471  AVGFRYFNK  497
            A G R++ K
Sbjct  123  AFGIRFYTK  131



>ref|XP_011044704.1| PREDICTED: cytochrome b5 isoform X2 [Populus euphratica]
Length=134

 Score =   134 bits (336),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 99/131 (76%), Gaps = 2/131 (2%)
 Frame = +3

Query  117  AKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIGH  296
            +KV+ F+E++KHNK  DCW+IISGKVY+VT +++DHPGG +VLL++TGKDATNDF+D+GH
Sbjct  4    SKVYLFDEIAKHNKIKDCWLIISGKVYDVTSFMEDHPGGGEVLLSSTGKDATNDFKDVGH  63

Query  297  SDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQ--KSGGMMTllqfllpllilGF  470
            SDDAR  M KY IG++D  TVP K +Y  P    A  +  KS  ++ +LQ L+PLLILG 
Sbjct  64   SDDARGMMGKYVIGEVDITTVPTKRLYVAPGLGGASSKDDKSEFLIKILQLLVPLLILGL  123

Query  471  AVGFRYFNKKE  503
            A+  R + KKE
Sbjct  124  ALATRTYTKKE  134



>ref|XP_004960538.1| PREDICTED: cytochrome b5-like [Setaria italica]
Length=133

 Score =   133 bits (335),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 90/130 (69%), Gaps = 1/130 (1%)
 Frame = +3

Query  117  AKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIGH  296
            +KV++ EEV+KHN KDDCW+II GKVY+VT +L+DHPGGDDVLL++T KDAT+DFED+GH
Sbjct  2    SKVYTLEEVAKHNSKDDCWLIIGGKVYDVTKFLEDHPGGDDVLLSSTAKDATDDFEDVGH  61

Query  297  SDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-llilGFA  473
            S  AR  M +Y +G+IDS+T+P +  Y  P      + K+   +  +   L  L ILG A
Sbjct  62   STTARAMMDEYLLGEIDSSTIPARTKYVAPKQPHYNQDKTPEFIIKILQFLVPLAILGLA  121

Query  474  VGFRYFNKKE  503
            V  R + K E
Sbjct  122  VAVRIYTKSE  131



>ref|XP_002439129.1| hypothetical protein SORBIDRAFT_09g000970 [Sorghum bicolor]
 gb|EES17559.1| hypothetical protein SORBIDRAFT_09g000970 [Sorghum bicolor]
Length=133

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 92/130 (71%), Gaps = 1/130 (1%)
 Frame = +3

Query  117  AKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIGH  296
            +KV + E+V+KHN K+DCW+II GKVY+VT +L+DHPGGDDVLL++TGKDAT+DFED+GH
Sbjct  2    SKVFTLEDVAKHNTKEDCWLIIGGKVYDVTKFLEDHPGGDDVLLSSTGKDATDDFEDVGH  61

Query  297  SDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-llilGFA  473
            S+ AR  M +Y +G+ID++T+P +  Y PP      + K+   +  +   L  L ILG A
Sbjct  62   SNTARAMMDEYLVGEIDASTIPSRTKYVPPKQPHYNQDKTPEFVIKILQFLVPLAILGLA  121

Query  474  VGFRYFNKKE  503
            V  R + K E
Sbjct  122  VAVRMYTKSE  131



>ref|XP_010109733.1| Cytochrome b5 [Morus notabilis]
 gb|EXC24203.1| Cytochrome b5 [Morus notabilis]
Length=132

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 92/128 (72%), Gaps = 1/128 (1%)
 Frame = +3

Query  117  AKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIGH  296
             KV++  EVS+HN ++ C ++I GKVY+VT +L+DHPGGDDVLL++TGKDATNDFED+GH
Sbjct  2    GKVYTLAEVSQHNNREKCLLVIHGKVYDVTKFLEDHPGGDDVLLSSTGKDATNDFEDVGH  61

Query  297  SDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-llilGFA  473
            S  A+  M ++Y+GDID+ T+P K  YTPP      + K+   +  +  LL  L+ILG A
Sbjct  62   SSSAKAVMDEFYVGDIDTATIPAKVQYTPPKQPYYNQDKTSQFIIKVLQLLVPLVILGVA  121

Query  474  VGFRYFNK  497
            VG R++ K
Sbjct  122  VGIRFYTK  129



>ref|XP_011044703.1| PREDICTED: cytochrome b5 isoform X1 [Populus euphratica]
Length=142

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 99/131 (76%), Gaps = 2/131 (2%)
 Frame = +3

Query  117  AKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIGH  296
            +KV+ F+E++KHNK  DCW+IISGKVY+VT +++DHPGG +VLL++TGKDATNDF+D+GH
Sbjct  12   SKVYLFDEIAKHNKIKDCWLIISGKVYDVTSFMEDHPGGGEVLLSSTGKDATNDFKDVGH  71

Query  297  SDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQ--KSGGMMTllqfllpllilGF  470
            SDDAR  M KY IG++D  TVP K +Y  P    A  +  KS  ++ +LQ L+PLLILG 
Sbjct  72   SDDARGMMGKYVIGEVDITTVPTKRLYVAPGLGGASSKDDKSEFLIKILQLLVPLLILGL  131

Query  471  AVGFRYFNKKE  503
            A+  R + KKE
Sbjct  132  ALATRTYTKKE  142



>ref|XP_008235483.1| PREDICTED: cytochrome b5 [Prunus mume]
Length=136

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M+   KV++  EVS H+ + DCW++I GKVY+VT +L+DHPGGD+VLL ATGKDA+NDFE
Sbjct  1    MAGGNKVYTLAEVSAHSDRKDCWLLIDGKVYDVTKFLEDHPGGDEVLLAATGKDASNDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS  AR  M ++Y+GDIDS+++P K  YTPP      + K+   +  +   L  LLI
Sbjct  61   DVGHSSTARAMMDEFYVGDIDSSSIPTKRAYTPPKQPYYNQDKTTDFIIKILQFLVPLLI  120

Query  462  lGFAVGFRYFNK  497
            LG A G R++ K
Sbjct  121  LGLAFGVRFYTK  132



>ref|XP_006304208.1| hypothetical protein CARUB_v10010310mg [Capsella rubella]
 gb|EOA37106.1| hypothetical protein CARUB_v10010310mg [Capsella rubella]
Length=205

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +3

Query  102  KMSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDF  281
            KM +  K++S EE + HNK+DDCW++I GKVY+VT Y+D+HPGGDDVLL  TGKDAT+DF
Sbjct  70   KMPTLTKLYSMEEAATHNKQDDCWVVIDGKVYDVTSYMDEHPGGDDVLLAVTGKDATDDF  129

Query  282  EDIGHSDDARETMKKYYIGDIDSNTVPEKP  371
            ED GHS DARE M+KY+IG++D ++VPE P
Sbjct  130  EDAGHSKDARELMEKYFIGELDESSVPEIP  159



>gb|KDP20335.1| hypothetical protein JCGZ_06421 [Jatropha curcas]
Length=134

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 89/132 (67%), Gaps = 1/132 (1%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  + KV +  EVS+HN   DCW+II GKVY+VT +LDDHPGGD+VLL+ATGKDAT+DFE
Sbjct  1    MGGEEKVFTLAEVSEHNTPKDCWLIIDGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTSSAPKQKSGGMMTllqfllp-lli  461
            D+GHS  A+E M +YY+G ID +T+P+K  Y PP      + K+   +  L   L  L I
Sbjct  61   DVGHSTSAKEMMDQYYVGKIDPSTIPQKTTYKPPKQPHYNQDKTSEFIIKLLQFLVPLAI  120

Query  462  lGFAVGFRYFNK  497
            LG A G R + K
Sbjct  121  LGLAFGVRIYTK  132



>ref|XP_009151679.1| PREDICTED: cytochrome B5 isoform D [Brassica rapa]
Length=138

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +3

Query  105  MSSDAKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFE  284
            M  D KV + EEVS+H    DCWI+I GKVY+VT +LDDHPGGD+V+LT+TGKDAT+DFE
Sbjct  1    MGGDGKVFTLEEVSQHTSNQDCWIVIDGKVYDVTKFLDDHPGGDEVILTSTGKDATDDFE  60

Query  285  DIGHSDDARETMKKYYIGDIDSNTVPEKPIYTPPPTS  395
            D+GHS  A+  + +YY+GDIDS TVP K  +  PP++
Sbjct  61   DVGHSSTAKAMLDEYYVGDIDSATVPAKTKFVAPPSN  97



>emb|CDY61721.1| BnaA04g27110D [Brassica napus]
 emb|CDY27310.1| BnaC04g50950D [Brassica napus]
Length=134

 Score =   133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 97/133 (73%), Gaps = 6/133 (5%)
 Frame = +3

Query  117  AKVHSFEEVSKHNKKDDCWIIISGKVYNVTPYLDDHPGGDDVLLTATGKDATNDFEDIGH  296
            AK+ SF +V+KH  K+DCWI+I GKVY+V+ ++D+HPGGD+VLL  TGKDA+ DF+D+ H
Sbjct  2    AKLISFHDVAKHKCKNDCWILIHGKVYDVSSFIDEHPGGDNVLLAVTGKDASTDFDDVNH  61

Query  297  SDDARETMKKYYIGDIDSNTVPEKPIYTPP----PTSSAPKQKSGGMMTllqfllpllil  464
            S++A+ETMKKYYIGD+D +TVP    Y PP     T+   K +SG  M    +L+PLLIL
Sbjct  62   SNEAKETMKKYYIGDVDKSTVPVTAKYIPPWEKESTAETTKDESGNKML--VYLVPLLIL  119

Query  465  GFAVGFRYFNKKE  503
            G A   R++N K+
Sbjct  120  GVAFFLRFYNNKQ  132



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950