BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP007G04 545 bp,:Filtered

Length=508
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002311516.1|  high-mobility-group family protein               88.6    2e-18   Populus trichocarpa [western balsam poplar]
ref|XP_011023827.1|  PREDICTED: HMG-Y-related protein B-like          88.6    3e-18   Populus euphratica
ref|XP_011038601.1|  PREDICTED: HMG-Y-related protein B-like          87.4    8e-18   Populus euphratica
ref|XP_002284720.1|  PREDICTED: HMG-Y-related protein A               86.7    9e-18   Vitis vinifera
ref|XP_002315870.2|  hypothetical protein POPTR_0010s11980g           87.0    9e-18   Populus trichocarpa [western balsam poplar]
ref|XP_006448210.1|  hypothetical protein CICLE_v10016374mg           86.7    2e-17   Citrus clementina
ref|XP_006469214.1|  PREDICTED: HMG-Y-related protein A-like          86.3    2e-17   Citrus sinensis [Valencia orange]
gb|KDO64579.1|  hypothetical protein CISIN_1g028369mg                 85.9    2e-17   Citrus sinensis [Valencia orange]
ref|XP_010044209.1|  PREDICTED: HMG-Y-related protein B-like          84.7    5e-17   Eucalyptus grandis [rose gum]
emb|CAN71833.1|  hypothetical protein VITISV_005586                   84.3    7e-17   Vitis vinifera
ref|XP_002527784.1|  Histone H1, putative                             83.6    1e-16   Ricinus communis
gb|KDP38087.1|  hypothetical protein JCGZ_04730                       83.6    2e-16   Jatropha curcas
ref|XP_004297466.2|  PREDICTED: HMG-Y-related protein B-like          83.2    3e-16   Fragaria vesca subsp. vesca
gb|EYU24928.1|  hypothetical protein MIMGU_mgv1a013363mg              82.0    7e-16   Erythranthe guttata [common monkey flower]
gb|EYU33118.1|  hypothetical protein MIMGU_mgv1a025782mg              81.3    7e-16   Erythranthe guttata [common monkey flower]
ref|XP_008221436.1|  PREDICTED: HMG-Y-related protein B-like          80.5    1e-15   Prunus mume [ume]
ref|XP_009627953.1|  PREDICTED: HMG-Y-related protein B-like          80.9    2e-15   Nicotiana tomentosiformis
ref|XP_007221891.1|  hypothetical protein PRUPE_ppa018145mg           80.1    2e-15   Prunus persica
gb|EYU33122.1|  hypothetical protein MIMGU_mgv1a014230mg              80.5    2e-15   Erythranthe guttata [common monkey flower]
gb|EPS73298.1|  hypothetical protein M569_01461                       79.7    4e-15   Genlisea aurea
ref|XP_009773451.1|  PREDICTED: HMG-Y-related protein B               79.3    5e-15   Nicotiana sylvestris
ref|XP_007045213.1|  HMG-Y-related protein B                          79.3    5e-15   Theobroma cacao [chocolate]
ref|XP_011075400.1|  PREDICTED: HMG-Y-related protein B-like          79.3    5e-15   Sesamum indicum [beniseed]
ref|XP_004236944.1|  PREDICTED: HMG-Y-related protein A               78.6    7e-15   Solanum lycopersicum
ref|XP_008466945.1|  PREDICTED: HMG-Y-related protein A               78.6    7e-15   Cucumis melo [Oriental melon]
gb|KDP33183.1|  hypothetical protein JCGZ_13448                       78.6    8e-15   Jatropha curcas
ref|XP_006355073.1|  PREDICTED: HMG-Y-related protein A-like          78.6    9e-15   Solanum tuberosum [potatoes]
ref|XP_004150116.1|  PREDICTED: HMG-Y-related protein A-like          78.2    1e-14   Cucumis sativus [cucumbers]
ref|XP_010101971.1|  HMG-Y-related protein A                          77.4    2e-14   Morus notabilis
ref|XP_008677023.1|  PREDICTED: uncharacterized protein LOC100277...  77.0    2e-14   Zea mays [maize]
gb|AFW62239.1|  hypothetical protein ZEAMMB73_329593                  77.4    2e-14   Zea mays [maize]
gb|KHF97239.1|  HMG-Y-related A                                       77.0    3e-14   Gossypium arboreum [tree cotton]
gb|KJB08551.1|  hypothetical protein B456_001G088600                  76.6    3e-14   Gossypium raimondii
ref|NP_001144569.1|  uncharacterized protein LOC100277576             76.6    4e-14   Zea mays [maize]
ref|XP_008800773.1|  PREDICTED: LOW QUALITY PROTEIN: HMG-Y-relate...  76.6    4e-14   Phoenix dactylifera
ref|XP_009351784.1|  PREDICTED: HMG-Y-related protein A-like          75.9    5e-14   Pyrus x bretschneideri [bai li]
ref|XP_008775214.1|  PREDICTED: HMG-Y-related protein A-like          75.1    9e-14   Phoenix dactylifera
dbj|BAA11766.1|  high mobility group protein                          75.1    1e-13   Canavalia gladiata [Japanese jack bean]
emb|CDP00813.1|  unnamed protein product                              75.5    1e-13   Coffea canephora [robusta coffee]
ref|XP_010932593.1|  PREDICTED: HMG-Y-related protein A-like          74.7    2e-13   Elaeis guineensis
ref|XP_007215046.1|  hypothetical protein PRUPE_ppa012096mg           74.3    2e-13   Prunus persica
ref|XP_010909519.1|  PREDICTED: LOW QUALITY PROTEIN: HMG-Y-relate...  73.9    3e-13   Elaeis guineensis
ref|XP_010274748.1|  PREDICTED: HMG-Y-related protein A               73.9    3e-13   Nelumbo nucifera [Indian lotus]
ref|XP_008343053.1|  PREDICTED: HMG-Y-related protein A-like          73.9    3e-13   Malus domestica [apple tree]
ref|XP_009401276.1|  PREDICTED: HMG-Y-related protein A-like          73.6    4e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008801167.1|  PREDICTED: HMG-Y-related protein A-like          73.2    6e-13   Phoenix dactylifera
ref|XP_008229206.1|  PREDICTED: HMG-Y-related protein A-like          73.2    7e-13   Prunus mume [ume]
ref|XP_009334425.1|  PREDICTED: HMG-Y-related protein A-like          72.8    8e-13   Pyrus x bretschneideri [bai li]
gb|KJB50374.1|  hypothetical protein B456_008G167400                  72.8    9e-13   Gossypium raimondii
ref|NP_001061850.2|  Os08g0428800                                     72.4    1e-12   
gb|KHG07018.1|  HMG-Y-related A                                       72.4    1e-12   Gossypium arboreum [tree cotton]
ref|XP_010554409.1|  PREDICTED: HMG-Y-related protein A-like          72.8    1e-12   Tarenaya hassleriana [spider flower]
ref|XP_002266360.1|  PREDICTED: HMG-Y-related protein B-like          72.4    1e-12   Vitis vinifera
ref|XP_004973484.1|  PREDICTED: HMG-Y-related protein A-like          72.4    1e-12   Setaria italica
ref|XP_006305538.1|  hypothetical protein CARUB_v10010056mg           72.8    1e-12   Capsella rubella
ref|XP_010496630.1|  PREDICTED: HMG-Y-related protein A-like          72.4    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010459005.1|  PREDICTED: HMG-Y-related protein A-like isof...  72.0    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010459006.1|  PREDICTED: HMG-Y-related protein A-like isof...  71.6    2e-12   Camelina sativa [gold-of-pleasure]
emb|CAN79065.1|  hypothetical protein VITISV_019692                   71.6    2e-12   Vitis vinifera
ref|XP_010476567.1|  PREDICTED: HMG-Y-related protein A-like          72.0    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_004288399.1|  PREDICTED: HMG-Y-related protein A-like          71.6    2e-12   Fragaria vesca subsp. vesca
dbj|BAA11767.1|  high mobility group protein                          71.6    2e-12   Canavalia gladiata [Japanese jack bean]
ref|XP_006482095.1|  PREDICTED: HMG-Y-related protein A-like          71.2    3e-12   Citrus sinensis [Valencia orange]
gb|KJB50373.1|  hypothetical protein B456_008G167300                  71.2    3e-12   Gossypium raimondii
gb|AAT08736.1|  high mobility group I/Y-2                             71.2    3e-12   Hyacinthus orientalis [common hyacinth]
ref|XP_007032993.1|  High mobility group A isoform 1                  71.2    3e-12   Theobroma cacao [chocolate]
ref|XP_007032994.1|  High mobility group A isoform 2                  71.2    3e-12   Theobroma cacao [chocolate]
ref|XP_010527792.1|  PREDICTED: HMG-Y-related protein A-like          70.9    4e-12   Tarenaya hassleriana [spider flower]
gb|KHG27381.1|  HMG-Y-related A                                       70.5    4e-12   Gossypium arboreum [tree cotton]
ref|NP_001105938.1|  HMGI/Y protein                                   70.5    7e-12   
ref|NP_001105009.1|  high mobility group I/Y-2                        70.5    7e-12   Zea mays [maize]
ref|XP_006430572.1|  hypothetical protein CICLE_v10012880mg           70.1    7e-12   Citrus clementina
ref|XP_010108992.1|  HMG-Y-related protein A                          70.5    7e-12   Morus notabilis
dbj|BAK06763.1|  predicted protein                                    69.3    1e-11   Hordeum vulgare subsp. vulgare [barley]
ref|XP_009399732.1|  PREDICTED: HMG-Y-related protein A-like          69.7    1e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009589931.1|  PREDICTED: HMG-Y-related protein A-like          68.6    1e-11   Nicotiana tomentosiformis
ref|XP_010266048.1|  PREDICTED: HMG-Y-related protein A-like          69.3    1e-11   Nelumbo nucifera [Indian lotus]
ref|XP_006416960.1|  hypothetical protein EUTSA_v10008756mg           69.3    1e-11   Eutrema salsugineum
emb|CAA71797.1|  HMG-I/Y                                              69.3    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002445522.1|  hypothetical protein SORBIDRAFT_07g020920        68.9    2e-11   Sorghum bicolor [broomcorn]
gb|AAM60937.1|  linker histone protein, putative                      68.6    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008802440.1|  PREDICTED: HMG-Y-related protein A-like          68.2    3e-11   Phoenix dactylifera
ref|XP_002892836.1|  hypothetical protein ARALYDRAFT_888880           68.6    3e-11   Arabidopsis lyrata subsp. lyrata
ref|XP_009403355.1|  PREDICTED: HMG-Y-related protein B               68.2    3e-11   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY04096.1|  BnaA09g18740D                                        68.2    3e-11   Brassica napus [oilseed rape]
ref|NP_172943.1|  high mobility group protein A protein               68.6    3e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KJB10442.1|  hypothetical protein B456_001G201200                  68.2    3e-11   Gossypium raimondii
emb|CBI25277.3|  unnamed protein product                              68.6    3e-11   Vitis vinifera
ref|XP_011001582.1|  PREDICTED: HMG-Y-related protein A-like          68.2    3e-11   Populus euphratica
ref|XP_006372577.1|  HMGI/Y family protein                            68.2    3e-11   Populus trichocarpa [western balsam poplar]
ref|XP_008381335.1|  PREDICTED: HMG-Y-related protein A-like          67.8    4e-11   Malus domestica [apple tree]
ref|XP_009371788.1|  PREDICTED: HMG-Y-related protein A-like          67.8    5e-11   Pyrus x bretschneideri [bai li]
ref|XP_008358162.1|  PREDICTED: HMG-Y-related protein A-like          67.8    5e-11   Malus domestica [apple tree]
ref|XP_002305213.1|  HMGI/Y family protein                            67.8    5e-11   Populus trichocarpa [western balsam poplar]
ref|XP_003574504.1|  PREDICTED: HMG-Y-related protein A-like          67.4    5e-11   Brachypodium distachyon [annual false brome]
ref|XP_006384158.1|  hypothetical protein POPTR_0004s08590g           67.8    5e-11   Populus trichocarpa [western balsam poplar]
ref|XP_009789096.1|  PREDICTED: HMG-Y-related protein A-like          67.0    5e-11   Nicotiana sylvestris
emb|CAB40849.1|  HMGI/Y protein                                       67.4    6e-11   Zea mays [maize]
ref|XP_002273423.1|  PREDICTED: HMG-Y-related protein B-like          68.2    6e-11   Vitis vinifera
gb|EEC84552.1|  hypothetical protein OsI_31304                        65.9    7e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_008456999.1|  PREDICTED: HMG-Y-related protein A-like          67.4    7e-11   Cucumis melo [Oriental melon]
ref|XP_004145857.1|  PREDICTED: HMG-Y-related protein A-like          67.0    7e-11   Cucumis sativus [cucumbers]
ref|XP_002531913.1|  Histone H1, putative                             67.0    8e-11   Ricinus communis
ref|XP_010032711.1|  PREDICTED: HMG-Y-related protein B-like isof...  66.2    1e-10   Eucalyptus grandis [rose gum]
ref|XP_010032710.1|  PREDICTED: HMG-Y-related protein B-like isof...  66.2    1e-10   Eucalyptus grandis [rose gum]
ref|XP_010032709.1|  PREDICTED: HMG-Y-related protein A-like isof...  66.6    1e-10   Eucalyptus grandis [rose gum]
ref|NP_001063124.1|  Os09g0402100                                     66.6    2e-10   
ref|XP_007141909.1|  hypothetical protein PHAVU_008G236000g           65.9    2e-10   Phaseolus vulgaris [French bean]
gb|KHN17948.1|  HMG-Y-related protein A                               65.9    2e-10   Glycine soja [wild soybean]
ref|XP_004490811.1|  PREDICTED: HMG-Y-related protein A-like          65.5    3e-10   Cicer arietinum [garbanzo]
emb|CDY36240.1|  BnaC07g20940D                                        65.5    3e-10   Brassica napus [oilseed rape]
ref|XP_010916178.1|  PREDICTED: HMG-Y-related protein A-like          65.1    3e-10   Elaeis guineensis
ref|XP_006395873.1|  hypothetical protein EUTSA_v10004909mg           65.5    3e-10   Eutrema salsugineum
ref|XP_002444432.1|  hypothetical protein SORBIDRAFT_07g021860        63.9    4e-10   Sorghum bicolor [broomcorn]
emb|CAA61747.1|  HMGI/Y                                               65.1    4e-10   Pisum sativum [garden pea]
ref|XP_003538393.1|  PREDICTED: HMG-Y-related protein A-like          65.1    4e-10   Glycine max [soybeans]
ref|XP_004503130.1|  PREDICTED: HMG-Y-related protein A-like          64.7    5e-10   Cicer arietinum [garbanzo]
emb|CDP01624.1|  unnamed protein product                              64.3    5e-10   Coffea canephora [robusta coffee]
ref|XP_010694434.1|  PREDICTED: HMG-Y-related protein A-like          64.7    5e-10   Beta vulgaris subsp. vulgaris [Swiss chard]
emb|CDY17659.1|  BnaA06g34780D                                        64.7    6e-10   Brassica napus [oilseed rape]
gb|AAA32718.1|  DNA-binding protein                                   64.3    6e-10   Avena sativa [cultivated oat]
ref|XP_007141903.1|  hypothetical protein PHAVU_008G235600g           64.3    6e-10   Phaseolus vulgaris [French bean]
ref|XP_003600727.1|  HMG-Y-related protein A                          64.7    6e-10   Medicago truncatula
gb|KHN07545.1|  HMG-Y-related protein A                               63.9    6e-10   Glycine soja [wild soybean]
gb|AAF22135.1|AF127919_1  high mobility group protein I/Y             64.7    7e-10   Brassica napus [oilseed rape]
ref|XP_011075253.1|  PREDICTED: uncharacterized protein LOC105159765  65.5    7e-10   Sesamum indicum [beniseed]
gb|ACJ83992.1|  unknown                                               63.9    9e-10   Medicago truncatula
ref|XP_003552987.1|  PREDICTED: HMG-Y-related protein A-like          63.9    9e-10   Glycine max [soybeans]
ref|XP_010430645.1|  PREDICTED: HMG-Y-related protein A-like          63.5    9e-10   Camelina sativa [gold-of-pleasure]
ref|XP_011007253.1|  PREDICTED: HMG-Y-related protein A-like          63.9    9e-10   Populus euphratica
ref|XP_003616293.1|  HMG-Y-related protein A                          63.9    1e-09   Medicago truncatula
gb|EYU24123.1|  hypothetical protein MIMGU_mgv1a007150mg              66.2    1e-09   Erythranthe guttata [common monkey flower]
ref|XP_011099943.1|  PREDICTED: HMG-Y-related protein A-like          63.5    1e-09   Sesamum indicum [beniseed]
ref|XP_006661206.1|  PREDICTED: HMG-Y-related protein A-like          63.5    1e-09   Oryza brachyantha
gb|EYU30904.1|  hypothetical protein MIMGU_mgv1a015059mg              63.5    1e-09   Erythranthe guttata [common monkey flower]
ref|XP_010502141.1|  PREDICTED: HMG-Y-related protein A-like          63.5    1e-09   Camelina sativa [gold-of-pleasure]
gb|EMT05494.1|  HMG-Y-related protein A                               63.2    1e-09   Aegilops tauschii
ref|XP_009609378.1|  PREDICTED: HMG-Y-related protein A-like          62.8    2e-09   Nicotiana tomentosiformis
ref|XP_006291855.1|  hypothetical protein CARUB_v10018031mg           63.2    2e-09   Capsella rubella
ref|XP_009762223.1|  PREDICTED: HMG-Y-related protein A-like          62.4    2e-09   Nicotiana sylvestris
gb|KFK33382.1|  hypothetical protein AALP_AA5G005900                  62.8    3e-09   Arabis alpina [alpine rockcress]
gb|AAM22691.1|AF502250_1  HMG-I/Y protein HMGa                        62.0    4e-09   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010673842.1|  PREDICTED: HMG-Y-related protein A-like          61.2    1e-08   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009101330.1|  PREDICTED: LOW QUALITY PROTEIN: HMG-Y-relate...  61.2    1e-08   Brassica rapa
ref|XP_009589683.1|  PREDICTED: HMG-Y-related protein A-like          60.5    1e-08   Nicotiana tomentosiformis
ref|XP_006364633.1|  PREDICTED: HMG-Y-related protein A-like          60.5    1e-08   Solanum tuberosum [potatoes]
dbj|BAJ97147.1|  predicted protein                                    60.5    1e-08   Hordeum vulgare subsp. vulgare [barley]
ref|XP_004250181.1|  PREDICTED: HMG-Y-related protein A-like          60.1    1e-08   Solanum lycopersicum
ref|XP_010465878.1|  PREDICTED: RNA exonuclease 1 homolog             62.8    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_009798419.1|  PREDICTED: HMG-Y-related protein A-like          59.7    2e-08   Nicotiana sylvestris
ref|XP_008240168.1|  PREDICTED: RNA polymerase II degradation fac...  61.6    4e-08   Prunus mume [ume]
ref|XP_007209923.1|  hypothetical protein PRUPE_ppa004509mg           61.6    4e-08   Prunus persica
ref|XP_010487717.1|  PREDICTED: RNA exonuclease 1 homolog             61.2    5e-08   Camelina sativa [gold-of-pleasure]
emb|CDY48812.1|  BnaC02g34020D                                        58.5    5e-08   Brassica napus [oilseed rape]
ref|XP_002885238.1|  hypothetical protein ARALYDRAFT_479291           61.2    5e-08   Arabidopsis lyrata subsp. lyrata
ref|XP_010506292.1|  PREDICTED: bromodomain-containing protein 4-...  61.2    6e-08   Camelina sativa [gold-of-pleasure]
ref|XP_003634203.1|  PREDICTED: histone H1                            60.5    6e-08   Vitis vinifera
gb|KDP24595.1|  hypothetical protein JCGZ_25511                       60.8    7e-08   Jatropha curcas
ref|XP_009145002.1|  PREDICTED: basic salivary proline-rich prote...  60.5    8e-08   Brassica rapa
ref|NP_001236157.1|  uncharacterized protein LOC100305747             57.4    8e-08   Glycine max [soybeans]
ref|XP_008374835.1|  PREDICTED: formin-like protein 5                 60.5    9e-08   Malus domestica [apple tree]
emb|CDY59682.1|  BnaA05g36480D                                        60.5    1e-07   Brassica napus [oilseed rape]
ref|XP_010513890.1|  PREDICTED: HMG-Y-related protein A-like          58.2    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_007036771.1|  Winged-helix DNA-binding transcription facto...  59.7    1e-07   Theobroma cacao [chocolate]
ref|XP_002875083.1|  predicted protein                                57.8    1e-07   Arabidopsis lyrata subsp. lyrata
emb|CDY67892.1|  BnaUnng02610D                                        58.9    2e-07   Brassica napus [oilseed rape]
ref|XP_009408998.1|  PREDICTED: HMG-Y-related protein A-like          57.0    2e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006574481.1|  PREDICTED: HMG-Y-related protein A isoform X1    57.4    2e-07   Glycine max [soybeans]
ref|XP_003519330.1|  PREDICTED: HMG-Y-related protein A-like          57.4    2e-07   Glycine max [soybeans]
gb|AAG50847.1|AC074308_3  hypothetical protein, 3' partial            58.9    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009356056.1|  PREDICTED: proline-rich protein LAS17-like       59.7    2e-07   Pyrus x bretschneideri [bai li]
ref|XP_006393382.1|  hypothetical protein EUTSA_v10011410mg           59.3    2e-07   Eutrema salsugineum
ref|XP_007036770.1|  Winged-helix DNA-binding transcription facto...  59.3    2e-07   Theobroma cacao [chocolate]
emb|CDX95791.1|  BnaC05g35420D                                        58.9    2e-07   Brassica napus [oilseed rape]
ref|XP_009129220.1|  PREDICTED: HMG-Y-related protein A-like          56.2    2e-07   Brassica rapa
ref|XP_002534496.1|  histone h1/h5, putative                          58.9    3e-07   
gb|KDO40665.1|  hypothetical protein CISIN_1g0171711mg                58.5    3e-07   Citrus sinensis [Valencia orange]
gb|KHG26521.1|  hypothetical protein F383_08088                       58.9    3e-07   Gossypium arboreum [tree cotton]
emb|CDP01623.1|  unnamed protein product                              56.6    3e-07   Coffea canephora [robusta coffee]
gb|KJB50577.1|  hypothetical protein B456_008G177600                  58.9    3e-07   Gossypium raimondii
ref|XP_002442718.1|  hypothetical protein SORBIDRAFT_08g001690        55.1    4e-07   Sorghum bicolor [broomcorn]
emb|CDY09431.1|  BnaA02g25790D                                        55.5    4e-07   Brassica napus [oilseed rape]
ref|XP_006596504.1|  PREDICTED: HMG-Y-related protein A               56.2    4e-07   Glycine max [soybeans]
gb|AAF79708.1|AC020889_16  T1N15.25                                   58.5    4e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006838026.1|  hypothetical protein AMTR_s00091p00072780        56.6    4e-07   
ref|XP_006451648.1|  hypothetical protein CICLE_v10008667mg           58.2    5e-07   Citrus clementina
ref|XP_006490754.1|  PREDICTED: histone H1-like                       58.2    5e-07   Citrus sinensis [Valencia orange]
emb|CDY09432.1|  BnaA02g25780D                                        56.2    5e-07   Brassica napus [oilseed rape]
emb|CDY40600.1|  BnaC06g02160D                                        58.2    5e-07   Brassica napus [oilseed rape]
emb|CDX93685.1|  BnaA06g03630D                                        57.8    6e-07   Brassica napus [oilseed rape]
ref|NP_175295.1|  high mobility group A5                              58.2    6e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009147949.1|  PREDICTED: histone H1                            57.8    6e-07   Brassica rapa
ref|XP_007152693.1|  hypothetical protein PHAVU_004G151300g           57.8    6e-07   Phaseolus vulgaris [French bean]
gb|KHN39458.1|  HMG-Y-related protein B                               55.5    7e-07   Glycine soja [wild soybean]
ref|XP_003576512.1|  PREDICTED: HMG-Y-related protein A-like          55.8    7e-07   Brachypodium distachyon [annual false brome]
ref|XP_003544987.1|  PREDICTED: HMG-Y-related protein A-like          55.5    7e-07   Glycine max [soybeans]
ref|XP_010653193.1|  PREDICTED: HMG-Y-related protein B-like          55.5    7e-07   Vitis vinifera
ref|NP_001238502.1|  HMG-Y-related protein A                          55.5    8e-07   Glycine max [soybeans]
gb|KHN41070.1|  HMG-Y-related protein A                               55.1    8e-07   Glycine soja [wild soybean]
ref|XP_010479286.1|  PREDICTED: formin-like protein 5                 57.8    8e-07   Camelina sativa [gold-of-pleasure]
ref|XP_011084389.1|  PREDICTED: histone H1                            57.4    9e-07   Sesamum indicum [beniseed]
gb|KHN41069.1|  HMG-Y-related protein A                               55.1    9e-07   Glycine soja [wild soybean]
ref|XP_006360387.1|  PREDICTED: HMG-Y-related protein A-like          55.1    9e-07   Solanum tuberosum [potatoes]
ref|NP_188431.3|  protein HON4                                        57.4    9e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004240031.1|  PREDICTED: HMG-Y-related protein B-like          55.1    9e-07   Solanum lycopersicum
ref|XP_009360089.1|  PREDICTED: synapsin-1                            57.4    9e-07   Pyrus x bretschneideri [bai li]
emb|CDY04315.1|  BnaC05g25770D                                        57.4    1e-06   Brassica napus [oilseed rape]
ref|XP_006307404.1|  hypothetical protein CARUB_v10009029mg           57.4    1e-06   Capsella rubella
ref|XP_008352867.1|  PREDICTED: nascent polypeptide-associated co...  57.0    1e-06   Malus domestica [apple tree]
emb|CDY48811.1|  BnaC02g34030D                                        55.8    1e-06   Brassica napus [oilseed rape]
ref|XP_004512726.1|  PREDICTED: helicase SRCAP-like                   56.6    2e-06   Cicer arietinum [garbanzo]
ref|XP_002894121.1|  hypothetical protein ARALYDRAFT_474000           56.6    2e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_006297480.1|  hypothetical protein CARUB_v10013499mg           56.6    2e-06   Capsella rubella
ref|XP_010461688.1|  PREDICTED: extensin-like isoform X1              56.2    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010274698.1|  PREDICTED: histone H1-like                       56.2    2e-06   Nelumbo nucifera [Indian lotus]
ref|XP_006406662.1|  hypothetical protein EUTSA_v10020566mg           56.2    2e-06   Eutrema salsugineum
ref|XP_010461689.1|  PREDICTED: proline-rich extensin-like protei...  56.2    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_002265692.2|  PREDICTED: HMG-Y-related protein B               54.7    3e-06   Vitis vinifera
ref|XP_010500400.1|  PREDICTED: putative uncharacterized protein ...  55.8    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_007163385.1|  hypothetical protein PHAVU_001G230300g           53.5    4e-06   Phaseolus vulgaris [French bean]
ref|XP_006341568.1|  PREDICTED: altered inheritance of mitochondr...  55.5    4e-06   Solanum tuberosum [potatoes]
ref|XP_004982003.1|  PREDICTED: basic proline-rich protein-like       54.3    4e-06   Setaria italica
gb|KHN00167.1|  Histone H1.2                                          54.7    4e-06   Glycine soja [wild soybean]
gb|AFW67843.1|  hypothetical protein ZEAMMB73_725660                  54.3    4e-06   Zea mays [maize]
gb|KJB78248.1|  hypothetical protein B456_012G185800                  55.1    4e-06   Gossypium raimondii
ref|NP_001236260.1|  HMG I/Y like protein                             55.1    5e-06   Glycine max [soybeans]
gb|KEH26927.1|  linker histone H1 and h5 family protein               55.5    5e-06   Medicago truncatula
gb|KJB78249.1|  hypothetical protein B456_012G185800                  55.1    5e-06   Gossypium raimondii
emb|CAA15421.1|  HMR1 protein                                         55.1    5e-06   Antirrhinum majus [garden snapdragon]
ref|NP_001142793.1|  uncharacterized protein LOC100275167             53.9    6e-06   Zea mays [maize]
ref|XP_003524344.1|  PREDICTED: histone H1-like                       54.7    7e-06   Glycine max [soybeans]
gb|KEH28971.1|  linker histone H1 and h5 family protein               52.4    7e-06   Medicago truncatula
ref|XP_002321509.1|  hypothetical protein POPTR_0015s04390g           54.7    8e-06   Populus trichocarpa [western balsam poplar]
gb|KHN10548.1|  Histone H1.2                                          53.5    8e-06   Glycine soja [wild soybean]
ref|XP_010095996.1|  Histone                                          54.7    8e-06   Morus notabilis
ref|XP_011039114.1|  PREDICTED: histone-lysine N-methyltransferas...  54.7    8e-06   Populus euphratica
ref|XP_011008342.1|  PREDICTED: nascent polypeptide-associated co...  54.3    9e-06   Populus euphratica
ref|XP_011008341.1|  PREDICTED: nascent polypeptide-associated co...  54.3    9e-06   Populus euphratica
ref|XP_011008340.1|  PREDICTED: nascent polypeptide-associated co...  54.3    9e-06   Populus euphratica
ref|XP_011008339.1|  PREDICTED: AF4/FMR2 family member 4-like iso...  54.3    9e-06   Populus euphratica
ref|XP_009146128.1|  PREDICTED: uncharacterized protein LOC103869808  54.7    9e-06   Brassica rapa
ref|XP_003631087.1|  HMG-Y-related protein A                          54.3    1e-05   Medicago truncatula
ref|XP_002464000.1|  hypothetical protein SORBIDRAFT_01g010370        53.5    1e-05   Sorghum bicolor [broomcorn]
ref|XP_004235775.1|  PREDICTED: basic salivary proline-rich prote...  53.9    1e-05   Solanum lycopersicum
emb|CDX95794.1|  BnaC05g35450D                                        53.9    1e-05   Brassica napus [oilseed rape]
ref|XP_011464492.1|  PREDICTED: extensin                              53.9    1e-05   Fragaria vesca subsp. vesca
emb|CDX92189.1|  BnaA05g22180D                                        53.5    2e-05   Brassica napus [oilseed rape]
gb|KCW53132.1|  hypothetical protein EUGRSUZ_J02424                   51.2    2e-05   Eucalyptus grandis [rose gum]
ref|XP_008644071.1|  PREDICTED: uncharacterized LOC100383454 isof...  53.5    2e-05   Zea mays [maize]
ref|NP_001169574.1|  uncharacterized LOC100383454                     53.5    2e-05   Zea mays [maize]
gb|KFK39128.1|  hypothetical protein AALP_AA3G204600                  53.1    2e-05   Arabis alpina [alpine rockcress]
ref|XP_006607091.1|  PREDICTED: histone H1-like                       52.4    3e-05   
ref|XP_004959446.1|  PREDICTED: HMG-Y-related protein A-like          50.8    3e-05   
ref|XP_002318524.2|  hypothetical protein POPTR_0012s04580g           52.4    4e-05   Populus trichocarpa [western balsam poplar]
ref|XP_009145943.1|  PREDICTED: formin-like protein 20                52.4    4e-05   Brassica rapa
emb|CDX92188.1|  BnaA05g22190D                                        52.4    4e-05   Brassica napus [oilseed rape]
ref|XP_010926660.1|  PREDICTED: HMG-Y-related protein A-like          52.0    4e-05   Elaeis guineensis
emb|CDO98365.1|  unnamed protein product                              52.4    5e-05   Coffea canephora [robusta coffee]
gb|KHN28586.1|  HMG-Y-related protein A                               50.1    5e-05   Glycine soja [wild soybean]
ref|XP_003557467.1|  PREDICTED: histone H1-like                       51.2    7e-05   Brachypodium distachyon [annual false brome]
gb|ACF84298.1|  unknown                                               50.4    1e-04   Zea mays [maize]
gb|ACG30920.1|  hypothetical protein                                  50.4    1e-04   Zea mays [maize]
gb|ACG26676.1|  histone H1                                            50.4    1e-04   Zea mays [maize]
ref|NP_001105088.1|  histone H1-like protein                          50.4    1e-04   
sp|Q10370.1|HMGYB_SOYBN  RecName: Full=HMG-Y-related protein B; A...  48.9    1e-04   Glycine max [soybeans]
ref|XP_008651835.1|  PREDICTED: histone H1-like protein isoform X1    50.1    1e-04   Zea mays [maize]
gb|ACF78698.1|  unknown                                               50.4    1e-04   Zea mays [maize]
tpg|DAA61366.1|  TPA: hypothetical protein ZEAMMB73_096672            50.4    2e-04   Zea mays [maize]
ref|XP_009631521.1|  PREDICTED: bromodomain-containing protein 4B...  50.4    2e-04   Nicotiana tomentosiformis
ref|XP_009769081.1|  PREDICTED: SH3 domain-containing protein C23...  50.4    2e-04   Nicotiana sylvestris
ref|XP_010033474.1|  PREDICTED: uncharacterized protein LOC104422...  50.4    2e-04   Eucalyptus grandis [rose gum]
gb|KCW53134.1|  hypothetical protein EUGRSUZ_J02425                   50.4    2e-04   Eucalyptus grandis [rose gum]
gb|AAA50196.1|  DNA-binding protein                                   50.4    2e-04   Nicotiana tabacum [American tobacco]
ref|XP_010033476.1|  PREDICTED: uncharacterized protein LOC104422...  50.4    2e-04   Eucalyptus grandis [rose gum]
ref|XP_010034691.1|  PREDICTED: uncharacterized protein LOC104423975  50.4    2e-04   Eucalyptus grandis [rose gum]
ref|XP_010033475.1|  PREDICTED: uncharacterized protein LOC104422...  50.4    2e-04   Eucalyptus grandis [rose gum]
emb|CDP00776.1|  unnamed protein product                              49.3    2e-04   Coffea canephora [robusta coffee]
gb|KFK36079.1|  hypothetical protein AALP_AA4G074700                  50.1    2e-04   Arabis alpina [alpine rockcress]
ref|XP_009419474.1|  PREDICTED: HMG-Y-related protein B-like          49.7    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008792959.1|  PREDICTED: HMG-Y-related protein A-like isof...  49.7    2e-04   
ref|NP_001169309.1|  uncharacterized protein LOC100383173             49.7    3e-04   
ref|XP_008792960.1|  PREDICTED: HMG-Y-related protein A-like isof...  49.3    3e-04   
ref|XP_008792961.1|  PREDICTED: HMG-Y-related protein A-like isof...  49.3    3e-04   
emb|CDX95560.1|  BnaC01g34520D                                        49.7    3e-04   
ref|XP_006604195.1|  PREDICTED: HMG-Y-related protein A-like          48.5    4e-04   
ref|XP_009113565.1|  PREDICTED: histone H1-like                       49.7    4e-04   
gb|KCW48598.1|  hypothetical protein EUGRSUZ_K02265                   47.4    4e-04   
ref|XP_002459445.1|  hypothetical protein SORBIDRAFT_02g004730        48.9    4e-04   
gb|KJB78158.1|  hypothetical protein B456_012G181100                  49.7    4e-04   
ref|XP_007160515.1|  hypothetical protein PHAVU_002G328400g           48.9    4e-04   
emb|CDY18486.1|  BnaA01g27090D                                        49.3    5e-04   
gb|KJB78159.1|  hypothetical protein B456_012G181100                  49.3    5e-04   
ref|XP_006575279.1|  PREDICTED: HMG-Y-related protein A-like isof...  48.5    5e-04   
ref|XP_010036942.1|  PREDICTED: uncharacterized protein LOC104425829  47.8    6e-04   
ref|XP_007160516.1|  hypothetical protein PHAVU_002G328400g           48.5    7e-04   
gb|EYU31828.1|  hypothetical protein MIMGU_mgv11b022888mg             48.1    7e-04   
ref|NP_001059060.1|  Os07g0184800                                     48.1    7e-04   
gb|EYU45802.1|  hypothetical protein MIMGU_mgv1a015242mg              47.4    7e-04   
gb|EAZ03015.1|  hypothetical protein OsI_25157                        48.1    8e-04   
ref|XP_006855358.1|  hypothetical protein AMTR_s00057p00112340        47.4    8e-04   
gb|EMT22690.1|  hypothetical protein F775_43958                       45.1    0.001   



>ref|XP_002311516.1| high-mobility-group family protein [Populus trichocarpa]
 gb|EEE88883.1| high-mobility-group family protein [Populus trichocarpa]
Length=207

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IMAAIE LNEK GS K+ IS+QIE+ H  +LP +H+TLL+H+L+KMKQSGQLVLVKNNY
Sbjct  42   MIMAAIEALNEKEGSNKTSISKQIESTHP-DLPPAHSTLLSHHLNKMKQSGQLVLVKNNY  100

Query  284  KK  279
             K
Sbjct  101  MK  102



>ref|XP_011023827.1| PREDICTED: HMG-Y-related protein B-like [Populus euphratica]
Length=211

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IMAAIE LNEK GS K+ IS+QIE+ H  +LP +H+TLL+H+L+KMKQSGQLVLVKNNY
Sbjct  46   MIMAAIEALNEKEGSNKTSISKQIESTHP-DLPPAHSTLLSHHLNKMKQSGQLVLVKNNY  104

Query  284  KK  279
             K
Sbjct  105  MK  106



>ref|XP_011038601.1| PREDICTED: HMG-Y-related protein B-like [Populus euphratica]
Length=215

 Score = 87.4 bits (215),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 53/62 (85%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IMAA+E LNEK GS+K+ IS+QIE+ H  +LP +H TLL+H+L+K+KQSGQLVLVKNNY
Sbjct  50   MIMAAVEALNEKEGSSKTSISKQIESTHP-DLPPAHGTLLSHHLNKLKQSGQLVLVKNNY  108

Query  284  KK  279
             K
Sbjct  109  MK  110



>ref|XP_002284720.1| PREDICTED: HMG-Y-related protein A [Vitis vinifera]
 emb|CBI26865.3| unnamed protein product [Vitis vinifera]
Length=182

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IMAAIE LN+KGGS KS IS+ IE+ +G +LP +H+TLL H+L+KMKQSG LV+VKNNY
Sbjct  22   MIMAAIEALNDKGGSNKSSISKYIESTYG-DLPAAHSTLLAHHLNKMKQSGDLVMVKNNY  80

Query  284  KK  279
             K
Sbjct  81   MK  82



>ref|XP_002315870.2| hypothetical protein POPTR_0010s11980g [Populus trichocarpa]
 gb|ABK94398.1| unknown [Populus trichocarpa]
 gb|EEF02041.2| hypothetical protein POPTR_0010s11980g [Populus trichocarpa]
Length=215

 Score = 87.0 bits (214),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 53/62 (85%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IMAA+E LNEK GS+K+ IS+QIE+ H  +LP +H TLL+H+L+K+KQSGQLVLVKNNY
Sbjct  50   MIMAAVEALNEKEGSSKTSISKQIESTHP-DLPPAHGTLLSHHLNKLKQSGQLVLVKNNY  108

Query  284  KK  279
             K
Sbjct  109  MK  110



>ref|XP_006448210.1| hypothetical protein CICLE_v10016374mg [Citrus clementina]
 gb|ESR61450.1| hypothetical protein CICLE_v10016374mg [Citrus clementina]
Length=251

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 54/62 (87%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IMAAIE LNEK GS+K++IS+Q+E+A+  +LP +H TLL H+L+KMKQSG+LV+VKNNY
Sbjct  79   MIMAAIEALNEKAGSSKAEISKQMESAYP-DLPPAHTTLLAHHLNKMKQSGELVMVKNNY  137

Query  284  KK  279
             K
Sbjct  138  MK  139



>ref|XP_006469214.1| PREDICTED: HMG-Y-related protein A-like [Citrus sinensis]
Length=210

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 54/62 (87%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IMAAIE LNEK GS+K++IS+Q+E+A+  +LP +H TLL H+L+KMKQSG+LV+VKNNY
Sbjct  38   MIMAAIEALNEKAGSSKAEISKQMESAYP-DLPPAHTTLLAHHLNKMKQSGELVMVKNNY  96

Query  284  KK  279
             K
Sbjct  97   MK  98



>gb|KDO64579.1| hypothetical protein CISIN_1g028369mg [Citrus sinensis]
Length=210

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 54/62 (87%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IMAAIE LNEK GS+K++IS+Q+E+A+  +LP +H TLL H+L+KMKQSG+LV+VKNNY
Sbjct  38   MIMAAIEALNEKAGSSKAEISKQMESAYP-DLPPAHTTLLAHHLNKMKQSGELVMVKNNY  96

Query  284  KK  279
             K
Sbjct  97   MK  98



>ref|XP_010044209.1| PREDICTED: HMG-Y-related protein B-like [Eucalyptus grandis]
 gb|KCW86256.1| hypothetical protein EUGRSUZ_B02941 [Eucalyptus grandis]
Length=198

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IMAAIE LN+  GS KS I+RQIE+ +G +LP +H+TLL H+L+KMKQSG+LVLVKNNY
Sbjct  32   MIMAAIEALNDPSGSNKSAIARQIESTYG-DLPPAHSTLLAHHLNKMKQSGELVLVKNNY  90

Query  284  KK  279
             K
Sbjct  91   MK  92



>emb|CAN71833.1| hypothetical protein VITISV_005586 [Vitis vinifera]
Length=182

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IMAAIE LN+K GS KS IS+ IE+ +G +LP +H+TLL H+L+KMKQSG LV+VKNNY
Sbjct  22   MIMAAIEALNDKSGSNKSSISKYIESTYG-DLPAAHSTLLAHHLNKMKQSGDLVMVKNNY  80

Query  284  KK  279
             K
Sbjct  81   MK  82



>ref|XP_002527784.1| Histone H1, putative [Ricinus communis]
 gb|EEF34594.1| Histone H1, putative [Ricinus communis]
Length=199

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AAIE LN+K GS KS IS+Q+E  +  +LP +H TLL+H+L+KMKQSGQLVLVKNNY
Sbjct  34   MILAAIESLNDKNGSNKSAISKQMETTYP-DLPPAHTTLLSHHLNKMKQSGQLVLVKNNY  92

Query  284  KK  279
             K
Sbjct  93   MK  94



>gb|KDP38087.1| hypothetical protein JCGZ_04730 [Jatropha curcas]
Length=212

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            LIM AIE LN+K GS KS IS+QIE  +  +LP +H TLL+H+L+KMKQSGQLV+VKNNY
Sbjct  46   LIMQAIEALNDKNGSNKSAISKQIETIYP-DLPAAHTTLLSHHLNKMKQSGQLVMVKNNY  104

Query  284  KK  279
             K
Sbjct  105  MK  106



>ref|XP_004297466.2| PREDICTED: HMG-Y-related protein B-like [Fragaria vesca subsp. 
vesca]
Length=264

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE LNE GGS K+ I++QIE+ H  +LP +HATLL  +L+KMKQSG+L  VKNNY
Sbjct  96   MIMEAIEGLNETGGSNKTSIAQQIESTHTTDLPPAHATLLAQHLEKMKQSGELAFVKNNY  155

Query  284  KK  279
             K
Sbjct  156  MK  157



>gb|EYU24928.1| hypothetical protein MIMGU_mgv1a013363mg [Erythranthe guttata]
Length=222

 Score = 82.0 bits (201),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AAIE LNE  GS KS IS+QIE  HG +LP +H+TLLTH+L+KMK SGQL+  KN+Y
Sbjct  35   MILAAIEALNEDQGSNKSSISKQIEDTHG-DLPPAHSTLLTHHLNKMKSSGQLIFSKNSY  93

Query  284  KK  279
            +K
Sbjct  94   RK  95



>gb|EYU33118.1| hypothetical protein MIMGU_mgv1a025782mg, partial [Erythranthe 
guttata]
Length=172

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AAIE LNE  GS KS IS+QIE  HG +LP +H+TLLTH+L+KMK SGQL+  KN Y
Sbjct  35   MILAAIEALNEDQGSNKSSISKQIEDTHG-DLPPAHSTLLTHHLNKMKSSGQLIFSKNCY  93

Query  284  KK  279
            +K
Sbjct  94   RK  95



>ref|XP_008221436.1| PREDICTED: HMG-Y-related protein B-like [Prunus mume]
Length=176

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IMAAIE LN+  GS KS I+  IE+ +G +LP +HATLL H+L+KMKQSG+LVLVKNNY
Sbjct  25   MIMAAIEALNDSNGSNKSAIATYIESTYG-DLPPAHATLLAHHLNKMKQSGELVLVKNNY  83

Query  284  KK  279
             K
Sbjct  84   MK  85



>ref|XP_009627953.1| PREDICTED: HMG-Y-related protein B-like [Nicotiana tomentosiformis]
Length=197

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE LN++ GS KS I++QI+A++G  LP +H TLL H+L+KMKQSGQLV+VKNNY
Sbjct  29   MIMEAIEALNDENGSNKSAIAKQIDASYG-TLPPAHGTLLAHHLNKMKQSGQLVMVKNNY  87

Query  284  KK  279
             K
Sbjct  88   MK  89



>ref|XP_007221891.1| hypothetical protein PRUPE_ppa018145mg [Prunus persica]
 gb|EMJ23090.1| hypothetical protein PRUPE_ppa018145mg [Prunus persica]
Length=188

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IMAAIE LN+  GS KS I+  IE+ +G +LP +HATLL H+L+KMKQSG+LVLVKNNY
Sbjct  25   MIMAAIEALNDSNGSNKSAIATYIESTYG-DLPPAHATLLAHHLNKMKQSGELVLVKNNY  83

Query  284  KK  279
             K
Sbjct  84   MK  85



>gb|EYU33122.1| hypothetical protein MIMGU_mgv1a014230mg [Erythranthe guttata]
Length=196

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IMAAIE L+E+ GS KS IS+QIEA +G  LP +H TL+TH+L++MK SGQL+ VKNNY
Sbjct  25   MIMAAIEALSEESGSNKSSISKQIEATYG-NLPPAHTTLITHHLNRMKSSGQLLFVKNNY  83

Query  284  KK  279
             K
Sbjct  84   LK  85



>gb|EPS73298.1| hypothetical protein M569_01461 [Genlisea aurea]
Length=208

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AAIE LN+K GS KS ISRQIE+ +G  LP +H+TLLTH+L++MK  GQLV  KNNY
Sbjct  31   MIIAAIEALNDKNGSNKSAISRQIESTYG-NLPPAHSTLLTHHLNRMKSIGQLVFSKNNY  89

Query  284  KK  279
             K
Sbjct  90   LK  91



>ref|XP_009773451.1| PREDICTED: HMG-Y-related protein B [Nicotiana sylvestris]
Length=197

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE LN++ GS KS I++QI+A +G  LP +H TLL H+L+KMKQSGQLV+ KNNY
Sbjct  29   MIMEAIEALNDENGSNKSAIAKQIDATYG-TLPPAHGTLLAHHLNKMKQSGQLVMAKNNY  87

Query  284  KK  279
             K
Sbjct  88   MK  89



>ref|XP_007045213.1| HMG-Y-related protein B [Theobroma cacao]
 gb|EOY01045.1| HMG-Y-related protein B [Theobroma cacao]
Length=190

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AIE LNEK GS KS IS+ IE+ H  +LP +H+TLL+H+L+KMKQSGQ+V+ KNNY
Sbjct  27   MILEAIEALNEKAGSNKSAISKHIESTHP-DLPAAHSTLLSHHLNKMKQSGQIVMSKNNY  85

Query  284  KK  279
             K
Sbjct  86   LK  87



>ref|XP_011075400.1| PREDICTED: HMG-Y-related protein B-like [Sesamum indicum]
Length=206

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AAIE LNE  GS KS IS+ IEA +G  LP +H+TLLTH+L+KMK +GQL+ VKNNY
Sbjct  35   MILAAIEALNEDNGSNKSSISKHIEATYG-NLPPAHSTLLTHHLNKMKSAGQLLFVKNNY  93

Query  284  KK  279
             K
Sbjct  94   LK  95



>ref|XP_004236944.1| PREDICTED: HMG-Y-related protein A [Solanum lycopersicum]
Length=179

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AI+ LNE+ GS KS I +QIEA HG  LP +H TLL H+L++MKQ+GQLV++KNNY
Sbjct  16   MIMEAIDALNEEEGSNKSAIWKQIEATHG-TLPPAHGTLLAHHLNQMKQAGQLVMLKNNY  74

Query  284  KK  279
             K
Sbjct  75   MK  76



>ref|XP_008466945.1| PREDICTED: HMG-Y-related protein A [Cucumis melo]
Length=186

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IMAAI+ LN+K G +KS I++QIE+ +G +LP +  TLLTH+LD MKQ+GQL+ VKNNY
Sbjct  26   MIMAAIDSLNDKNGVSKSAITKQIESTYG-DLPPAFTTLLTHHLDVMKQTGQLLFVKNNY  84

Query  284  KK  279
             K
Sbjct  85   MK  86



>gb|KDP33183.1| hypothetical protein JCGZ_13448 [Jatropha curcas]
Length=190

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AAIE LNE+ GS K+ IS+ IE+ +G ELP SH TLLTH+L++MK +G+LV  KNNY
Sbjct  18   MILAAIEALNEQNGSNKTSISKYIESKYG-ELPASHTTLLTHHLNRMKDTGELVFWKNNY  76

Query  284  KK  279
             K
Sbjct  77   MK  78



>ref|XP_006355073.1| PREDICTED: HMG-Y-related protein A-like [Solanum tuberosum]
Length=188

 Score = 78.6 bits (192),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AI+ LNE+ GS KS I RQIE  HG  LP +H TLL H+L++MKQ+GQLV++KNNY
Sbjct  16   MIMEAIDALNEEEGSNKSAIWRQIEGTHG-TLPPAHGTLLAHHLNQMKQAGQLVMLKNNY  74

Query  284  KK  279
             K
Sbjct  75   MK  76



>ref|XP_004150116.1| PREDICTED: HMG-Y-related protein A-like [Cucumis sativus]
 ref|XP_004168995.1| PREDICTED: HMG-Y-related protein A-like [Cucumis sativus]
 gb|KGN51483.1| hypothetical protein Csa_5G568810 [Cucumis sativus]
Length=186

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IMAAI+ LN+K G +KS I++QIE+ +G +LP +  TLLTH+LD MKQ+GQL+ +KNNY
Sbjct  26   MIMAAIDSLNDKNGVSKSAITKQIESTYG-DLPPAFTTLLTHHLDVMKQTGQLLFIKNNY  84

Query  284  KK  279
             K
Sbjct  85   MK  86



>ref|XP_010101971.1| HMG-Y-related protein A [Morus notabilis]
 gb|EXB90895.1| HMG-Y-related protein A [Morus notabilis]
Length=184

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IMAAIE L+E+GGS KS I++ IE    G LP +H TLL H+L++M+QSG+LVLVKN Y
Sbjct  25   MIMAAIESLDEEGGSNKSSIAKHIEET-CGNLPAAHTTLLAHHLNRMRQSGELVLVKNCY  83

Query  284  KK  279
             K
Sbjct  84   MK  85



>ref|XP_008677023.1| PREDICTED: uncharacterized protein LOC100277576 isoform X1 [Zea 
mays]
Length=166

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AAIE+L +K GS KS ISR IE  + G+LP +HA+LL  +L +MK+SG+LV VKNNY
Sbjct  1    MILAAIEDLGDKSGSNKSAISRYIEGKYDGDLPPAHASLLAAHLARMKESGELVFVKNNY  60



>gb|AFW62239.1| hypothetical protein ZEAMMB73_329593 [Zea mays]
Length=183

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AAIE+L +K GS KS ISR IE  + G+LP +HA+LL  +L +MK+SG+LV VKNNY
Sbjct  18   MILAAIEDLGDKSGSNKSAISRYIEGKYDGDLPPAHASLLAAHLARMKESGELVFVKNNY  77



>gb|KHF97239.1| HMG-Y-related A [Gossypium arboreum]
Length=195

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            LIM AIE LN+K GS K+ IS+ IE+ +G +LP  H TLL+H+L++MKQ+G+LV +KNNY
Sbjct  18   LIMNAIEALNDKNGSNKTSISKYIESKYG-DLPAGHTTLLSHHLNRMKQTGELVFLKNNY  76

Query  284  KK  279
             K
Sbjct  77   MK  78



>gb|KJB08551.1| hypothetical protein B456_001G088600 [Gossypium raimondii]
 gb|KJB08552.1| hypothetical protein B456_001G088600 [Gossypium raimondii]
 gb|KJB08553.1| hypothetical protein B456_001G088600 [Gossypium raimondii]
Length=179

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            LIM AIE LN+K GS K+ IS+ IE+ +G +LP  H TLL+H+L++MKQ+G+LV +KNNY
Sbjct  18   LIMNAIEALNDKNGSNKTSISKYIESKYG-DLPAGHTTLLSHHLNRMKQTGELVFLKNNY  76

Query  284  KK  279
             K
Sbjct  77   MK  78



>ref|NP_001144569.1| uncharacterized protein LOC100277576 [Zea mays]
 gb|ACG41426.1| hypothetical protein [Zea mays]
Length=183

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AAIE+L +K GS KS ISR IE  + G+LP +HA+LL  +L +MK+SG+LV VKNNY
Sbjct  18   MILAAIEDLCDKSGSNKSAISRYIEGKYDGDLPPAHASLLAAHLARMKESGELVFVKNNY  77



>ref|XP_008800773.1| PREDICTED: LOW QUALITY PROTEIN: HMG-Y-related protein A-like 
[Phoenix dactylifera]
Length=179

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 52/62 (84%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AAIE LNEK GS KS IS+ IE+++G ELP SH++LLT +L +MK+SG+L+LVKNNY
Sbjct  18   MILAAIEALNEKEGSNKSAISKYIESSYG-ELPQSHSSLLTAHLARMKESGELLLVKNNY  76

Query  284  KK  279
             K
Sbjct  77   LK  78



>ref|XP_009351784.1| PREDICTED: HMG-Y-related protein A-like, partial [Pyrus x bretschneideri]
Length=164

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            LIMAAIE LN+  GS+KS I++ IE+ +G +LP +HA LL H+L+ MK +G+LVLVKNNY
Sbjct  24   LIMAAIEALNDSNGSSKSAIAKHIESTYG-DLPETHAALLAHHLNMMKDTGELVLVKNNY  82

Query  284  KK  279
             K
Sbjct  83   MK  84



>ref|XP_008775214.1| PREDICTED: HMG-Y-related protein A-like [Phoenix dactylifera]
Length=166

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AI  L+EK GS+KS IS+ IEAAHGG+LP SHA+LL  +L +M ++G+LV V N Y
Sbjct  18   MILTAISALDEKSGSSKSAISKHIEAAHGGQLPPSHASLLAGHLARMTEAGELVFVNNCY  77



>dbj|BAA11766.1| high mobility group protein [Canavalia gladiata]
 dbj|BAA13133.1| high mobility group protein [Canavalia gladiata]
Length=178

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            ++M A++ LNE  GS KS IS+ IE+ +G ELP  HATLL H+L+KMK SG+LV +KNNY
Sbjct  18   MVMKALDALNEPSGSNKSAISKYIESTYG-ELPDGHATLLAHHLNKMKDSGELVFLKNNY  76

Query  284  KK  279
             K
Sbjct  77   MK  78



>emb|CDP00813.1| unnamed protein product [Coffea canephora]
Length=206

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I++AIE LN+K GS KS IS+ IE+ +G  LP +H+TLLTH+L++MK +GQL ++KNNY
Sbjct  38   MILSAIEALNDKNGSNKSTISKHIESTYG-NLPPAHSTLLTHHLNRMKATGQLAMLKNNY  96

Query  284  KK  279
             K
Sbjct  97   LK  98



>ref|XP_010932593.1| PREDICTED: HMG-Y-related protein A-like [Elaeis guineensis]
Length=179

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 52/62 (84%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AAI  LNEK GS+KS IS+ IE+++G ELP SH++LLT +L +MK+SG+L+LVKNNY
Sbjct  18   MILAAIAALNEKEGSSKSAISKYIESSYG-ELPQSHSSLLTAHLARMKESGELLLVKNNY  76

Query  284  KK  279
             K
Sbjct  77   LK  78



>ref|XP_007215046.1| hypothetical protein PRUPE_ppa012096mg [Prunus persica]
 gb|EMJ16245.1| hypothetical protein PRUPE_ppa012096mg [Prunus persica]
Length=183

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AIE LNEK GS KS IS+ IE+ +G +LP  H +LL+H+L+KMK SG+LV  KNNY
Sbjct  18   MILKAIEALNEKNGSNKSSISKFIESTYG-DLPAGHNSLLSHHLNKMKDSGELVFWKNNY  76

Query  284  KK  279
             K
Sbjct  77   TK  78



>ref|XP_010909519.1| PREDICTED: LOW QUALITY PROTEIN: HMG-Y-related protein B-like 
[Elaeis guineensis]
Length=162

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 50/60 (83%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AAI  LNEK GS KS IS+ IE+++G ELP SH++LLT +L +MK+SG+L+L+KNNY
Sbjct  1    MILAAITALNEKNGSNKSAISKYIESSYG-ELPQSHSSLLTAHLARMKESGELLLIKNNY  59



>ref|XP_010274748.1| PREDICTED: HMG-Y-related protein A [Nelumbo nucifera]
Length=173

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AAI  LNEK GS KS IS+ IE+ +G ++P  H+ LL+H+L++MK+SG+L++VKNNY
Sbjct  18   MILAAIAALNEKNGSNKSAISKYIESQYG-DIPAGHSQLLSHHLNRMKESGELIMVKNNY  76

Query  284  KK  279
             K
Sbjct  77   IK  78



>ref|XP_008343053.1| PREDICTED: HMG-Y-related protein A-like [Malus domestica]
Length=183

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AIE LN+K GS KS IS+ IE+ +G E+P  H+TLL+H+L KMK +G+LV  KNNY
Sbjct  18   MILQAIEALNDKNGSNKSSISKYIESTYG-EVPAGHSTLLSHHLSKMKDNGELVFWKNNY  76

Query  284  KK  279
             K
Sbjct  77   TK  78



>ref|XP_009401276.1| PREDICTED: HMG-Y-related protein A-like [Musa acuminata subsp. 
malaccensis]
Length=177

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE LNEK GS KS IS+ IE  +G ELP SH++LLT +L +M++SG+L+ +KNNY
Sbjct  14   MIMEAIEALNEKNGSNKSAISKYIETKYG-ELPPSHSSLLTAHLARMRESGELLFIKNNY  72



>ref|XP_008801167.1| PREDICTED: HMG-Y-related protein A-like [Phoenix dactylifera]
Length=180

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 51/62 (82%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AAI  L+EK GS KS IS+ IE+++G ELP SH++LLT +L +MK+SG+L+LVKNNY
Sbjct  18   MILAAITALDEKNGSNKSAISKYIESSYG-ELPQSHSSLLTAHLARMKESGELLLVKNNY  76

Query  284  KK  279
             K
Sbjct  77   VK  78



>ref|XP_008229206.1| PREDICTED: HMG-Y-related protein A-like [Prunus mume]
Length=183

 Score = 73.2 bits (178),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AIE LNEK GS KS IS+ IE+ +G +LP  H +LL+H+L+KMK SG+L+  KNNY
Sbjct  18   MILKAIEALNEKNGSNKSSISKFIESTYG-DLPAGHNSLLSHHLNKMKDSGELLFWKNNY  76

Query  284  KK  279
             K
Sbjct  77   TK  78



>ref|XP_009334425.1| PREDICTED: HMG-Y-related protein A-like [Pyrus x bretschneideri]
Length=183

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AIE LN+K GS KS IS+ IE+ +G E+P  H TLL+H+L KMK +G+LV  KNNY
Sbjct  18   MILQAIEALNDKNGSNKSSISKYIESTYG-EVPAGHNTLLSHHLSKMKDNGELVFWKNNY  76

Query  284  KK  279
             K
Sbjct  77   TK  78



>gb|KJB50374.1| hypothetical protein B456_008G167400 [Gossypium raimondii]
Length=182

 Score = 72.8 bits (177),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AIE LNEK GS+ S I++ I++ H  +LP SH+TLL+H+L++MKQ GQ+V++ NNY
Sbjct  27   MILEAIEALNEKEGSSMSSIAKHIDSTHS-DLPASHSTLLSHHLNQMKQMGQIVMLNNNY  85

Query  284  KK  279
             K
Sbjct  86   SK  87



>ref|NP_001061850.2| Os08g0428800 [Oryza sativa Japonica Group]
 dbj|BAC24935.1| putative high mobility group I/Y (HMGI/Y protein) [Oryza sativa 
Japonica Group]
 dbj|BAD01198.1| putative high mobility group I/Y (HMGI/Y protein) [Oryza sativa 
Japonica Group]
 dbj|BAF23764.2| Os08g0428800 [Oryza sativa Japonica Group]
Length=178

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AAIE LNEK GS KS IS+ IE  +G +LP +HA+LLT +L +MK+SG+L+ +KNNY
Sbjct  19   MILAAIEGLNEKSGSNKSAISKFIEGKYG-DLPPAHASLLTAHLARMKESGELIFLKNNY  77



>gb|KHG07018.1| HMG-Y-related A [Gossypium arboreum]
Length=182

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AIE LNEK GS+ S I++ I++ H  +LP SH+TLL+H+L++MKQ GQ+V++ NNY
Sbjct  27   MILEAIEALNEKEGSSMSSIAKHIDSTHS-DLPASHSTLLSHHLNQMKQMGQIVMLNNNY  85

Query  284  KK  279
             K
Sbjct  86   TK  87



>ref|XP_010554409.1| PREDICTED: HMG-Y-related protein A-like [Tarenaya hassleriana]
Length=202

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM A+E L +K GS K+ IS+ IE+ H   LP SHATLL+++L ++KQ+GQLV+VKNNY
Sbjct  31   MIMQAVEALGDKSGSNKTAISKHIESLHPN-LPPSHATLLSYHLSQLKQNGQLVMVKNNY  89

Query  284  KK  279
             K
Sbjct  90   MK  91



>ref|XP_002266360.1| PREDICTED: HMG-Y-related protein B-like [Vitis vinifera]
Length=215

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 53/76 (70%), Gaps = 9/76 (12%)
 Frame = -3

Query  506  IIYHLGTNYFVVV*LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDK  327
            I+ HL T         MAAIE LN+K GS+KS IS+ IE+AH G+LP +H+TLL H+L++
Sbjct  43   ILQHLET--------TMAAIEALNDKSGSSKSFISKHIESAH-GDLPAAHSTLLMHHLNR  93

Query  326  MKQSGQLVLVKNNYKK  279
             KQ+G  V+V+N+  K
Sbjct  94   RKQNGDPVMVRNHCMK  109



>ref|XP_004973484.1| PREDICTED: HMG-Y-related protein A-like [Setaria italica]
Length=196

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AAIE L +K GS KS ISR IE  +G ELP +HA+LLT +L +MK+SG+L+ +KNNY
Sbjct  18   MILAAIEGLGDKNGSNKSAISRYIEGKYG-ELPPAHASLLTAHLARMKESGELIFLKNNY  76



>ref|XP_006305538.1| hypothetical protein CARUB_v10010056mg, partial [Capsella rubella]
 gb|EOA38436.1| hypothetical protein CARUB_v10010056mg, partial [Capsella rubella]
Length=258

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE LN+K G  K+ IS+ IE+A    LP SH TLL+++L++MK+SGQL++VKNNY
Sbjct  95   MIMEAIEALNDKNGCNKTTISKHIESAQQ-TLPPSHTTLLSYHLNQMKKSGQLIMVKNNY  153

Query  284  KK  279
             K
Sbjct  154  MK  155



>ref|XP_010496630.1| PREDICTED: HMG-Y-related protein A-like [Camelina sativa]
Length=196

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE LN+K GS K+ I++QIE+     LP SH TLL+++L++MK++GQL++VKNNY
Sbjct  23   MIMEAIEALNDKNGSNKTTIAKQIESTQQ-TLPPSHTTLLSYHLNQMKKTGQLLMVKNNY  81

Query  284  KK  279
             K
Sbjct  82   MK  83



>ref|XP_010459005.1| PREDICTED: HMG-Y-related protein A-like isoform X1 [Camelina 
sativa]
Length=192

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE LN+K GS K+ I++QIE+     LP SH TLL+++L++MK++GQL++VKNNY
Sbjct  23   MIMEAIEALNDKNGSNKTTIAKQIESTQQ-TLPPSHTTLLSYHLNQMKKTGQLLMVKNNY  81

Query  284  KK  279
             K
Sbjct  82   MK  83



>ref|XP_010459006.1| PREDICTED: HMG-Y-related protein A-like isoform X2 [Camelina 
sativa]
Length=170

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE LN+K GS K+ I++QIE+     LP SH TLL+++L++MK++GQL++VKNNY
Sbjct  1    MIMEAIEALNDKNGSNKTTIAKQIESTQQ-TLPPSHTTLLSYHLNQMKKTGQLLMVKNNY  59

Query  284  KK  279
             K
Sbjct  60   MK  61



>emb|CAN79065.1| hypothetical protein VITISV_019692 [Vitis vinifera]
Length=165

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = -3

Query  458  MAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNYKK  279
            MAAIE LN+K GS+KS IS+ IE+AH G+LP +H+TLL H+L++ KQ+G  V+V+N+  K
Sbjct  1    MAAIEALNDKSGSSKSFISKHIESAH-GDLPAAHSTLLMHHLNRRKQNGDPVMVRNHCMK  59



>ref|XP_010476567.1| PREDICTED: HMG-Y-related protein A-like [Camelina sativa]
Length=197

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE LN+K GS K+ I++QIE+     LP SH TLL+++L++MK++GQL++VKNNY
Sbjct  23   MIMEAIEALNDKNGSNKTTIAKQIESTQQ-TLPPSHTTLLSYHLNQMKKTGQLLMVKNNY  81



>ref|XP_004288399.1| PREDICTED: HMG-Y-related protein A-like [Fragaria vesca subsp. 
vesca]
Length=183

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AIE LNE  GS KS ISR IE+ +G ELP  H+ LL+ +L KMK SG+LV  KNNY
Sbjct  18   MILKAIEGLNESNGSNKSSISRYIESTYG-ELPAGHSALLSDHLSKMKDSGELVFWKNNY  76

Query  284  KK  279
             K
Sbjct  77   TK  78



>dbj|BAA11767.1| high mobility group protein [Canavalia gladiata]
 dbj|BAA13134.1| high mobility group protein [Canavalia gladiata]
Length=178

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  A++ LNE  GS KS IS+ IE+  G ELP  H+TLL H+L+KMK+SG+LV +KNNY
Sbjct  18   MITKALDSLNEPNGSNKSAISKYIESTCG-ELPDGHSTLLAHHLNKMKESGELVFLKNNY  76

Query  284  KK  279
             K
Sbjct  77   MK  78



>ref|XP_006482095.1| PREDICTED: HMG-Y-related protein A-like [Citrus sinensis]
Length=184

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I++AIE LNE  GS K+ IS+ IE+ +G  LP  H TLL+H+L++MK++G+LV  KNNY
Sbjct  18   MILSAIEALNESNGSNKTSISKYIESKYG-HLPAGHTTLLSHHLNRMKETGELVFWKNNY  76

Query  284  KK  279
             K
Sbjct  77   MK  78



>gb|KJB50373.1| hypothetical protein B456_008G167300 [Gossypium raimondii]
Length=182

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AIE LNE+ GS+ S I++ I++ H  +LP SH TLL+H+L++MKQ GQ+V++ NNY
Sbjct  27   MILEAIEALNEREGSSMSSIAKHIDSTHS-DLPASHTTLLSHHLNQMKQMGQIVMLNNNY  85

Query  284  KK  279
             K
Sbjct  86   SK  87



>gb|AAT08736.1| high mobility group I/Y-2 [Hyacinthus orientalis]
Length=180

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE L+EK GS KS IS+ IE+ +  +LP +H++LLT +L +MK+SG++++VKNNY
Sbjct  10   MIMGAIEALDEKAGSNKSAISKYIESKYAEQLPEAHSSLLTAHLARMKESGEILMVKNNY  69

Query  284  KK  279
             K
Sbjct  70   MK  71



>ref|XP_007032993.1| High mobility group A isoform 1 [Theobroma cacao]
 gb|EOY03919.1| High mobility group A isoform 1 [Theobroma cacao]
Length=190

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AIE LN+K GS K+ IS+ IE+ +G +LP  H TLL+H+L++MK++G+L+  KNNY
Sbjct  18   MIVNAIEALNDKNGSNKTSISKYIESQYG-DLPAGHTTLLSHHLNRMKETGELIFWKNNY  76

Query  284  KK  279
             K
Sbjct  77   MK  78



>ref|XP_007032994.1| High mobility group A isoform 2 [Theobroma cacao]
 gb|EOY03920.1| High mobility group A isoform 2 [Theobroma cacao]
Length=191

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AIE LN+K GS K+ IS+ IE+ +G +LP  H TLL+H+L++MK++G+L+  KNNY
Sbjct  19   MIVNAIEALNDKNGSNKTSISKYIESQYG-DLPAGHTTLLSHHLNRMKETGELIFWKNNY  77

Query  284  KK  279
             K
Sbjct  78   MK  79



>ref|XP_010527792.1| PREDICTED: HMG-Y-related protein A-like [Tarenaya hassleriana]
Length=204

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE LN+K GS K+ IS+ IE+ H   LP SHATLL+++L ++K +GQLV+VKNNY
Sbjct  31   MIMEAIEALNDKIGSNKTAISKHIESLHP-TLPPSHATLLSYHLSQLKHNGQLVMVKNNY  89

Query  284  KK  279
             K
Sbjct  90   MK  91



>gb|KHG27381.1| HMG-Y-related A [Gossypium arboreum]
Length=180

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            LI+ AIE LN+K GS K+ IS+ IE+ +G +LP  H++LL+H+L+ MK+SG+LV  KNNY
Sbjct  18   LIINAIEALNDKNGSNKTSISKYIESKYG-DLPAGHSSLLSHHLNIMKESGELVFWKNNY  76

Query  284  KK  279
             K
Sbjct  77   MK  78



>ref|NP_001105938.1| HMGI/Y protein [Zea mays]
 emb|CAB40848.2| HMGI/Y protein [Zea mays]
Length=191

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AAIE L++K GS KS IS+ IE  +G  LP +HA+LLT +L +MK+SG+LV +KNNY
Sbjct  18   MILAAIEGLDDKSGSNKSAISKYIEGKYG-SLPPAHASLLTAHLARMKESGELVFLKNNY  76



>ref|NP_001105009.1| high mobility group I/Y-2 [Zea mays]
 gb|AAG00601.1|AF291748_1 high mobility group I/Y-2 [Zea mays]
 gb|ACG24429.1| hypothetical protein [Zea mays]
 tpg|DAA49042.1| TPA: high mobility group I/Y-2 [Zea mays]
Length=193

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AAIE L++K GS KS IS+ IE  +G  LP +HA+LLT +L +MK+SG+LV +KNNY
Sbjct  18   MILAAIEGLDDKSGSNKSAISKYIEGKYG-SLPPAHASLLTAHLARMKESGELVFLKNNY  76



>ref|XP_006430572.1| hypothetical protein CICLE_v10012880mg [Citrus clementina]
 gb|ESR43812.1| hypothetical protein CICLE_v10012880mg [Citrus clementina]
Length=184

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I +AIE LNE  GS K+ IS+ IE+ +G  LP  H TLL+H+L++MK++G+LV  KNNY
Sbjct  18   MISSAIEALNESNGSNKTSISKYIESKYG-HLPAGHTTLLSHHLNRMKETGELVFWKNNY  76

Query  284  KK  279
             K
Sbjct  77   MK  78



>ref|XP_010108992.1| HMG-Y-related protein A [Morus notabilis]
 gb|EXC20632.1| HMG-Y-related protein A [Morus notabilis]
Length=212

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AIE LN++ GS KS IS+ IE+ +G +LP  H+ LL+H+L++MK++G+LV  KNNY
Sbjct  42   IILRAIEALNDQNGSNKSSISKYIESTYG-DLPAGHSALLSHHLNRMKETGELVFWKNNY  100



>dbj|BAK06763.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=163

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AAIE LN+K GS KS IS+ IE  +G +LP  HA+LL  +L +MK+SGQL+ +KNNY
Sbjct  18   MILAAIEALNDKNGSNKSAISKYIEGKYG-DLPKEHASLLAAHLLRMKESGQLLFLKNNY  76



>ref|XP_009399732.1| PREDICTED: HMG-Y-related protein A-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IMAAIE L+EKGGS KS I+R I + +  +L  SHA+LLT +L +MK+SG+L+ VKNNY
Sbjct  18   MIMAAIEALDEKGGSNKSAIARHIASTYQ-DLSESHASLLTAHLARMKESGELLFVKNNY  76



>ref|XP_009589931.1| PREDICTED: HMG-Y-related protein A-like [Nicotiana tomentosiformis]
Length=136

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  A+E LN++GGS KS IS+ IE+ +G  L   H+ LLT YLDKMKQ+G+L+ +KNNY
Sbjct  18   MIYEALEALNQEGGSNKSSISKYIESKYG-NLDQGHSKLLTFYLDKMKQTGELIFLKNNY  76

Query  284  KK  279
             K
Sbjct  77   IK  78



>ref|XP_010266048.1| PREDICTED: HMG-Y-related protein A-like [Nelumbo nucifera]
Length=174

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I AAI  L++K GS+KS IS+ IE+ +G  LP  H+ LL+H+L+++K+SG+L++VKNNY
Sbjct  18   MIFAAIAALDDKNGSSKSAISKYIESQYG-NLPAGHSQLLSHHLNRLKESGELIMVKNNY  76

Query  284  KK  279
             K
Sbjct  77   IK  78



>ref|XP_006416960.1| hypothetical protein EUTSA_v10008756mg [Eutrema salsugineum]
 gb|ESQ35313.1| hypothetical protein EUTSA_v10008756mg [Eutrema salsugineum]
Length=215

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE LN+K GS K+ I++ IE+     LP SH+TLL+ +L++MK++GQL++VKNNY
Sbjct  36   MIMEAIESLNDKNGSNKTTIAKHIESTQQ-TLPPSHSTLLSFHLNQMKKTGQLLMVKNNY  94

Query  284  KK  279
             K
Sbjct  95   MK  96



>emb|CAA71797.1| HMG-I/Y [Arabidopsis thaliana]
Length=204

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE LN+K G  K+ I++ IE+     LP SH TLL+++L++MK++GQL++VKNNY
Sbjct  29   MIMEAIESLNDKNGCNKTTIAKHIESTQQ-TLPPSHTTLLSYHLNQMKKTGQLIMVKNNY  87

Query  284  KK  279
             K
Sbjct  88   MK  89



>ref|XP_002445522.1| hypothetical protein SORBIDRAFT_07g020920 [Sorghum bicolor]
 gb|EES15017.1| hypothetical protein SORBIDRAFT_07g020920 [Sorghum bicolor]
Length=198

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AAIE L +K GS KS IS+ IE  +G ELP +HA+LLT +L +MK+SG+L+ +KNNY
Sbjct  18   MILAAIEGLGDKNGSNKSAISKFIEDKYG-ELPPAHASLLTAHLARMKESGELIFLKNNY  76



>gb|AAM60937.1| linker histone protein, putative [Arabidopsis thaliana]
 dbj|BAH57156.1| AT1G14900 [Arabidopsis thaliana]
Length=176

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE LN+K G  K+ I++ IE+     LP SH TLL+++L++MK++GQL++VKNNY
Sbjct  1    MIMEAIESLNDKNGCNKTTIAKHIESTQQ-TLPPSHMTLLSYHLNQMKKTGQLIMVKNNY  59

Query  284  KK  279
             K
Sbjct  60   MK  61



>ref|XP_008802440.1| PREDICTED: HMG-Y-related protein A-like [Phoenix dactylifera]
Length=168

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AAI  L+EK GS+KS I + I+AAHG +LP SH +LL  +L +M ++G+LV V N Y
Sbjct  18   MILAAISALDEKSGSSKSAILKHIDAAHGDQLPPSHESLLAAHLTRMTEAGELVFVDNCY  77



>ref|XP_002892836.1| hypothetical protein ARALYDRAFT_888880 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69095.1| hypothetical protein ARALYDRAFT_888880 [Arabidopsis lyrata subsp. 
lyrata]
Length=202

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE LN+K G  K+ I++ IE+     LP SH TLL+++L++MK++GQL++VKNNY
Sbjct  30   MIMEAIESLNDKNGCNKTTIAKHIESTQQ-TLPPSHTTLLSYHLNQMKKNGQLIMVKNNY  88

Query  284  KK  279
             K
Sbjct  89   MK  90



>ref|XP_009403355.1| PREDICTED: HMG-Y-related protein B [Musa acuminata subsp. malaccensis]
 ref|XP_009403356.1| PREDICTED: HMG-Y-related protein B [Musa acuminata subsp. malaccensis]
Length=180

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AIE LN+K GS KS IS+ +E+ +G ELP +H++LLT +L +MK+SG+L+ VKNNY
Sbjct  15   MITEAIEALNDKNGSNKSAISKYMESKYG-ELPPAHSSLLTAHLARMKESGELLFVKNNY  73



>emb|CDY04096.1| BnaA09g18740D [Brassica napus]
Length=164

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IMAAIE  N+  G  K+ I++ IE+     LP SH+TLL ++L++MKQSGQ+V+VKNNY
Sbjct  19   MIMAAIEASNDANGCNKTAIAKHIESTQS-ILPPSHSTLLNYHLNQMKQSGQIVMVKNNY  77

Query  284  KK  279
             K
Sbjct  78   MK  79



>ref|NP_172943.1| high mobility group protein A protein [Arabidopsis thaliana]
 gb|AAF79232.1|AC006917_17 F10B6.31 [Arabidopsis thaliana]
 emb|CAA67564.1| HMG-I/Y protein [Arabidopsis thaliana]
 gb|AAB97739.1| high mobility group protein a [Arabidopsis thaliana]
 gb|AAO44072.1| At1g14900 [Arabidopsis thaliana]
 dbj|BAH19921.1| AT1G14900 [Arabidopsis thaliana]
 gb|AEE29240.1| high mobility group protein A protein [Arabidopsis thaliana]
Length=204

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE LN+K G  K+ I++ IE+     LP SH TLL+++L++MK++GQL++VKNNY
Sbjct  29   MIMEAIESLNDKNGCNKTTIAKHIESTQQ-TLPPSHMTLLSYHLNQMKKTGQLIMVKNNY  87

Query  284  KK  279
             K
Sbjct  88   MK  89



>gb|KJB10442.1| hypothetical protein B456_001G201200 [Gossypium raimondii]
Length=180

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            LI+ AIE LN+K GS K+ IS+ IE+ +G +L   H+TLL+H+L+ MK+SG+LV  KNNY
Sbjct  18   LIINAIEALNDKNGSNKTSISKYIESKYG-DLAAGHSTLLSHHLNIMKESGELVFWKNNY  76

Query  284  KK  279
             K
Sbjct  77   MK  78



>emb|CBI25277.3| unnamed protein product [Vitis vinifera]
Length=215

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 52/76 (68%), Gaps = 9/76 (12%)
 Frame = -3

Query  506  IIYHLGTNYFVVV*LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDK  327
            I+ HL T         MAAIE LN+K GS+KS IS+ IE+AH G+L  +H+TLL H+L++
Sbjct  43   ILQHLET--------TMAAIEALNDKSGSSKSFISKHIESAH-GDLSAAHSTLLVHHLNR  93

Query  326  MKQSGQLVLVKNNYKK  279
             KQ+G  V+V+N+  K
Sbjct  94   RKQNGDPVMVRNHCMK  109



>ref|XP_011001582.1| PREDICTED: HMG-Y-related protein A-like [Populus euphratica]
Length=189

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I++AIE LNE  G  K+ IS+ IE+ +G +LP  H  LL+H+L++MK +G+LV  KNNY
Sbjct  18   MILSAIEALNEANGCNKTSISKYIESKYG-DLPAGHTALLSHHLNRMKDTGELVFWKNNY  76

Query  284  KK  279
             K
Sbjct  77   MK  78



>ref|XP_006372577.1| HMGI/Y family protein [Populus trichocarpa]
 gb|ERP50374.1| HMGI/Y family protein [Populus trichocarpa]
Length=190

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I++AIE LNE  G  K+ IS+ IE+ +G +LP  H  LL+H+L++MK +G+LV  KNNY
Sbjct  18   MILSAIEALNEANGCNKTSISKYIESKYG-DLPAGHTALLSHHLNRMKDTGELVFWKNNY  76

Query  284  KK  279
             K
Sbjct  77   MK  78



>ref|XP_008381335.1| PREDICTED: HMG-Y-related protein A-like [Malus domestica]
Length=183

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AIE LN+K GS KS IS+ IE+ +G ++P  H  LL+H+L++MK +G+LV  KNNY
Sbjct  18   MILNAIEALNDKNGSNKSTISKYIESTYG-DVPAGHNKLLSHHLNEMKDNGELVFWKNNY  76

Query  284  KK  279
             K
Sbjct  77   TK  78



>ref|XP_009371788.1| PREDICTED: HMG-Y-related protein A-like [Pyrus x bretschneideri]
Length=183

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AIE LN+K GS KS IS+ IE+ +G ++P  H  LL+H+L++MK +G+LV  KNNY
Sbjct  18   MILKAIEALNDKNGSNKSTISKYIESTYG-DVPAGHNKLLSHHLNEMKDNGELVFWKNNY  76

Query  284  KK  279
             K
Sbjct  77   TK  78



>ref|XP_008358162.1| PREDICTED: HMG-Y-related protein A-like [Malus domestica]
Length=183

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AIE LN+K GS KS IS+ IE+ +G ++P  H  LL+H+L++MK +G+LV  KNNY
Sbjct  18   MILNAIEALNDKNGSNKSTISKYIESTYG-DVPAGHNKLLSHHLNEMKDNGELVFWKNNY  76

Query  284  KK  279
             K
Sbjct  77   TK  78



>ref|XP_002305213.1| HMGI/Y family protein [Populus trichocarpa]
 gb|EEE85724.1| HMGI/Y family protein [Populus trichocarpa]
Length=189

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I +AI  LNE GGS K+ IS+ IE+ HG  LP  H  LL H+L++M  +G+L+ +KNNY
Sbjct  18   MIWSAIAALNETGGSNKTSISKYIESKHG-NLPAGHTALLAHHLNRMTDTGELMFLKNNY  76

Query  284  KK  279
             K
Sbjct  77   MK  78



>ref|XP_003574504.1| PREDICTED: HMG-Y-related protein A-like [Brachypodium distachyon]
Length=174

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AIE LN+K GS KS IS+ IE  +G +LP +H +LLT +L +MK+SG+L+ +KNNY
Sbjct  18   MILEAIEALNDKQGSNKSAISKHIEGKYG-DLPPAHGSLLTAHLSRMKESGELLFLKNNY  76



>ref|XP_006384158.1| hypothetical protein POPTR_0004s08590g [Populus trichocarpa]
 gb|ERP61955.1| hypothetical protein POPTR_0004s08590g [Populus trichocarpa]
Length=185

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I +AI  LNE GGS K+ IS+ IE+ HG  LP  H  LL H+L++M  +G+L+ +KNNY
Sbjct  18   MIWSAIAALNETGGSNKTSISKYIESKHG-NLPAGHTALLAHHLNRMTDTGELMFLKNNY  76

Query  284  KK  279
             K
Sbjct  77   MK  78



>ref|XP_009789096.1| PREDICTED: HMG-Y-related protein A-like [Nicotiana sylvestris]
Length=145

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  A+E LN++GGS KS +S+ IE+ +G  L   H+ LLT YLDKMKQ+G+L+ +KNNY
Sbjct  19   MIYEALEALNQEGGSNKSSMSKYIESKYG-NLDQGHSKLLTFYLDKMKQNGELIFLKNNY  77



>emb|CAB40849.1| HMGI/Y protein [Zea mays]
Length=190

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AAIE L+EK GS KS IS+ IE  +G  LP +H +LLT +L  MK+SG+LV +KNNY
Sbjct  18   MILAAIEGLDEKSGSNKSAISKYIEGKYG-SLPPAHESLLTAHLAAMKESGELVFLKNNY  76



>ref|XP_002273423.1| PREDICTED: HMG-Y-related protein B-like [Vitis vinifera]
Length=262

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 52/76 (68%), Gaps = 9/76 (12%)
 Frame = -3

Query  506  IIYHLGTNYFVVV*LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDK  327
            I+ HL T         MAAIE LN+K GS+KS IS+ IE+AH G+L  +H+TLL H+L++
Sbjct  43   ILQHLETT--------MAAIEALNDKSGSSKSFISKHIESAH-GDLSAAHSTLLVHHLNR  93

Query  326  MKQSGQLVLVKNNYKK  279
             KQ+G  V+V+N+  K
Sbjct  94   RKQNGDPVMVRNHCMK  109



>gb|EEC84552.1| hypothetical protein OsI_31304 [Oryza sativa Indica Group]
Length=102

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AAIE L+++ GS K+ IS+ IE  + G LP +H +LLT +L +MKQ+G+L   KNNY
Sbjct  28   MILAAIEALDDRNGSNKTAISQHIEGKYEGLLPPAHPSLLTAHLARMKQTGELAFSKNNY  87



>ref|XP_008456999.1| PREDICTED: HMG-Y-related protein A-like [Cucumis melo]
Length=180

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AIE LN   GS KS IS+ IE+ +G  LP  H++LLTH+L+ MK SG LV  KNNY
Sbjct  18   MIFRAIEALNSDNGSNKSTISKYIESTYG-NLPTGHSSLLTHHLNMMKASGDLVFWKNNY  76

Query  284  KK  279
             K
Sbjct  77   MK  78



>ref|XP_004145857.1| PREDICTED: HMG-Y-related protein A-like [Cucumis sativus]
 ref|XP_004156916.1| PREDICTED: HMG-Y-related protein A-like [Cucumis sativus]
 gb|KGN57766.1| hypothetical protein Csa_3G284020 [Cucumis sativus]
Length=180

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AIE LN   GS KS IS+ IE+ +G  LP  H++LLTH+L+ MK SG LV  KNNY
Sbjct  18   MIFRAIEALNSDNGSNKSTISKYIESTYG-NLPTGHSSLLTHHLNMMKASGDLVFWKNNY  76

Query  284  KK  279
             K
Sbjct  77   MK  78



>ref|XP_002531913.1| Histone H1, putative [Ricinus communis]
 gb|EEF30457.1| Histone H1, putative [Ricinus communis]
Length=166

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AAI  L++K GS K+ IS+ IE+ +G +LP  H  LLTH+L +MK +G+LV  KNNY
Sbjct  19   MILAAIAALDDKNGSNKTSISKYIESKYG-DLPAGHTALLTHHLARMKDTGELVFWKNNY  77



>ref|XP_010032711.1| PREDICTED: HMG-Y-related protein B-like isoform X3 [Eucalyptus 
grandis]
 ref|XP_010032712.1| PREDICTED: HMG-Y-related protein B-like isoform X3 [Eucalyptus 
grandis]
Length=168

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AA+E L E  GS K+ I++ IE+ +G +LP  H+ LL+H+L++MK+SG+LV  KNNY
Sbjct  1    MIVAALEALKEPSGSNKTSITKYIESKYG-DLPAGHSQLLSHHLNRMKESGELVFWKNNY  59



>ref|XP_010032710.1| PREDICTED: HMG-Y-related protein B-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW52157.1| hypothetical protein EUGRSUZ_J01599 [Eucalyptus grandis]
Length=177

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AA+E L E  GS K+ I++ IE+ +G +LP  H+ LL+H+L++MK+SG+LV  KNNY
Sbjct  10   MIVAALEALKEPSGSNKTSITKYIESKYG-DLPAGHSQLLSHHLNRMKESGELVFWKNNY  68



>ref|XP_010032709.1| PREDICTED: HMG-Y-related protein A-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW52155.1| hypothetical protein EUGRSUZ_J01599 [Eucalyptus grandis]
 gb|KCW52156.1| hypothetical protein EUGRSUZ_J01599 [Eucalyptus grandis]
Length=185

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AA+E L E  GS K+ I++ IE+ +G +LP  H+ LL+H+L++MK+SG+LV  KNNY
Sbjct  18   MIVAALEALKEPSGSNKTSITKYIESKYG-DLPAGHSQLLSHHLNRMKESGELVFWKNNY  76



>ref|NP_001063124.1| Os09g0402100 [Oryza sativa Japonica Group]
 gb|AAA33914.1| AT hook 1 from AA 98-106, AT hook 2 from AA 129-137, AT hook 
3 from AA 154-162, AT hook 4 from AA 192-200 [Oryza sativa Indica 
Group]
 dbj|BAD36308.1| DNA binding protein PF1 [Oryza sativa Japonica Group]
 dbj|BAF25038.1| Os09g0402100 [Oryza sativa Japonica Group]
 dbj|BAG90934.1| unnamed protein product [Oryza sativa Japonica Group]
Length=213

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AAIE L+++ GS K+ IS+ IE  + G LP +H +LLT +L +MKQ+G+L   KNNY
Sbjct  28   MILAAIEALDDRNGSNKTAISQHIEGKYEGLLPPAHPSLLTAHLARMKQTGELAFSKNNY  87



>ref|XP_007141909.1| hypothetical protein PHAVU_008G236000g [Phaseolus vulgaris]
 gb|ESW13903.1| hypothetical protein PHAVU_008G236000g [Phaseolus vulgaris]
Length=176

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 3/62 (5%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            LI+ A+E LNE GGS+KS IS+ IE+ + GELP S  T+L ++L+KMK SG+LV  KNN+
Sbjct  18   LILKALEALNEPGGSSKSAISKYIESTY-GELPDS--TVLDNHLNKMKDSGELVFSKNNF  74

Query  284  KK  279
             K
Sbjct  75   MK  76



>gb|KHN17948.1| HMG-Y-related protein A [Glycine soja]
Length=185

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AIE LNE+ GS KS IS+ IE+ +GG LP +H  LL  +L KM++SG LV  KNNY
Sbjct  20   MILEAIEALNEENGSNKSSISKYIESTYGG-LPQAHKVLLNVHLAKMRESGVLVFWKNNY  78

Query  284  KK  279
             K
Sbjct  79   TK  80



>ref|XP_004490811.1| PREDICTED: HMG-Y-related protein A-like [Cicer arietinum]
Length=203

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM A+E L+E  GS KS I+  IE+ +G ELP  H+ L++H+L+++K+SG+LV  KNNY
Sbjct  18   MIMKALEALHEPNGSNKSSITNYIESTYG-ELPEGHSNLVSHHLNQLKESGELVFSKNNY  76

Query  284  KK  279
             K
Sbjct  77   MK  78



>emb|CDY36240.1| BnaC07g20940D [Brassica napus]
Length=206

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE  N+  G  K+ I++ IE+     LP SH TLL+++L++MKQSGQ+ +VKNNY
Sbjct  30   MIMEAIEASNDANGCNKTAIAKHIESTQAS-LPPSHMTLLSYHLNQMKQSGQIAMVKNNY  88

Query  284  KK  279
             K
Sbjct  89   MK  90



>ref|XP_010916178.1| PREDICTED: HMG-Y-related protein A-like [Elaeis guineensis]
Length=166

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AI  L+EK GS+KS IS+ IEAAHG +L  SHA+LL  +L +M ++G+LV V N Y
Sbjct  18   MILTAILALDEKSGSSKSAISKHIEAAHGEQLLPSHASLLAAHLARMTEAGELVFVNNCY  77



>ref|XP_006395873.1| hypothetical protein EUTSA_v10004909mg [Eutrema salsugineum]
 gb|ESQ33159.1| hypothetical protein EUTSA_v10004909mg [Eutrema salsugineum]
Length=213

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE  N+  G  K+ IS+ IE+     LP SH TLL ++L++MK SGQ+V+ KNNY
Sbjct  37   MIMEAIEACNDANGCNKTAISKHIESTQPA-LPPSHTTLLNYHLNQMKNSGQIVMAKNNY  95

Query  284  KK  279
             K
Sbjct  96   MK  97



>ref|XP_002444432.1| hypothetical protein SORBIDRAFT_07g021860 [Sorghum bicolor]
 gb|EES13927.1| hypothetical protein SORBIDRAFT_07g021860 [Sorghum bicolor]
Length=97

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AIE L +K GS KS IS+ I+  +G ELP +HA LLT +L +MK+SG+++L+KN+Y
Sbjct  18   MILEAIEGLGDKNGSNKSSISKYIQGKYG-ELPPAHACLLTAHLARMKESGEVILLKNHY  76



>emb|CAA61747.1| HMGI/Y [Pisum sativum]
 emb|CAA67752.1| HMG-I/Y [Pisum sativum]
Length=197

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            LI+ AI+ LNE  GS KS IS  IE+ +G ELP  H+ +L ++L++MK+SG LV  KNNY
Sbjct  18   LILKAIDSLNEPNGSNKSAISNYIESVYG-ELPEGHSVVLLYHLNQMKESGDLVFAKNNY  76



>ref|XP_003538393.1| PREDICTED: HMG-Y-related protein A-like [Glycine max]
Length=184

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AIE LNE+ GS KS IS+ IE+ +GG LP +H  LL  +L KM++SG LV  KNNY
Sbjct  19   MIREAIEALNEENGSNKSSISKYIESTYGG-LPQAHKVLLNVHLAKMRESGVLVFWKNNY  77

Query  284  KK  279
             K
Sbjct  78   TK  79



>ref|XP_004503130.1| PREDICTED: HMG-Y-related protein A-like [Cicer arietinum]
Length=181

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AIE LNE+ GS KS IS+ IE+ +GG LP  H  LL  +L +M+ SG+LV  KNNY
Sbjct  19   MILRAIEALNEENGSNKSSISKYIESTYGG-LPHGHRALLNLHLARMRDSGELVFWKNNY  77

Query  284  KK  279
             K
Sbjct  78   TK  79



>emb|CDP01624.1| unnamed protein product [Coffea canephora]
Length=151

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AI+ L +K G+ KS IS+ IE+ +G +LP  H+TLLT +L +MK+SG+LV  KNNY
Sbjct  18   MIVEAIDALKQKEGANKSAISKYIESKYG-DLPAGHSTLLTVHLTRMKESGELVFFKNNY  76

Query  284  K  282
            +
Sbjct  77   Q  77



>ref|XP_010694434.1| PREDICTED: HMG-Y-related protein A-like [Beta vulgaris subsp. 
vulgaris]
Length=178

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AI+ LNEK GS K+ IS+ IE+ +   LP  H+TLL H+L++MK +G+L+  KNNY
Sbjct  18   MIITAIDALNEKMGSNKTSISKFIESKYQ-NLPAGHSTLLRHHLNRMKDTGELIFWKNNY  76

Query  284  KK  279
             K
Sbjct  77   MK  78



>emb|CDY17659.1| BnaA06g34780D [Brassica napus]
Length=205

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE  N+  G  K+ I++ IE+     LP SH TLL+++L++MKQSGQ+ +VKNNY
Sbjct  31   MIMEAIEASNDANGCNKTAIAKHIESTQTS-LPPSHMTLLSYHLNQMKQSGQIAMVKNNY  89

Query  284  KK  279
             K
Sbjct  90   MK  91



>gb|AAA32718.1| DNA-binding protein [Avena sativa]
Length=170

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AIE LN+K GS KS IS+ IE  +G ++P +H +LLT +L +MK++G+L+ +KNNY
Sbjct  18   MILEAIESLNDKVGSNKSAISKYIEGKYG-DMPPTHGSLLTAHLARMKETGELLFLKNNY  76



>ref|XP_007141903.1| hypothetical protein PHAVU_008G235600g [Phaseolus vulgaris]
 gb|ESW13897.1| hypothetical protein PHAVU_008G235600g [Phaseolus vulgaris]
Length=178

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 46/62 (74%), Gaps = 3/62 (5%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            LI+ A+E LNE GGS+KS IS+ IE+ + GELP S  T+L + L+KMK SG+LV  KNN+
Sbjct  18   LILKALEALNEPGGSSKSAISKYIESTY-GELPDS--TVLGNQLNKMKDSGELVFSKNNF  74

Query  284  KK  279
             K
Sbjct  75   MK  76



>ref|XP_003600727.1| HMG-Y-related protein A [Medicago truncatula]
 gb|AES70978.1| linker histone H1 and h5 family protein [Medicago truncatula]
Length=184

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AIE LNE+ GS KS IS+ IE+ +GG LP  H  LL  +L +M+ SG+LV  KNNY
Sbjct  19   MILKAIEGLNEENGSNKSSISKYIESTYGG-LPQGHKVLLNLHLARMRDSGELVFWKNNY  77

Query  284  KK  279
             K
Sbjct  78   TK  79



>gb|KHN07545.1| HMG-Y-related protein A [Glycine soja]
Length=147

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AIE LNE  GS KS IS+ IE+ +GG LP  H  LL  +L KM+ SG LV  KNNY
Sbjct  19   MILEAIEALNEDNGSNKSSISKYIESTYGG-LPQGHKVLLNVHLAKMRDSGVLVFWKNNY  77

Query  284  KK  279
             K
Sbjct  78   TK  79



>gb|AAF22135.1|AF127919_1 high mobility group protein I/Y [Brassica napus]
Length=203

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE  N+  G  K+ I++ IE+     LP SH TLL+++L++MKQSGQ+ +VKNNY
Sbjct  31   MIMEAIEASNDANGCNKTAIAKHIESTQTS-LPPSHMTLLSYHLNQMKQSGQIAMVKNNY  89

Query  284  KK  279
             K
Sbjct  90   MK  91



>ref|XP_011075253.1| PREDICTED: uncharacterized protein LOC105159765 [Sesamum indicum]
Length=275

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM A++ L +  G+ KS IS+ +E+ +G E+P  HA LL+H+L++MK SGQL+ +KNNY
Sbjct  18   MIMEALDALKQTEGANKSAISKYMESKYG-EMPAGHADLLSHHLNRMKDSGQLLFIKNNY  76

Query  284  KK  279
             K
Sbjct  77   VK  78



>gb|ACJ83992.1| unknown [Medicago truncatula]
 gb|AFK43801.1| unknown [Medicago truncatula]
Length=193

 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM A+E LNE  GS KS IS  IE+ +G ELP  H+ +L ++L++MK +G LV  KNNY
Sbjct  18   MIMKALEALNEPNGSNKSSISNYIESIYG-ELPEGHSIVLANHLNQMKDNGDLVFAKNNY  76

Query  284  KK  279
             K
Sbjct  77   MK  78



>ref|XP_003552987.1| PREDICTED: HMG-Y-related protein A-like [Glycine max]
Length=182

 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AIE LNE  GS KS IS+ IE+ +GG LP  H  LL  +L KM+ SG LV  KNNY
Sbjct  19   MILEAIEALNEDNGSNKSSISKYIESTYGG-LPQGHKVLLNVHLAKMRDSGVLVFWKNNY  77

Query  284  KK  279
             K
Sbjct  78   TK  79



>ref|XP_010430645.1| PREDICTED: HMG-Y-related protein A-like [Camelina sativa]
Length=158

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE  N+  G  K+ IS+ IE+     LP SH TLL ++L+ MKQ+GQLV+VKNNY
Sbjct  26   MIMDAIEASNDPNGCNKTAISKHIESTQI-TLPPSHNTLLNYHLNHMKQTGQLVIVKNNY  84

Query  284  KK  279
             K
Sbjct  85   MK  86



>ref|XP_011007253.1| PREDICTED: HMG-Y-related protein A-like [Populus euphratica]
Length=189

 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I +AI  LNE GGS K+ IS+ IE+ +G  LP  H  LL H+L++M  +G+L+  KNNY
Sbjct  18   MIWSAIVALNETGGSNKTSISKYIESKYG-NLPAGHTALLAHHLNRMTDTGELMFWKNNY  76

Query  284  KK  279
             K
Sbjct  77   MK  78



>ref|XP_003616293.1| HMG-Y-related protein A [Medicago truncatula]
 gb|ACJ84109.1| unknown [Medicago truncatula]
 gb|AES99251.1| linker histone H1 and h5 family protein [Medicago truncatula]
 gb|AFK45824.1| unknown [Medicago truncatula]
Length=204

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM A+E LNE  GS KS IS  IE+ +G ELP  H+ +L ++L++MK +G LV  KNNY
Sbjct  18   MIMKALEALNEPNGSNKSSISNYIESIYG-ELPEGHSIVLANHLNQMKDNGDLVFAKNNY  76

Query  284  KK  279
             K
Sbjct  77   MK  78



>gb|EYU24123.1| hypothetical protein MIMGU_mgv1a007150mg [Erythranthe guttata]
Length=417

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I AAI ELNE+ GS+K  +++ IE  H   LP +H+ LLTHYL ++K +GQ+++VK++Y
Sbjct  45   MITAAISELNERNGSSKRAVAKYIET-HFSNLPPTHSALLTHYLKRLKINGQILMVKHSY  103

Query  284  K  282
            K
Sbjct  104  K  104



>ref|XP_011099943.1| PREDICTED: HMG-Y-related protein A-like [Sesamum indicum]
Length=160

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM A++ L +  G+ KS IS+ +E+ +G E+P  HA LL+H+L++MK SG+L+ +KNNY
Sbjct  18   MIMEALDALKQTEGANKSAISKYMESKYG-EMPAGHADLLSHHLNRMKDSGELLFIKNNY  76

Query  284  KK  279
             K
Sbjct  77   VK  78



>ref|XP_006661206.1| PREDICTED: HMG-Y-related protein A-like [Oryza brachyantha]
Length=166

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AIE L++K GS K+ IS+ IE  + G LP +H +LLT +L +MKQ+G+LV  KNNY
Sbjct  31   MILGAIEALDDKNGSNKTAISQYIEEKYEG-LPAAHPSLLTAHLARMKQTGELVFSKNNY  89



>gb|EYU30904.1| hypothetical protein MIMGU_mgv1a015059mg [Erythranthe guttata]
Length=169

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM A++EL +  G+ KS IS  +E+ +G E+P  HA  LTH+L +MK+ G+L+ VKNNY
Sbjct  18   MIMEALDELKQAEGANKSSISNYMESKYG-EMPPGHAEFLTHHLTRMKEGGELLFVKNNY  76

Query  284  KK  279
             K
Sbjct  77   LK  78



>ref|XP_010502141.1| PREDICTED: HMG-Y-related protein A-like [Camelina sativa]
Length=194

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE  N+  G  K+ IS+ IE+     LP SH TLL ++L+ MKQ+GQLV+VKNNY
Sbjct  26   MIMDAIEASNDANGCNKTTISKHIESTQI-TLPPSHNTLLNYHLNHMKQTGQLVIVKNNY  84

Query  284  KK  279
             K
Sbjct  85   MK  86



>gb|EMT05494.1| HMG-Y-related protein A [Aegilops tauschii]
Length=154

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AAIE L +K GS+KS IS  IE  + G LP +HA+LLT  L  MK++G+L  VKNNY
Sbjct  18   MILAAIEALGDKNGSSKSAISSYIEEKYEG-LPSAHASLLTANLASMKEAGKLAFVKNNY  76



>ref|XP_009609378.1| PREDICTED: HMG-Y-related protein A-like [Nicotiana tomentosiformis]
Length=161

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AIE LN++GGS KS IS  IE+ +G +L   H+  LT +LD MKQ+G+L+ +KNNY
Sbjct  15   MICEAIEALNQEGGSNKSSISTYIESKYG-DLGKDHSEFLTLHLDNMKQTGELIFLKNNY  73



>ref|XP_006291855.1| hypothetical protein CARUB_v10018031mg [Capsella rubella]
 gb|EOA24753.1| hypothetical protein CARUB_v10018031mg [Capsella rubella]
Length=207

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE  N+  G  K+ I++ IE+     LP SH TLL ++L+ MKQSGQLV+VKNNY
Sbjct  37   MIMDAIEASNDPNGCNKTAIAKYIESTQI-TLPPSHNTLLNYHLNHMKQSGQLVIVKNNY  95

Query  284  KK  279
             K
Sbjct  96   MK  97



>ref|XP_009762223.1| PREDICTED: HMG-Y-related protein A-like [Nicotiana sylvestris]
Length=161

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AIE LN++GGS KS IS  IE+ +G +L   H+  LT +LD MKQ+G+L+ +KNNY
Sbjct  15   MIYEAIEALNQEGGSNKSSISTYIESKYG-DLGKDHSEFLTLHLDNMKQTGELIFLKNNY  73



>gb|KFK33382.1| hypothetical protein AALP_AA5G005900 [Arabis alpina]
Length=209

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE  N+  G  K+ I++ IE+A    LP SH TLL ++L++MKQSGQ+V VKNN+
Sbjct  28   MIMEAIEVCNDANGINKTAIAKHIESAQV-TLPPSHTTLLNYHLNQMKQSGQIVQVKNNF  86

Query  284  KK  279
             K
Sbjct  87   MK  88



>gb|AAM22691.1|AF502250_1 HMG-I/Y protein HMGa [Triticum aestivum]
Length=189

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AAIE L +K GS+KS IS  IE  + G LP +HA+LLT  L  MK++G+L   KNNY
Sbjct  18   MILAAIEALGDKNGSSKSAISSYIEEKYEG-LPSAHASLLTANLASMKEAGKLAFAKNNY  76



>ref|XP_010673842.1| PREDICTED: HMG-Y-related protein A-like [Beta vulgaris subsp. 
vulgaris]
Length=197

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNN  288
            +IM AIEELNEK GS+K  I   IE+ +  +LP SHAT ++H L+K+KQ+GQL+++K++
Sbjct  13   MIMGAIEELNEKEGSSKEAIIEFIESNYS-DLPPSHATHVSHTLEKLKQTGQLLMLKDD  70



>ref|XP_009101330.1| PREDICTED: LOW QUALITY PROTEIN: HMG-Y-related protein A-like 
[Brassica rapa]
Length=205

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE  N+  G  K+ I++  E+     LP SH TLL+ +L++MKQSGQ+ +VKNNY
Sbjct  31   MIMXAIEASNDATGCNKTAIAKHSESTQTS-LPPSHMTLLSSHLNQMKQSGQITMVKNNY  89

Query  284  KK  279
             K
Sbjct  90   MK  91



>ref|XP_009589683.1| PREDICTED: HMG-Y-related protein A-like [Nicotiana tomentosiformis]
Length=163

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  A++ L +K GS KS IS+ IE+ +G  L  +H+ LLT++LD+MKQ+G+L+ +KNNY
Sbjct  18   MIYEALDALQQKEGSNKSSISKYIESKYGI-LNDTHSKLLTYHLDRMKQTGELIFLKNNY  76



>ref|XP_006364633.1| PREDICTED: HMG-Y-related protein A-like [Solanum tuberosum]
Length=160

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  A++ L +K GS KS IS+ IE+ +G  +  +H+ LLT++LD+MKQ+G+L+ +KNNY
Sbjct  16   MIYEALDTLQQKEGSNKSSISKYIESKYGN-MNDAHSKLLTYHLDRMKQTGELLFLKNNY  74



>dbj|BAJ97147.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=184

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+AAIE L +  GS KS IS  IE  + G LP +HA+LLT  L  MK++G+L  VKNNY
Sbjct  18   MILAAIEALGDTNGSNKSAISSYIEEKYEG-LPSAHASLLTANLASMKEAGKLAFVKNNY  76



>ref|XP_004250181.1| PREDICTED: HMG-Y-related protein A-like [Solanum lycopersicum]
Length=160

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  A++ L +K GS KS IS+ IE+ +G  +  +H+ L+T++LD+MKQ+G+L+ +KNNY
Sbjct  16   MIYEALDALQQKEGSNKSSISKYIESKYGN-MNDAHSKLITYHLDRMKQTGELIFLKNNY  74



>ref|XP_010465878.1| PREDICTED: RNA exonuclease 1 homolog [Camelina sativa]
Length=513

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I AAI  LNE  GS+K  ISR IE  H G LP +H  LLTH L  +K SG L +VK +Y
Sbjct  91   MICAAIAALNEPDGSSKMAISRYIERCHSG-LPAAHPALLTHSLKTLKNSGVLAMVKKSY  149

Query  284  K  282
            K
Sbjct  150  K  150



>ref|XP_009798419.1| PREDICTED: HMG-Y-related protein A-like [Nicotiana sylvestris]
Length=163

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  A++ L +K GS KS IS  IE+ +G  L  +H+ LLT++LD+MKQ+G+L+ +KNNY
Sbjct  18   MIYEALDALQQKEGSNKSSISNYIESKYG-ILNDTHSKLLTYHLDRMKQTGELIFLKNNY  76



>ref|XP_008240168.1| PREDICTED: RNA polymerase II degradation factor 1 [Prunus mume]
Length=505

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = -3

Query  488  TNYFVVV*LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQ  309
            +N+     +I AAI  L EK GS+K  I++ IE A+ G LP +H+ LLTH+L ++K +G 
Sbjct  60   SNHPPYAEMIYAAIAALKEKDGSSKRAIAKYIERAYSG-LPTTHSALLTHHLKRLKSNGL  118

Query  308  LVLVKNNYK  282
            LV+VK +YK
Sbjct  119  LVMVKKSYK  127



>ref|XP_007209923.1| hypothetical protein PRUPE_ppa004509mg [Prunus persica]
 gb|EMJ11122.1| hypothetical protein PRUPE_ppa004509mg [Prunus persica]
Length=505

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = -3

Query  488  TNYFVVV*LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQ  309
            +N+     +I AAI  L EK GS+K  I++ IE A+ G LP +H+ LLTH+L ++K +G 
Sbjct  60   SNHPPYAEMIYAAIAALKEKDGSSKRAIAKYIERAYSG-LPTTHSALLTHHLKRLKSNGL  118

Query  308  LVLVKNNYK  282
            LV+VK +YK
Sbjct  119  LVMVKKSYK  127



>ref|XP_010487717.1| PREDICTED: RNA exonuclease 1 homolog [Camelina sativa]
Length=432

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I AAI  LNE  GS+K  ISR IE  H G LP +H  LLTH L  +K SG L +VK +Y
Sbjct  1    MICAAIAALNEPDGSSKMAISRYIERCHSG-LPSAHPALLTHSLKILKNSGVLAMVKKSY  59

Query  284  K  282
            K
Sbjct  60   K  60



>emb|CDY48812.1| BnaC02g34020D [Brassica napus]
Length=132

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE  N+  G +K+ I + IE      LP SH TLL ++L++MK SG++V+VKNNY
Sbjct  33   MIMEAIEASNDAKGCSKTAILKHIETTQT-HLPPSHLTLLDYHLNQMKHSGKIVIVKNNY  91

Query  284  KK  279
             K
Sbjct  92   MK  93



>ref|XP_002885238.1| hypothetical protein ARALYDRAFT_479291 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61497.1| hypothetical protein ARALYDRAFT_479291 [Arabidopsis lyrata subsp. 
lyrata]
Length=480

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I AAI  LNE  GS+K  ISR IE  H G L  +HA LLTH+L  +K SG L +VK +Y
Sbjct  75   MICAAIAALNEPDGSSKMAISRYIERCHPG-LTSAHAALLTHHLKTLKNSGVLTMVKKSY  133

Query  284  K  282
            K
Sbjct  134  K  134



>ref|XP_010506292.1| PREDICTED: bromodomain-containing protein 4-like [Camelina sativa]
Length=517

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I AAI  LNE  GS+K  ISR IE  H G LP +H  LLTH L  +K SG L +VK +Y
Sbjct  89   MICAAIAALNEPDGSSKMAISRYIERCHSG-LPSAHPALLTHSLKLLKNSGVLAMVKKSY  147

Query  284  K  282
            K
Sbjct  148  K  148



>ref|XP_003634203.1| PREDICTED: histone H1 [Vitis vinifera]
 emb|CAN74749.1| hypothetical protein VITISV_021497 [Vitis vinifera]
 emb|CBI15554.3| unnamed protein product [Vitis vinifera]
Length=355

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = -3

Query  485  NYFVVV*LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQL  306
            N+     +I  AI  LNE+ GS+K  I++ IE   G +LP SH  LLTH+L +++ SGQ+
Sbjct  40   NHPPYAEMITTAIGALNERTGSSKKAIAKYIERTFG-DLPPSHPALLTHHLKRLRSSGQV  98

Query  305  VLVKNNY  285
            V+VK++Y
Sbjct  99   VMVKHSY  105



>gb|KDP24595.1| hypothetical protein JCGZ_25511 [Jatropha curcas]
Length=496

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = -3

Query  488  TNYFVVV*LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQ  309
            +N+     +I AAI  L E+ GS+K  IS+ IE A  G LP +H  LLTH+L ++K +G 
Sbjct  75   SNHPTYTDMIYAAITALKERDGSSKRAISKYIEKAFTG-LPPTHPALLTHHLKRLKSTGL  133

Query  308  LVLVKNNYK  282
            LV+VK +YK
Sbjct  134  LVMVKKSYK  142



>ref|XP_009145002.1| PREDICTED: basic salivary proline-rich protein 1-like [Brassica 
rapa]
Length=425

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = -3

Query  506  IIYHLGTNYFVVV*LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDK  327
            +  H   N+     +I +AI  LNE  GS+K  ISR IE  + G +P +H +LLTH+L  
Sbjct  52   VPCHPSVNHPHYSEMICSAISALNEPDGSSKQAISRYIERFYTG-IPPAHGSLLTHHLRT  110

Query  326  MKQSGQLVLVKNNYK  282
            +K SG LV+VK +YK
Sbjct  111  LKNSGVLVMVKKSYK  125



>ref|NP_001236157.1| uncharacterized protein LOC100305747 [Glycine max]
 gb|ACU13600.1| unknown [Glycine max]
Length=123

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 3/62 (5%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM A+E LNE  GS+KS IS+ IE  +G ELP    T+L  +L+KMK+SG+L   +NNY
Sbjct  18   MIMKALEALNEADGSSKSAISKYIETTYG-ELPDE--TVLGSHLNKMKESGELAFKQNNY  74

Query  284  KK  279
             K
Sbjct  75   MK  76



>ref|XP_008374835.1| PREDICTED: formin-like protein 5 [Malus domestica]
Length=494

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AI  L EK GS+K  I + IE  + G LP +H++LLTH+L ++K SG LV+VK +Y
Sbjct  64   MIYGAITALREKDGSSKRAIEKYIERVYSG-LPATHSSLLTHHLKRLKNSGHLVMVKKSY  122

Query  284  K  282
            K
Sbjct  123  K  123



>emb|CDY59682.1| BnaA05g36480D [Brassica napus]
Length=601

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = -3

Query  506  IIYHLGTNYFVVV*LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDK  327
            +  H   N+     +I +AI  LNE  GS+K  ISR IE  + G +P +H +LLTH+L  
Sbjct  50   VPCHPSVNHPHYSEMICSAISALNEPDGSSKQAISRYIERFYTG-IPPAHGSLLTHHLRT  108

Query  326  MKQSGQLVLVKNNYK  282
            +K SG LV+VK +YK
Sbjct  109  LKNSGVLVMVKKSYK  123



>ref|XP_010513890.1| PREDICTED: HMG-Y-related protein A-like [Camelina sativa]
Length=200

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 3/62 (5%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE  N+  G  K+ I++ IE+     LP SH TLL ++L+ MKQ+GQLV+VKNNY
Sbjct  31   MIMDAIEASND--GCNKTTIAKHIESTQI-TLPPSHNTLLNYHLNHMKQTGQLVIVKNNY  87

Query  284  KK  279
             K
Sbjct  88   MK  89



>ref|XP_007036771.1| Winged-helix DNA-binding transcription factor family protein, 
putative isoform 2 [Theobroma cacao]
 gb|EOY21272.1| Winged-helix DNA-binding transcription factor family protein, 
putative isoform 2 [Theobroma cacao]
Length=349

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AIE L E+ GS+K  I++ IE+A+  +LP +H+ LLTH+L ++K +G LV+VK +Y
Sbjct  50   MISEAIEALKERNGSSKRAIAKYIESAYK-DLPPTHSALLTHHLKRLKNNGILVMVKKSY  108

Query  284  K  282
            K
Sbjct  109  K  109



>ref|XP_002875083.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51342.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=199

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE   +  G  K+ I++ IE+     LP SH TLL+++L++MKQSGQL++ KNNY
Sbjct  28   MIMEAIEASTDPYGCNKTAIAKHIESTKI-TLPPSHMTLLSYHLNQMKQSGQLMVFKNNY  86

Query  284  KK  279
             K
Sbjct  87   MK  88



>emb|CDY67892.1| BnaUnng02610D [Brassica napus]
Length=292

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = -3

Query  485  NYFVVV*LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQL  306
            NY     +I  AI +LNE  GS+KS ISR+I+ ++   LP SHA L+T++L  +++SG L
Sbjct  90   NYPPYDDMIFEAIRDLNEPDGSSKSRISRRIKRSN-AVLPPSHAVLVTYHLKTLRRSGFL  148

Query  305  VLVKNNYK  282
             +V N YK
Sbjct  149  TMVNNLYK  156



>ref|XP_009408998.1| PREDICTED: HMG-Y-related protein A-like [Musa acuminata subsp. 
malaccensis]
Length=170

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ A+    E  G+++S IS  IE +H G+LP SH +LL  +L +M ++G+L+LV   Y
Sbjct  18   MILTAVSAFGEDNGTSESAISEYIETSHSGQLPPSHPSLLAAHLARMTETGELILVDGGY  77



>ref|XP_006574481.1| PREDICTED: HMG-Y-related protein A isoform X1 [Glycine max]
Length=176

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ A+E LNE  GS KS IS+ IE  +G ELP   AT+L  +L+KMK SG+L   +NNY
Sbjct  18   MIVKALEALNEPNGSNKSAISKYIETTYG-ELP--DATVLGSHLNKMKDSGELSFKQNNY  74

Query  284  KK  279
             K
Sbjct  75   MK  76



>ref|XP_003519330.1| PREDICTED: HMG-Y-related protein A-like [Glycine max]
Length=176

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ A+E LNE  GS KS IS+ IE  +G ELP   AT+L  +L+KMK SG+L   +NNY
Sbjct  18   MIVKALEALNEPNGSNKSAISKYIETTYG-ELP--DATVLGSHLNKMKDSGELSFKQNNY  74

Query  284  KK  279
             K
Sbjct  75   MK  76



>gb|AAG50847.1|AC074308_3 hypothetical protein, 3' partial [Arabidopsis thaliana]
Length=332

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AI  LNE  GS+K  ISR IE  + G +P +H  LLTH+L  +K SG LV+VK +Y
Sbjct  81   MICTAIAALNEPDGSSKQAISRYIERIYTG-IPTAHGALLTHHLKTLKTSGILVMVKKSY  139

Query  284  K  282
            K
Sbjct  140  K  140



>ref|XP_009356056.1| PREDICTED: proline-rich protein LAS17-like [Pyrus x bretschneideri]
Length=496

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AI  L EK GS+K  I + IE  + G LP +H++LLTH+L ++K SG LV+VK +Y
Sbjct  64   MIYGAITALREKDGSSKRAIEKYIERFYSG-LPATHSSLLTHHLKRLKNSGHLVMVKKSY  122

Query  284  K  282
            K
Sbjct  123  K  123



>ref|XP_006393382.1| hypothetical protein EUTSA_v10011410mg [Eutrema salsugineum]
 gb|ESQ30668.1| hypothetical protein EUTSA_v10011410mg [Eutrema salsugineum]
Length=504

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = -3

Query  503  IYHLGTNYFVVV*LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKM  324
            + H   N+     +I  AI  LNE  GS+K  ISR IE  + G +P +H  LLTH+L  +
Sbjct  61   VPHPSFNHPPYSDMICTAIAALNEPDGSSKQAISRYIERIYTG-IPPAHGALLTHHLKTL  119

Query  323  KQSGQLVLVKNNYK  282
            K SG LV+VK +YK
Sbjct  120  KNSGILVMVKKSYK  133



>ref|XP_007036770.1| Winged-helix DNA-binding transcription factor family protein, 
putative isoform 1 [Theobroma cacao]
 gb|EOY21271.1| Winged-helix DNA-binding transcription factor family protein, 
putative isoform 1 [Theobroma cacao]
Length=403

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AIE L E+ GS+K  I++ IE+A+  +LP +H+ LLTH+L ++K +G LV+VK +Y
Sbjct  50   MISEAIEALKERNGSSKRAIAKYIESAYK-DLPPTHSALLTHHLKRLKNNGILVMVKKSY  108

Query  284  K  282
            K
Sbjct  109  K  109



>emb|CDX95791.1| BnaC05g35420D [Brassica napus]
Length=324

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = -3

Query  485  NYFVVV*LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQL  306
            NY     +I  AI +LNE  GS+KS ISR+I+ ++   LP SHA L+T++L  +++SG L
Sbjct  90   NYPPYDDMIFEAIRDLNEPDGSSKSRISRRIKRSN-AVLPPSHAVLVTYHLKTLRRSGVL  148

Query  305  VLVKNNYK  282
             +V N YK
Sbjct  149  TMVNNLYK  156



>ref|XP_009129220.1| PREDICTED: HMG-Y-related protein A-like [Brassica rapa]
Length=126

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 4/62 (6%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE  N   G  K+ I + IE+     LP SH TLL ++L++MKQSG++V+VKNNY
Sbjct  32   MIMEAIEASN---GCNKTAIVKHIESTQI-TLPPSHLTLLNYHLNRMKQSGRIVIVKNNY  87

Query  284  KK  279
             K
Sbjct  88   TK  89



>ref|XP_002534496.1| histone h1/h5, putative [Ricinus communis]
 gb|EEF27887.1| histone h1/h5, putative [Ricinus communis]
Length=435

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I AAI  L E+ GS+K  I++ IE  + G LP +H+ LLTH+L ++K +G LV+VK +Y
Sbjct  75   MIYAAITALKERDGSSKRAIAKYIERVYPG-LPPTHSALLTHHLKRLKNTGLLVMVKKSY  133

Query  284  K  282
            K
Sbjct  134  K  134



>gb|KDO40665.1| hypothetical protein CISIN_1g0171711mg, partial [Citrus sinensis]
 gb|KDO40666.1| hypothetical protein CISIN_1g0171711mg, partial [Citrus sinensis]
Length=296

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = -3

Query  494  LGTNYFVVV*LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQS  315
            L  N+     +I AAI  L E+ GS+K  I++ IE A+   LP +H+TLLT++L ++K +
Sbjct  39   LNHNHPPYAEMICAAISALKERDGSSKRAIAKYIEKAYP-NLPTTHSTLLTNHLKRLKNA  97

Query  314  GQLVLVKNNYK  282
            G LV+VK +YK
Sbjct  98   GHLVMVKKSYK  108



>gb|KHG26521.1| hypothetical protein F383_08088 [Gossypium arboreum]
Length=425

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AI  L +K GS+K  I++ IE+AH  +LP +H+ LLTH+L ++K +G LV+VK +Y
Sbjct  54   MICEAIGALKDKNGSSKRAIAKYIESAHK-DLPPTHSALLTHHLKRLKNNGILVMVKKSY  112

Query  284  K  282
            K
Sbjct  113  K  113



>emb|CDP01623.1| unnamed protein product [Coffea canephora]
Length=163

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  A+  L +K G+ K+ IS+ IE+ +G +LP  H+ LL+ +L +MK +G+LV  KNNY
Sbjct  17   MIFEAMSALQQKDGANKTAISKYIESRYG-DLPAGHSNLLSAHLTRMKDTGELVFFKNNY  75



>gb|KJB50577.1| hypothetical protein B456_008G177600 [Gossypium raimondii]
Length=426

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AI  L +K GS+K  I++ IE+AH  +LP +H+ LLTH+L ++K +G LV+VK +Y
Sbjct  54   MICEAIGALKDKNGSSKRAIAKYIESAHK-DLPPTHSALLTHHLKRLKNNGILVMVKKSY  112

Query  284  K  282
            K
Sbjct  113  K  113



>ref|XP_002442718.1| hypothetical protein SORBIDRAFT_08g001690 [Sorghum bicolor]
 gb|EES16556.1| hypothetical protein SORBIDRAFT_08g001690 [Sorghum bicolor]
Length=93

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = -3

Query  458  MAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            MAAIE L++K G  KS IS+ +E  +G ELP  H +LLT +L++ K+  +L+ +KNNY
Sbjct  1    MAAIEGLSDKNGLNKSAISKNMEGKYG-ELPLPHVSLLTGHLERTKEPMELIFLKNNY  57



>emb|CDY09431.1| BnaA02g25790D [Brassica napus]
Length=114

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 4/62 (6%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AI   N   G  K+ I + IE+     LP SH TLL ++L++MKQSGQ+V+VKNNY
Sbjct  32   MIMEAIGTSN---GCNKTAIVKHIESTQI-TLPPSHLTLLNYHLNRMKQSGQIVIVKNNY  87

Query  284  KK  279
             K
Sbjct  88   TK  89



>ref|XP_006596504.1| PREDICTED: HMG-Y-related protein A [Glycine max]
Length=176

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 3/62 (5%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ A+E LNE  GS+KS IS+ IE  +G ELP    T+L  +L+KMK+SG+L   +NNY
Sbjct  18   MIVKALEALNEADGSSKSAISKYIETTYG-ELP--DETVLGSHLNKMKESGELAFKQNNY  74

Query  284  KK  279
             K
Sbjct  75   MK  76



>gb|AAF79708.1|AC020889_16 T1N15.25 [Arabidopsis thaliana]
Length=594

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AI  LNE  GS+K  ISR IE  + G +P +H  LLTH+L  +K SG LV+VK +Y
Sbjct  196  MICTAIAALNEPDGSSKQAISRYIERIYTG-IPTAHGALLTHHLKTLKTSGILVMVKKSY  254

Query  284  K  282
            K
Sbjct  255  K  255



>ref|XP_006838026.1| hypothetical protein AMTR_s00091p00072780 [Amborella trichopoda]
 gb|ERN00595.1| hypothetical protein AMTR_s00091p00072780 [Amborella trichopoda]
Length=198

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I++AI  L E+ GS+K  I + +EA +   LP +H  LL H+L ++K+ G+LV+VKN+Y
Sbjct  1    MIISAITALKEENGSSKRAIDKYMEANYPN-LPPTHTALLAHHLRRLKECGELVMVKNSY  59

Query  284  K  282
            K
Sbjct  60   K  60



>ref|XP_006451648.1| hypothetical protein CICLE_v10008667mg [Citrus clementina]
 gb|ESR64888.1| hypothetical protein CICLE_v10008667mg [Citrus clementina]
Length=376

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = -3

Query  494  LGTNYFVVV*LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQS  315
            L  N+     +I AAI  L E+ GS+K  I++ IE A+   LP +H+TLLT++L ++K +
Sbjct  39   LNHNHPPYAEMICAAISALKERDGSSKRAIAKYIEKAYP-NLPTTHSTLLTNHLKRLKNA  97

Query  314  GQLVLVKNNYK  282
            G LV+VK +YK
Sbjct  98   GHLVMVKKSYK  108



>ref|XP_006490754.1| PREDICTED: histone H1-like [Citrus sinensis]
Length=376

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = -3

Query  494  LGTNYFVVV*LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQS  315
            L  N+     +I AAI  L E+ GS+K  I++ IE A+   LP +H+TLLT++L ++K +
Sbjct  39   LNHNHPPYAEMICAAISALKERDGSSKRAIAKYIEKAYP-NLPTTHSTLLTNHLKRLKNA  97

Query  314  GQLVLVKNNYK  282
            G LV+VK +YK
Sbjct  98   GHLVMVKKSYK  108



>emb|CDY09432.1| BnaA02g25780D [Brassica napus]
Length=192

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE  N+  G TK+ I + IE      LP SH TLL ++L++MK SG++V+VKN Y
Sbjct  33   MIMEAIEASNDAKGCTKTAILKHIETTQT-HLPPSHLTLLDYHLNQMKHSGKIVIVKNYY  91

Query  284  KK  279
             K
Sbjct  92   MK  93



>emb|CDY40600.1| BnaC06g02160D [Brassica napus]
Length=445

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AI  LNE  GS+K  ISR IE  + G +P +H  L+TH+L  +K SG LV+VK +Y
Sbjct  73   MICCAIAALNEADGSSKQAISRYIERTYTG-IPTAHGALMTHHLKSLKNSGVLVMVKKSY  131

Query  284  K  282
            K
Sbjct  132  K  132



>emb|CDX93685.1| BnaA06g03630D [Brassica napus]
Length=410

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AI  LNE  GS+K  ISR IE  + G +P +H  L+TH+L  +K SG LV+VK +Y
Sbjct  55   MICCAIAALNEAEGSSKQAISRYIERTYTG-IPPAHGALMTHHLKSLKNSGVLVMVKKSY  113

Query  284  K  282
            K
Sbjct  114  K  114



>ref|NP_175295.1| high mobility group A5 [Arabidopsis thaliana]
 gb|AAY56416.1| At1g48620 [Arabidopsis thaliana]
 gb|ABF57274.1| At1g48620 [Arabidopsis thaliana]
 gb|AEE32328.1| high mobility group A5 [Arabidopsis thaliana]
Length=479

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AI  LNE  GS+K  ISR IE  + G +P +H  LLTH+L  +K SG LV+VK +Y
Sbjct  81   MICTAIAALNEPDGSSKQAISRYIERIYTG-IPTAHGALLTHHLKTLKTSGILVMVKKSY  139

Query  284  K  282
            K
Sbjct  140  K  140



>ref|XP_009147949.1| PREDICTED: histone H1 [Brassica rapa]
Length=405

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AI  LNE  GS+K  ISR IE  + G +P +H  L+TH+L  +K SG LV+VK +Y
Sbjct  56   MICCAIAALNEAEGSSKQAISRYIERTYTG-IPPAHGALMTHHLKSLKNSGVLVMVKKSY  114

Query  284  K  282
            K
Sbjct  115  K  115



>ref|XP_007152693.1| hypothetical protein PHAVU_004G151300g [Phaseolus vulgaris]
 gb|ESW24687.1| hypothetical protein PHAVU_004G151300g [Phaseolus vulgaris]
Length=491

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = -3

Query  485  NYFVVV*LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQL  306
            N+     +I  AIE L EK GS+K  I + +E  +  +LP +H+ LLT +L +MK SG L
Sbjct  37   NHPPYAEMIYTAIEALKEKDGSSKKAIGKYMEQVYRDQLPPNHSNLLTQHLTRMKTSGML  96

Query  305  VLVKNNY  285
            V+VK +Y
Sbjct  97   VMVKKSY  103



>gb|KHN39458.1| HMG-Y-related protein B [Glycine soja]
Length=153

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 3/62 (5%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ A+E LNE  GS+KS IS+ IE  +G ELP    T+L  +L+KMK+SG+L   +NNY
Sbjct  18   MIVKALEALNEADGSSKSAISKYIETTYG-ELPDE--TVLGSHLNKMKESGELAFKQNNY  74

Query  284  KK  279
             K
Sbjct  75   MK  76



>ref|XP_003576512.1| PREDICTED: HMG-Y-related protein A-like [Brachypodium distachyon]
Length=199

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AI+ L++K G+ K+ IS  IE  +  ELP +HA+LLT  L  MK+SG+L+  KNNY
Sbjct  18   MILEAIDALDDKNGANKTAISSFIEEKYK-ELPSAHASLLTANLASMKESGKLLFDKNNY  76



>ref|XP_003544987.1| PREDICTED: HMG-Y-related protein A-like [Glycine max]
Length=176

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ A+E LNE  GS KS IS+ IE  +G ELP    T+L  +L+KMK+SG+L   +NNY
Sbjct  18   MIVKALEALNEADGSNKSAISKYIETTYG-ELP--DETVLGSHLNKMKESGELAFKQNNY  74

Query  284  KK  279
             K
Sbjct  75   MK  76



>ref|XP_010653193.1| PREDICTED: HMG-Y-related protein B-like [Vitis vinifera]
Length=180

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            + MAAIE LN+K GS+KS IS+ IE+AHGG LP  H+TLL H++++M+Q+   V+V+N+ 
Sbjct  56   MTMAAIEALNDKSGSSKSSISKHIESAHGG-LPADHSTLLVHHINRMQQNDNPVMVRNHC  114

Query  284  KK  279
             K
Sbjct  115  MK  116



>ref|NP_001238502.1| HMG-Y-related protein A [Glycine max]
 sp|Q00423.1|HMGYA_SOYBN RecName: Full=HMG-Y-related protein A; AltName: Full=Protein 
SB16A [Glycine max]
 emb|CAA41201.1| HMG-Y related protein variant A [Glycine max]
Length=176

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+  +E LNE  GS KS IS+ IE  +G ELP   AT+L  +L+KMK SG+L   +NNY
Sbjct  18   MIVKTLEALNEPNGSNKSAISKYIETTYG-ELP--DATVLGSHLNKMKDSGELSFKQNNY  74

Query  284  KK  279
             K
Sbjct  75   MK  76



>gb|KHN41070.1| HMG-Y-related protein A [Glycine soja]
Length=158

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+  +E LNE  GS KS IS+ IE  +G ELP   AT+L  +L+KMK SG+L   +NNY
Sbjct  18   MIVKTLEALNEPNGSNKSAISKYIETTYG-ELP--DATVLGSHLNKMKDSGELSFKQNNY  74

Query  284  KK  279
             K
Sbjct  75   MK  76



>ref|XP_010479286.1| PREDICTED: formin-like protein 5 [Camelina sativa]
Length=480

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AI  LNE  GS+K  ISR IE  + G +P +H  LLTH+L  +K SG L++VK +Y
Sbjct  77   MICTAISALNEPDGSSKQAISRYIERIYTG-MPTTHGALLTHHLKTLKNSGILMMVKKSY  135

Query  284  K  282
            K
Sbjct  136  K  136



>ref|XP_011084389.1| PREDICTED: histone H1 [Sesamum indicum]
Length=421

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I AAI  L E+ GS+K  I++ IE  H   LP +H+ LLTH+L ++K +GQ+++VK++Y
Sbjct  44   MITAAISALKERNGSSKRAIAKYIET-HYPNLPPTHSALLTHHLKRLKINGQVLMVKHSY  102

Query  284  K  282
            K
Sbjct  103  K  103



>gb|KHN41069.1| HMG-Y-related protein A [Glycine soja]
Length=156

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+  +E LNE  GS KS IS+ IE  +G ELP   AT+L  +L+KMK SG+L   +NNY
Sbjct  18   MIVKTLEALNEPNGSNKSAISKYIETTYG-ELP--DATVLGSHLNKMKDSGELSFKQNNY  74

Query  284  KK  279
             K
Sbjct  75   MK  76



>ref|XP_006360387.1| PREDICTED: HMG-Y-related protein A-like [Solanum tuberosum]
Length=171

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  A++ELN++GG+ KS I++ IE  +G +L    + +L  +LD MKQ+G LV +KNNY
Sbjct  15   MIYEALDELNQEGGANKSSITKYIETKYG-DLNEDLSKMLPLHLDNMKQNGNLVFLKNNY  73

Query  284  KK  279
             K
Sbjct  74   MK  75



>ref|NP_188431.3| protein HON4 [Arabidopsis thaliana]
 dbj|BAB01332.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO00794.1| linker histone protein, putative [Arabidopsis thaliana]
 gb|AAP31950.1| At3g18035 [Arabidopsis thaliana]
 gb|AEE76037.1| winged-helix DNA-binding transcription factor family protein 
[Arabidopsis thaliana]
Length=480

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I AAI  LNE  GS+K  ISR IE  + G L  +HA LLTH+L  +K SG L +VK +Y
Sbjct  71   MICAAIAALNEPDGSSKMAISRYIERCYTG-LTSAHAALLTHHLKTLKTSGVLSMVKKSY  129

Query  284  K  282
            K
Sbjct  130  K  130



>ref|XP_004240031.1| PREDICTED: HMG-Y-related protein B-like [Solanum lycopersicum]
Length=172

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  A++ELN++GG+ KS IS+ IE  + G+L    + +L  +LD MKQ+G L+ +KNNY
Sbjct  15   MIYEALDELNQEGGANKSSISKYIETKY-GDLNEDLSKMLPLHLDNMKQNGDLIFLKNNY  73



>ref|XP_009360089.1| PREDICTED: synapsin-1 [Pyrus x bretschneideri]
Length=496

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AI  L EK GS+K  I++ IE  + G LP +H+ LLTH+L ++K +G L++VK +Y
Sbjct  65   MIYGAITALKEKDGSSKRAIAKYIERVYSG-LPATHSALLTHHLKRLKNNGHLLMVKKSY  123

Query  284  K  282
            K
Sbjct  124  K  124



>emb|CDY04315.1| BnaC05g25770D [Brassica napus]
Length=452

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I +AI  LNE  GS+K  ISR IE  + G +P +H +LLTH+L  +K SG L +VK +Y
Sbjct  67   MICSAISALNEPDGSSKQAISRYIERFYTG-IPPAHGSLLTHHLRTLKNSGVLFMVKKSY  125

Query  284  K  282
            K
Sbjct  126  K  126



>ref|XP_006307404.1| hypothetical protein CARUB_v10009029mg [Capsella rubella]
 gb|EOA40302.1| hypothetical protein CARUB_v10009029mg [Capsella rubella]
Length=475

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AI  LNE  GS+K  ISR IE  + G +P +H  LLTH+L  +K SG L++VK +Y
Sbjct  75   MICTAIAALNEPDGSSKQAISRYIERIYTG-IPTAHGALLTHHLKTLKNSGVLMMVKKSY  133

Query  284  K  282
            K
Sbjct  134  K  134



>ref|XP_008352867.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form-like [Malus domestica]
Length=495

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AI  L EK GS+K  I++ IE  + G LP +H+ LLTH+L ++K +G L++VK +Y
Sbjct  65   MIYGAITALKEKDGSSKRAIAKYIERVYSG-LPATHSALLTHHLKRLKNNGHLLMVKKSY  123

Query  284  K  282
            K
Sbjct  124  K  124



>emb|CDY48811.1| BnaC02g34030D [Brassica napus]
Length=246

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 4/62 (6%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +IM AIE  N   G  K+ I + I++     LP SH TLL ++L+ MKQSGQ+V+VKNNY
Sbjct  143  MIMDAIEATN---GCNKTAIVKHIDSTQI-TLPPSHLTLLNYHLNWMKQSGQIVIVKNNY  198

Query  284  KK  279
             K
Sbjct  199  MK  200



>ref|XP_004512726.1| PREDICTED: helicase SRCAP-like [Cicer arietinum]
Length=505

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AIE L EK GS+K  IS+ IE  +  +L  +H+TLLTH+L ++K  G L +VK +Y
Sbjct  51   MIYNAIEALKEKNGSSKRAISKYIEQVYKHQLSPAHSTLLTHHLKRLKSQGLLEMVKKSY  110

Query  284  K  282
            K
Sbjct  111  K  111



>ref|XP_002894121.1| hypothetical protein ARALYDRAFT_474000 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70380.1| hypothetical protein ARALYDRAFT_474000 [Arabidopsis lyrata subsp. 
lyrata]
Length=473

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AI  LNE  GS+K  ISR IE  + G +P +H  LLTH+L  +K SG L++VK +Y
Sbjct  79   MICTAIAALNEPDGSSKQAISRYIERIYTG-IPTAHGALLTHHLKTLKTSGILMMVKKSY  137

Query  284  K  282
            K
Sbjct  138  K  138



>ref|XP_006297480.1| hypothetical protein CARUB_v10013499mg [Capsella rubella]
 gb|EOA30378.1| hypothetical protein CARUB_v10013499mg [Capsella rubella]
Length=503

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 43/77 (56%), Gaps = 2/77 (3%)
 Frame = -3

Query  506  IIYHLGTNY--FVVV*LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYL  333
            +I H   N+  +  V L  +    LNE  GS+K  ISR IE  + G LP +H  LLTH L
Sbjct  68   MIPHPSLNHPPYSEVCLWRSRFAALNEPDGSSKMAISRYIERCYTGLLPSAHPALLTHNL  127

Query  332  DKMKQSGQLVLVKNNYK  282
              +K SG L +VK +YK
Sbjct  128  KTLKSSGVLAMVKKSYK  144



>ref|XP_010461688.1| PREDICTED: extensin-like isoform X1 [Camelina sativa]
Length=510

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AI  LNE  GS+K  I+R IE  + G +P +H  LLTH+L  +K SG L++VK +Y
Sbjct  113  MICTAISALNEPDGSSKQAIARYIERIYTG-IPTTHGALLTHHLKTLKNSGILMMVKKSY  171

Query  284  K  282
            K
Sbjct  172  K  172



>ref|XP_010274698.1| PREDICTED: histone H1-like [Nelumbo nucifera]
Length=364

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I++AI  LNEK GS+K  I++ I+AA+   LP +H+ LL+ +L ++K+SG +V VK++Y
Sbjct  88   MIVSAIRGLNEKKGSSKKAIAKFIDAAY-TNLPPTHSALLSTHLKRLKKSGHVVQVKHSY  146

Query  284  K  282
            K
Sbjct  147  K  147



>ref|XP_006406662.1| hypothetical protein EUTSA_v10020566mg [Eutrema salsugineum]
 gb|ESQ48115.1| hypothetical protein EUTSA_v10020566mg [Eutrema salsugineum]
Length=502

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 41/72 (57%), Gaps = 1/72 (1%)
 Frame = -3

Query  497  HLGTNYFVVV*LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQ  318
            H   N+     +I AAI  LNE  GS+K  ISR IE      LP SH  LLTH+L  +K 
Sbjct  79   HPSLNHPPYSQMICAAIGALNEPDGSSKMAISRYIERFQP-VLPPSHGALLTHHLKTLKN  137

Query  317  SGQLVLVKNNYK  282
            SG L +VK +YK
Sbjct  138  SGVLAMVKKSYK  149



>ref|XP_010461689.1| PREDICTED: proline-rich extensin-like protein EPR1 isoform X2 
[Camelina sativa]
Length=488

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AI  LNE  GS+K  I+R IE  + G +P +H  LLTH+L  +K SG L++VK +Y
Sbjct  77   MICTAISALNEPDGSSKQAIARYIERIYTG-IPTTHGALLTHHLKTLKNSGILMMVKKSY  135

Query  284  K  282
            K
Sbjct  136  K  136



>ref|XP_002265692.2| PREDICTED: HMG-Y-related protein B [Vitis vinifera]
 emb|CBI40230.3| unnamed protein product [Vitis vinifera]
Length=215

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 53/76 (70%), Gaps = 9/76 (12%)
 Frame = -3

Query  506  IIYHLGTNYFVVV*LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDK  327
            I+ HL T         MAAI+ LN+K GS+KS IS+ IE+AHG +LP +H+TLL H+L++
Sbjct  43   ILQHLETT--------MAAIKALNDKSGSSKSSISKHIESAHG-DLPAAHSTLLAHHLNR  93

Query  326  MKQSGQLVLVKNNYKK  279
             KQ+G  V+V+N+  K
Sbjct  94   RKQNGDPVMVRNHCMK  109



>ref|XP_010500400.1| PREDICTED: putative uncharacterized protein FLJ22184 [Camelina 
sativa]
Length=482

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AI  LNE  GS+K  I+R IE  + G +P +H  LLTH+L  +K SG L++VK +Y
Sbjct  76   MICTAISALNEPDGSSKQAIARYIERIYTG-IPTTHGALLTHHLKTLKNSGILMMVKKSY  134

Query  284  K  282
            K
Sbjct  135  K  135



>ref|XP_007163385.1| hypothetical protein PHAVU_001G230300g [Phaseolus vulgaris]
 gb|ESW35379.1| hypothetical protein PHAVU_001G230300g [Phaseolus vulgaris]
Length=179

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AIE LNE  GS K+ IS+ IE+ + G LP  H  LL  +L K++ +G L   KNNY
Sbjct  19   MILEAIEALNEGNGSNKTSISKYIESKY-GVLPPGHKVLLNVHLAKLRDTGLLDFWKNNY  77

Query  284  KK  279
             K
Sbjct  78   TK  79



>ref|XP_006341568.1| PREDICTED: altered inheritance of mitochondria protein 3-like 
[Solanum tuberosum]
Length=531

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            LI  AI  LNEK GS++  I++ I+  H   LP +H+ LLTH+L ++K SG L +VK++Y
Sbjct  51   LITGAITALNEKEGSSRVAIAKYIDRVHS-NLPPNHSALLTHHLKRLKNSGYLAMVKHSY  109



>ref|XP_004982003.1| PREDICTED: basic proline-rich protein-like [Setaria italica]
Length=220

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLV  297
            +I+AAI  L E+ GS+++ I+R+IEA   G+LP SH  L+  +L +M  +G+LV V
Sbjct  27   MIVAAIAALAEENGSSQAAIARRIEAEARGDLPASHPALVAAHLSRMSAAGELVAV  82



>gb|KHN00167.1| Histone H1.2 [Glycine soja]
Length=289

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = -3

Query  488  TNYFVVV*LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQ  309
            TN+     +I  AI  L EK GS+K  I + +E  +  +LP +H+ LLTH+L+++K +G 
Sbjct  34   TNHPPYDEMIYTAIGALKEKDGSSKRAIGKYMEQVYK-DLPPTHSALLTHHLNRLKSAGL  92

Query  308  LVLVKNNYK  282
            L+LVK +YK
Sbjct  93   LILVKKSYK  101



>gb|AFW67843.1| hypothetical protein ZEAMMB73_725660 [Zea mays]
Length=227

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLV  297
            +I+AAI  L E+ GS+++ I+R+IEA   G+LP SH  L+  +L +M  +G+LV V
Sbjct  26   MIVAAIAALAEENGSSQAAIARRIEAQARGDLPASHPALVAAHLSRMSAAGELVAV  81



>gb|KJB78248.1| hypothetical protein B456_012G185800 [Gossypium raimondii]
Length=371

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AI  L EK GS+K  IS+ IE AH    P SH  LLT +L  +K SGQLV+V+ +Y
Sbjct  51   MIIEAIGALKEKNGSSKRAISKYIELAHK-PYPPSHDELLTQHLKLLKSSGQLVMVRKSY  109

Query  284  K  282
            K
Sbjct  110  K  110



>ref|NP_001236260.1| HMG I/Y like protein [Glycine max]
 emb|CAC69997.1| HMG I/Y like protein [Glycine max]
Length=413

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = -3

Query  488  TNYFVVV*LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQ  309
            TN+     +I  AI  L EK GS+K  I + +E  +  +LP +H+ LLTH+L+++K +G 
Sbjct  32   TNHPPYDEMIYTAIGALKEKDGSSKRAIGKYMEQVYK-DLPPTHSALLTHHLNRLKSAGL  90

Query  308  LVLVKNNYK  282
            L+LVK +YK
Sbjct  91   LILVKKSYK  99



>gb|KEH26927.1| linker histone H1 and h5 family protein [Medicago truncatula]
Length=553

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPG--SHATLLTHYLDKMKQSGQLVLVKN  291
            +I  AIE L EK GS+K  IS+ IE  +  +LP   SH  LLTH+L ++K  G L ++KN
Sbjct  48   MIYTAIEALKEKDGSSKRAISKYIEHVYRDQLPNSESHQNLLTHHLKRLKSEGLLQMIKN  107

Query  290  NY  285
            +Y
Sbjct  108  SY  109



>gb|KJB78249.1| hypothetical protein B456_012G185800 [Gossypium raimondii]
Length=391

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I+ AI  L EK GS+K  IS+ IE AH    P SH  LLT +L  +K SGQLV+V+ +Y
Sbjct  51   MIIEAIGALKEKNGSSKRAISKYIELAHK-PYPPSHDELLTQHLKLLKSSGQLVMVRKSY  109

Query  284  K  282
            K
Sbjct  110  K  110



>emb|CAA15421.1| HMR1 protein [Antirrhinum majus]
Length=400

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I +AI  LNE+ GS+K  I++ +E+   G LP +HA+LL  +L ++K +G +++VK++Y
Sbjct  57   MITSAISALNERNGSSKRAIAKYVESNFTG-LPATHASLLATHLKRLKDTGDILMVKHSY  115

Query  284  K  282
            K
Sbjct  116  K  116



>ref|NP_001142793.1| uncharacterized protein LOC100275167 [Zea mays]
 gb|ACG26765.1| hypothetical protein [Zea mays]
Length=225

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLV  297
            +I+AAI  L E+ GS+++ I+R+IEA   G+LP SH  L+  +L +M  +G+LV V
Sbjct  26   MIVAAITALAEENGSSQAAIARRIEAQARGDLPASHPALVAAHLSRMSAAGELVAV  81



>ref|XP_003524344.1| PREDICTED: histone H1-like [Glycine max]
Length=383

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AI  L E+ GS+K  I + IE  +  +LP +H  LLTH+L+++K S  LVLVK +Y
Sbjct  15   MIYTAIGALKERDGSSKRAIGKYIEQVYK-DLPPTHPALLTHHLNRLKSSALLVLVKKSY  73

Query  284  K  282
            K
Sbjct  74   K  74



>gb|KEH28971.1| linker histone H1 and h5 family protein [Medicago truncatula]
Length=147

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKN  291
            +I  A++ELNEK GST+ DIS+ I   +  +LP  HA +L   L K   SG+L+  +N
Sbjct  51   MIKRAVKELNEKSGSTEEDISKFIRREYDNDLPFDHAFILHSRLKKFCMSGELLCTEN  108



>ref|XP_002321509.1| hypothetical protein POPTR_0015s04390g [Populus trichocarpa]
 gb|ABK92462.1| unknown [Populus trichocarpa]
 gb|ABK95512.1| unknown [Populus trichocarpa]
 gb|EEF05636.1| hypothetical protein POPTR_0015s04390g [Populus trichocarpa]
Length=478

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I +AI  L E+ GS++  I++ IE A+ G LP +H+ LLTH+L ++K SG LVL K +Y
Sbjct  54   MIYSAITALKEQDGSSRIAIAKYIERAYPG-LPSNHSDLLTHHLKRLKNSGALVLNKKSY  112



>gb|KHN10548.1| Histone H1.2 [Glycine soja]
Length=236

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AI  L E+ GS+K  I + IE  +  +LP +H  LLTH+L+++K S  LVLVK +Y
Sbjct  15   MIYTAIGALKERDGSSKRAIGKYIEQVYK-DLPPTHPALLTHHLNRLKSSALLVLVKKSY  73

Query  284  K  282
            K
Sbjct  74   K  74



>ref|XP_010095996.1| Histone [Morus notabilis]
 gb|EXB62689.1| Histone [Morus notabilis]
Length=507

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I +AI  L E+ GS+K  I++ IE A+ G LP +H+ LLT++L ++K +G LV+VK +Y
Sbjct  82   MIYSAIGALKERDGSSKRAIAKYIEQAYMG-LPSTHSALLTNHLKRLKNNGLLVMVKKSY  140

Query  284  K  282
            K
Sbjct  141  K  141



>ref|XP_011039114.1| PREDICTED: histone-lysine N-methyltransferase 2B-like [Populus 
euphratica]
Length=465

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I +AI  L E+ GS++  IS+ IE A+   LP SH+ LLTH+L ++K SG LVL K +Y
Sbjct  54   MIYSAITALKEQDGSSRIAISKYIERAYP-RLPPSHSDLLTHHLKRLKNSGALVLNKKSY  112



>ref|XP_011008342.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form-like isoform X4 [Populus euphratica]
Length=465

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I +AI  L E+ GS++  I++ IE A+ G LP +H+ LLTH+L ++K SG LVL K +Y
Sbjct  54   MIYSAITALKEQDGSSRIAIAKYIEKAYPG-LPSNHSDLLTHHLKRLKNSGALVLNKKSY  112



>ref|XP_011008341.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form-like isoform X3 [Populus euphratica]
Length=467

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I +AI  L E+ GS++  I++ IE A+ G LP +H+ LLTH+L ++K SG LVL K +Y
Sbjct  54   MIYSAITALKEQDGSSRIAIAKYIEKAYPG-LPSNHSDLLTHHLKRLKNSGALVLNKKSY  112



>ref|XP_011008340.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form-like isoform X2 [Populus euphratica]
Length=469

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I +AI  L E+ GS++  I++ IE A+ G LP +H+ LLTH+L ++K SG LVL K +Y
Sbjct  54   MIYSAITALKEQDGSSRIAIAKYIEKAYPG-LPSNHSDLLTHHLKRLKNSGALVLNKKSY  112



>ref|XP_011008339.1| PREDICTED: AF4/FMR2 family member 4-like isoform X1 [Populus 
euphratica]
Length=481

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I +AI  L E+ GS++  I++ IE A+ G LP +H+ LLTH+L ++K SG LVL K +Y
Sbjct  54   MIYSAITALKEQDGSSRIAIAKYIEKAYPG-LPSNHSDLLTHHLKRLKNSGALVLNKKSY  112



>ref|XP_009146128.1| PREDICTED: uncharacterized protein LOC103869808 [Brassica rapa]
Length=884

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AI +LNE  GS+K+ ISR+I+ ++   LP SHA L+T++L  ++++G L +V N Y
Sbjct  511  MIFDAIRDLNEPDGSSKTRISRRIKRSNAV-LPPSHAVLMTYHLKTLRKNGVLTMVNNLY  569

Query  284  K  282
            K
Sbjct  570  K  570



>ref|XP_003631087.1| HMG-Y-related protein A [Medicago truncatula]
 gb|ABE80152.1| High mobility group proteins HMG-I and HMG-Y; Linker histone, 
N-terminal [Medicago truncatula]
 gb|AET05563.1| linker histone H1 and h5 family protein [Medicago truncatula]
Length=422

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AIE L EK GS+K  I + IE  +   LP  H+TLLT +L+ +K +G L++ K +Y
Sbjct  33   MIYKAIEALKEKDGSSKRAIGKYIEHVYKQVLPPEHSTLLTQHLNHLKSAGLLIMFKKSY  92

Query  284  K  282
            K
Sbjct  93   K  93



>ref|XP_002464000.1| hypothetical protein SORBIDRAFT_01g010370 [Sorghum bicolor]
 gb|EER90998.1| hypothetical protein SORBIDRAFT_01g010370 [Sorghum bicolor]
Length=281

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLV  297
            +I+AAI  L E+ GS+++ I+R+IEA   G+LP SH  L+  +L +M  +G+LV V
Sbjct  26   MIVAAIAALAEENGSSQAAIARRIEAEARGDLPASHPALVAAHLSRMSAAGELVAV  81



>ref|XP_004235775.1| PREDICTED: basic salivary proline-rich protein 1 [Solanum lycopersicum]
Length=518

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            LI AAI  L EK GS++  I++ I+  H   LP +H+ LLTH+L ++K SG L +VK++Y
Sbjct  49   LITAAITALKEKEGSSRVAIAKYIDRVHP-NLPPNHSALLTHHLKRLKNSGYLAMVKHSY  107



>emb|CDX95794.1| BnaC05g35450D [Brassica napus]
Length=423

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = -3

Query  485  NYFVVV*LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQL  306
            NY     +I   I +LNE  GS+KS ISR+I+ ++   LP SH+ L+T++L +++++G L
Sbjct  105  NYPPYDDMICDVIRDLNEPDGSSKSRISRRIKRSN-VVLPPSHSVLMTYHLKRLRKNGVL  163

Query  305  VLVKNNYK  282
             +V N YK
Sbjct  164  TMVNNLYK  171



>ref|XP_011464492.1| PREDICTED: extensin [Fragaria vesca subsp. vesca]
Length=514

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLVKNNY  285
            +I  AI  L E+ GS++  I++ IE  +   LP +H+ LLTH+L ++K SG L +VK +Y
Sbjct  56   MIYTAIAALKERDGSSRRAIAKYIEQVYP-SLPPTHSALLTHHLKRLKNSGHLEMVKKSY  114

Query  284  K  282
            K
Sbjct  115  K  115



>emb|CDX92189.1| BnaA05g22180D [Brassica napus]
Length=428

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = -3

Query  485  NYFVVV*LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQL  306
            NY     +I  AI +LNE  GS+K+ ISR+I+ ++   LP S+A L+T++L  ++++G L
Sbjct  78   NYPPYDDMIFDAIRDLNEPDGSSKTRISRRIKRSN-AVLPPSYAVLMTYHLKTLRKNGVL  136

Query  305  VLVKNNYK  282
             +V N YK
Sbjct  137  TMVNNLYK  144



>gb|KCW53132.1| hypothetical protein EUGRSUZ_J02424 [Eucalyptus grandis]
Length=145

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = -3

Query  485  NYFVVV*LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQL  306
            N+     +I  AI+ELNE+GGS++  IS+ I+A +  +LP  HA+LL+H+L K+ + G++
Sbjct  75   NHPTYALMIRRAIQELNEEGGSSEESISKFIKAEY-QDLPWGHASLLSHHLMKLSECGEI  133

Query  305  V  303
            +
Sbjct  134  I  134



>ref|XP_008644071.1| PREDICTED: uncharacterized LOC100383454 isoform X2 [Zea mays]
 gb|AFW67836.1| putative AGC protein kinase family protein [Zea mays]
Length=664

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLV  297
            +I+AAI  L E+ GS+++ I+R+IEA   G+LP SH  L+  +L +M  +G+LV V
Sbjct  26   MIVAAITALAEENGSSQAAIARRIEAQARGDLPASHPALVAAHLSRMSAAGELVAV  81



>ref|NP_001169574.1| uncharacterized LOC100383454 [Zea mays]
 ref|XP_008644072.1| PREDICTED: uncharacterized LOC100383454 isoform X1 [Zea mays]
 ref|XP_008644073.1| PREDICTED: uncharacterized LOC100383454 isoform X1 [Zea mays]
 ref|XP_008644074.1| PREDICTED: uncharacterized LOC100383454 isoform X1 [Zea mays]
 ref|XP_008644075.1| PREDICTED: uncharacterized LOC100383454 isoform X1 [Zea mays]
 gb|ACN34161.1| unknown [Zea mays]
 gb|AFW67837.1| putative AGC protein kinase family protein isoform 1 [Zea mays]
 gb|AFW67838.1| putative AGC protein kinase family protein isoform 2 [Zea mays]
 gb|AFW67839.1| putative AGC protein kinase family protein isoform 3 [Zea mays]
Length=657

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -3

Query  464  LIMAAIEELNEKGGSTKSDISRQIEAAHGGELPGSHATLLTHYLDKMKQSGQLVLV  297
            +I+AAI  L E+ GS+++ I+R+IEA   G+LP SH  L+  +L +M  +G+LV V
Sbjct  26   MIVAAITALAEENGSSQAAIARRIEAQARGDLPASHPALVAAHLSRMSAAGELVAV  81



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559877061510