BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP007G02 659 bp,

Length=626
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011099397.1|  PREDICTED: heptahelical transmembrane protei...    361   9e-121   Sesamum indicum [beniseed]
ref|XP_009624872.1|  PREDICTED: heptahelical transmembrane protei...    352   2e-117   Nicotiana tomentosiformis
ref|XP_006363814.1|  PREDICTED: ADIPOR-like receptor IZH1-like          350   8e-117   Solanum tuberosum [potatoes]
ref|XP_004231936.1|  PREDICTED: heptahelical transmembrane protei...    349   3e-116   Solanum lycopersicum
ref|XP_008440411.1|  PREDICTED: adiponectin receptor protein 2-li...    348   8e-116   Cucumis melo [Oriental melon]
ref|XP_004141855.1|  PREDICTED: adiponectin receptor protein 2-li...    347   2e-115   Cucumis sativus [cucumbers]
ref|XP_004167676.1|  PREDICTED: adiponectin receptor protein 2-li...    347   2e-115   
ref|XP_007047565.1|  Heptahelical protein 4 isoform 2                   345   1e-114   Theobroma cacao [chocolate]
emb|CDP02615.1|  unnamed protein product                                344   3e-114   Coffea canephora [robusta coffee]
ref|XP_009758486.1|  PREDICTED: heptahelical transmembrane protei...    343   5e-114   Nicotiana sylvestris
ref|XP_010273060.1|  PREDICTED: heptahelical transmembrane protei...    343   5e-114   Nelumbo nucifera [Indian lotus]
ref|XP_007047564.1|  Heptahelical protein 4 isoform 1                   345   1e-113   Theobroma cacao [chocolate]
ref|XP_010106925.1|  Adiponectin receptor protein 2                     341   4e-113   Morus notabilis
ref|XP_007205266.1|  hypothetical protein PRUPE_ppa006424mg             340   1e-112   Prunus persica
ref|XP_008237729.1|  PREDICTED: adiponectin receptor protein-like...    340   1e-112   Prunus mume [ume]
gb|EPS69882.1|  hypothetical protein M569_04878                         339   2e-112   Genlisea aurea
gb|KJB43938.1|  hypothetical protein B456_007G224700                    339   2e-112   Gossypium raimondii
ref|XP_009758488.1|  PREDICTED: heptahelical transmembrane protei...    338   4e-112   Nicotiana sylvestris
ref|XP_002525289.1|  conserved hypothetical protein                     338   4e-112   
ref|XP_008341411.1|  PREDICTED: adiponectin receptor protein 2-like     337   1e-111   Malus domestica [apple tree]
ref|XP_009354632.1|  PREDICTED: heptahelical transmembrane protei...    337   2e-111   Pyrus x bretschneideri [bai li]
ref|XP_010274409.1|  PREDICTED: heptahelical transmembrane protei...    337   2e-111   Nelumbo nucifera [Indian lotus]
gb|KDP32090.1|  hypothetical protein JCGZ_12551                         336   3e-111   Jatropha curcas
ref|XP_004511819.1|  PREDICTED: adiponectin receptor protein 1-li...    335   5e-111   Cicer arietinum [garbanzo]
ref|XP_010028082.1|  PREDICTED: heptahelical transmembrane protei...    335   9e-111   Eucalyptus grandis [rose gum]
ref|XP_010999933.1|  PREDICTED: heptahelical transmembrane protei...    333   5e-110   Populus euphratica
ref|XP_002320004.2|  hypothetical protein POPTR_0014s00900g             333   6e-110   Populus trichocarpa [western balsam poplar]
ref|XP_009797604.1|  PREDICTED: heptahelical transmembrane protei...    332   1e-109   Nicotiana sylvestris
emb|CBI25834.3|  unnamed protein product                                332   1e-109   Vitis vinifera
ref|XP_009362593.1|  PREDICTED: heptahelical transmembrane protei...    332   2e-109   Pyrus x bretschneideri [bai li]
ref|XP_010646812.1|  PREDICTED: heptahelical transmembrane protei...    331   4e-109   Vitis vinifera
ref|XP_004288264.1|  PREDICTED: heptahelical transmembrane protei...    331   5e-109   Fragaria vesca subsp. vesca
ref|XP_011007839.1|  PREDICTED: heptahelical transmembrane protei...    330   1e-108   Populus euphratica
gb|EYU44509.1|  hypothetical protein MIMGU_mgv1a007578mg                329   2e-108   Erythranthe guttata [common monkey flower]
ref|XP_010531306.1|  PREDICTED: heptahelical transmembrane protein 4    328   6e-108   Tarenaya hassleriana [spider flower]
ref|XP_009362592.1|  PREDICTED: heptahelical transmembrane protei...    327   1e-107   Pyrus x bretschneideri [bai li]
ref|XP_009419320.1|  PREDICTED: heptahelical transmembrane protei...    327   1e-107   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008237736.1|  PREDICTED: adiponectin receptor protein-like...    326   2e-107   Prunus mume [ume]
ref|XP_007156702.1|  hypothetical protein PHAVU_002G010000g             323   3e-106   Phaseolus vulgaris [French bean]
ref|XP_006466458.1|  PREDICTED: ADIPOR-like receptor IZH1-like is...    323   4e-106   Citrus sinensis [Valencia orange]
gb|KDO78928.1|  hypothetical protein CISIN_1g015195mg                   323   4e-106   Citrus sinensis [Valencia orange]
ref|XP_006426099.1|  hypothetical protein CICLE_v10025731mg             323   5e-106   Citrus clementina
ref|XP_002285384.1|  PREDICTED: heptahelical transmembrane protei...    323   5e-106   Vitis vinifera
ref|XP_009797605.1|  PREDICTED: heptahelical transmembrane protei...    322   9e-106   Nicotiana sylvestris
ref|XP_009618874.1|  PREDICTED: heptahelical transmembrane protei...    322   1e-105   Nicotiana tomentosiformis
gb|KHG04092.1|  ADIPOR-like receptor protein                            322   2e-105   Gossypium arboreum [tree cotton]
gb|KHN36309.1|  ADIPOR-like receptor CG5315-like protein                320   2e-105   Glycine soja [wild soybean]
ref|XP_002310891.1|  hypothetical protein POPTR_0007s14850g             320   4e-105   Populus trichocarpa [western balsam poplar]
ref|XP_008647457.1|  PREDICTED: uncharacterized protein LOC100502...    320   7e-105   Zea mays [maize]
ref|XP_002468234.1|  hypothetical protein SORBIDRAFT_01g042200          320   9e-105   Sorghum bicolor [broomcorn]
ref|XP_006649686.1|  PREDICTED: ADIPOR-like receptor CG5315-like        319   1e-104   Oryza brachyantha
ref|NP_001242849.1|  uncharacterized protein LOC100778227               318   1e-104   Glycine max [soybeans]
ref|XP_010679658.1|  PREDICTED: heptahelical transmembrane protei...    319   2e-104   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009395019.1|  PREDICTED: heptahelical transmembrane protei...    318   3e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011031308.1|  PREDICTED: heptahelical transmembrane protei...    318   3e-104   Populus euphratica
gb|EMT18253.1|  ADIPOR-like receptor                                    317   1e-103   Aegilops tauschii
ref|XP_004985130.1|  PREDICTED: ADIPOR-like receptor CG5315-like ...    317   2e-103   Setaria italica
gb|EEE58653.1|  hypothetical protein OsJ_10038                          315   2e-103   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006857128.1|  hypothetical protein AMTR_s00065p00145160          315   4e-103   Amborella trichopoda
gb|ABM68566.1|  hemolysin III-related family protein                    315   4e-103   Lilium longiflorum [Easter lily]
ref|NP_001049471.1|  Os03g0232900                                       315   7e-103   
gb|KJB43936.1|  hypothetical protein B456_007G224700                    311   8e-103   Gossypium raimondii
gb|EEC74820.1|  hypothetical protein OsI_10642                          315   8e-103   Oryza sativa Indica Group [Indian rice]
gb|KJB18049.1|  hypothetical protein B456_003G031300                    312   5e-102   Gossypium raimondii
ref|XP_006350623.1|  PREDICTED: adiponectin receptor protein 1-like     311   9e-102   Solanum tuberosum [potatoes]
ref|XP_004234646.1|  PREDICTED: heptahelical transmembrane protei...    309   1e-100   Solanum lycopersicum
dbj|BAJ95400.1|  predicted protein                                      309   1e-100   Hordeum vulgare subsp. vulgare [barley]
gb|AAM19133.1|AC103891_13  Hypothetical protein                         319   5e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004511821.1|  PREDICTED: adiponectin receptor protein 1-li...    306   9e-100   Cicer arietinum [garbanzo]
ref|XP_009133930.1|  PREDICTED: adiponectin receptor protein-like...    306   1e-99    Brassica rapa
emb|CDX69320.1|  BnaC01g01330D                                          306   1e-99    Brassica napus [oilseed rape]
ref|XP_003611557.1|  Adiponectin receptor protein                       305   2e-99    Medicago truncatula
ref|XP_006411861.1|  hypothetical protein EUTSA_v10025437mg             305   2e-99    Eutrema salsugineum
gb|AFK46125.1|  unknown                                                 305   2e-99    Medicago truncatula
ref|XP_009138520.1|  PREDICTED: adiponectin receptor protein 1-li...    305   3e-99    Brassica rapa
emb|CDY29576.1|  BnaA03g54210D                                          305   3e-99    Brassica napus [oilseed rape]
ref|XP_010446637.1|  PREDICTED: heptahelical transmembrane protein 4    304   5e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010437193.1|  PREDICTED: heptahelical transmembrane protein 4    304   5e-99    Camelina sativa [gold-of-pleasure]
ref|XP_002868976.1|  hypothetical protein ARALYDRAFT_490848             304   8e-99    Arabidopsis lyrata subsp. lyrata
gb|KJB40282.1|  hypothetical protein B456_007G056700                    303   1e-98    Gossypium raimondii
ref|NP_195483.1|  heptahelical transmembrane protein HHP4               303   1e-98    Arabidopsis thaliana [mouse-ear cress]
ref|NP_195545.1|  heptahelical protein 5                                303   1e-98    Arabidopsis thaliana [mouse-ear cress]
gb|KJB40281.1|  hypothetical protein B456_007G056700                    303   2e-98    Gossypium raimondii
emb|CDX72648.1|  BnaC07g46700D                                          302   3e-98    Brassica napus [oilseed rape]
ref|XP_010432040.1|  PREDICTED: heptahelical transmembrane protei...    302   3e-98    Camelina sativa [gold-of-pleasure]
ref|XP_006283903.1|  hypothetical protein CARUB_v10005020mg             302   4e-98    Capsella rubella
ref|NP_001241554.1|  uncharacterized protein LOC100776175               301   7e-98    Glycine max [soybeans]
ref|XP_010228935.1|  PREDICTED: LOW QUALITY PROTEIN: heptahelical...    302   7e-98    
dbj|BAD43945.1|  putative protein                                       301   7e-98    Arabidopsis thaliana [mouse-ear cress]
gb|KHG23872.1|  ADIPOR-like receptor protein                            301   8e-98    Gossypium arboreum [tree cotton]
ref|XP_010936139.1|  PREDICTED: heptahelical transmembrane protei...    301   1e-97    Elaeis guineensis
ref|XP_007156701.1|  hypothetical protein PHAVU_002G010000g             297   2e-96    Phaseolus vulgaris [French bean]
ref|XP_003611558.1|  Adiponectin receptor protein                       293   2e-95    
ref|XP_004985131.1|  PREDICTED: ADIPOR-like receptor CG5315-like ...    294   7e-95    
ref|XP_006572848.1|  PREDICTED: uncharacterized protein LOC100778...    293   8e-95    Glycine max [soybeans]
ref|XP_008790240.1|  PREDICTED: adiponectin receptor protein-like       294   1e-94    Phoenix dactylifera
gb|AES94516.2|  heptahelical protein                                    292   2e-94    Medicago truncatula
ref|XP_010687835.1|  PREDICTED: heptahelical transmembrane protei...    292   5e-94    Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010664499.1|  PREDICTED: heptahelical transmembrane protei...    289   3e-93    Vitis vinifera
gb|ABR16950.1|  unknown                                                 283   2e-90    Picea sitchensis
ref|XP_007209192.1|  hypothetical protein PRUPE_ppa006423mg             278   1e-88    Prunus persica
ref|XP_008238506.1|  PREDICTED: ADIPOR-like receptor IZH1               276   2e-87    Prunus mume [ume]
ref|XP_006590276.1|  PREDICTED: uncharacterized protein LOC100776...    274   2e-87    Glycine max [soybeans]
ref|XP_009797606.1|  PREDICTED: heptahelical transmembrane protei...    268   3e-86    Nicotiana sylvestris
gb|KEH35830.1|  hemolysin-III-like protein                              263   1e-82    Medicago truncatula
ref|XP_002510080.1|  conserved hypothetical protein                     262   3e-82    Ricinus communis
ref|XP_004300330.1|  PREDICTED: heptahelical transmembrane protei...    261   5e-82    Fragaria vesca subsp. vesca
ref|XP_009371039.1|  PREDICTED: heptahelical transmembrane protei...    259   3e-81    Pyrus x bretschneideri [bai li]
ref|XP_008373649.1|  PREDICTED: adiponectin receptor protein-like       259   4e-81    Malus domestica [apple tree]
ref|XP_008340762.1|  PREDICTED: adiponectin receptor protein-like       258   5e-81    Malus domestica [apple tree]
ref|XP_008353207.1|  PREDICTED: adiponectin receptor protein-like       258   5e-81    Malus domestica [apple tree]
ref|XP_006581272.1|  PREDICTED: adiponectin receptor protein 2-li...    256   7e-80    Glycine max [soybeans]
ref|XP_003523624.1|  PREDICTED: adiponectin receptor protein 1-like     254   4e-79    
ref|XP_004501515.1|  PREDICTED: ADIPOR-like receptor CG5315-like        251   6e-78    Cicer arietinum [garbanzo]
gb|KDP41605.1|  hypothetical protein JCGZ_16012                         247   2e-76    Jatropha curcas
ref|XP_011466189.1|  PREDICTED: heptahelical transmembrane protei...    241   8e-76    Fragaria vesca subsp. vesca
ref|XP_009138522.1|  PREDICTED: adiponectin receptor protein 2-li...    241   2e-75    Brassica rapa
ref|XP_006472313.1|  PREDICTED: adiponectin receptor protein 1-like     243   3e-75    Citrus sinensis [Valencia orange]
gb|KDO81490.1|  hypothetical protein CISIN_1g016259mg                   243   4e-75    Citrus sinensis [Valencia orange]
ref|XP_006433647.1|  hypothetical protein CICLE_v10001488mg             243   4e-75    Citrus clementina
ref|XP_010943142.1|  PREDICTED: heptahelical transmembrane protei...    240   1e-74    Elaeis guineensis
ref|XP_007136770.1|  hypothetical protein PHAVU_009G072600g             243   4e-74    Phaseolus vulgaris [French bean]
ref|XP_008340785.1|  PREDICTED: adiponectin receptor protein 1-like     239   1e-73    Malus domestica [apple tree]
ref|XP_008795674.1|  PREDICTED: uncharacterized protein LOC103711343    235   2e-71    
gb|ABK22411.1|  unknown                                                 232   4e-71    Picea sitchensis
ref|XP_010939046.1|  PREDICTED: heptahelical transmembrane protei...    233   1e-70    Elaeis guineensis
ref|XP_010687843.1|  PREDICTED: heptahelical transmembrane protei...    229   2e-70    Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_008810106.1|  PREDICTED: uncharacterized protein LOC103721614    233   1e-68    
ref|XP_008440416.1|  PREDICTED: adiponectin receptor protein 2-li...    221   3e-68    
ref|XP_006581275.1|  PREDICTED: adiponectin receptor protein 2-li...    209   7e-63    Glycine max [soybeans]
gb|KHN04432.1|  ADIPOR-like receptor CG5315-like protein                205   2e-61    Glycine soja [wild soybean]
gb|KHN45137.1|  Adiponectin receptor protein 2                          202   2e-60    Glycine soja [wild soybean]
ref|XP_008353215.1|  PREDICTED: uncharacterized protein LOC103416771    206   2e-59    Malus domestica [apple tree]
gb|KDO81492.1|  hypothetical protein CISIN_1g016259mg                   187   1e-54    Citrus sinensis [Valencia orange]
ref|XP_001757760.1|  predicted protein                                  185   3e-52    Physcomitrella patens
ref|XP_001778966.1|  predicted protein                                  182   3e-51    Physcomitrella patens
ref|XP_010943141.1|  PREDICTED: heptahelical transmembrane protei...    171   2e-47    Elaeis guineensis
ref|XP_009134009.1|  PREDICTED: adiponectin receptor protein-like...    164   2e-46    Brassica rapa
ref|XP_004962901.1|  PREDICTED: ADIPOR-like receptor CG5315-like ...    166   2e-45    Setaria italica
ref|XP_002442218.1|  hypothetical protein SORBIDRAFT_08g016470          164   6e-45    Sorghum bicolor [broomcorn]
ref|XP_008795675.1|  PREDICTED: adiponectin receptor protein 2-like     163   8e-45    
ref|XP_004962900.1|  PREDICTED: ADIPOR-like receptor CG5315-like ...    164   2e-44    Setaria italica
ref|XP_006649572.1|  PREDICTED: adiponectin receptor protein 1-like     160   3e-43    Oryza brachyantha
ref|XP_003575484.1|  PREDICTED: heptahelical transmembrane protei...    159   1e-42    Brachypodium distachyon [annual false brome]
ref|XP_001785325.1|  predicted protein                                  157   1e-42    Physcomitrella patens
ref|NP_001130559.1|  uncharacterized protein LOC100191658               157   4e-42    Zea mays [maize]
gb|AFW74657.1|  hypothetical protein ZEAMMB73_526410                    162   4e-42    Zea mays [maize]
gb|ACR38470.1|  unknown                                                 157   6e-42    Zea mays [maize]
tpg|DAA44187.1|  TPA: hypothetical protein ZEAMMB73_882874              151   7e-42    Zea mays [maize]
ref|XP_009389658.1|  PREDICTED: heptahelical transmembrane protei...    155   1e-41    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001183583.1|  uncharacterized protein LOC100502176               152   2e-41    Zea mays [maize]
gb|EEC69364.1|  hypothetical protein OsI_38488                          155   3e-41    Oryza sativa Indica Group [Indian rice]
ref|XP_004987123.1|  PREDICTED: adiponectin receptor protein 1-like     154   6e-41    Setaria italica
gb|ABF94486.1|  Haemolysin-III related family protein, expressed        153   9e-41    Oryza sativa Japonica Group [Japonica rice]
tpg|DAA44186.1|  TPA: hypothetical protein ZEAMMB73_882874              150   1e-40    Zea mays [maize]
ref|XP_008652310.1|  PREDICTED: adiponectin receptor protein 1-like     153   1e-40    Zea mays [maize]
gb|AGT16350.1|  hypothetical protein SHCRBa_020_D23_F_70                151   6e-40    Saccharum hybrid cultivar R570
ref|XP_003561941.1|  PREDICTED: heptahelical transmembrane protei...    151   7e-40    Brachypodium distachyon [annual false brome]
ref|XP_002468327.1|  hypothetical protein SORBIDRAFT_01g043860          150   1e-39    Sorghum bicolor [broomcorn]
ref|NP_001066867.1|  Os12g0511200                                       149   8e-39    
gb|KJB83211.1|  hypothetical protein B456_013G235700                    144   2e-37    Gossypium raimondii
ref|XP_006474409.1|  PREDICTED: adiponectin receptor protein 1-like     144   3e-37    Citrus sinensis [Valencia orange]
gb|KDO73472.1|  hypothetical protein CISIN_1g017287mg                   143   7e-37    Citrus sinensis [Valencia orange]
ref|XP_006664585.1|  PREDICTED: uncharacterized protein LOC102712044    141   1e-36    
ref|XP_011015262.1|  PREDICTED: heptahelical transmembrane protei...    142   2e-36    Populus euphratica
ref|XP_006453094.1|  hypothetical protein CICLE_v10010628mg             144   4e-36    Citrus clementina
ref|XP_002947829.1|  hypothetical protein VOLCADRAFT_43835              139   1e-35    Volvox carteri f. nagariensis
emb|CDY60375.1|  BnaCnng36160D                                          138   3e-35    Brassica napus [oilseed rape]
ref|XP_006358328.1|  PREDICTED: ADIPOR-like receptor CG5315-like        138   4e-35    Solanum tuberosum [potatoes]
ref|XP_009778210.1|  PREDICTED: heptahelical transmembrane protei...    138   5e-35    Nicotiana sylvestris
ref|XP_001780544.1|  predicted protein                                  138   5e-35    Physcomitrella patens
ref|XP_009606704.1|  PREDICTED: heptahelical transmembrane protei...    137   7e-35    Nicotiana tomentosiformis
ref|XP_004242752.1|  PREDICTED: heptahelical transmembrane protein 1    137   1e-34    Solanum lycopersicum
ref|XP_008242828.1|  PREDICTED: adiponectin receptor protein 1          137   2e-34    Prunus mume [ume]
gb|ACJ85151.1|  unknown                                                 132   1e-33    Medicago truncatula
ref|XP_009624873.1|  PREDICTED: heptahelical transmembrane protei...    129   1e-33    Nicotiana tomentosiformis
ref|XP_007204648.1|  hypothetical protein PRUPE_ppa001571mg             136   3e-33    Prunus persica
ref|XP_010687884.1|  PREDICTED: heptahelical transmembrane protein 1    132   7e-33    Beta vulgaris subsp. vulgaris [Swiss chard]
gb|KGN65108.1|  hypothetical protein Csa_1G224880                       131   8e-33    Cucumis sativus [cucumbers]
ref|XP_008443935.1|  PREDICTED: adiponectin receptor protein            131   1e-32    Cucumis melo [Oriental melon]
gb|KCW82943.1|  hypothetical protein EUGRSUZ_C04321                     131   1e-32    Eucalyptus grandis [rose gum]
gb|AES91625.2|  hemolysin-III-like protein                              131   1e-32    Medicago truncatula
ref|XP_008352233.1|  PREDICTED: adiponectin receptor protein-like       131   2e-32    Malus domestica [apple tree]
ref|XP_010050089.1|  PREDICTED: heptahelical transmembrane protei...    131   2e-32    Eucalyptus grandis [rose gum]
ref|XP_003609428.1|  Adiponectin receptor protein                       131   2e-32    
ref|XP_004287273.1|  PREDICTED: heptahelical transmembrane protei...    131   2e-32    Fragaria vesca subsp. vesca
ref|XP_007013572.1|  Heptahelical transmembrane protein1 isoform 1      130   2e-32    Theobroma cacao [chocolate]
ref|XP_009782054.1|  PREDICTED: heptahelical transmembrane protei...    130   3e-32    Nicotiana sylvestris
ref|XP_008336977.1|  PREDICTED: adiponectin receptor protein isof...    130   4e-32    Malus domestica [apple tree]
ref|XP_010239850.1|  PREDICTED: heptahelical transmembrane protei...    130   5e-32    Brachypodium distachyon [annual false brome]
gb|KJB23591.1|  hypothetical protein B456_004G106400                    129   9e-32    Gossypium raimondii
ref|XP_007013573.1|  Heptahelical transmembrane protein1 isoform 2      129   1e-31    Theobroma cacao [chocolate]
ref|XP_009340651.1|  PREDICTED: heptahelical transmembrane protei...    128   2e-31    Pyrus x bretschneideri [bai li]
ref|XP_002960615.1|  hypothetical protein SELMODRAFT_65678              126   3e-31    Selaginella moellendorffii
ref|XP_009363962.1|  PREDICTED: heptahelical transmembrane protei...    128   3e-31    Pyrus x bretschneideri [bai li]
gb|ACU17599.1|  unknown                                                 123   3e-31    Glycine max [soybeans]
gb|KJB64686.1|  hypothetical protein B456_010G060500                    127   3e-31    Gossypium raimondii
ref|XP_001774065.1|  predicted protein                                  125   4e-31    Physcomitrella patens
ref|XP_002983423.1|  hypothetical protein SELMODRAFT_234248             126   5e-31    Selaginella moellendorffii
ref|XP_004287274.1|  PREDICTED: heptahelical transmembrane protei...    127   5e-31    Fragaria vesca subsp. vesca
ref|XP_008362888.1|  PREDICTED: progestin and adipoQ receptor-lik...    127   5e-31    Malus domestica [apple tree]
ref|XP_004965759.1|  PREDICTED: adiponectin receptor protein 1-like     126   7e-31    Setaria italica
gb|AGT17177.1|  adiponectin receptor                                    126   8e-31    Saccharum hybrid cultivar R570
ref|XP_002438737.1|  hypothetical protein SORBIDRAFT_10g025230          126   9e-31    Sorghum bicolor [broomcorn]
ref|XP_006345277.1|  PREDICTED: ADIPOR-like receptor CG5315-like        125   1e-30    Solanum tuberosum [potatoes]
gb|KHG16208.1|  adipor-like receptor izh1                               125   1e-30    Gossypium arboreum [tree cotton]
ref|XP_008649040.1|  PREDICTED: adiponectin receptor protein 1          125   1e-30    Zea mays [maize]
ref|XP_002263728.1|  PREDICTED: heptahelical transmembrane protein 1    125   2e-30    Vitis vinifera
emb|CBI25538.3|  unnamed protein product                                125   3e-30    Vitis vinifera
gb|AGT15921.1|  hypothetical protein SHCRBa_179_G22_F_140               125   3e-30    Saccharum hybrid cultivar R570
ref|XP_009611748.1|  PREDICTED: heptahelical transmembrane protei...    124   4e-30    Nicotiana tomentosiformis
gb|AGT17002.1|  hypothetical protein SHCRBa_063_N24_F_260               124   4e-30    Saccharum hybrid cultivar R570
gb|KDP30239.1|  hypothetical protein JCGZ_17021                         124   5e-30    Jatropha curcas
gb|EPS71737.1|  hypothetical protein M569_03024                         124   5e-30    Genlisea aurea
gb|KJB83217.1|  hypothetical protein B456_013G235800                    124   6e-30    Gossypium raimondii
emb|CDP03234.1|  unnamed protein product                                119   9e-30    Coffea canephora [robusta coffee]
gb|AGT16223.1|  hypothetical protein SHCRBa_014_G09_R_50                123   1e-29    Saccharum hybrid cultivar R570
ref|XP_006656288.1|  PREDICTED: adiponectin receptor protein 1-like     123   2e-29    Oryza brachyantha
ref|XP_011084126.1|  PREDICTED: heptahelical transmembrane protei...    122   3e-29    Sesamum indicum [beniseed]
ref|XP_006852868.1|  hypothetical protein AMTR_s00033p00203190          121   3e-29    Amborella trichopoda
ref|XP_010051735.1|  PREDICTED: heptahelical transmembrane protei...    122   3e-29    Eucalyptus grandis [rose gum]
ref|XP_008336978.1|  PREDICTED: adiponectin receptor protein isof...    121   4e-29    
ref|XP_001691252.1|  hypothetical protein CHLREDRAFT_128250             122   4e-29    Chlamydomonas reinhardtii
ref|XP_006845419.1|  hypothetical protein AMTR_s00019p00084530          121   5e-29    Amborella trichopoda
ref|XP_010040847.1|  PREDICTED: heptahelical transmembrane protei...    120   6e-29    Eucalyptus grandis [rose gum]
gb|KCW81147.1|  hypothetical protein EUGRSUZ_C02517                     121   7e-29    Eucalyptus grandis [rose gum]
ref|XP_002531943.1|  conserved hypothetical protein                     120   8e-29    
ref|XP_004514143.1|  PREDICTED: adiponectin receptor protein 1-li...    120   1e-28    Cicer arietinum [garbanzo]
gb|KJB83216.1|  hypothetical protein B456_013G235800                    119   2e-28    Gossypium raimondii
ref|XP_010241589.1|  PREDICTED: heptahelical transmembrane protei...    120   2e-28    Nelumbo nucifera [Indian lotus]
ref|XP_009340652.1|  PREDICTED: heptahelical transmembrane protei...    119   2e-28    Pyrus x bretschneideri [bai li]
gb|KDP38730.1|  hypothetical protein JCGZ_04083                         119   3e-28    Jatropha curcas
ref|XP_010548494.1|  PREDICTED: heptahelical transmembrane protei...    118   8e-28    Tarenaya hassleriana [spider flower]
ref|XP_010250377.1|  PREDICTED: heptahelical transmembrane protei...    117   2e-27    Nelumbo nucifera [Indian lotus]
ref|XP_002274323.1|  PREDICTED: heptahelical transmembrane protein 2    117   2e-27    Vitis vinifera
ref|XP_008378958.1|  PREDICTED: ADIPOR-like receptor SPBC12C2.09c       117   2e-27    Malus domestica [apple tree]
ref|XP_011018079.1|  PREDICTED: heptahelical transmembrane protein 2    116   4e-27    Populus euphratica
emb|CBI36585.3|  unnamed protein product                                115   4e-27    Vitis vinifera
gb|EAZ20641.1|  hypothetical protein OsJ_36257                          116   4e-27    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010051045.1|  PREDICTED: heptahelical transmembrane protein 2    116   5e-27    Eucalyptus grandis [rose gum]
ref|XP_008339440.1|  PREDICTED: uncharacterized protein LOC103402...    114   6e-27    Malus domestica [apple tree]
gb|EYU18238.1|  hypothetical protein MIMGU_mgv1a009140mg                115   9e-27    Erythranthe guttata [common monkey flower]
emb|CDP10463.1|  unnamed protein product                                115   1e-26    Coffea canephora [robusta coffee]
gb|EYU34968.1|  hypothetical protein MIMGU_mgv1a008266mg                114   1e-26    Erythranthe guttata [common monkey flower]
gb|KCW81148.1|  hypothetical protein EUGRSUZ_C02517                     114   2e-26    Eucalyptus grandis [rose gum]
emb|CAN61543.1|  hypothetical protein VITISV_008489                     115   2e-26    Vitis vinifera
ref|XP_006453549.1|  hypothetical protein CICLE_v10008677mg             114   2e-26    Citrus clementina
gb|KDO62306.1|  hypothetical protein CISIN_1g017277mg                   114   2e-26    Citrus sinensis [Valencia orange]
ref|XP_009355394.1|  PREDICTED: heptahelical transmembrane protei...    114   2e-26    Pyrus x bretschneideri [bai li]
ref|XP_006350145.1|  PREDICTED: ADIPOR-like receptor CG5315-like        114   3e-26    Solanum tuberosum [potatoes]
gb|KJB83210.1|  hypothetical protein B456_013G235700                    112   3e-26    Gossypium raimondii
ref|XP_009341239.1|  PREDICTED: heptahelical transmembrane protei...    113   3e-26    Pyrus x bretschneideri [bai li]
ref|XP_010268485.1|  PREDICTED: heptahelical transmembrane protein 2    113   4e-26    Nelumbo nucifera [Indian lotus]
ref|XP_008339441.1|  PREDICTED: adiponectin receptor protein 1-li...    112   4e-26    Malus domestica [apple tree]
ref|XP_010313846.1|  PREDICTED: heptahelical transmembrane protei...    113   6e-26    Solanum lycopersicum
ref|XP_009416089.1|  PREDICTED: heptahelical transmembrane protei...    113   6e-26    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011020205.1|  PREDICTED: heptahelical transmembrane protei...    112   7e-26    Populus euphratica
ref|XP_006474059.1|  PREDICTED: adiponectin receptor protein 2-like     112   8e-26    Citrus sinensis [Valencia orange]
ref|XP_009384940.1|  PREDICTED: heptahelical transmembrane protei...    112   9e-26    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011078413.1|  PREDICTED: heptahelical transmembrane protein 1    112   1e-25    Sesamum indicum [beniseed]
ref|XP_002324517.2|  hypothetical protein POPTR_0018s11140g             112   1e-25    Populus trichocarpa [western balsam poplar]
ref|XP_009341240.1|  PREDICTED: heptahelical transmembrane protei...    112   1e-25    Pyrus x bretschneideri [bai li]
ref|XP_009415463.1|  PREDICTED: heptahelical transmembrane protei...    111   2e-25    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009341238.1|  PREDICTED: heptahelical transmembrane protei...    111   2e-25    Pyrus x bretschneideri [bai li]
ref|XP_010525797.1|  PREDICTED: heptahelical transmembrane protei...    111   2e-25    Tarenaya hassleriana [spider flower]
ref|XP_007138283.1|  hypothetical protein PHAVU_009G195500g             110   3e-25    Phaseolus vulgaris [French bean]
ref|XP_010447656.1|  PREDICTED: heptahelical transmembrane protei...    110   3e-25    Camelina sativa [gold-of-pleasure]
ref|XP_010417162.1|  PREDICTED: heptahelical transmembrane protei...    110   6e-25    Camelina sativa [gold-of-pleasure]
gb|KJB64684.1|  hypothetical protein B456_010G060500                    108   6e-25    Gossypium raimondii
ref|XP_009416079.1|  PREDICTED: heptahelical transmembrane protei...    110   7e-25    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010438121.1|  PREDICTED: heptahelical transmembrane protei...    110   7e-25    Camelina sativa [gold-of-pleasure]
ref|XP_004508450.1|  PREDICTED: ADIPOR-like receptor CG5315-like        109   7e-25    Cicer arietinum [garbanzo]
ref|NP_001241762.1|  uncharacterized protein LOC100856947               109   8e-25    Zea mays [maize]
gb|KJB64685.1|  hypothetical protein B456_010G060500                    108   9e-25    Gossypium raimondii
gb|EYU34322.1|  hypothetical protein MIMGU_mgv1a009102mg                109   1e-24    Erythranthe guttata [common monkey flower]
ref|XP_010432936.1|  PREDICTED: heptahelical transmembrane protein 2    109   1e-24    Camelina sativa [gold-of-pleasure]
ref|XP_007222265.1|  hypothetical protein PRUPE_ppa007940mg             108   1e-24    Prunus persica
ref|XP_007013901.1|  Heptahelical transmembrane protein2                108   2e-24    Theobroma cacao [chocolate]
ref|XP_010417163.1|  PREDICTED: heptahelical transmembrane protei...    108   2e-24    Camelina sativa [gold-of-pleasure]
ref|XP_007155063.1|  hypothetical protein PHAVU_003G170000g             108   2e-24    
ref|NP_194814.2|  heptahelical transmembrane protein2                   108   2e-24    
ref|NP_001130249.1|  uncharacterized protein LOC100191343               108   3e-24    
gb|AAK17138.1|AF325070_1  hypothetical protein                          108   3e-24    
emb|CDP02857.1|  unnamed protein product                                108   3e-24    
gb|AAL67024.1|  unknown protein                                         108   3e-24    
ref|NP_565564.1|  heptahelical protein 3                                107   3e-24    
ref|XP_011396555.1|  ADIPOR-like receptor                               108   3e-24    
gb|KFK32681.1|  hypothetical protein AALP_AA6G275100                    107   4e-24    
ref|XP_009137975.1|  PREDICTED: adiponectin receptor protein-like...    107   5e-24    
ref|XP_009416097.1|  PREDICTED: heptahelical transmembrane protei...    107   5e-24    
ref|XP_008795847.1|  PREDICTED: ADIPOR-like receptor SPBC12C2.09c       107   6e-24    
ref|XP_008223597.1|  PREDICTED: adiponectin receptor protein 1-li...    107   6e-24    
ref|XP_009137973.1|  PREDICTED: adiponectin receptor protein-like...    107   7e-24    
ref|NP_001242577.1|  uncharacterized protein LOC100809900               106   8e-24    
ref|XP_010429371.1|  PREDICTED: heptahelical transmembrane protei...    106   8e-24    
emb|CDY13392.1|  BnaA03g51100D                                          106   9e-24    
ref|XP_008223599.1|  PREDICTED: adiponectin receptor protein 1-li...    106   1e-23    
ref|XP_003524037.1|  PREDICTED: adiponectin receptor protein 1-like     106   1e-23    
gb|KFK29668.1|  hypothetical protein AALP_AA7G163200                    106   1e-23    
ref|XP_010472417.1|  PREDICTED: heptahelical transmembrane protei...    105   2e-23    
gb|KFK32682.1|  hypothetical protein AALP_AA6G275100                    105   2e-23    
ref|XP_010687652.1|  PREDICTED: heptahelical transmembrane protein 2    106   2e-23    
ref|XP_004146666.1|  PREDICTED: progestin and adipoq receptor-lik...    105   2e-23    
ref|XP_003549736.1|  PREDICTED: ADIPOR-like receptor CG5315-like        105   2e-23    
ref|XP_006412661.1|  hypothetical protein EUTSA_v10025325mg             106   2e-23    
ref|XP_004296423.1|  PREDICTED: heptahelical transmembrane protei...    105   2e-23    
ref|XP_006285586.1|  hypothetical protein CARUB_v10007031mg             106   3e-23    
ref|XP_011462313.1|  PREDICTED: heptahelical transmembrane protei...    105   3e-23    
ref|XP_006575321.1|  PREDICTED: progestin and adipoQ receptor-lik...    104   3e-23    
ref|XP_002963772.1|  hypothetical protein SELMODRAFT_79950              105   3e-23    
emb|CDY34793.1|  BnaA09g41600D                                          105   3e-23    
ref|XP_011079361.1|  PREDICTED: heptahelical transmembrane protei...    105   3e-23    
ref|XP_002867326.1|  hypothetical protein ARALYDRAFT_491666             105   3e-23    
ref|XP_009616847.1|  PREDICTED: heptahelical transmembrane protei...    105   4e-23    
ref|XP_006381107.1|  hypothetical protein POPTR_0006s06320g             104   4e-23    
gb|KCW66230.1|  hypothetical protein EUGRSUZ_F00059                     103   4e-23    
ref|XP_006600519.1|  PREDICTED: ADIPOR-like receptor SPBC12C2.09c...    104   4e-23    
ref|XP_006400594.1|  hypothetical protein EUTSA_v10014079mg             104   4e-23    
ref|XP_010429372.1|  PREDICTED: heptahelical transmembrane protei...    104   4e-23    
gb|KHN47104.1|  ADIPOR-like receptor CG5315-like protein                104   4e-23    
ref|XP_002880550.1|  hypothetical protein ARALYDRAFT_481271             104   5e-23    
ref|XP_003519166.1|  PREDICTED: progestin and adipoQ receptor-lik...    104   5e-23    
ref|XP_006287899.1|  hypothetical protein CARUB_v10001133mg             104   6e-23    
ref|XP_006404918.1|  hypothetical protein EUTSA_v10000219mg             104   6e-23    
emb|CDX88844.1|  BnaA03g08050D                                          103   6e-23    
emb|CDX68699.1|  BnaC01g07540D                                          104   7e-23    
ref|XP_010493136.1|  PREDICTED: heptahelical transmembrane protein 1    103   7e-23    
gb|AFW76206.1|  hypothetical protein ZEAMMB73_611924                    102   8e-23    
ref|XP_010059789.1|  PREDICTED: heptahelical transmembrane protei...    102   8e-23    
gb|KCW82924.1|  hypothetical protein EUGRSUZ_C04293                     103   9e-23    
ref|XP_003542648.1|  PREDICTED: ADIPOR-like receptor CG5315-like        103   9e-23    
gb|KCW66232.1|  hypothetical protein EUGRSUZ_F00063                     102   9e-23    
ref|XP_009117243.1|  PREDICTED: ADIPOR-like receptor SPBC12C2.09c       103   1e-22    
ref|XP_006293499.1|  hypothetical protein CARUB_v10023564mg             103   1e-22    
ref|XP_009791415.1|  PREDICTED: heptahelical transmembrane protei...    103   1e-22    
emb|CDX76831.1|  BnaC08g34170D                                          103   1e-22    
gb|KHN17520.1|  Adiponectin receptor protein 1                          103   1e-22    
ref|XP_009791414.1|  PREDICTED: heptahelical transmembrane protei...    103   1e-22    
emb|CAN76362.1|  hypothetical protein VITISV_035439                     102   1e-22    
ref|NP_001143779.1|  hypothetical protein                               103   1e-22    
ref|XP_009771658.1|  PREDICTED: heptahelical transmembrane protei...    103   1e-22    
ref|XP_006389444.1|  hypothetical protein POPTR_0025s00750g             105   1e-22    
ref|XP_008443826.1|  PREDICTED: adiponectin receptor protein 1          103   2e-22    
emb|CDX83206.1|  BnaA03g23000D                                          103   2e-22    
ref|NP_197527.1|  heptahelical transmembrane protein1                   102   2e-22    
dbj|BAJ89826.1|  predicted protein                                      102   2e-22    
gb|KHN02053.1|  Adiponectin receptor protein 2                          102   2e-22    
ref|XP_009133985.1|  PREDICTED: adiponectin receptor protein-like       102   2e-22    
ref|XP_010454333.1|  PREDICTED: heptahelical transmembrane protei...    102   2e-22    
ref|XP_003549528.1|  PREDICTED: ADIPOR-like receptor SPBC12C2.09c...    102   2e-22    
ref|XP_009616846.1|  PREDICTED: heptahelical transmembrane protei...    102   2e-22    
ref|XP_010420868.1|  PREDICTED: heptahelical transmembrane protei...    102   3e-22    
ref|XP_002505656.1|  haemolysin-iii related expressed protein           104   3e-22    
ref|XP_009627936.1|  PREDICTED: heptahelical transmembrane protei...    102   3e-22    
emb|CDY28222.1|  BnaA01g06270D                                          102   4e-22    
emb|CDY21485.1|  BnaC03g27120D                                          102   4e-22    
ref|XP_009127453.1|  PREDICTED: adiponectin receptor protein 1-like     102   5e-22    
ref|XP_006343593.1|  PREDICTED: ADIPOR-like receptor CG5315-like        101   7e-22    
ref|XP_002873987.1|  hypothetical protein ARALYDRAFT_326421             103   8e-22    
emb|CDX72274.1|  BnaC07g42960D                                          100   9e-22    
ref|XP_009120821.1|  PREDICTED: adiponectin receptor protein 1-like     100   1e-21    
ref|XP_009126435.1|  PREDICTED: adiponectin receptor protein 1-like     100   1e-21    
ref|XP_010535854.1|  PREDICTED: heptahelical transmembrane protein 1    100   1e-21    
ref|XP_011069577.1|  PREDICTED: heptahelical transmembrane protei...    100   1e-21    
emb|CDX92475.1|  BnaA10g15140D                                          100   1e-21    
ref|NP_001058180.2|  Os06g0643700                                       100   2e-21    
dbj|BAD37371.1|  putative adiponectin receptor 1                        100   2e-21    
gb|EAZ37796.1|  hypothetical protein OsJ_22132                          100   2e-21    
ref|XP_009131788.1|  PREDICTED: adiponectin receptor protein 1-like   99.8    2e-21    
emb|CDY35816.1|  BnaC09g37480D                                        99.8    3e-21    
ref|XP_007154854.1|  hypothetical protein PHAVU_003G153200g           99.4    3e-21    
gb|KCW66227.1|  hypothetical protein EUGRSUZ_F00055                   98.6    3e-21    
ref|XP_010913330.1|  PREDICTED: heptahelical transmembrane protei...  99.4    4e-21    
gb|KFK26238.1|  hypothetical protein AALP_AA8G221100                  99.0    4e-21    
emb|CDY45097.1|  BnaA02g04790D                                        99.0    4e-21    
ref|XP_005647676.1|  HlyIII-domain-containing protein                 98.2    1e-20    
ref|XP_010064148.1|  PREDICTED: heptahelical transmembrane protei...  97.1    1e-20    
gb|EMT28280.1|  ADIPOR-like receptor                                  95.1    2e-20    
ref|XP_009418091.1|  PREDICTED: heptahelical transmembrane protei...  97.4    2e-20    
ref|XP_010909797.1|  PREDICTED: heptahelical transmembrane protei...  97.4    2e-20    
ref|XP_004242626.1|  PREDICTED: heptahelical transmembrane protei...  96.7    3e-20    
ref|XP_003081430.1|  Predicted membrane proteins, contain hemolys...  97.4    4e-20    
emb|CEF99238.1|  Hly-III-related                                      97.1    6e-20    
ref|XP_010110860.1|  ADIPOR-like receptor                             95.1    2e-19    
ref|XP_004150654.1|  PREDICTED: ADIPOR-like receptor CG5315-like      94.0    2e-19    
ref|XP_004031106.1|  hypothetical protein IMG5_147130                 94.4    2e-19    
ref|XP_010051733.1|  PREDICTED: heptahelical transmembrane protei...  90.9    8e-19    
ref|XP_008791343.1|  PREDICTED: adiponectin receptor protein 1-like   92.0    1e-18    
ref|XP_005846716.1|  hypothetical protein CHLNCDRAFT_35894            91.7    1e-18    
ref|XP_001451023.1|  hypothetical protein                             92.8    1e-18    
ref|XP_003571019.2|  PREDICTED: heptahelical transmembrane protei...  89.7    6e-18    
ref|XP_004514144.1|  PREDICTED: adiponectin receptor protein 1-li...  89.4    9e-18    
ref|XP_003059974.1|  predicted protein                                89.0    1e-17    
gb|KIY92811.1|  Adiponectin receptor protein 2                        87.4    3e-17    
ref|XP_010095010.1|  ADIPOR-like receptor                             87.4    5e-17    
ref|XP_001445779.1|  hypothetical protein                             88.2    5e-17    
dbj|BAJ94019.1|  predicted protein                                    87.0    7e-17    
gb|KCW44875.1|  hypothetical protein EUGRSUZ_L015502                  84.7    2e-16    
ref|XP_002528385.1|  conserved hypothetical protein                   84.3    3e-16    
ref|XP_002451658.1|  hypothetical protein SORBIDRAFT_04g005400        84.0    4e-16    
gb|KDD76029.1|  hemolysin-III-like protein                            84.7    4e-16    
dbj|BAJ91131.1|  predicted protein                                    84.3    6e-16    
gb|EMT02547.1|  hypothetical protein F775_52083                       83.6    6e-16    
ref|NP_001046084.1|  Os02g0179500                                     83.2    7e-16    
gb|EAY84726.1|  hypothetical protein OsI_06094                        83.2    2e-15    
ref|XP_004951694.1|  PREDICTED: ADIPOR-like receptor CG5315-like      82.8    2e-15    
gb|EAZ21965.1|  hypothetical protein OsJ_05618                        83.2    2e-15    
ref|XP_002309369.2|  hypothetical protein POPTR_0006s19370g           79.0    7e-15    
gb|EJY77662.1|  hypothetical protein OXYTRI_00705                     82.0    1e-14    
gb|EEC81095.1|  hypothetical protein OsI_23936                        80.5    2e-14    
gb|EEE66136.1|  hypothetical protein OsJ_22189                        80.5    2e-14    
ref|XP_004965705.1|  PREDICTED: ADIPOR-like receptor CG5315-like      80.5    2e-14    
gb|KHN08737.1|  ADIPOR-like receptor CG5315-like protein              79.0    3e-14    
gb|KCW66233.1|  hypothetical protein EUGRSUZ_F00065                   78.2    3e-14    
gb|AFW87568.1|  hypothetical protein ZEAMMB73_083625                  78.2    3e-14    
ref|XP_002438769.1|  hypothetical protein SORBIDRAFT_10g025870        79.7    4e-14    
ref|XP_004161874.1|  PREDICTED: ADIPOR-like receptor CG5315-like      78.2    4e-14    
gb|ACG40084.1|  hemolysin-III related family protein                  78.6    9e-14    
ref|NP_001130583.1|  hemolysin-III family protein                     78.2    1e-13    
ref|XP_001422539.1|  predicted protein                                76.3    2e-13    
emb|CCA17357.1|  adiponectin receptor protein putative                77.8    3e-13    
ref|XP_011069387.1|  PREDICTED: heptahelical transmembrane protei...  75.5    4e-13    
emb|CEG02073.1|  Hly-III-related                                      76.6    7e-13    
emb|CBK22630.2|  unnamed protein product                              75.1    2e-12    
ref|XP_008872882.1|  hypothetical protein H310_08788                  75.1    3e-12    
ref|XP_010240019.1|  PREDICTED: heptahelical transmembrane protei...  73.9    3e-12    
emb|CCI44241.1|  unnamed protein product                              74.7    4e-12    
emb|CCI44242.1|  unnamed protein product                              74.3    4e-12    
ref|XP_001031752.1|  hemolysin-III related protein                    73.6    7e-12    
ref|XP_005818873.1|  hypothetical protein GUITHDRAFT_121917           73.6    9e-12    
gb|KDO26210.1|  hypothetical protein SPRG_08572                       72.4    2e-11    
ref|XP_009832308.1|  hypothetical protein H257_08197                  72.4    2e-11    
gb|AFW66286.1|  hypothetical protein ZEAMMB73_196595                  69.3    2e-11    
ref|XP_001457089.1|  hypothetical protein                             71.6    3e-11    
gb|KIO28039.1|  hypothetical protein M407DRAFT_243189                 71.2    3e-11    
ref|XP_002998729.1|  adiponectin receptor protein, putative           71.6    3e-11    
gb|ETP52499.1|  hypothetical protein F442_02483                       71.6    4e-11    
gb|ETI54710.1|  hypothetical protein F443_02512                       71.6    4e-11    
ref|XP_008899939.1|  hypothetical protein PPTG_22084                  71.2    6e-11    
ref|XP_009535093.1|  hypothetical protein PHYSODRAFT_347864           70.9    6e-11    
ref|XP_011017848.1|  PREDICTED: heptahelical transmembrane protei...  66.6    1e-10    
ref|XP_010108038.1|  ADIPOR-like receptor                             66.6    1e-10    
emb|CDW90553.1|  adiponectin receptor protein                         69.7    2e-10    
ref|XP_007509869.1|  predicted protein                                69.7    2e-10    
gb|EJY78426.1|  Adiponectin receptor protein putative                 69.7    2e-10    
ref|XP_008615735.1|  hypothetical protein SDRG_11470                  68.9    2e-10    
gb|KDO35225.1|  hypothetical protein SPRG_00071                       68.9    2e-10    
emb|CCA68854.1|  related to PHO36 (regulatory role in lipid and p...  67.8    3e-10    
ref|XP_008610302.1|  hypothetical protein SDRG_06307                  68.9    3e-10    
ref|NP_001058233.2|  Os06g0652200                                     66.2    3e-10    
emb|CEG81134.1|  hypothetical protein RMATCC62417_15367               67.0    3e-10    
gb|KEH16923.1|  hemolysin-III-like protein                            65.9    4e-10    
gb|KII84284.1|  hypothetical protein PLICRDRAFT_62186                 67.0    4e-10    
emb|CEI87851.1|  hypothetical protein RMCBS344292_02259               67.0    5e-10    
gb|KDQ31897.1|  hypothetical protein PLEOSDRAFT_1035068               67.0    5e-10    
gb|KIM28893.1|  hypothetical protein M408DRAFT_329314                 67.0    6e-10    
gb|EJY67098.1|  hypothetical protein OXYTRI_12607                     68.2    6e-10    
gb|EGN92896.1|  hypothetical protein SERLA73DRAFT_65012               66.6    9e-10    
emb|CEG81133.1|  hypothetical protein RMATCC62417_15367               66.2    1e-09    
gb|EJY67135.1|  hypothetical protein OXYTRI_12570                     67.4    1e-09    
emb|CEG67829.1|  hypothetical protein RMATCC62417_04194               66.2    1e-09    
ref|XP_004037025.1|  hypothetical protein IMG5_063250                 66.6    2e-09    
gb|KDQ58613.1|  hypothetical protein JAAARDRAFT_206498                64.7    3e-09    
ref|XP_001628113.1|  predicted protein                                64.7    4e-09    
emb|CEG81135.1|  hypothetical protein RMATCC62417_15367               63.5    4e-09    
dbj|GAN11053.1|  hemolysin III family channel protein                 64.3    5e-09    
gb|EXX75794.1|  Izh1p                                                 63.5    6e-09    
gb|KIM86736.1|  hypothetical protein PILCRDRAFT_64786                 63.9    7e-09    
gb|KIW99347.1|  hypothetical protein Z518_11335                       63.5    8e-09    
gb|EPB81248.1|  hypothetical protein HMPREF1544_12036                 63.9    8e-09    
ref|XP_002129916.1|  PREDICTED: adiponectin receptor protein 1-like   63.9    9e-09    
gb|EXX75795.1|  Izh1p                                                 63.2    9e-09    
ref|XP_004346843.1|  adiponectin receptor 1b                          63.9    1e-08    
ref|XP_005955663.1|  PREDICTED: adiponectin receptor protein 2        63.9    1e-08    
emb|CBY12885.1|  unnamed protein product                              63.5    1e-08    
gb|KIW28992.1|  hypothetical protein, variant                         62.8    1e-08    
emb|CBY37384.1|  unnamed protein product                              63.5    1e-08    
ref|XP_007658872.1|  PREDICTED: LOW QUALITY PROTEIN: adiponectin ...  63.5    1e-08    
ref|XP_004438842.1|  PREDICTED: adiponectin receptor protein 2        63.5    1e-08    
ref|XP_005895252.1|  PREDICTED: adiponectin receptor protein 2        63.5    1e-08    
ref|XP_005610869.1|  PREDICTED: adiponectin receptor protein 2 is...  63.5    1e-08    
ref|NP_001035589.1|  adiponectin receptor protein 2                   63.5    1e-08    
ref|XP_009001651.1|  PREDICTED: LOW QUALITY PROTEIN: adiponectin ...  63.5    1e-08    
ref|XP_010843348.1|  PREDICTED: adiponectin receptor protein 2        63.5    1e-08    
ref|XP_003934532.1|  PREDICTED: adiponectin receptor protein 2        63.5    1e-08    
ref|NP_001157302.1|  adiponectin receptor protein 2                   63.5    1e-08    
ref|XP_007414648.1|  hypothetical protein MELLADRAFT_38743            62.8    1e-08    
ref|XP_006069975.1|  PREDICTED: adiponectin receptor protein 2        63.2    2e-08    
gb|ESA15102.1|  hypothetical protein GLOINDRAFT_166759                63.2    2e-08    
ref|XP_003771387.1|  PREDICTED: adiponectin receptor protein 2        63.2    2e-08    
ref|XP_005681099.1|  PREDICTED: adiponectin receptor protein 2        63.2    2e-08    
ref|XP_007313968.1|  hypothetical protein SERLADRAFT_359619           62.8    2e-08    
ref|XP_004007653.1|  PREDICTED: adiponectin receptor protein 2        63.2    2e-08    
ref|XP_008533362.1|  PREDICTED: adiponectin receptor protein 2 is...  62.8    2e-08    
gb|AHK05782.1|  adiponectin receptor 2                                63.2    2e-08    
ref|XP_007101211.1|  PREDICTED: adiponectin receptor protein 2 is...  62.8    2e-08    
ref|XP_001373467.1|  PREDICTED: adiponectin receptor protein 2 is...  62.8    2e-08    
ref|XP_007178704.1|  PREDICTED: adiponectin receptor protein 2        62.8    2e-08    
ref|XP_007869412.1|  HlyIII-domain-containing protein                 62.4    2e-08    
ref|XP_006742382.1|  PREDICTED: adiponectin receptor protein 2        62.4    2e-08    



>ref|XP_011099397.1| PREDICTED: heptahelical transmembrane protein 4-like [Sesamum 
indicum]
 ref|XP_011099398.1| PREDICTED: heptahelical transmembrane protein 4-like [Sesamum 
indicum]
Length=413

 Score =   361 bits (926),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 175/221 (79%), Positives = 190/221 (86%), Gaps = 13/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQALLSVFTIHNETLN+WTHL+GFFLFL+LTIYTAM +P+VVDFP LQN PDVLRKADL
Sbjct  69   LKQALLSVFTIHNETLNIWTHLIGFFLFLALTIYTAMMVPNVVDFPRLQNFPDVLRKADL  128

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPS------LSNWHIVQLLTNCLPECFSNS  322
                     CLPSL H+PD+H+LREELK +FPS      LSNWHIV+L +NCLPE  S+S
Sbjct  129  QKLHMELITCLPSLPHMPDMHKLREELKNSFPSMDLLPSLSNWHIVELFSNCLPESISHS  188

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            NHT+ CVL SMKEDL NIIAPL  RPITRWPFFAFLGGAMFCLLASS CHLLSCHSER+S
Sbjct  189  NHTDTCVLHSMKEDLANIIAPLLVRPITRWPFFAFLGGAMFCLLASSACHLLSCHSERVS  248

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALISTSFYPPVYYSFMCYP FC LY+GFI
Sbjct  249  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPVFCGLYMGFI  289



>ref|XP_009624872.1| PREDICTED: heptahelical transmembrane protein 4-like isoform 
X1 [Nicotiana tomentosiformis]
Length=400

 Score =   352 bits (902),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 175/215 (81%), Positives = 189/215 (88%), Gaps = 10/215 (5%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQALLS+FTIHNETLNVWTHL+GFFLFL+LTIYTA+K+P VVD  +LQNLPDVLRKADL
Sbjct  65   LKQALLSIFTIHNETLNVWTHLIGFFLFLALTIYTAIKVPKVVDLHSLQNLPDVLRKADL  124

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H        CLPSL H+PDLHRLR+ L     S S+WHI+ LLTNCLPE FS SNHT+VC
Sbjct  125  HKLQSELLTCLPSLPHMPDLHRLRDGL---LLSPSSWHILDLLTNCLPERFSLSNHTDVC  181

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
            VL S+KED+ NIIAPL  RPITRWPF+AFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL
Sbjct  182  VLRSVKEDVANIIAPLLVRPITRWPFYAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  241

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI
Sbjct  242  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  276



>ref|XP_006363814.1| PREDICTED: ADIPOR-like receptor IZH1-like [Solanum tuberosum]
Length=397

 Score =   350 bits (898),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 172/215 (80%), Positives = 188/215 (87%), Gaps = 10/215 (5%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQALLS+FTIHNETLNVWTHL+GFFLFL+LTIYTA K+P VVD  +LQNLPDVLRKADL
Sbjct  62   LKQALLSIFTIHNETLNVWTHLIGFFLFLALTIYTATKVPKVVDLHSLQNLPDVLRKADL  121

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H        CLPSL H+PDLH+LR+ L     S SNWHI+ LL NCLPE FS+SNHT+VC
Sbjct  122  HKLQAELLTCLPSLPHMPDLHKLRDGL---LRSPSNWHIIDLLNNCLPERFSHSNHTDVC  178

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
            VL S+KED+ NI+APL  RPITRWPF+AFLGGAMFCLLASSTCHLLSCHS+RLSYIMLRL
Sbjct  179  VLRSVKEDVANILAPLLVRPITRWPFYAFLGGAMFCLLASSTCHLLSCHSKRLSYIMLRL  238

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI
Sbjct  239  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  273



>ref|XP_004231936.1| PREDICTED: heptahelical transmembrane protein 4-like [Solanum 
lycopersicum]
Length=400

 Score =   349 bits (895),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 172/215 (80%), Positives = 188/215 (87%), Gaps = 10/215 (5%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQALLS+FTIHNETLNVWTHL+GFFLFL+LTIYTA K+P VVD  +LQNLPDVLRKADL
Sbjct  65   LKQALLSIFTIHNETLNVWTHLIGFFLFLALTIYTATKVPKVVDLHSLQNLPDVLRKADL  124

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H        CLPSL ++PDLH+LR+ L     S SNWHI+ LL NCLPE FS+SNHT+VC
Sbjct  125  HKLQAELLTCLPSLPYMPDLHKLRDGL---LRSPSNWHIIDLLHNCLPERFSHSNHTDVC  181

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
            VL S+KED+ NI+APL  RPITRWPF+AFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL
Sbjct  182  VLRSVKEDVANILAPLLVRPITRWPFYAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  241

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI
Sbjct  242  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  276



>ref|XP_008440411.1| PREDICTED: adiponectin receptor protein 2-like isoform X1 [Cucumis 
melo]
 ref|XP_008440412.1| PREDICTED: adiponectin receptor protein 2-like isoform X1 [Cucumis 
melo]
 ref|XP_008440413.1| PREDICTED: adiponectin receptor protein 2-like isoform X1 [Cucumis 
melo]
 ref|XP_008440414.1| PREDICTED: adiponectin receptor protein 2-like isoform X1 [Cucumis 
melo]
Length=414

 Score =   348 bits (893),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 170/221 (77%), Positives = 188/221 (85%), Gaps = 13/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +KQ LLS+F+IHNETLNVWTHL+GFFLFLSLTIYTA KIPDVVD   LQ+LPDVL+KADL
Sbjct  70   MKQTLLSIFSIHNETLNVWTHLIGFFLFLSLTIYTATKIPDVVDIHPLQHLPDVLKKADL  129

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSL------SNWHIVQLLTNCLPECFSNS  322
            H        CLPSL H PDL +LREELKTA PSL      S WH+V+LL NCLP+ FS+ 
Sbjct  130  HKLQEELLTCLPSLPHFPDLQKLREELKTALPSLDMLSSLSRWHVVELLYNCLPQRFSHG  189

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            N T+ CVL SMKE++ N+IAPL  RPITRWPFFAFLGGAMFCLLASSTCHLLSCHSER+S
Sbjct  190  NQTDDCVLRSMKEEVANMIAPLAMRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERVS  249

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFC+LY+GFI
Sbjct  250  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCSLYMGFI  290



>ref|XP_004141855.1| PREDICTED: adiponectin receptor protein 2-like isoform 1 [Cucumis 
sativus]
 ref|XP_004141856.1| PREDICTED: adiponectin receptor protein 2-like isoform 2 [Cucumis 
sativus]
 gb|KGN48622.1| hypothetical protein Csa_6G495760 [Cucumis sativus]
Length=414

 Score =   347 bits (890),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 170/221 (77%), Positives = 186/221 (84%), Gaps = 13/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +KQ LLS+F+IHNETLNVWTHL+GFFLFLSLTIYTA KIPDVVD   LQ+LPD LRKADL
Sbjct  70   MKQTLLSIFSIHNETLNVWTHLIGFFLFLSLTIYTATKIPDVVDIHPLQHLPDALRKADL  129

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPS------LSNWHIVQLLTNCLPECFSNS  322
            H        CLPSL H PDL +LREELK A PS      LS WH+V+LL NCLPE FS+ 
Sbjct  130  HKLQEELLTCLPSLPHFPDLQKLREELKIAMPSMDMLSSLSRWHVVELLYNCLPERFSHG  189

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            N T+ CVL SMKE++ N+IAPL  RPITRWPFFAFLGGAMFCLLASSTCHLLSCHSER+S
Sbjct  190  NQTDDCVLRSMKEEVANMIAPLAMRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERVS  249

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFC+LY+GFI
Sbjct  250  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCSLYMGFI  290



>ref|XP_004167676.1| PREDICTED: adiponectin receptor protein 2-like isoform 1 [Cucumis 
sativus]
 ref|XP_004167677.1| PREDICTED: adiponectin receptor protein 2-like isoform 2 [Cucumis 
sativus]
Length=414

 Score =   347 bits (890),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 170/221 (77%), Positives = 186/221 (84%), Gaps = 13/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +KQ LLS+F+IHNETLNVWTHL+GFFLFLSLTIYTA KIPDVVD   LQ+LPD LRKADL
Sbjct  70   MKQTLLSIFSIHNETLNVWTHLIGFFLFLSLTIYTATKIPDVVDIHPLQHLPDALRKADL  129

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPS------LSNWHIVQLLTNCLPECFSNS  322
            H        CLPSL H PDL +LREELK A PS      LS WH+V+LL NCLPE FS+ 
Sbjct  130  HKLQEELLTCLPSLPHFPDLQKLREELKIAMPSMDMLSSLSRWHVVELLYNCLPERFSHG  189

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            N T+ CVL SMKE++ N+IAPL  RPITRWPFFAFLGGAMFCLLASSTCHLLSCHSER+S
Sbjct  190  NQTDNCVLRSMKEEVANMIAPLAMRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERVS  249

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFC+LY+GFI
Sbjct  250  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCSLYMGFI  290



>ref|XP_007047565.1| Heptahelical protein 4 isoform 2 [Theobroma cacao]
 ref|XP_007047566.1| Heptahelical protein 4 isoform 2 [Theobroma cacao]
 ref|XP_007047567.1| Heptahelical protein 4 isoform 2 [Theobroma cacao]
 ref|XP_007047568.1| Heptahelical protein 4 isoform 2 [Theobroma cacao]
 gb|EOX91722.1| Heptahelical protein 4 isoform 2 [Theobroma cacao]
 gb|EOX91723.1| Heptahelical protein 4 isoform 2 [Theobroma cacao]
 gb|EOX91724.1| Heptahelical protein 4 isoform 2 [Theobroma cacao]
 gb|EOX91725.1| Heptahelical protein 4 isoform 2 [Theobroma cacao]
Length=412

 Score =   345 bits (884),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 190/221 (86%), Gaps = 13/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +KQ LLS+F IHNETLNVWTHL+GFF+FLSLTIYTA K+P VVD  +LQ++PDVLRKADL
Sbjct  68   MKQVLLSIFKIHNETLNVWTHLIGFFIFLSLTIYTATKVPKVVDLHSLQHIPDVLRKADL  127

Query  182  HA-------CLPSLLHIPDLHRLREELKTA------FPSLSNWHIVQLLTNCLPECFSNS  322
            H        CLPSL ++P+LH+LR+ELKT+      FPSLS WH+++LL NCLPECFS+ 
Sbjct  128  HKLQSELITCLPSLPNMPNLHKLRQELKTSLPSMDLFPSLSGWHVLELLYNCLPECFSSG  187

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            NHT+VCVL S+KED+ NIIAPL  RPITRWPFFAFL GAMFCLLASSTCHLLSCHS+RLS
Sbjct  188  NHTDVCVLQSVKEDVANIIAPLMGRPITRWPFFAFLVGAMFCLLASSTCHLLSCHSKRLS  247

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDY GIAALISTSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  248  YIMLRLDYTGIAALISTSFYPPVYYSFMCDPFFCNLYLGFI  288



>emb|CDP02615.1| unnamed protein product [Coffea canephora]
Length=414

 Score =   344 bits (883),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 170/221 (77%), Positives = 187/221 (85%), Gaps = 13/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK  LLS+FTIHNETLNVWTHL+GFFLFLSLTIYTAMK+P VV+ PTLQ+LPDVL+KADL
Sbjct  70   LKHILLSIFTIHNETLNVWTHLIGFFLFLSLTIYTAMKVPSVVELPTLQHLPDVLKKADL  129

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLS------NWHIVQLLTNCLPECFSNS  322
                     CLPSL H+PDL + R+ELKT+  S+        WHIV+LLTNCLPE F +S
Sbjct  130  QKLQEEFLTCLPSLPHMPDLQKFRDELKTSLLSMDLLSSPSTWHIVELLTNCLPERFLHS  189

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            NHT+ CVL  MKED+ N+IAPL  RPITRWPFFAF+GGAMFCLLASSTCHLLSCHSERLS
Sbjct  190  NHTDACVLRGMKEDVANMIAPLLVRPITRWPFFAFMGGAMFCLLASSTCHLLSCHSERLS  249

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI
Sbjct  250  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  290



>ref|XP_009758486.1| PREDICTED: heptahelical transmembrane protein 4-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009758487.1| PREDICTED: heptahelical transmembrane protein 4-like isoform 
X1 [Nicotiana sylvestris]
Length=400

 Score =   343 bits (880),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 171/215 (80%), Positives = 186/215 (87%), Gaps = 10/215 (5%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQALLS+F IHNETLNVWTHL+GFFLFL+LTIYTA+++P VVD  +LQNLPDVLRKADL
Sbjct  65   LKQALLSIFIIHNETLNVWTHLIGFFLFLALTIYTAIQVPKVVDLHSLQNLPDVLRKADL  124

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H        CLPSL H+PDLHRLR+ L     S S+WHI+ LLTNCLPE FS SNHT+VC
Sbjct  125  HKLQSEVLTCLPSLPHMPDLHRLRDGL---LLSPSSWHILDLLTNCLPERFSLSNHTDVC  181

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
            VL S+KED+ NIIAPL  RPITRWPF+AFLGGAMFCLLASSTCHLLSCHSE LSYIML L
Sbjct  182  VLQSVKEDVANIIAPLLVRPITRWPFYAFLGGAMFCLLASSTCHLLSCHSEHLSYIMLSL  241

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI
Sbjct  242  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  276



>ref|XP_010273060.1| PREDICTED: heptahelical transmembrane protein 4-like [Nelumbo 
nucifera]
Length=413

 Score =   343 bits (881),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 187/217 (86%), Gaps = 9/217 (4%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLS+F+IHNETLNVWTHL+GFFLFLSLTIYTAMK+P VVD  +L +LPDVLRKADL
Sbjct  73   LKQVLLSIFSIHNETLNVWTHLIGFFLFLSLTIYTAMKVPKVVDLQSLPHLPDVLRKADL  132

Query  182  H---ACLPSLLHIPDLHRLREELKTAFPS------LSNWHIVQLLTNCLPECFSNSNHTN  334
            H    CLPS+ ++PDL +LR+E KT+ PS      LS WHI +LL NCLPE FS+SNHT+
Sbjct  133  HELLTCLPSMPNMPDLQKLRDEFKTSLPSMDMLPSLSGWHIPELLANCLPERFSHSNHTD  192

Query  335  VCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIML  514
             CVL SMKED+VN+IAPL  RPITRWPFFAF+GGAMFCLLASSTCHLLSCHSERLSYIML
Sbjct  193  PCVLRSMKEDVVNMIAPLMVRPITRWPFFAFMGGAMFCLLASSTCHLLSCHSERLSYIML  252

Query  515  RLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            RLDY GIAALISTSFYP VYYSFMC PFFCNLYLGFI
Sbjct  253  RLDYTGIAALISTSFYPSVYYSFMCNPFFCNLYLGFI  289



>ref|XP_007047564.1| Heptahelical protein 4 isoform 1 [Theobroma cacao]
 gb|EOX91721.1| Heptahelical protein 4 isoform 1 [Theobroma cacao]
Length=497

 Score =   345 bits (886),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 190/221 (86%), Gaps = 13/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +KQ LLS+F IHNETLNVWTHL+GFF+FLSLTIYTA K+P VVD  +LQ++PDVLRKADL
Sbjct  153  MKQVLLSIFKIHNETLNVWTHLIGFFIFLSLTIYTATKVPKVVDLHSLQHIPDVLRKADL  212

Query  182  HA-------CLPSLLHIPDLHRLREELKTA------FPSLSNWHIVQLLTNCLPECFSNS  322
            H        CLPSL ++P+LH+LR+ELKT+      FPSLS WH+++LL NCLPECFS+ 
Sbjct  213  HKLQSELITCLPSLPNMPNLHKLRQELKTSLPSMDLFPSLSGWHVLELLYNCLPECFSSG  272

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            NHT+VCVL S+KED+ NIIAPL  RPITRWPFFAFL GAMFCLLASSTCHLLSCHS+RLS
Sbjct  273  NHTDVCVLQSVKEDVANIIAPLMGRPITRWPFFAFLVGAMFCLLASSTCHLLSCHSKRLS  332

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDY GIAALISTSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  333  YIMLRLDYTGIAALISTSFYPPVYYSFMCDPFFCNLYLGFI  373



>ref|XP_010106925.1| Adiponectin receptor protein 2 [Morus notabilis]
 gb|EXC12641.1| Adiponectin receptor protein 2 [Morus notabilis]
Length=402

 Score =   341 bits (874),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 166/218 (76%), Positives = 187/218 (86%), Gaps = 11/218 (5%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ  LS+F+IHNETLNVWTHL+GFFLFLSLTIYTAMK+P VVD   LQ++PD+L+KADL
Sbjct  62   LKQVFLSMFSIHNETLNVWTHLIGFFLFLSLTIYTAMKVPKVVDLHNLQHVPDMLKKADL  121

Query  182  HA---CLPSLLHIPDLHRLREELKTAFPSL-------SNWHIVQLLTNCLPECFSNSNHT  331
            H    CLPSL H+PDLHRL+E LKT FPS+       S WH+++LL NCLPE FS  N+T
Sbjct  122  HKLQECLPSLPHMPDLHRLKE-LKTTFPSMDLLPSLSSGWHVMELLYNCLPERFSYKNYT  180

Query  332  NVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIM  511
            ++CVL S+K+D  NIIAPL  RPITRWPFFAF+GGAMFCLLASSTCHLLSCHSERLSYIM
Sbjct  181  DICVLRSLKDDFANIIAPLMMRPITRWPFFAFMGGAMFCLLASSTCHLLSCHSERLSYIM  240

Query  512  LRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            LRLDYAGIAALISTSFYPPVYYSFMCYPF CNLY+GFI
Sbjct  241  LRLDYAGIAALISTSFYPPVYYSFMCYPFLCNLYMGFI  278



>ref|XP_007205266.1| hypothetical protein PRUPE_ppa006424mg [Prunus persica]
 gb|EMJ06465.1| hypothetical protein PRUPE_ppa006424mg [Prunus persica]
Length=412

 Score =   340 bits (872),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/221 (76%), Positives = 188/221 (85%), Gaps = 13/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLS+FTIHNETLNVWTHL+GFFLFLSLTIYTA+K+P+VVD   LQ+ PDVL+KADL
Sbjct  68   LKQVLLSMFTIHNETLNVWTHLIGFFLFLSLTIYTAIKLPEVVDLHALQHFPDVLKKADL  127

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPS------LSNWHIVQLLTNCLPECFSNS  322
            H        CLPSL ++PDL+RLR ELKT+ PS      LS WH+++LL NCLP+ FS+ 
Sbjct  128  HKLHEEFMTCLPSLPNMPDLNRLRGELKTSLPSMDLLPSLSGWHVMELLNNCLPQRFSHG  187

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            N T+VCVLSSMKEDL NI+APL  RPITRWPFFAFLGGAMFCLL+SS CHLLSCHSER+S
Sbjct  188  NQTDVCVLSSMKEDLANIVAPLMLRPITRWPFFAFLGGAMFCLLSSSACHLLSCHSERMS  247

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALISTSFYP VYYSFMC PFFCNLY+GFI
Sbjct  248  YIMLRLDYAGIAALISTSFYPLVYYSFMCNPFFCNLYMGFI  288



>ref|XP_008237729.1| PREDICTED: adiponectin receptor protein-like isoform X1 [Prunus 
mume]
Length=412

 Score =   340 bits (871),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/221 (76%), Positives = 188/221 (85%), Gaps = 13/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLS+FTIHNETLNVWTHL+GFFLFLSLTIYTA+K+P+VVD   LQ+ PDVL+KADL
Sbjct  68   LKQVLLSMFTIHNETLNVWTHLIGFFLFLSLTIYTAIKLPEVVDLHALQHFPDVLKKADL  127

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPS------LSNWHIVQLLTNCLPECFSNS  322
            H        CLPSL ++P L+RLREELKT+ PS      LS WH+++LL NCLP+ FS+ 
Sbjct  128  HKLHEEFMTCLPSLPNMPHLNRLREELKTSLPSMDLLPSLSGWHVMELLNNCLPQRFSHG  187

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            N T+VCVLSSMKEDL NI+APL  RPITRWPFFAFLGGAMFCLL+SS CHLLSCHSER+S
Sbjct  188  NQTDVCVLSSMKEDLANIVAPLMLRPITRWPFFAFLGGAMFCLLSSSACHLLSCHSERMS  247

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALISTSFYP VYYSFMC PFFCNLY+GFI
Sbjct  248  YIMLRLDYAGIAALISTSFYPLVYYSFMCNPFFCNLYMGFI  288



>gb|EPS69882.1| hypothetical protein M569_04878, partial [Genlisea aurea]
Length=386

 Score =   339 bits (869),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 184/215 (86%), Gaps = 13/215 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLS FTIHNETLNVWTHL+GFFLFL LTIYTAMKIP+VVD P+L   P VLRKAD 
Sbjct  54   LKQILLSAFTIHNETLNVWTHLIGFFLFLVLTIYTAMKIPNVVDLPSL---PHVLRKADF  110

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
                     CLPSL   PD+ R+R+ELKT+FPSLSNWH+V+LL+NCLP+  S +NHT+ C
Sbjct  111  QKLHTDLITCLPSL---PDMQRVRDELKTSFPSLSNWHVVELLSNCLPQSLSCANHTDTC  167

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
            VLSSMKED+ NIIAPL  +PITRWPFFAFLGGAMFCLL+SSTCHL SCHSERLSYIMLRL
Sbjct  168  VLSSMKEDVANIIAPLLVQPITRWPFFAFLGGAMFCLLSSSTCHLFSCHSERLSYIMLRL  227

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPPVYYSFMCYP FCNLY+GFI
Sbjct  228  DYAGIAALISTSFYPPVYYSFMCYPVFCNLYMGFI  262



>gb|KJB43938.1| hypothetical protein B456_007G224700 [Gossypium raimondii]
 gb|KJB43939.1| hypothetical protein B456_007G224700 [Gossypium raimondii]
Length=402

 Score =   339 bits (870),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 185/215 (86%), Gaps = 11/215 (5%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +KQ LLS+FTIHNETLNVWTHL+GFF+FL+LTIYTAMK+P VVDF +LQ++PDVLRKADL
Sbjct  68   MKQVLLSIFTIHNETLNVWTHLIGFFIFLALTIYTAMKVPKVVDFHSLQHIPDVLRKADL  127

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H        CLPSL ++P LH+LREEL      LS WH+ +LL NCLPE F + NHT+VC
Sbjct  128  HKLHSELLTCLPSLPNMPGLHKLREELLL----LSGWHVRELLYNCLPERFFSGNHTDVC  183

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
            VL S+KED+ NIIAPL  RPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL
Sbjct  184  VLQSVKEDVANIIAPLMVRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  243

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  244  DYAGIAALISTSFYPPVYYSFMCDPFFCNLYLGFI  278



>ref|XP_009758488.1| PREDICTED: heptahelical transmembrane protein 4-like isoform 
X2 [Nicotiana sylvestris]
Length=399

 Score =   338 bits (867),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 171/215 (80%), Positives = 186/215 (87%), Gaps = 11/215 (5%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQALLS+F IHNETLNVWTHL+GFFLFL+LTIYTA+++P VVD  +LQNLPDVLRKADL
Sbjct  65   LKQALLSIFIIHNETLNVWTHLIGFFLFLALTIYTAIQVPKVVDLHSLQNLPDVLRKADL  124

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H        CLPSL H+PDLHRLR+ L     S S+WHI+ LLTNCLPE FS SNHT+VC
Sbjct  125  HKLQSEVLTCLPSLPHMPDLHRLRDGL---LLSPSSWHILDLLTNCLPERFSLSNHTDVC  181

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
            VLS +KED+ NIIAPL  RPITRWPF+AFLGGAMFCLLASSTCHLLSCHSE LSYIML L
Sbjct  182  VLS-VKEDVANIIAPLLVRPITRWPFYAFLGGAMFCLLASSTCHLLSCHSEHLSYIMLSL  240

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI
Sbjct  241  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  275



>ref|XP_002525289.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37117.1| conserved hypothetical protein [Ricinus communis]
Length=399

 Score =   338 bits (867),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 167/211 (79%), Positives = 184/211 (87%), Gaps = 7/211 (3%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLS+F++HNETLNVWTHL+GFF+FLSLTIYTAMK+P VVD  ++Q LP+VL KADL
Sbjct  69   LKQTLLSIFSVHNETLNVWTHLIGFFIFLSLTIYTAMKVPKVVDLHSIQ-LPEVL-KADL  126

Query  182  HA---CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSS  352
            H    CLPSL  + D+HRLREELKT  PS   WHI++LL NCLPE FSN NHT+ CVL S
Sbjct  127  HKLHECLPSLPTMTDMHRLREELKTTLPS--GWHIMELLYNCLPERFSNGNHTDACVLRS  184

Query  353  MKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAG  532
            MKED+ N+IAPL  RPITRWPFFAFLGGAMFCLLASSTCHLLSCHSER+SYIMLRLDYAG
Sbjct  185  MKEDVANLIAPLMVRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERMSYIMLRLDYAG  244

Query  533  IAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            IAALISTSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  245  IAALISTSFYPPVYYSFMCNPFFCNLYLGFI  275



>ref|XP_008341411.1| PREDICTED: adiponectin receptor protein 2-like [Malus domestica]
Length=412

 Score =   337 bits (865),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/221 (74%), Positives = 186/221 (84%), Gaps = 13/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLS+FTIHNETLNVWTHL+GFFLFLSLTIYTA+K+P+VVD   LQ+ PDVL+KADL
Sbjct  68   LKQVLLSMFTIHNETLNVWTHLIGFFLFLSLTIYTAIKVPEVVDLHALQHFPDVLKKADL  127

Query  182  HA-------CLPSLLHIPDLHRLREELKTAF------PSLSNWHIVQLLTNCLPECFSNS  322
            H        CLPSL ++PDL+RLREELKT+       PSLS WH+++LL NCLP+ FS+ 
Sbjct  128  HKLSEEFMTCLPSLPNMPDLNRLREELKTSLTSMDLLPSLSGWHVMELLNNCLPQRFSHG  187

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            N T+VCVL SMKED+ NIIAPL  RPITRWPFFAFLGGAMFCLL SS CHLLSCHSER+S
Sbjct  188  NQTDVCVLRSMKEDVANIIAPLMIRPITRWPFFAFLGGAMFCLLTSSACHLLSCHSERMS  247

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLR+DYAGIAALISTSFYP VYY+FMC PFFC LY+GFI
Sbjct  248  YIMLRMDYAGIAALISTSFYPLVYYTFMCDPFFCALYMGFI  288



>ref|XP_009354632.1| PREDICTED: heptahelical transmembrane protein 4-like [Pyrus x 
bretschneideri]
Length=412

 Score =   337 bits (864),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/221 (74%), Positives = 186/221 (84%), Gaps = 13/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLS+FTIHNETLNVWTHL+GFFLFLSLTIYTA+K+P+VVD   LQ+ PDVL+KADL
Sbjct  68   LKQVLLSMFTIHNETLNVWTHLIGFFLFLSLTIYTAIKVPEVVDLHALQHFPDVLKKADL  127

Query  182  HA-------CLPSLLHIPDLHRLREELKTAF------PSLSNWHIVQLLTNCLPECFSNS  322
            H        CLPSL ++PDL+RLREELKT+       PSLS WH+++LL NCLP+ FS+ 
Sbjct  128  HKLSEEFMTCLPSLPNMPDLNRLREELKTSLTSMDLLPSLSGWHVMELLNNCLPQRFSHG  187

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            N T+VCVL SMKED+ NIIAPL  RPITRWPFFAFLGGAMFCLL SS CHLLSCHSER+S
Sbjct  188  NQTDVCVLRSMKEDVANIIAPLMIRPITRWPFFAFLGGAMFCLLTSSACHLLSCHSERMS  247

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLR+DYAGIAALISTSFYP VYY+FMC PFFC LY+GFI
Sbjct  248  YIMLRMDYAGIAALISTSFYPLVYYTFMCDPFFCALYMGFI  288



>ref|XP_010274409.1| PREDICTED: heptahelical transmembrane protein 4-like [Nelumbo 
nucifera]
 ref|XP_010274410.1| PREDICTED: heptahelical transmembrane protein 4-like [Nelumbo 
nucifera]
Length=413

 Score =   337 bits (864),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 189/217 (87%), Gaps = 10/217 (5%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ  LS+FTIHNETLNVWTHL+GFFLFLSLTIYT MK+P+VVD  +L +LP+VL+K DL
Sbjct  74   LKQTFLSIFTIHNETLNVWTHLIGFFLFLSLTIYT-MKVPEVVDLQSLHHLPEVLKKTDL  132

Query  182  H---ACLPSLLHIPDLHRLREELKTAFPS------LSNWHIVQLLTNCLPECFSNSNHTN  334
            H    CLPS+ ++PDL RL++E K +FPS      LS+W+I++LLTNCLPE FS+SNH++
Sbjct  133  HELLTCLPSMPNMPDLRRLQDEYKPSFPSMDVLPSLSSWYILELLTNCLPERFSHSNHSD  192

Query  335  VCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIML  514
             CVL SMKED+VN+IAPL  RPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIML
Sbjct  193  ACVLRSMKEDMVNMIAPLMFRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIML  252

Query  515  RLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            RLDY GIAALISTSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  253  RLDYTGIAALISTSFYPPVYYSFMCKPFFCNLYLGFI  289



>gb|KDP32090.1| hypothetical protein JCGZ_12551 [Jatropha curcas]
Length=406

 Score =   336 bits (862),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 185/217 (85%), Gaps = 11/217 (5%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLS+F+IHNETLNVWTHL+GFFLFLSLT+YTAMK+P VVD  +LQ LPDVL KADL
Sbjct  68   LKQVLLSIFSIHNETLNVWTHLIGFFLFLSLTVYTAMKVPKVVDLHSLQ-LPDVL-KADL  125

Query  182  HA---CLPSLLHIPDLHRLREELKTAFPS------LSNWHIVQLLTNCLPECFSNSNHTN  334
            H    CLPSL  +  +HRLREELKT  PS      LS WHI+ LL NCLP+ FS+ NHT+
Sbjct  126  HKLHECLPSLPAMLSMHRLREELKTTLPSMDLLPSLSGWHIMDLLYNCLPDRFSSGNHTD  185

Query  335  VCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIML  514
            VCVL SMKED+ N+IAPL  RPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIML
Sbjct  186  VCVLRSMKEDVANMIAPLMVRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIML  245

Query  515  RLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            RLDYAGIAALI+TSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  246  RLDYAGIAALIATSFYPPVYYSFMCNPFFCNLYLGFI  282



>ref|XP_004511819.1| PREDICTED: adiponectin receptor protein 1-like isoform X1 [Cicer 
arietinum]
 ref|XP_004511820.1| PREDICTED: adiponectin receptor protein 1-like isoform X2 [Cicer 
arietinum]
Length=391

 Score =   335 bits (859),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 164/215 (76%), Positives = 184/215 (86%), Gaps = 17/215 (8%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLS+FTIHNETLNVWTHL+GFFLFL+LTIYTAMK+P VVD  +LQ+LPD+L+KADL
Sbjct  63   LKQVLLSIFTIHNETLNVWTHLIGFFLFLALTIYTAMKVPQVVDLNSLQHLPDILKKADL  122

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H        CLPS+   PDL RLREE+       S+WH+ +LL NCLP  FS+SNHT+VC
Sbjct  123  HKLQSELLTCLPSM---PDLQRLREEI-------SSWHVKELLYNCLPVSFSSSNHTDVC  172

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
            VL S+K+DL NIIAPL  RPITRWPF+AFLGGAMFCLLASSTCHLLSCHSER+SYIMLRL
Sbjct  173  VLHSVKDDLANIIAPLLIRPITRWPFYAFLGGAMFCLLASSTCHLLSCHSERVSYIMLRL  232

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPPVYYSFMCYPFFCNLY+GFI
Sbjct  233  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYMGFI  267



>ref|XP_010028082.1| PREDICTED: heptahelical transmembrane protein 4-like [Eucalyptus 
grandis]
 gb|KCW54741.1| hypothetical protein EUGRSUZ_I00694 [Eucalyptus grandis]
Length=409

 Score =   335 bits (859),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 167/221 (76%), Positives = 191/221 (86%), Gaps = 15/221 (7%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLS+FTIHNETLNVWTHL+GFF+FLSLTIYTA K+P+VVD  ++ +LPDVLRKADL
Sbjct  67   LKQTLLSIFTIHNETLNVWTHLIGFFVFLSLTIYTASKVPNVVDIHSI-HLPDVLRKADL  125

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPS------LSNWHIVQLLTNCLPECFSNS  322
            H         LPSL ++PDLHRLREEL+T+ PS      LS WH+V+LL NCLPE FS+ 
Sbjct  126  HKIHAELMTSLPSLPNMPDLHRLREELRTSLPSMDLLPSLSGWHVVELLYNCLPERFSH-  184

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            +HT+VCVL SMK+D++N+IAPL TRPITRWPFF F+GGAMFCLLASSTCHLLSCHSERLS
Sbjct  185  DHTDVCVLRSMKDDVLNMIAPLVTRPITRWPFFVFMGGAMFCLLASSTCHLLSCHSERLS  244

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALI+TSFYPPVYYSFMC PFFCNLY+GFI
Sbjct  245  YIMLRLDYAGIAALIATSFYPPVYYSFMCDPFFCNLYMGFI  285



>ref|XP_010999933.1| PREDICTED: heptahelical transmembrane protein 4-like [Populus 
euphratica]
 ref|XP_010999934.1| PREDICTED: heptahelical transmembrane protein 4-like [Populus 
euphratica]
Length=409

 Score =   333 bits (854),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 185/217 (85%), Gaps = 11/217 (5%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLSVFTIHNETLNVWTHL+GFFLFLSLTIYTAMK+P VVD  +LQ LP+VL KADL
Sbjct  68   LKQVLLSVFTIHNETLNVWTHLIGFFLFLSLTIYTAMKVPKVVDLHSLQ-LPEVL-KADL  125

Query  182  HA---CLPSLLHIPDLHRLREELKTAFPSL------SNWHIVQLLTNCLPECFSNSNHTN  334
            H    CLPSL ++PDLH+L  ELK+  PS+      S WH++ LL NCLPE FS+SN T+
Sbjct  126  HKLQECLPSLPNMPDLHKLSGELKSTLPSIDLLPSFSRWHVMDLLYNCLPERFSHSNQTD  185

Query  335  VCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIML  514
             CVL SMKED+ N+IAPL  RPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERL+YIML
Sbjct  186  ACVLRSMKEDVANMIAPLMLRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLTYIML  245

Query  515  RLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            RLDYAGIAALISTSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  246  RLDYAGIAALISTSFYPPVYYSFMCNPFFCNLYLGFI  282



>ref|XP_002320004.2| hypothetical protein POPTR_0014s00900g [Populus trichocarpa]
 gb|EEE98319.2| hypothetical protein POPTR_0014s00900g [Populus trichocarpa]
Length=409

 Score =   333 bits (854),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 186/217 (86%), Gaps = 11/217 (5%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLSVFTIHNETLNVWTHL+GFFLFLSLTIYTAMK+P VVD  +LQ LP+VL KADL
Sbjct  68   LKQVLLSVFTIHNETLNVWTHLIGFFLFLSLTIYTAMKVPKVVDLHSLQ-LPEVL-KADL  125

Query  182  HA---CLPSLLHIPDLHRLREELKTAFPSL------SNWHIVQLLTNCLPECFSNSNHTN  334
            H    CLPSL ++PDLH+L  ELK+  PS+      S WH++ LL NCLPE FS+SN T+
Sbjct  126  HKLQECLPSLPNMPDLHKLSGELKSTLPSIDLLPSFSRWHVMDLLYNCLPERFSHSNQTD  185

Query  335  VCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIML  514
            VCVL SMKED+ N+IAPL  RPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERL+YI+L
Sbjct  186  VCVLRSMKEDVANMIAPLMLRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLTYILL  245

Query  515  RLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            RLDYAGIAALISTSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  246  RLDYAGIAALISTSFYPPVYYSFMCNPFFCNLYLGFI  282



>ref|XP_009797604.1| PREDICTED: heptahelical transmembrane protein 4-like isoform 
X1 [Nicotiana sylvestris]
Length=401

 Score =   332 bits (851),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 166/215 (77%), Positives = 180/215 (84%), Gaps = 19/215 (9%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQALLSVFTIHNETLNVWTHL+GF LFL LTIYTAMK+PD+VD  TLQNLP+ LRKADL
Sbjct  75   LKQALLSVFTIHNETLNVWTHLIGFILFLVLTIYTAMKVPDIVDLQTLQNLPEKLRKADL  134

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H        C+PSL H+PDLH+LRE+L            +QLL+NCLPE FSNSN T+V 
Sbjct  135  HKLQAELLPCIPSLPHMPDLHKLREDL------------LQLLSNCLPERFSNSNRTDVG  182

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
            VL S+KED+ N+IAPL   PITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL
Sbjct  183  VLRSVKEDVANMIAPLLVTPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  242

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPPVYYSFMCYPFF NLYLGFI
Sbjct  243  DYAGIAALISTSFYPPVYYSFMCYPFFLNLYLGFI  277



>emb|CBI25834.3| unnamed protein product [Vitis vinifera]
Length=390

 Score =   332 bits (850),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 165/221 (75%), Positives = 190/221 (86%), Gaps = 13/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK+ LLS+FTIHNETLNVWTHL+GFFLFLSLTIYTAMK+P V+D  +LQ+LPD++++ADL
Sbjct  46   LKEVLLSIFTIHNETLNVWTHLIGFFLFLSLTIYTAMKVPSVMDLHSLQHLPDLIKRADL  105

Query  182  ---HA----CLPSLLHIPDLHRLREELKTAFPS------LSNWHIVQLLTNCLPECFSNS  322
               HA    CLPSL ++PDL+RLR ELKT+ PS      LS WHI++LLT CLPE FS+ 
Sbjct  106  QKIHALLLTCLPSLPNMPDLYRLRGELKTSLPSMDLLPSLSGWHILELLTKCLPERFSHG  165

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            NHT+V VL  +KED+ N+IAPL  RPITRWPF+AFLGGAMFCLLASSTCHLLSC+S+RLS
Sbjct  166  NHTDVSVLHDVKEDVANMIAPLILRPITRWPFYAFLGGAMFCLLASSTCHLLSCYSKRLS  225

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALISTSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  226  YIMLRLDYAGIAALISTSFYPPVYYSFMCNPFFCNLYLGFI  266



>ref|XP_009362593.1| PREDICTED: heptahelical transmembrane protein 4-like isoform 
X2 [Pyrus x bretschneideri]
Length=412

 Score =   332 bits (850),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/221 (73%), Positives = 184/221 (83%), Gaps = 13/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ L S+FTIHNETLNVWTHL+GF LFLSLTIYTA+K+P+VVD   LQ+LPDVL+KADL
Sbjct  68   LKQVLFSMFTIHNETLNVWTHLIGFLLFLSLTIYTAIKVPEVVDLHALQHLPDVLKKADL  127

Query  182  HA-------CLPSLLHIPDLHRLREELKTAF------PSLSNWHIVQLLTNCLPECFSNS  322
            H        CLPSL ++PDL+RLREELKT+       PSLS WH+++LL NCLP+ FS+ 
Sbjct  128  HKLHEEFMTCLPSLPNMPDLNRLREELKTSLTSIDLLPSLSGWHVMELLKNCLPQRFSHG  187

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            N T+VCVL SMKED+ NIIAPL  RPITRWPFFAFLGGAMFCLL SS CHLLSCHSER+S
Sbjct  188  NQTDVCVLRSMKEDVANIIAPLMIRPITRWPFFAFLGGAMFCLLTSSACHLLSCHSERMS  247

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLR+DYAGIAALISTSFYP VYY+FMC PFFC LY+G I
Sbjct  248  YIMLRMDYAGIAALISTSFYPLVYYTFMCNPFFCALYMGCI  288



>ref|XP_010646812.1| PREDICTED: heptahelical transmembrane protein 4-like [Vitis vinifera]
Length=412

 Score =   331 bits (849),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 188/221 (85%), Gaps = 13/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK+ LLS+FTIHNETLNVWTHL+GFFLFLSLTIYTAMK+P V+D  +LQ+LPD++++ADL
Sbjct  68   LKEVLLSIFTIHNETLNVWTHLIGFFLFLSLTIYTAMKVPSVMDLHSLQHLPDLIKRADL  127

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPS------LSNWHIVQLLTNCLPECFSNS  322
                     CLPSL ++PDL+RLR ELKT+ PS      LS WHI++LLT CLPE FS+ 
Sbjct  128  QKIHALLLTCLPSLPNMPDLYRLRGELKTSLPSMDLLPSLSGWHILELLTKCLPERFSHG  187

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            NHT+V VL  +KED+ N+IAPL  RPITRWPF+AFLGGAMFCLLASSTCHLLSC+S+RLS
Sbjct  188  NHTDVSVLHDVKEDVANMIAPLILRPITRWPFYAFLGGAMFCLLASSTCHLLSCYSKRLS  247

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALISTSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  248  YIMLRLDYAGIAALISTSFYPPVYYSFMCNPFFCNLYLGFI  288



>ref|XP_004288264.1| PREDICTED: heptahelical transmembrane protein 4-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=409

 Score =   331 bits (848),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 166/221 (75%), Positives = 184/221 (83%), Gaps = 16/221 (7%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLS+FTIHNETLNVWTHL+GFFLFL+LTIYTAMK+PDVVD   L  LPDVL+ ADL
Sbjct  68   LKQVLLSMFTIHNETLNVWTHLIGFFLFLALTIYTAMKVPDVVD---LHALPDVLKNADL  124

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPS------LSNWHIVQLLTNCLPECFSNS  322
            H        CLPSL ++P L++LREELKT+ PS      LS WH+++LL NCLP+ FS+ 
Sbjct  125  HKLHEELMTCLPSLPNMPALNKLREELKTSLPSMDLLPSLSGWHVMELLNNCLPQRFSHG  184

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            NHT+VCVL SMKEDL NIIAPL  RPITRWPFFAFLGGAMFCLL+SS CHLLSCHSER S
Sbjct  185  NHTDVCVLHSMKEDLANIIAPLVMRPITRWPFFAFLGGAMFCLLSSSACHLLSCHSERTS  244

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALISTSFYP VYYSFMC PFFC LY+GFI
Sbjct  245  YIMLRLDYAGIAALISTSFYPLVYYSFMCNPFFCTLYMGFI  285



>ref|XP_011007839.1| PREDICTED: heptahelical transmembrane protein 4-like [Populus 
euphratica]
Length=409

 Score =   330 bits (845),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 184/217 (85%), Gaps = 11/217 (5%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLSVFTIHNETLNVWTHL+GFFLFLSLTIYTAMK+P VVD  +LQ LP+VL KADL
Sbjct  68   LKQVLLSVFTIHNETLNVWTHLIGFFLFLSLTIYTAMKVPKVVDLHSLQ-LPEVL-KADL  125

Query  182  HA---CLPSLLHIPDLHRLREELKTAFPSL------SNWHIVQLLTNCLPECFSNSNHTN  334
            H    CLPSL ++PDLH+L  ELK+  PS+      S WH++ LL NCLPE FS+SN T+
Sbjct  126  HKLQECLPSLPNMPDLHKLSGELKSTLPSIDLLPSFSRWHVMDLLYNCLPERFSHSNQTD  185

Query  335  VCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIML  514
             CVL SMKED+ N+IAPL  RPITRWPFFAFLGGAMFCLLASSTCHLLSCHSE L+YIML
Sbjct  186  ACVLRSMKEDVANMIAPLMLRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSELLTYIML  245

Query  515  RLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            RLDYAGIAALISTSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  246  RLDYAGIAALISTSFYPPVYYSFMCNPFFCNLYLGFI  282



>gb|EYU44509.1| hypothetical protein MIMGU_mgv1a007578mg [Erythranthe guttata]
Length=403

 Score =   329 bits (843),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 163/212 (77%), Positives = 183/212 (86%), Gaps = 6/212 (3%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLR-KAD  178
            LKQ LLSVFTIHNETLNVWTHL+GFFLFLSLTIYTA K+P V +  ++    D  +  A+
Sbjct  70   LKQVLLSVFTIHNETLNVWTHLIGFFLFLSLTIYTATKVPYVQN--SVMKTADYQKLHAE  127

Query  179  LHACLPSLLHIPDLHRLREELKTA---FPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLS  349
            L  CLPSL H+PD+ RLREELKT+    PSLSNWHI++LL+NC+PE  S+SNHT++CVL 
Sbjct  128  LMTCLPSLPHMPDMQRLREELKTSIDLLPSLSNWHIMELLSNCIPESLSHSNHTDICVLR  187

Query  350  SMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYA  529
            SMKED+ NIIAPL  RPITRWPFFAFL GAMFCLL+SSTCHLLSCHSERLSYIMLRLDYA
Sbjct  188  SMKEDVANIIAPLLVRPITRWPFFAFLCGAMFCLLSSSTCHLLSCHSERLSYIMLRLDYA  247

Query  530  GIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            GIAALISTSFYPPVYYSFMCYPFFCNLY+GFI
Sbjct  248  GIAALISTSFYPPVYYSFMCYPFFCNLYMGFI  279



>ref|XP_010531306.1| PREDICTED: heptahelical transmembrane protein 4 [Tarenaya hassleriana]
 ref|XP_010531307.1| PREDICTED: heptahelical transmembrane protein 4 [Tarenaya hassleriana]
Length=404

 Score =   328 bits (840),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 165/216 (76%), Positives = 185/216 (86%), Gaps = 11/216 (5%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQN-LPDVLRKAD  178
            LKQ L+SVFTIHNETLNVWTHL+GFFLFL+LTIYTA  +P + D  +LQ+ +PDVLRKAD
Sbjct  68   LKQILISVFTIHNETLNVWTHLIGFFLFLALTIYTAKMVPGM-DLHSLQHRIPDVLRKAD  126

Query  179  LHA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNV  337
            LH        CLPSL H+PDLHRLR +LKT+ PS    H+++LL NCLPE FS+ N+T++
Sbjct  127  LHKLHSDLVTCLPSLPHMPDLHRLRHDLKTSLPS--GRHVMELLYNCLPERFSHGNYTDM  184

Query  338  CVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLR  517
            CVL S+KEDLVNIIAPL  RPITRWPFFAFLGGAMFCLLASSTCHL SCHSER+SYIMLR
Sbjct  185  CVLHSVKEDLVNIIAPLLARPITRWPFFAFLGGAMFCLLASSTCHLFSCHSERISYIMLR  244

Query  518  LDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            LDYAGIAALISTSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  245  LDYAGIAALISTSFYPPVYYSFMCDPFFCNLYLGFI  280



>ref|XP_009362592.1| PREDICTED: heptahelical transmembrane protein 4-like isoform 
X1 [Pyrus x bretschneideri]
Length=413

 Score =   327 bits (839),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 162/222 (73%), Positives = 184/222 (83%), Gaps = 14/222 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ L S+FTIHNETLNVWTHL+GF LFLSLTIYTA+K+P+VVD   LQ+LPDVL+KADL
Sbjct  68   LKQVLFSMFTIHNETLNVWTHLIGFLLFLSLTIYTAIKVPEVVDLHALQHLPDVLKKADL  127

Query  182  HA-------CLPSLLHIPDLHRLREELKTAF------PSLSNWHIVQLLTNCLPECFSNS  322
            H        CLPSL ++PDL+RLREELKT+       PSLS WH+++LL NCLP+ FS+ 
Sbjct  128  HKLHEEFMTCLPSLPNMPDLNRLREELKTSLTSIDLLPSLSGWHVMELLKNCLPQRFSHG  187

Query  323  NHTNVCVLS-SMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERL  499
            N T+VCVL  SMKED+ NIIAPL  RPITRWPFFAFLGGAMFCLL SS CHLLSCHSER+
Sbjct  188  NQTDVCVLQRSMKEDVANIIAPLMIRPITRWPFFAFLGGAMFCLLTSSACHLLSCHSERM  247

Query  500  SYIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            SYIMLR+DYAGIAALISTSFYP VYY+FMC PFFC LY+G I
Sbjct  248  SYIMLRMDYAGIAALISTSFYPLVYYTFMCNPFFCALYMGCI  289



>ref|XP_009419320.1| PREDICTED: heptahelical transmembrane protein ADIPOR3-like [Musa 
acuminata subsp. malaccensis]
Length=403

 Score =   327 bits (837),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/221 (71%), Positives = 187/221 (85%), Gaps = 13/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ  LS+FTIHNETLNVWTHL+GFFLFL+LT+YTAMK+P VVD  +LQ+LPDVL+KADL
Sbjct  59   LKQIFLSIFTIHNETLNVWTHLIGFFLFLALTVYTAMKVPKVVDLQSLQHLPDVLKKADL  118

Query  182  H-------ACLPSLLHIPDLHRLREELKTAF------PSLSNWHIVQLLTNCLPECFSNS  322
                    ACLPSL H+  L RL+ E+KT+       PSLS+ HI+QLL+NCLP  ++++
Sbjct  119  QKIQSELVACLPSLPHLSHLQRLKNEVKTSLASLDMLPSLSHRHILQLLSNCLPHRYAHA  178

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            N++NV VLS+MK+D+ N+IAPL  RPI+RWPFFAFLGGAMFCLLASSTCHLLSCHS RL+
Sbjct  179  NYSNVSVLSAMKDDVANMIAPLVVRPISRWPFFAFLGGAMFCLLASSTCHLLSCHSRRLA  238

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLR+DYAGIAALISTSFYPPVYYSFMC PFFCN+YLGFI
Sbjct  239  YIMLRIDYAGIAALISTSFYPPVYYSFMCNPFFCNIYLGFI  279



>ref|XP_008237736.1| PREDICTED: adiponectin receptor protein-like isoform X2 [Prunus 
mume]
Length=408

 Score =   326 bits (836),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 184/221 (83%), Gaps = 17/221 (8%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLS+FTIHNETLNVWTHL+GFFLFLSLTIYTA+K+P+VVD   LQ+ PDVL+KADL
Sbjct  68   LKQVLLSMFTIHNETLNVWTHLIGFFLFLSLTIYTAIKLPEVVDLHALQHFPDVLKKADL  127

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPS------LSNWHIVQLLTNCLPECFSNS  322
            H        CLPSL ++P L+RLREELKT+ PS      LS WH+++LL NCLP+ FS+ 
Sbjct  128  HKLHEEFMTCLPSLPNMPHLNRLREELKTSLPSMDLLPSLSGWHVMELLNNCLPQRFSHG  187

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            N T+    SSMKEDL NI+APL  RPITRWPFFAFLGGAMFCLL+SS CHLLSCHSER+S
Sbjct  188  NQTD----SSMKEDLANIVAPLMLRPITRWPFFAFLGGAMFCLLSSSACHLLSCHSERMS  243

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALISTSFYP VYYSFMC PFFCNLY+GFI
Sbjct  244  YIMLRLDYAGIAALISTSFYPLVYYSFMCNPFFCNLYMGFI  284



>ref|XP_007156702.1| hypothetical protein PHAVU_002G010000g [Phaseolus vulgaris]
 gb|ESW28696.1| hypothetical protein PHAVU_002G010000g [Phaseolus vulgaris]
Length=387

 Score =   323 bits (827),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 177/215 (82%), Gaps = 17/215 (8%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +KQ LLS+FTIHNETLNVWTHLVGFF+FL+LT+YTAMKIP VVD  +LQ+ PD+L K DL
Sbjct  59   IKQVLLSMFTIHNETLNVWTHLVGFFIFLALTVYTAMKIPKVVDLNSLQHFPDILMKTDL  118

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
                     CLPS   IPDL RL+EE+       SNWHI + L NCLP  F +SNHT+VC
Sbjct  119  QKLQSELLTCLPS---IPDLQRLKEEI-------SNWHIKEYLYNCLPVRFFSSNHTDVC  168

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
            VL S+KEDL NIIAPL  RPITRWPFFAFLGGAMFCLLASS CHLLSCHSER++YIMLRL
Sbjct  169  VLHSVKEDLANIIAPLIIRPITRWPFFAFLGGAMFCLLASSVCHLLSCHSERMAYIMLRL  228

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI
Sbjct  229  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  263



>ref|XP_006466458.1| PREDICTED: ADIPOR-like receptor IZH1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006466459.1| PREDICTED: ADIPOR-like receptor IZH1-like isoform X2 [Citrus 
sinensis]
Length=411

 Score =   323 bits (829),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 181/221 (82%), Gaps = 14/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLS+FTIHNETLNVWTHL+GFF+FL+LTIYTAMK P VVD  +L ++P+VL+ ADL
Sbjct  68   LKQTLLSIFTIHNETLNVWTHLIGFFIFLALTIYTAMKAPRVVDLHSL-HIPEVLKNADL  126

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPS------LSNWHIVQLLTNCLPECFSNS  322
            H        CLPSL ++P+L RLREELKT  PS      LS WH+++ L NCLPE FS+ 
Sbjct  127  HKLQAELLTCLPSLPNLPNLQRLREELKTTLPSMDLLPSLSGWHVMEHLYNCLPERFSHG  186

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            N T VCVL S+KED+ NIIAPL  RPITRWPFFAFLGGAMFCLL SS CHLLSCHSER+S
Sbjct  187  NQTEVCVLHSVKEDVANIIAPLMVRPITRWPFFAFLGGAMFCLLTSSACHLLSCHSERMS  246

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALISTSFYP VYYSFMC PFFCNLY+GFI
Sbjct  247  YIMLRLDYAGIAALISTSFYPLVYYSFMCTPFFCNLYMGFI  287



>gb|KDO78928.1| hypothetical protein CISIN_1g015195mg [Citrus sinensis]
Length=411

 Score =   323 bits (828),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 181/221 (82%), Gaps = 14/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLS+FTIHNETLNVWTHL+GFF+FL+LTIYTAMK P VVD  +L ++P+VL+ ADL
Sbjct  68   LKQTLLSIFTIHNETLNVWTHLIGFFIFLALTIYTAMKAPRVVDLHSL-HIPEVLKNADL  126

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPS------LSNWHIVQLLTNCLPECFSNS  322
            H        CLPSL ++P+L RLREELKT  PS      LS WH+++ L NCLPE FS+ 
Sbjct  127  HKLQAELLTCLPSLPNLPNLQRLREELKTTLPSMDLLPSLSGWHVMEHLYNCLPERFSHG  186

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            N T VCVL S+KED+ NIIAPL  RPITRWPFFAFLGGAMFCLL SS CHLLSCHSER+S
Sbjct  187  NQTEVCVLHSVKEDVANIIAPLMVRPITRWPFFAFLGGAMFCLLTSSACHLLSCHSERMS  246

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALISTSFYP VYYSFMC PFFCNLY+GFI
Sbjct  247  YIMLRLDYAGIAALISTSFYPLVYYSFMCTPFFCNLYMGFI  287



>ref|XP_006426099.1| hypothetical protein CICLE_v10025731mg [Citrus clementina]
 gb|ESR39339.1| hypothetical protein CICLE_v10025731mg [Citrus clementina]
Length=411

 Score =   323 bits (828),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 181/221 (82%), Gaps = 14/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLS+FTIHNETLNVWTHL+GFF+FL+LTIYTAMK P VVD  +L ++P+VL+ ADL
Sbjct  68   LKQTLLSIFTIHNETLNVWTHLIGFFIFLALTIYTAMKAPRVVDLHSL-HIPEVLKNADL  126

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPS------LSNWHIVQLLTNCLPECFSNS  322
            H        CLPSL ++P+L RLREELKT  PS      LS WH+++ L NCLPE FS+ 
Sbjct  127  HKLQAELLTCLPSLPNLPNLQRLREELKTTLPSMDLLPSLSGWHVMEHLYNCLPERFSHG  186

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            N T VCVL S+KED+ NIIAPL  RPITRWPFFAFLGGAMFCLL SS CHLLSCHSER+S
Sbjct  187  NQTEVCVLHSVKEDVANIIAPLMVRPITRWPFFAFLGGAMFCLLTSSACHLLSCHSERMS  246

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALISTSFYP VYYSFMC PFFCNLY+GFI
Sbjct  247  YIMLRLDYAGIAALISTSFYPLVYYSFMCTPFFCNLYMGFI  287



>ref|XP_002285384.1| PREDICTED: heptahelical transmembrane protein 4 isoform X1 [Vitis 
vinifera]
 ref|XP_010664496.1| PREDICTED: heptahelical transmembrane protein 4 isoform X1 [Vitis 
vinifera]
 ref|XP_010664497.1| PREDICTED: heptahelical transmembrane protein 4 isoform X1 [Vitis 
vinifera]
 ref|XP_010664498.1| PREDICTED: heptahelical transmembrane protein 4 isoform X1 [Vitis 
vinifera]
 emb|CBI19385.3| unnamed protein product [Vitis vinifera]
Length=415

 Score =   323 bits (828),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 185/221 (84%), Gaps = 13/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ +LS+FTIHNETLNVWTHL+GFFLFLSLTIYTAM++P+VVD  + Q+LPD LR+ADL
Sbjct  71   LKQVILSIFTIHNETLNVWTHLIGFFLFLSLTIYTAMRVPEVVDLRSFQHLPDFLRRADL  130

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPS------LSNWHIVQLLTNCLPECFSNS  322
            H        CLPSL ++P+L+RL +ELKT+ PS      LS WH+++LL+NCLPE FS +
Sbjct  131  HNIRSVLLNCLPSLPNMPNLNRLTDELKTSLPSMDFLSSLSGWHVLELLSNCLPERFSPT  190

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            N T+ CVL ++KE   N+IAPL  +PITRWPFFAFLGGAMFCLL+SS CHLLSCHSERLS
Sbjct  191  NQTSDCVLCAVKEGAANLIAPLMFQPITRWPFFAFLGGAMFCLLSSSICHLLSCHSERLS  250

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALISTSFYPPVYYSFMC PFFC LYLGFI
Sbjct  251  YIMLRLDYAGIAALISTSFYPPVYYSFMCNPFFCRLYLGFI  291



>ref|XP_009797605.1| PREDICTED: heptahelical transmembrane protein 4-like isoform 
X2 [Nicotiana sylvestris]
Length=397

 Score =   322 bits (825),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 177/215 (82%), Gaps = 23/215 (11%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQALLSVFTIHNETLNVWTHL+GF LFL LTIYTAMK+PD+VD  TLQNLP+ LRKADL
Sbjct  75   LKQALLSVFTIHNETLNVWTHLIGFILFLVLTIYTAMKVPDIVDLQTLQNLPEKLRKADL  134

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H        C+PSL H+PDLH+LRE+L            +QLL+NCLPE FSNSN T+  
Sbjct  135  HKLQAELLPCIPSLPHMPDLHKLREDL------------LQLLSNCLPERFSNSNRTD--  180

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
               S+KED+ N+IAPL   PITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL
Sbjct  181  --RSVKEDVANMIAPLLVTPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  238

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPPVYYSFMCYPFF NLYLGFI
Sbjct  239  DYAGIAALISTSFYPPVYYSFMCYPFFLNLYLGFI  273



>ref|XP_009618874.1| PREDICTED: heptahelical transmembrane protein 4-like [Nicotiana 
tomentosiformis]
Length=401

 Score =   322 bits (824),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 177/215 (82%), Gaps = 19/215 (9%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQALLSVFTIHNETLNVWTHL+GF LFL LTIYTAMK+PD+VD  TLQNLP+ LRKADL
Sbjct  75   LKQALLSVFTIHNETLNVWTHLIGFILFLVLTIYTAMKVPDIVDLQTLQNLPEKLRKADL  134

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H        C+PSL H+PDLH+LRE+L            +QLL+ CLPE FSNSN  ++ 
Sbjct  135  HKLQAELLPCIPSLPHMPDLHKLREDL------------LQLLSKCLPERFSNSNRIDIG  182

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
            VL S+KED+ N+IAPL   PITRWPFFAFL GAMFCLLASSTCHLLSCHSERLSYIMLRL
Sbjct  183  VLLSVKEDVANMIAPLLVTPITRWPFFAFLCGAMFCLLASSTCHLLSCHSERLSYIMLRL  242

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPPVYYSFMCYPFF NLYLGFI
Sbjct  243  DYAGIAALISTSFYPPVYYSFMCYPFFLNLYLGFI  277



>gb|KHG04092.1| ADIPOR-like receptor protein [Gossypium arboreum]
Length=428

 Score =   322 bits (826),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 166/241 (69%), Positives = 184/241 (76%), Gaps = 37/241 (15%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +KQ LLS+FTIHNETLNVWTHL+GFF+FL+LTIYTA K+P VVDF +LQ++PDVLRKADL
Sbjct  68   MKQVLLSIFTIHNETLNVWTHLIGFFIFLALTIYTATKVPKVVDFHSLQHIPDVLRKADL  127

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H        CLPSL ++P LH+LREEL      LS WH+ +LL NCLPE F + NHT+VC
Sbjct  128  HKLHSELMTCLPSLPNMPGLHKLREELLL----LSGWHVRELLYNCLPERFFSGNHTDVC  183

Query  341  VL--------------------------SSMKEDLVNIIAPLTTRPITRWPFFAFLGGAM  442
            VL                           S+KED+ NIIAPL  RPITRWPFFAFLGGAM
Sbjct  184  VLVCVWLNGRCLEGLRLFCCLVLRRTAQQSVKEDVANIIAPLMVRPITRWPFFAFLGGAM  243

Query  443  FCLLASSTCHLLSCHSERLSYIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGF  622
            FCLLASSTCHLLSCHSERLSYIMLRLDYAGIAALISTSFYPPVYYSFMC PFFCNLYLGF
Sbjct  244  FCLLASSTCHLLSCHSERLSYIMLRLDYAGIAALISTSFYPPVYYSFMCDPFFCNLYLGF  303

Query  623  I  625
            I
Sbjct  304  I  304



>gb|KHN36309.1| ADIPOR-like receptor CG5315-like protein [Glycine soja]
Length=380

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 178/215 (83%), Gaps = 17/215 (8%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +KQ LLS FTIHNETLNVWTHL+GFF+FL+LTIYTAMKIP VVD  +LQ+ PD+L+KADL
Sbjct  52   IKQVLLSAFTIHNETLNVWTHLIGFFIFLALTIYTAMKIPKVVDLNSLQHFPDMLKKADL  111

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H        CLPS+   PDLHRLR+E+       S+WHI + L NCLP  FS+SNHT+ C
Sbjct  112  HKLQSEILTCLPSM---PDLHRLRDEI-------SSWHIKEYLYNCLPVRFSSSNHTDAC  161

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
            VL S+K+DL NIIAPL  RPITRWPFFAFLGGAMFCLLASS CHLLSCHS R++YIMLRL
Sbjct  162  VLLSVKDDLANIIAPLMIRPITRWPFFAFLGGAMFCLLASSICHLLSCHSARMAYIMLRL  221

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  222  DYAGIAALISTSFYPPVYYSFMCDPFFCNLYLGFI  256



>ref|XP_002310891.1| hypothetical protein POPTR_0007s14850g [Populus trichocarpa]
 gb|EEE91341.1| hypothetical protein POPTR_0007s14850g [Populus trichocarpa]
Length=401

 Score =   320 bits (821),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 165/218 (76%), Positives = 185/218 (85%), Gaps = 12/218 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLSVFTIHNETLNVWTHL+GFFLFLSLTIYTAMK+P VVD  +L +LP+VL KADL
Sbjct  62   LKQVLLSVFTIHNETLNVWTHLIGFFLFLSLTIYTAMKVPKVVDLHSL-HLPEVL-KADL  119

Query  182  H---ACLPSLLHIPDLHRLREELKTAFPS------LSNWHIVQLLTNCLPECFSNSNHTN  334
            H    CLPSL  +PDLH+LREELK+ FPS      LS WH++ LL NCLPE FS+ N T+
Sbjct  120  HRLQECLPSLPTMPDLHKLREELKSTFPSIDMLPSLSGWHVMDLLYNCLPERFSHGNQTD  179

Query  335  VCVLSSMKEDLVNIIAPLTT-RPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIM  511
            V VL ++KED+ NIIAPL   RPITRWPF+AFLGGAMFCLLASSTCHLLSCHS+R SYI+
Sbjct  180  VYVLRTVKEDVANIIAPLMMMRPITRWPFYAFLGGAMFCLLASSTCHLLSCHSKRSSYIL  239

Query  512  LRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            LRLDYAGIAALISTSF+PPVYYSFMC PFFCNLY+GFI
Sbjct  240  LRLDYAGIAALISTSFFPPVYYSFMCNPFFCNLYMGFI  277



>ref|XP_008647457.1| PREDICTED: uncharacterized protein LOC100502176 isoform X1 [Zea 
mays]
 tpg|DAA44185.1| TPA: hypothetical protein ZEAMMB73_882874 [Zea mays]
Length=402

 Score =   320 bits (820),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 154/221 (70%), Positives = 183/221 (83%), Gaps = 13/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L Q LLS F+IHNETLNVWTHL+GFF+FL+LTIYTA ++P+ VD  +LQ+LPDVLRKAD+
Sbjct  58   LPQVLLSAFSIHNETLNVWTHLIGFFIFLALTIYTATQVPNAVDIRSLQHLPDVLRKADI  117

Query  182  H-------ACLPSLLHIPDLHRLREELKTAF------PSLSNWHIVQLLTNCLPECFSNS  322
            H       +CLPSL H+ DL +L++ELKT++      PSLS WH+++LL NCLP  F++ 
Sbjct  118  HKIQAELVSCLPSLPHLSDLQKLKDELKTSWNSMEVLPSLSRWHLLELLANCLPHRFTHP  177

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            N T++ VL SMKEDL ++IAP   RPI RWPF+AFLGGAMFCLLASSTCHLLSCHS RL+
Sbjct  178  NETSLSVLQSMKEDLASLIAPQLIRPIARWPFYAFLGGAMFCLLASSTCHLLSCHSRRLA  237

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALI+TSFYPPVYYSFMCYPFFCNLYL FI
Sbjct  238  YIMLRLDYAGIAALIATSFYPPVYYSFMCYPFFCNLYLSFI  278



>ref|XP_002468234.1| hypothetical protein SORBIDRAFT_01g042200 [Sorghum bicolor]
 gb|EER95232.1| hypothetical protein SORBIDRAFT_01g042200 [Sorghum bicolor]
Length=402

 Score =   320 bits (819),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 184/221 (83%), Gaps = 13/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L Q LLS F+IHNETLNVWTHL+GFF+FL+LTIYTA ++P+VVD  +LQ+LPDVLRKAD+
Sbjct  58   LPQVLLSAFSIHNETLNVWTHLIGFFIFLALTIYTATQVPNVVDIQSLQHLPDVLRKADI  117

Query  182  H-------ACLPSLLHIPDLHRLREELKTAF------PSLSNWHIVQLLTNCLPECFSNS  322
            H       +CLPSL H+ DL +L++ELK+++      PSLS WH+++LL +CLP  F++ 
Sbjct  118  HKIQAELVSCLPSLPHLSDLQKLKDELKSSWNSMEVLPSLSRWHLLELLASCLPHRFTHP  177

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            N T++ VL SMKEDL N+IAP   RPI RWPF+AFLGGAMFCLLASSTCHLLSCHS RL+
Sbjct  178  NETSLSVLQSMKEDLANLIAPQLIRPIARWPFYAFLGGAMFCLLASSTCHLLSCHSRRLA  237

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALI+TSFYPPVYYSFMCYPFFCN+YL FI
Sbjct  238  YIMLRLDYAGIAALIATSFYPPVYYSFMCYPFFCNMYLSFI  278



>ref|XP_006649686.1| PREDICTED: ADIPOR-like receptor CG5315-like [Oryza brachyantha]
Length=405

 Score =   319 bits (818),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/221 (70%), Positives = 184/221 (83%), Gaps = 13/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L Q LLS F+IHNETLNVWTHL+GFF+FL LTIYTA K+P+VVD  +LQ+LPDVLRKADL
Sbjct  61   LPQVLLSAFSIHNETLNVWTHLIGFFIFLVLTIYTATKVPNVVDLQSLQHLPDVLRKADL  120

Query  182  H-------ACLPSLLHIPDLHRLREELKTAF------PSLSNWHIVQLLTNCLPECFSNS  322
            H       ACLPSL H+ DL ++++ELK+++      PSLS WH+++L+++CLP  F++S
Sbjct  121  HKIQTELVACLPSLPHLSDLQKMKDELKSSWNSIEVLPSLSRWHLLELVSSCLPHRFTHS  180

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            N T++ VL SMKED+ N+IAP   RPI RWPFFAFLGGAMFCLLASSTCHLLSCHS RL+
Sbjct  181  NETSLSVLQSMKEDIANLIAPQLIRPIPRWPFFAFLGGAMFCLLASSTCHLLSCHSRRLA  240

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALI+TSFYPPVYYSFMCYPFFCNLYL  I
Sbjct  241  YIMLRLDYAGIAALIATSFYPPVYYSFMCYPFFCNLYLSLI  281



>ref|NP_001242849.1| uncharacterized protein LOC100778227 [Glycine max]
 gb|ACU22878.1| unknown [Glycine max]
Length=380

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 178/215 (83%), Gaps = 17/215 (8%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +KQ LLS FTIHNETLNVWTHL+GFF+FL+LTIYTAMKIP VVD  +LQ+ PD+L+KADL
Sbjct  52   IKQVLLSAFTIHNETLNVWTHLIGFFIFLALTIYTAMKIPKVVDLNSLQHFPDMLKKADL  111

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H        CLPS+   PDLHRLR+E+       S+WHI + L NCLP  FS+SNHT+ C
Sbjct  112  HKLQSEILTCLPSM---PDLHRLRDEI-------SSWHIKEYLYNCLPVRFSSSNHTDAC  161

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
            VL S+K+DL NIIAPL  RPITRWPFFAFLGGAMFCLLASS CHLLSCHS R+++IMLRL
Sbjct  162  VLLSVKDDLANIIAPLMIRPITRWPFFAFLGGAMFCLLASSICHLLSCHSARMAHIMLRL  221

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  222  DYAGIAALISTSFYPPVYYSFMCDPFFCNLYLGFI  256



>ref|XP_010679658.1| PREDICTED: heptahelical transmembrane protein 4-like [Beta vulgaris 
subsp. vulgaris]
Length=398

 Score =   319 bits (817),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/220 (69%), Positives = 180/220 (82%), Gaps = 12/220 (5%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQA  S+F++HNETLNVWTHL+GFF FL LTIYTA K+P+VVD  ++Q+LPDV R+ADL
Sbjct  55   LKQAFFSIFSLHNETLNVWTHLIGFFFFLCLTIYTAKKVPNVVDLHSIQHLPDVFRRADL  114

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSL-----SNWHIVQLLTNCLPECFSNSN  325
            H         LPSL  + D+H++ EELKT+ P+      S WH+++LL+NCLPECFS+ N
Sbjct  115  HKMHADLLTSLPSLPDMSDIHKICEELKTSLPTKNMLHSSGWHVLELLSNCLPECFSSGN  174

Query  326  HTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSY  505
            HT+ CVL +M  DL N+IAP+T RPITRWPFFA+LGGAMFCLLASS CHL  CHSERL+Y
Sbjct  175  HTDACVLRTMTGDLANVIAPVTRRPITRWPFFAYLGGAMFCLLASSICHLFYCHSERLAY  234

Query  506  IMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            IMLR+DYAGIAALISTSFYP VYYSFMCYPFFCNLY+GFI
Sbjct  235  IMLRVDYAGIAALISTSFYPLVYYSFMCYPFFCNLYIGFI  274



>ref|XP_009395019.1| PREDICTED: heptahelical transmembrane protein ADIPOR3-like [Musa 
acuminata subsp. malaccensis]
Length=401

 Score =   318 bits (815),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/221 (70%), Positives = 185/221 (84%), Gaps = 15/221 (7%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLS+FT+HNETLNVWTHL+GFFLFL+LTIYTAMK+P VVD  +LQ+LPDVL+KADL
Sbjct  59   LKQILLSIFTVHNETLNVWTHLIGFFLFLALTIYTAMKVPKVVDLQSLQHLPDVLKKADL  118

Query  182  H-------ACLPSLLHIPDLHRLREELKTAF------PSLSNWHIVQLLTNCLPECFSNS  322
                    ACLPSL H+ DL R+++ELKT+       PSLS WH++QL+++CLP  F+++
Sbjct  119  QKIQSELVACLPSLPHLSDLQRIKDELKTSLGSLDMLPSLSRWHLLQLISDCLPHRFTHA  178

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
              TNV VLS++K+D+ N+IAP+  RPI RWPFFAFLGGAMFCLL+SS CHLLSCHS R++
Sbjct  179  --TNVSVLSAVKDDVANMIAPILVRPIPRWPFFAFLGGAMFCLLSSSICHLLSCHSRRIA  236

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALISTSFYPPVYYSFMC PFFCN+YL FI
Sbjct  237  YIMLRLDYAGIAALISTSFYPPVYYSFMCNPFFCNIYLSFI  277



>ref|XP_011031308.1| PREDICTED: heptahelical transmembrane protein 4-like [Populus 
euphratica]
Length=407

 Score =   318 bits (815),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 165/218 (76%), Positives = 184/218 (84%), Gaps = 12/218 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLSVFTIHNETLNVWTHL+GFFLFLSLTIYTAMK+P VVD  +L +LP+VL KADL
Sbjct  68   LKQVLLSVFTIHNETLNVWTHLIGFFLFLSLTIYTAMKVPKVVDLHSL-HLPEVL-KADL  125

Query  182  HA---CLPSLLHIPDLHRLREELKTAFPS------LSNWHIVQLLTNCLPECFSNSNHTN  334
            H    CLPSL  +PDLH+LREELK+ FPS      LS WH++ LL NCLPE FS+ N T+
Sbjct  126  HKLQECLPSLPTMPDLHKLREELKSTFPSIDMLPSLSGWHVMDLLYNCLPERFSHGNQTD  185

Query  335  VCVLSSMKEDLVNIIAPLTT-RPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIM  511
            V VL ++KED+ NIIAPL   RPITRWPF+AFLGGAMFCLLASSTCHLLSCHS+R SYI+
Sbjct  186  VYVLRTVKEDVTNIIAPLMMMRPITRWPFYAFLGGAMFCLLASSTCHLLSCHSKRSSYIL  245

Query  512  LRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            LRLDYAGIAALISTSF PPVYYSFMC PFFCNLY+GFI
Sbjct  246  LRLDYAGIAALISTSFCPPVYYSFMCNPFFCNLYMGFI  283



>gb|EMT18253.1| ADIPOR-like receptor [Aegilops tauschii]
Length=406

 Score =   317 bits (811),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/221 (70%), Positives = 185/221 (84%), Gaps = 14/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L Q LLSVF+IHNETLNVWTHL+GFF+FLSLTIYTA K+P+V D  +LQNLPD+LR ADL
Sbjct  63   LPQVLLSVFSIHNETLNVWTHLIGFFIFLSLTIYTATKVPNV-DLQSLQNLPDILRNADL  121

Query  182  H-------ACLPSLLHIPDLHRLREELKTAF------PSLSNWHIVQLLTNCLPECFSNS  322
            H       ACLPSL H  DL ++++EL++++      PSLS W +++LL+NCLP+ F++S
Sbjct  122  HKIQAELAACLPSLPHFSDLQKMKDELRSSWNSIDVLPSLSRWRLLELLSNCLPDRFTHS  181

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            N TN+ VL SMKED+V +IAP   RPI+RWPFFAFLGGAMFCLLASSTCHLLSCHS RL+
Sbjct  182  NETNLSVLESMKEDIVTVIAPHFIRPISRWPFFAFLGGAMFCLLASSTCHLLSCHSRRLA  241

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALI+TSFYPPVYYSF+C+PFFCNLYL FI
Sbjct  242  YIMLRLDYAGIAALIATSFYPPVYYSFLCHPFFCNLYLSFI  282



>ref|XP_004985130.1| PREDICTED: ADIPOR-like receptor CG5315-like isoform X1 [Setaria 
italica]
Length=412

 Score =   317 bits (811),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 185/221 (84%), Gaps = 13/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L Q LLS F+IHNETLNVWTHL+GFF+FL+LTIYTA ++P+VVD  +L++LPDVLR AD+
Sbjct  68   LPQVLLSAFSIHNETLNVWTHLIGFFIFLALTIYTATQVPNVVDIQSLKHLPDVLRNADI  127

Query  182  H-------ACLPSLLHIPDLHRLREELKTAF------PSLSNWHIVQLLTNCLPECFSNS  322
            H       +CLPSL H+ DL +L++ELK+++      PSLS WH+++LL+NCLP  F+++
Sbjct  128  HKIQAELVSCLPSLPHLSDLEKLKDELKSSWNSMEVLPSLSRWHLLELLSNCLPHRFTHT  187

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            N T++ VL SMK+D+ N+IAP   RPI RWPFFAFLGGAMFCLLASSTCHLLSCHS RL+
Sbjct  188  NETSLSVLQSMKDDIANMIAPELIRPIARWPFFAFLGGAMFCLLASSTCHLLSCHSRRLA  247

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALI+TSFYPPVYYSFMCYPFFCNLYL FI
Sbjct  248  YIMLRLDYAGIAALIATSFYPPVYYSFMCYPFFCNLYLSFI  288



>gb|EEE58653.1| hypothetical protein OsJ_10038 [Oryza sativa Japonica Group]
Length=361

 Score =   315 bits (806),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/221 (70%), Positives = 183/221 (83%), Gaps = 13/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L Q LLS F+IHNETLNVWTHL+GFF+FL LTIYTA ++P+VVD  +LQ+LPDVLR ADL
Sbjct  17   LPQVLLSAFSIHNETLNVWTHLIGFFIFLVLTIYTATQVPNVVDLQSLQHLPDVLRNADL  76

Query  182  H-------ACLPSLLHIPDLHRLREELKTAF------PSLSNWHIVQLLTNCLPECFSNS  322
            H       ACLPSL H+ DL +L++ELK+++      PSLS WH+++LL++CLP  F++S
Sbjct  77   HKIQTELVACLPSLPHLSDLQKLKDELKSSWNSIEVLPSLSRWHLLELLSSCLPHRFTHS  136

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            N T++ VL SMKED+ N+IAP   RPI RWPF+AFLGGAMFCLLASSTCHLLSCHS RL+
Sbjct  137  NETSLSVLQSMKEDIANMIAPQLIRPIPRWPFYAFLGGAMFCLLASSTCHLLSCHSRRLA  196

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALI+TSFYPPVYYSFMCYPFFCNLYL  I
Sbjct  197  YIMLRLDYAGIAALIATSFYPPVYYSFMCYPFFCNLYLSCI  237



>ref|XP_006857128.1| hypothetical protein AMTR_s00065p00145160 [Amborella trichopoda]
 gb|ERN18595.1| hypothetical protein AMTR_s00065p00145160 [Amborella trichopoda]
Length=404

 Score =   315 bits (808),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 181/218 (83%), Gaps = 10/218 (5%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK+  LS+FTIHNETLNVWTHL+GFFLFLSLTIYTA+K+P VVD  +L NLPDVL++ADL
Sbjct  61   LKEIFLSIFTIHNETLNVWTHLIGFFLFLSLTIYTAVKLPKVVDLHSLPNLPDVLKRADL  120

Query  182  HA----CLPSLLHIPDLHRLREELKTAFPS------LSNWHIVQLLTNCLPECFSNSNHT  331
            H     CLPS+ ++P L RLR ELK+A PS      LS WH+++L+ NCLPE   ++NHT
Sbjct  121  HKELMHCLPSMPNMPALQRLRNELKSALPSMDSLPSLSGWHLLELVRNCLPESLYHANHT  180

Query  332  NVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIM  511
            + CVL+S+K+D+ N+IAPL  RPITRWPFFAFLGGAMFCLLASSTCHLLSCHS RL+YIM
Sbjct  181  DTCVLTSIKDDVGNMIAPLLVRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSRRLAYIM  240

Query  512  LRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            LRLDYAGIAALI+TSFYPPVYYSFMC PFF  LYL  I
Sbjct  241  LRLDYAGIAALIATSFYPPVYYSFMCEPFFQYLYLSSI  278



>gb|ABM68566.1| hemolysin III-related family protein [Lilium longiflorum]
Length=400

 Score =   315 bits (807),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 180/221 (81%), Gaps = 18/221 (8%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ  LSVF+IHNETLNVWTHL+GFF+FL+LTIYTAMK+PDVVD  TLQ+L DVLRK DL
Sbjct  61   LKQIFLSVFSIHNETLNVWTHLIGFFIFLALTIYTAMKVPDVVDLRTLQHLSDVLRKTDL  120

Query  182  H-------ACLPSLLHIPDLHRLREELKTAFPSLS------NWHIVQLLTNCLPECFSNS  322
            H       ACLPS+ HI DL RLR+E KT+ PSL       NWH+++LL+NCLP+ FS  
Sbjct  121  HKIQSELLACLPSMPHISDLQRLRDEWKTSLPSLDMLPSLPNWHLLELLSNCLPQRFSQP  180

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            + T      ++ ED+ N+IAPL  +PI+RWPFFAFLGGAMFCLLASSTCHLLSCHS RL+
Sbjct  181  DLTK-----TVNEDMANVIAPLFLKPISRWPFFAFLGGAMFCLLASSTCHLLSCHSRRLA  235

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALI+TSFYPPVYYSFMC+PFFCNLYLG I
Sbjct  236  YIMLRLDYAGIAALITTSFYPPVYYSFMCHPFFCNLYLGSI  276



>ref|NP_001049471.1| Os03g0232900 [Oryza sativa Japonica Group]
 sp|Q10PI5.1|ADPO3_ORYSJ RecName: Full=Heptahelical transmembrane protein ADIPOR3; AltName: 
Full=PAQR family protein ADIPOR3 [Oryza sativa Japonica 
Group]
 gb|ABF94811.1| Haemolysin-III related family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11385.1| Os03g0232900 [Oryza sativa Japonica Group]
 dbj|BAG93109.1| unnamed protein product [Oryza sativa Japonica Group]
Length=403

 Score =   315 bits (806),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 154/221 (70%), Positives = 183/221 (83%), Gaps = 13/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L Q LLS F+IHNETLNVWTHL+GFF+FL LTIYTA ++P+VVD  +LQ+LPDVLR ADL
Sbjct  59   LPQVLLSAFSIHNETLNVWTHLIGFFIFLVLTIYTATQVPNVVDLQSLQHLPDVLRNADL  118

Query  182  H-------ACLPSLLHIPDLHRLREELKTAF------PSLSNWHIVQLLTNCLPECFSNS  322
            H       ACLPSL H+ DL +L++ELK+++      PSLS WH+++LL++CLP  F++S
Sbjct  119  HKIQTELVACLPSLPHLSDLQKLKDELKSSWNSIEVLPSLSRWHLLELLSSCLPHRFTHS  178

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            N T++ VL SMKED+ N+IAP   RPI RWPF+AFLGGAMFCLLASSTCHLLSCHS RL+
Sbjct  179  NETSLSVLQSMKEDIANMIAPQLIRPIPRWPFYAFLGGAMFCLLASSTCHLLSCHSRRLA  238

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALI+TSFYPPVYYSFMCYPFFCNLYL  I
Sbjct  239  YIMLRLDYAGIAALIATSFYPPVYYSFMCYPFFCNLYLSCI  279



>gb|KJB43936.1| hypothetical protein B456_007G224700 [Gossypium raimondii]
 gb|KJB43937.1| hypothetical protein B456_007G224700 [Gossypium raimondii]
Length=301

 Score =   311 bits (797),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 173/202 (86%), Gaps = 11/202 (5%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +KQ LLS+FTIHNETLNVWTHL+GFF+FL+LTIYTAMK+P VVDF +LQ++PDVLRKADL
Sbjct  68   MKQVLLSIFTIHNETLNVWTHLIGFFIFLALTIYTAMKVPKVVDFHSLQHIPDVLRKADL  127

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H        CLPSL ++P LH+LREEL      LS WH+ +LL NCLPE F + NHT+VC
Sbjct  128  HKLHSELLTCLPSLPNMPGLHKLREELLL----LSGWHVRELLYNCLPERFFSGNHTDVC  183

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
            VL S+KED+ NIIAPL  RPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL
Sbjct  184  VLQSVKEDVANIIAPLMVRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  243

Query  521  DYAGIAALISTSFYPPVYYSFM  586
            DYAGIAALISTSFYPPVYYSF+
Sbjct  244  DYAGIAALISTSFYPPVYYSFI  265



>gb|EEC74820.1| hypothetical protein OsI_10642 [Oryza sativa Indica Group]
Length=403

 Score =   315 bits (806),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 154/221 (70%), Positives = 183/221 (83%), Gaps = 13/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L Q LLS F+IHNETLNVWTHL+GFF+FL LTIYTA ++P+VVD  +LQ+LPDVLR ADL
Sbjct  59   LPQVLLSAFSIHNETLNVWTHLIGFFVFLVLTIYTATQVPNVVDLQSLQHLPDVLRNADL  118

Query  182  H-------ACLPSLLHIPDLHRLREELKTAF------PSLSNWHIVQLLTNCLPECFSNS  322
            H       ACLPSL H+ DL +L++ELK+++      PSLS WH+++LL++CLP  F++S
Sbjct  119  HKIQTELVACLPSLPHLSDLQKLKDELKSSWNSIEVLPSLSRWHLLELLSSCLPHRFTHS  178

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            N T++ VL SMKED+ N+IAP   RPI RWPF+AFLGGAMFCLLASSTCHLLSCHS RL+
Sbjct  179  NETSLSVLQSMKEDIANMIAPQLIRPIPRWPFYAFLGGAMFCLLASSTCHLLSCHSRRLA  238

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALI+TSFYPPVYYSFMCYPFFCNLYL  I
Sbjct  239  YIMLRLDYAGIAALIATSFYPPVYYSFMCYPFFCNLYLSCI  279



>gb|KJB18049.1| hypothetical protein B456_003G031300 [Gossypium raimondii]
Length=386

 Score =   312 bits (799),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 176/215 (82%), Gaps = 14/215 (7%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +KQ LLS+F+IHNETLNVWTHL+GFFLFL+LTIYTAMK+P VVD  +L ++ D+LRKADL
Sbjct  55   MKQLLLSIFSIHNETLNVWTHLIGFFLFLALTIYTAMKVPKVVDLNSLSHIHDILRKADL  114

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H        CLPSL ++ DLH+ R+ELKT   S+S WH+ +LL NCLPE FS+ N +N  
Sbjct  115  HKLHSELVTCLPSLPNMSDLHKFRDELKT---SISGWHVRELLYNCLPESFSSRNQSN--  169

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
               SMKED+ NIIAPL  RPITRWPFF FLGGAMFCLLASS CHLLSCHSER+SYI+ RL
Sbjct  170  --RSMKEDVTNIIAPLMVRPITRWPFFTFLGGAMFCLLASSACHLLSCHSERISYIVRRL  227

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPPVYYSF+C PFFC LYLGFI
Sbjct  228  DYAGIAALISTSFYPPVYYSFICDPFFCRLYLGFI  262



>ref|XP_006350623.1| PREDICTED: adiponectin receptor protein 1-like [Solanum tuberosum]
Length=400

 Score =   311 bits (798),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 178/215 (83%), Gaps = 20/215 (9%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +KQALLSVFTIHNETLN+WTHL+GFFLFL LTIYTAMK+PD+VD  TLQNLP+ LRK D+
Sbjct  75   VKQALLSVFTIHNETLNIWTHLIGFFLFLVLTIYTAMKVPDIVDLQTLQNLPEKLRKIDI  134

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H        C+PSL ++PDLH+L+E            H++QLL+NCLP+ FS+SNHT+V 
Sbjct  135  HKLPAELLPCIPSLPNMPDLHKLQE------------HLLQLLSNCLPDRFSHSNHTDVG  182

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
            VL S+K D+ N+IAPL  +PITRWPF+AFLGGAMFCLLASSTCHLL CHSERLSY+MLR 
Sbjct  183  VLHSVK-DVANVIAPLMVKPITRWPFYAFLGGAMFCLLASSTCHLLCCHSERLSYVMLRF  241

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPPVYYSFMCYPFF  LYLGFI
Sbjct  242  DYAGIAALISTSFYPPVYYSFMCYPFFLYLYLGFI  276



>ref|XP_004234646.1| PREDICTED: heptahelical transmembrane protein 4-like [Solanum 
lycopersicum]
Length=400

 Score =   309 bits (791),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 175/215 (81%), Gaps = 20/215 (9%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +KQALLSVFTIHNETLN+WTHL+GFFLFL LTIYTA K+PD+VD  TLQNLP+ L K DL
Sbjct  75   VKQALLSVFTIHNETLNIWTHLIGFFLFLVLTIYTAKKVPDIVDLQTLQNLPEKLSKIDL  134

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H        C+PSL ++PDLH+LRE L            +QLL+NCLP+ FS+ NHT+V 
Sbjct  135  HKLPADLLPCIPSLPNMPDLHKLRENL------------LQLLSNCLPDRFSHGNHTDVG  182

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
            VL S+K D+ N+IAPL  +PITRWPF+AFLGGAMFCLLASSTCHLL CHSERLSY+MLR 
Sbjct  183  VLHSVK-DVANVIAPLMVKPITRWPFYAFLGGAMFCLLASSTCHLLCCHSERLSYVMLRF  241

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPPVYYSFMCYPFF NLYLGFI
Sbjct  242  DYAGIAALISTSFYPPVYYSFMCYPFFLNLYLGFI  276



>dbj|BAJ95400.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=407

 Score =   309 bits (791),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 181/221 (82%), Gaps = 14/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L Q LLS F+IHNETLNVWTHL+GFF+FL+LTIYTA K+P+V D  +LQNLPD+LR ADL
Sbjct  64   LPQVLLSAFSIHNETLNVWTHLIGFFIFLALTIYTATKVPNV-DLQSLQNLPDMLRNADL  122

Query  182  H-------ACLPSLLHIPDLHRLREELKTAF------PSLSNWHIVQLLTNCLPECFSNS  322
            H       ACLPSL H  DL ++++E ++++      PSLS W +++LL+NCLP  F++S
Sbjct  123  HKIQAELAACLPSLPHFSDLQKMKDEFRSSWNSIDVLPSLSRWRLLELLSNCLPNRFTHS  182

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            N TN  +L SM+ED+V +IAP   RPI+RWPFFAFLGGAMFCLLASSTCHLLSCHS RL+
Sbjct  183  NETNPSILESMQEDIVTVIAPHFIRPISRWPFFAFLGGAMFCLLASSTCHLLSCHSRRLA  242

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALI+TSFYPPVYYSFMC+PFFCNLYL FI
Sbjct  243  YIMLRLDYAGIAALIATSFYPPVYYSFMCHPFFCNLYLSFI  283



>gb|AAM19133.1|AC103891_13 Hypothetical protein [Oryza sativa Japonica Group]
Length=822

 Score =   319 bits (818),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 182/218 (83%), Gaps = 13/218 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L Q LLS F+IHNETLNVWTHL+GFF+FL LTIYTA ++P+VVD  +LQ+LPDVLR ADL
Sbjct  59   LPQVLLSAFSIHNETLNVWTHLIGFFIFLVLTIYTATQVPNVVDLQSLQHLPDVLRNADL  118

Query  182  H-------ACLPSLLHIPDLHRLREELKTAF------PSLSNWHIVQLLTNCLPECFSNS  322
            H       ACLPSL H+ DL +L++ELK+++      PSLS WH+++LL++CLP  F++S
Sbjct  119  HKIQTELVACLPSLPHLSDLQKLKDELKSSWNSIEVLPSLSRWHLLELLSSCLPHRFTHS  178

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            N T++ VL SMKED+ N+IAP   RPI RWPF+AFLGGAMFCLLASSTCHLLSCHS RL+
Sbjct  179  NETSLSVLQSMKEDIANMIAPQLIRPIPRWPFYAFLGGAMFCLLASSTCHLLSCHSRRLA  238

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYL  616
            YIMLRLDYAGIAALI+TSFYPPVYYSFMCYPFFCNLYL
Sbjct  239  YIMLRLDYAGIAALIATSFYPPVYYSFMCYPFFCNLYL  276



>ref|XP_004511821.1| PREDICTED: adiponectin receptor protein 1-like isoform X3 [Cicer 
arietinum]
Length=377

 Score =   306 bits (783),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 172/215 (80%), Gaps = 31/215 (14%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLS+FTIHNETLNVWTHL+GFFLFL+LTIYTAMK+P VVD  +LQ+LPD+L+KADL
Sbjct  63   LKQVLLSIFTIHNETLNVWTHLIGFFLFLALTIYTAMKVPQVVDLNSLQHLPDILKKADL  122

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H        CLPS+   PDL RLREE+       S+WH+ +LL NCLP            
Sbjct  123  HKLQSELLTCLPSM---PDLQRLREEI-------SSWHVKELLYNCLPH-----------  161

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
               S+K+DL NIIAPL  RPITRWPF+AFLGGAMFCLLASSTCHLLSCHSER+SYIMLRL
Sbjct  162  ---SVKDDLANIIAPLLIRPITRWPFYAFLGGAMFCLLASSTCHLLSCHSERVSYIMLRL  218

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPPVYYSFMCYPFFCNLY+GFI
Sbjct  219  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYMGFI  253



>ref|XP_009133930.1| PREDICTED: adiponectin receptor protein-like isoform X1 [Brassica 
rapa]
 emb|CDX75670.1| BnaA01g00320D [Brassica napus]
Length=374

 Score =   306 bits (783),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/210 (73%), Positives = 174/210 (83%), Gaps = 15/210 (7%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQN-LPDVLRKAD  178
            +KQ LLS+FTIHNETLNVWTHL+GFFLFL+LTIYTA K+P VVD  +LQ+ LPDVLRK D
Sbjct  54   IKQILLSIFTIHNETLNVWTHLIGFFLFLALTIYTATKVPSVVDLHSLQHRLPDVLRKTD  113

Query  179  LHACLPSLLHIPDLHRLREELKTAFPSL-SNWHIVQLLTNCLPECFSNSNHTNVCVLSSM  355
            LH             +L  +L +  PS  S WH+++LL NCLPE FS+ N+T++CVL S+
Sbjct  114  LH-------------KLHSDLMSRLPSSPSKWHVMELLYNCLPERFSHGNNTDMCVLHSV  160

Query  356  KEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGI  535
            KEDL N+IAPL  RPITRWPF+AFLGGAMFCLLASSTCHLLSCHSER+SYIMLRLDYAGI
Sbjct  161  KEDLANMIAPLIFRPITRWPFYAFLGGAMFCLLASSTCHLLSCHSERVSYIMLRLDYAGI  220

Query  536  AALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            AALISTSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  221  AALISTSFYPPVYYSFMCDPFFCNLYLGFI  250



>emb|CDX69320.1| BnaC01g01330D [Brassica napus]
Length=383

 Score =   306 bits (783),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/210 (73%), Positives = 173/210 (82%), Gaps = 15/210 (7%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQN-LPDVLRKAD  178
            +KQ LLS+FTIHNETLNVWTHL+GFFLFL+LTIYTA K+P VVD  +LQ+ LPDVLRK D
Sbjct  63   IKQILLSIFTIHNETLNVWTHLIGFFLFLALTIYTATKVPSVVDLHSLQHRLPDVLRKTD  122

Query  179  LHACLPSLLHIPDLHRLREELKTAFPSL-SNWHIVQLLTNCLPECFSNSNHTNVCVLSSM  355
            LH             +L  +L +  PS  S WH+++LL NCLPE FS+ N T++CVL S+
Sbjct  123  LH-------------KLHSDLMSRLPSSPSKWHVMELLYNCLPERFSHGNSTDMCVLHSV  169

Query  356  KEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGI  535
            KEDL N+IAPL  RPITRWPF+AFLGGAMFCLLASSTCHLLSCHSER+SYIMLRLDYAGI
Sbjct  170  KEDLANMIAPLIFRPITRWPFYAFLGGAMFCLLASSTCHLLSCHSERVSYIMLRLDYAGI  229

Query  536  AALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            AALISTSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  230  AALISTSFYPPVYYSFMCDPFFCNLYLGFI  259



>ref|XP_003611557.1| Adiponectin receptor protein [Medicago truncatula]
 gb|AES94515.1| heptahelical protein [Medicago truncatula]
Length=379

 Score =   305 bits (782),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 170/215 (79%), Gaps = 26/215 (12%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +KQ LLS+F IHNETLNVWTHL+GFFLFL+LTIYTAMK+P  VD  +L +LPD L+ ADL
Sbjct  60   MKQVLLSIFRIHNETLNVWTHLIGFFLFLALTIYTAMKVPQAVDLSSLPHLPDFLKNADL  119

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H        CLPS+   PDL RLRE                LL NCLP  FS+SNHT+VC
Sbjct  120  HKLQSELLTCLPSM---PDLQRLRE----------------LLYNCLPGRFSSSNHTDVC  160

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
            VL ++KEDL NIIAPL  RPITRWPF+AFLGGAMFCLLASS CHLLSCHSER+SYIMLRL
Sbjct  161  VLHNVKEDLANIIAPLVIRPITRWPFYAFLGGAMFCLLASSVCHLLSCHSERVSYIMLRL  220

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI
Sbjct  221  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  255



>ref|XP_006411861.1| hypothetical protein EUTSA_v10025437mg [Eutrema salsugineum]
 dbj|BAJ34118.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53314.1| hypothetical protein EUTSA_v10025437mg [Eutrema salsugineum]
Length=386

 Score =   305 bits (782),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 153/210 (73%), Positives = 174/210 (83%), Gaps = 15/210 (7%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQN-LPDVLRKAD  178
            +KQ LLS FTIHNETLNVWTHL+GFFLFL+LTIYTA K+P VVD  +LQ+ LPDVLRK D
Sbjct  65   IKQILLSTFTIHNETLNVWTHLIGFFLFLALTIYTATKVPSVVDLHSLQHRLPDVLRKTD  124

Query  179  LHACLPSLLHIPDLHRLREELKTAFPSL-SNWHIVQLLTNCLPECFSNSNHTNVCVLSSM  355
            LH             +L  EL +  PS  S+WH+++LL NCLPE FS+ N+T++CVL S+
Sbjct  125  LH-------------KLHSELMSRLPSSPSSWHVMELLYNCLPERFSHGNYTDMCVLHSV  171

Query  356  KEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGI  535
            KEDL N+IAPL  RPITRWPF+AFLGGAMFCLLASSTCHLLSCHSER+SYIMLRLDYAGI
Sbjct  172  KEDLANMIAPLIFRPITRWPFYAFLGGAMFCLLASSTCHLLSCHSERVSYIMLRLDYAGI  231

Query  536  AALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            AALI+TSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  232  AALIATSFYPPVYYSFMCDPFFCNLYLGFI  261



>gb|AFK46125.1| unknown [Medicago truncatula]
Length=379

 Score =   305 bits (781),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 169/215 (79%), Gaps = 26/215 (12%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +KQ LLS+F IHNETLNVWTHL+GFFLFL+LTIYTAMK+P  VD  +L +LPD L+ ADL
Sbjct  60   MKQVLLSIFRIHNETLNVWTHLIGFFLFLALTIYTAMKVPQAVDLSSLPHLPDFLKNADL  119

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H        CLPS+   PDL RLRE                LL NCLP  FS+SNHT+VC
Sbjct  120  HKLQSELLTCLPSM---PDLQRLRE----------------LLYNCLPGRFSSSNHTDVC  160

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
            VL ++KEDL NIIAPL  RPITRWPF+AFLGGAMFCLLA S CHLLSCHSER+SYIMLRL
Sbjct  161  VLHNVKEDLANIIAPLVIRPITRWPFYAFLGGAMFCLLAGSVCHLLSCHSERVSYIMLRL  220

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI
Sbjct  221  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  255



>ref|XP_009138520.1| PREDICTED: adiponectin receptor protein 1-like isoform X1 [Brassica 
rapa]
 ref|XP_009138521.1| PREDICTED: adiponectin receptor protein 1-like isoform X1 [Brassica 
rapa]
Length=387

 Score =   305 bits (781),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 151/210 (72%), Positives = 174/210 (83%), Gaps = 15/210 (7%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQN-LPDVLRKAD  178
            +KQ LLS+FTIHNETLNVWTHL+GFFLFL+LTIYTA K+P VVD  +LQ+ LPD+LRK D
Sbjct  67   IKQILLSIFTIHNETLNVWTHLIGFFLFLALTIYTATKVPSVVDLHSLQDRLPDILRKTD  126

Query  179  LHACLPSLLHIPDLHRLREELKTAFPSL-SNWHIVQLLTNCLPECFSNSNHTNVCVLSSM  355
            LH             +L  +L +  PS  S WH+++LL NCLPE FS+ N+T++CVL S+
Sbjct  127  LH-------------KLHSDLMSHLPSSPSKWHVMELLYNCLPERFSHGNYTDMCVLHSV  173

Query  356  KEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGI  535
            KEDL N+IAPL  RPITRWPF+AFLGGAMFCLLASSTCHLLSCHSER+SYIMLRLDYAGI
Sbjct  174  KEDLANMIAPLIFRPITRWPFYAFLGGAMFCLLASSTCHLLSCHSERVSYIMLRLDYAGI  233

Query  536  AALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            AALI+TSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  234  AALIATSFYPPVYYSFMCDPFFCNLYLGFI  263



>emb|CDY29576.1| BnaA03g54210D [Brassica napus]
Length=387

 Score =   305 bits (780),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 151/210 (72%), Positives = 174/210 (83%), Gaps = 15/210 (7%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQN-LPDVLRKAD  178
            +KQ LLS+FTIHNETLNVWTHL+GFFLFL+LTIYTA K+P VVD  +LQ+ LPD+LRK D
Sbjct  67   IKQILLSIFTIHNETLNVWTHLIGFFLFLALTIYTATKVPSVVDLHSLQDRLPDILRKTD  126

Query  179  LHACLPSLLHIPDLHRLREELKTAFPSL-SNWHIVQLLTNCLPECFSNSNHTNVCVLSSM  355
            LH             +L  +L +  PS  S WH+++LL NCLPE FS+ N+T++CVL S+
Sbjct  127  LH-------------KLHSDLMSHLPSSPSKWHVMELLYNCLPERFSHGNYTDMCVLHSV  173

Query  356  KEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGI  535
            KEDL N+IAPL  RPITRWPF+AFLGGAMFCLLASSTCHLLSCHSER+SYIMLRLDYAGI
Sbjct  174  KEDLANMIAPLIFRPITRWPFYAFLGGAMFCLLASSTCHLLSCHSERVSYIMLRLDYAGI  233

Query  536  AALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            AALI+TSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  234  AALITTSFYPPVYYSFMCDPFFCNLYLGFI  263



>ref|XP_010446637.1| PREDICTED: heptahelical transmembrane protein 4 [Camelina sativa]
Length=387

 Score =   304 bits (779),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 174/210 (83%), Gaps = 15/210 (7%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQN-LPDVLRKAD  178
            +KQ LLS+FTIHNETLNVWTHL+GFFLFL+LTIYTA K+P VVD  +LQ+ LPDVLRK D
Sbjct  67   IKQILLSIFTIHNETLNVWTHLIGFFLFLALTIYTATKVPSVVDLHSLQHRLPDVLRKTD  126

Query  179  LHACLPSLLHIPDLHRLREELKTAFPSL-SNWHIVQLLTNCLPECFSNSNHTNVCVLSSM  355
            LH             +L  EL +  PS  S+WH++ LL NCLPE FS+ N+T++CVL S+
Sbjct  127  LH-------------KLHAELMSRLPSSPSSWHVMDLLYNCLPERFSHGNYTDMCVLHSV  173

Query  356  KEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGI  535
            +EDL N+IAPL  RPITRWPF+AFLGGAMFCLLASSTCHLLSCHSER+SYIMLRLDYAGI
Sbjct  174  REDLANMIAPLIFRPITRWPFYAFLGGAMFCLLASSTCHLLSCHSERVSYIMLRLDYAGI  233

Query  536  AALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            AALI+TSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  234  AALIATSFYPPVYYSFMCDPFFCNLYLGFI  263



>ref|XP_010437193.1| PREDICTED: heptahelical transmembrane protein 4 [Camelina sativa]
Length=389

 Score =   304 bits (779),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 174/210 (83%), Gaps = 15/210 (7%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQN-LPDVLRKAD  178
            +KQ LLS+FTIHNETLNVWTHL+GFFLFL+LTIYTA K+P VVD  +LQ+ LPDVLRK D
Sbjct  67   IKQILLSIFTIHNETLNVWTHLIGFFLFLALTIYTATKVPSVVDLHSLQHRLPDVLRKTD  126

Query  179  LHACLPSLLHIPDLHRLREELKTAFPSL-SNWHIVQLLTNCLPECFSNSNHTNVCVLSSM  355
            LH             +L  EL +  PS  S+WH++ LL NCLPE FS+ N+T++CVL S+
Sbjct  127  LH-------------KLHSELMSRLPSSPSSWHVMDLLYNCLPERFSHGNYTDMCVLHSV  173

Query  356  KEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGI  535
            +EDL N+IAPL  RPITRWPF+AFLGGAMFCLLASSTCHLLSCHSER+SYIMLRLDYAGI
Sbjct  174  REDLANMIAPLIFRPITRWPFYAFLGGAMFCLLASSTCHLLSCHSERVSYIMLRLDYAGI  233

Query  536  AALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            AALI+TSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  234  AALIATSFYPPVYYSFMCDPFFCNLYLGFI  263



>ref|XP_002868976.1| hypothetical protein ARALYDRAFT_490848 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45235.1| hypothetical protein ARALYDRAFT_490848 [Arabidopsis lyrata subsp. 
lyrata]
Length=386

 Score =   304 bits (778),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 151/210 (72%), Positives = 174/210 (83%), Gaps = 15/210 (7%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQN-LPDVLRKAD  178
            +KQ LLS+FTIHNETLNVWTHL+GFFLFL+LTIYTA K+P VVD  +LQ+ LPD+LRK D
Sbjct  66   IKQILLSIFTIHNETLNVWTHLIGFFLFLALTIYTATKVPSVVDLHSLQHRLPDLLRKTD  125

Query  179  LHACLPSLLHIPDLHRLREELKTAFPSL-SNWHIVQLLTNCLPECFSNSNHTNVCVLSSM  355
            LH             +L  EL +  PS  S+WH++ LL NCLPE FS+ N+T++CVL S+
Sbjct  126  LH-------------KLHAELMSRLPSSPSSWHVMDLLYNCLPERFSHGNYTDMCVLHSV  172

Query  356  KEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGI  535
            +EDL N+IAPL  RPITRWPF+AFLGGAMFCLLASSTCHLLSCHSER+SYIMLRLDYAGI
Sbjct  173  REDLANMIAPLIFRPITRWPFYAFLGGAMFCLLASSTCHLLSCHSERVSYIMLRLDYAGI  232

Query  536  AALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            AALI+TSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  233  AALIATSFYPPVYYSFMCDPFFCNLYLGFI  262



>gb|KJB40282.1| hypothetical protein B456_007G056700 [Gossypium raimondii]
Length=396

 Score =   303 bits (777),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 173/221 (78%), Gaps = 25/221 (11%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +KQ LLS+F IHNETLNVWTHL+GFF+FLSLTIYTAMK+P VVD   LQ + DVLRKADL
Sbjct  64   MKQILLSIFRIHNETLNVWTHLIGFFIFLSLTIYTAMKVPKVVDIHALQQITDVLRKADL  123

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFP------SLSNWHIVQLLTNCLPECFSNS  322
            H        CLPSL +IPDLH+LREELKT+ P      SLS+WH+++ L +CLPE  S  
Sbjct  124  HKLQSEILTCLPSLPNIPDLHKLREELKTSIPLMDLIPSLSSWHVMEHLYSCLPELSSAG  183

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            NH +  VL S+KE            PITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS
Sbjct  184  NHIDPHVLESVKE------------PITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  231

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALI+TSFYPPVYYSFMC PFFCNLYLG I
Sbjct  232  YIMLRLDYAGIAALIATSFYPPVYYSFMCDPFFCNLYLGSI  272



>ref|NP_195483.1| heptahelical transmembrane protein HHP4 [Arabidopsis thaliana]
 ref|NP_001190946.1| heptahelical transmembrane protein HHP4 [Arabidopsis thaliana]
 sp|Q9SZG0.1|HHP4_ARATH RecName: Full=Heptahelical transmembrane protein 4; AltName: 
Full=PAQR family protein HHP4 [Arabidopsis thaliana]
 gb|AAK25883.1|AF360173_1 unknown protein [Arabidopsis thaliana]
 emb|CAB38307.1| putative protein [Arabidopsis thaliana]
 emb|CAB80433.1| putative protein [Arabidopsis thaliana]
 gb|AAL07197.1| unknown protein [Arabidopsis thaliana]
 gb|AEE86824.1| heptahelical transmembrane protein HHP4 [Arabidopsis thaliana]
 gb|AEE86825.1| heptahelical transmembrane protein HHP4 [Arabidopsis thaliana]
Length=385

 Score =   303 bits (776),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/210 (72%), Positives = 173/210 (82%), Gaps = 15/210 (7%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQN-LPDVLRKAD  178
            +KQ LLS+FTIHNETLNVWTHL+GFFLFL+LTIYTA K+P VVD  +LQ+ LPD+LRK D
Sbjct  65   IKQILLSIFTIHNETLNVWTHLIGFFLFLALTIYTATKVPSVVDLHSLQHRLPDLLRKTD  124

Query  179  LHACLPSLLHIPDLHRLREELKTAFPSL-SNWHIVQLLTNCLPECFSNSNHTNVCVLSSM  355
            LH             +L  EL    PS  S+WH++ LL NCLPE FS+ N+T++CVL S+
Sbjct  125  LH-------------KLHSELMARLPSSPSSWHVMDLLYNCLPERFSHGNYTDMCVLHSV  171

Query  356  KEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGI  535
            +EDL N+IAPL  RPITRWPF+AFLGGAMFCLLASSTCHLLSCHSER+SYIMLRLDYAGI
Sbjct  172  REDLANLIAPLIFRPITRWPFYAFLGGAMFCLLASSTCHLLSCHSERVSYIMLRLDYAGI  231

Query  536  AALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            AALI+TSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  232  AALIATSFYPPVYYSFMCDPFFCNLYLGFI  261



>ref|NP_195545.1| heptahelical protein 5 [Arabidopsis thaliana]
 sp|Q9SVF3.1|HPP5_ARATH RecName: Full=Heptahelical transmembrane protein 5; AltName: 
Full=PAQR family protein HHP5 [Arabidopsis thaliana]
 emb|CAB37488.1| putative protein [Arabidopsis thaliana]
 emb|CAB80497.1| putative protein [Arabidopsis thaliana]
 gb|AAL49910.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20272.1| unknown protein [Arabidopsis thaliana]
 gb|AEE86913.1| heptahelical protein 5 [Arabidopsis thaliana]
Length=374

 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/210 (71%), Positives = 174/210 (83%), Gaps = 15/210 (7%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQN-LPDVLRKAD  178
            +KQ LLS+FTIHNETLNVWTHL+GFFLFL+LTIYTA K+P VVD  +LQ+ LPD+LRK D
Sbjct  65   IKQILLSIFTIHNETLNVWTHLIGFFLFLALTIYTATKVPSVVDLHSLQHRLPDLLRKTD  124

Query  179  LHACLPSLLHIPDLHRLREELKTAFPSL-SNWHIVQLLTNCLPECFSNSNHTNVCVLSSM  355
            LH             +L  EL +  PS  S+WH++ LL NCLPE FS+ N+T++CVL S+
Sbjct  125  LH-------------KLHSELMSRLPSSPSSWHVMDLLYNCLPERFSHGNYTDMCVLHSV  171

Query  356  KEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGI  535
            +EDL N+IAPL  RPITRWPF+AFLGGA+FCLLASSTCHLLSCHSER+SYIMLRLDYAGI
Sbjct  172  REDLANLIAPLIFRPITRWPFYAFLGGAIFCLLASSTCHLLSCHSERVSYIMLRLDYAGI  231

Query  536  AALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            AALI+TSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  232  AALIATSFYPPVYYSFMCDPFFCNLYLGFI  261



>gb|KJB40281.1| hypothetical protein B456_007G056700 [Gossypium raimondii]
 gb|KJB40283.1| hypothetical protein B456_007G056700 [Gossypium raimondii]
 gb|KJB40284.1| hypothetical protein B456_007G056700 [Gossypium raimondii]
Length=399

 Score =   303 bits (777),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 173/221 (78%), Gaps = 25/221 (11%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +KQ LLS+F IHNETLNVWTHL+GFF+FLSLTIYTAMK+P VVD   LQ + DVLRKADL
Sbjct  67   MKQILLSIFRIHNETLNVWTHLIGFFIFLSLTIYTAMKVPKVVDIHALQQITDVLRKADL  126

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFP------SLSNWHIVQLLTNCLPECFSNS  322
            H        CLPSL +IPDLH+LREELKT+ P      SLS+WH+++ L +CLPE  S  
Sbjct  127  HKLQSEILTCLPSLPNIPDLHKLREELKTSIPLMDLIPSLSSWHVMEHLYSCLPELSSAG  186

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            NH +  VL S+KE            PITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS
Sbjct  187  NHIDPHVLESVKE------------PITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  234

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALI+TSFYPPVYYSFMC PFFCNLYLG I
Sbjct  235  YIMLRLDYAGIAALIATSFYPPVYYSFMCDPFFCNLYLGSI  275



>emb|CDX72648.1| BnaC07g46700D [Brassica napus]
Length=384

 Score =   302 bits (774),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/210 (71%), Positives = 173/210 (82%), Gaps = 15/210 (7%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQN-LPDVLRKAD  178
            +KQ LLS+FTIHNETLNVWTHL+GFFLFL+LTIYTA K+P VVD  +LQ+ LPD+LRK D
Sbjct  64   IKQILLSIFTIHNETLNVWTHLIGFFLFLALTIYTATKVPSVVDLHSLQHRLPDILRKTD  123

Query  179  LHACLPSLLHIPDLHRLREELKTAFPSL-SNWHIVQLLTNCLPECFSNSNHTNVCVLSSM  355
            LH             +L  +L +  PS  S WH+++LL NCLPE F + N+T++CVL S+
Sbjct  124  LH-------------KLHSDLMSRLPSSPSKWHVMELLYNCLPERFYHGNYTDMCVLHSV  170

Query  356  KEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGI  535
            KEDL N+IAPL  RPITRWPF+AFLGGAMFCLLASSTCHLLSCHSER+SYIMLRLDYAGI
Sbjct  171  KEDLANMIAPLIFRPITRWPFYAFLGGAMFCLLASSTCHLLSCHSERVSYIMLRLDYAGI  230

Query  536  AALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            AALI+TSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  231  AALIATSFYPPVYYSFMCDPFFCNLYLGFI  260



>ref|XP_010432040.1| PREDICTED: heptahelical transmembrane protein 4-like [Camelina 
sativa]
Length=387

 Score =   302 bits (774),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/210 (71%), Positives = 174/210 (83%), Gaps = 15/210 (7%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQN-LPDVLRKAD  178
            +KQ LLS+FTIHNETLNVWTHL+GFFLFL+LTIYTA K+P VVD  +LQ+ LPDVLRK D
Sbjct  67   IKQILLSIFTIHNETLNVWTHLIGFFLFLALTIYTATKVPSVVDLHSLQHRLPDVLRKTD  126

Query  179  LHACLPSLLHIPDLHRLREELKTAFPSL-SNWHIVQLLTNCLPECFSNSNHTNVCVLSSM  355
            LH             +L  +L +  PS  S+WH++ LL NCLPE FS+ N+T++CVL S+
Sbjct  127  LH-------------KLHSDLMSRLPSSPSSWHVMDLLYNCLPERFSHGNYTDMCVLHSV  173

Query  356  KEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGI  535
            +EDL N+IAPL  RPITRWPF+AFLGGAMFCLLASSTCHL+SCHSER+SYIMLRLDYAGI
Sbjct  174  REDLANMIAPLIFRPITRWPFYAFLGGAMFCLLASSTCHLISCHSERVSYIMLRLDYAGI  233

Query  536  AALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            AALI+TSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  234  AALIATSFYPPVYYSFMCDPFFCNLYLGFI  263



>ref|XP_006283903.1| hypothetical protein CARUB_v10005020mg [Capsella rubella]
 gb|EOA16801.1| hypothetical protein CARUB_v10005020mg [Capsella rubella]
Length=387

 Score =   302 bits (773),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 151/210 (72%), Positives = 173/210 (82%), Gaps = 15/210 (7%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQN-LPDVLRKAD  178
            +KQ LLS+FTIHNETLNVWTHL+GFFLFL+LTIYTA K+P VVD  +LQ+ LPDVLRK D
Sbjct  67   IKQILLSIFTIHNETLNVWTHLIGFFLFLALTIYTATKVPSVVDLHSLQHRLPDVLRKTD  126

Query  179  LHACLPSLLHIPDLHRLREELKTAFPSL-SNWHIVQLLTNCLPECFSNSNHTNVCVLSSM  355
            L              +L  EL +  PS  S+WH++ LL NCLPE FS+ N+T++CVL S+
Sbjct  127  LQ-------------KLHSELMSRLPSSPSSWHVMDLLYNCLPERFSHGNYTDMCVLYSV  173

Query  356  KEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGI  535
            +EDL N+IAPL  RPITRWPF+AFLGGAMFCLLASSTCHLLSCHSER+SYIMLRLDYAGI
Sbjct  174  REDLANMIAPLIFRPITRWPFYAFLGGAMFCLLASSTCHLLSCHSERVSYIMLRLDYAGI  233

Query  536  AALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            AALI+TSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  234  AALIATSFYPPVYYSFMCDPFFCNLYLGFI  263



>ref|NP_001241554.1| uncharacterized protein LOC100776175 [Glycine max]
 ref|XP_006590275.1| PREDICTED: uncharacterized protein LOC100776175 isoform X1 [Glycine 
max]
 gb|ACU18265.1| unknown [Glycine max]
 gb|KHN13008.1| ADIPOR-like receptor CG5315-like protein [Glycine soja]
Length=374

 Score =   301 bits (770),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 152/215 (71%), Positives = 171/215 (80%), Gaps = 23/215 (11%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            ++Q LLS FTIHNETLNVWTHL+GFF+FL+LTIYTAM      +  +LQ  PD+L+KADL
Sbjct  52   IRQVLLSAFTIHNETLNVWTHLIGFFIFLALTIYTAM------NLNSLQQFPDMLKKADL  105

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H        CLPS+   PDLH LRE        +S+WHI + L NCLP  FS+SNHT+ C
Sbjct  106  HKLQSEILTCLPSM---PDLHILRE-------GISSWHIKEYLYNCLPVRFSSSNHTDAC  155

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
            VL S+K+DL NIIAPL  RPITRWPFFAFLGGAMFCLLASS CHLLSCHS R++YIMLRL
Sbjct  156  VLHSVKDDLANIIAPLMIRPITRWPFFAFLGGAMFCLLASSICHLLSCHSARMAYIMLRL  215

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI
Sbjct  216  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  250



>ref|XP_010228935.1| PREDICTED: LOW QUALITY PROTEIN: heptahelical transmembrane protein 
ADIPOR3-like [Brachypodium distachyon]
Length=399

 Score =   302 bits (773),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 178/215 (83%), Gaps = 8/215 (4%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L Q LLS F+IHNETLNVWTHL+GFF+FLSLTIYTA K+P+V DF +LQ+LPD+LRKADL
Sbjct  62   LPQVLLSAFSIHNETLNVWTHLIGFFIFLSLTIYTATKVPNV-DFQSLQHLPDMLRKADL  120

Query  182  HACLPSLLH-IPDLHRLREELKTAF------PSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H     L   +PDL ++++E+++++      PSLS WH+++LL++CLP  F + N TN+ 
Sbjct  121  HKIQAELAACLPDLQKMKDEMRSSWNSIEMLPSLSRWHLLELLSSCLPNKFVHPNETNLS  180

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
            VL SMKED+  +I P   RPI+RWPFFAF+GGAMFCLLASSTCHLLSCHS RL+YIMLRL
Sbjct  181  VLESMKEDVAIMIGPHFIRPISRWPFFAFMGGAMFCLLASSTCHLLSCHSRRLAYIMLRL  240

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALI+TSFYPPVYYSFMC+PFFCNLYL FI
Sbjct  241  DYAGIAALIATSFYPPVYYSFMCHPFFCNLYLSFI  275



>dbj|BAD43945.1| putative protein [Arabidopsis thaliana]
 dbj|BAD43963.1| putative protein [Arabidopsis thaliana]
 dbj|BAD43999.1| putative protein [Arabidopsis thaliana]
Length=374

 Score =   301 bits (770),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 150/210 (71%), Positives = 173/210 (82%), Gaps = 15/210 (7%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQN-LPDVLRKAD  178
            +KQ LLS+FTIHNETLNVWTHL+GFFLFL+LTIYTA K+P VVD  +LQ+ LPD+LRK D
Sbjct  65   IKQILLSIFTIHNETLNVWTHLIGFFLFLALTIYTATKVPSVVDLHSLQHRLPDLLRKTD  124

Query  179  LHACLPSLLHIPDLHRLREELKTAFPSL-SNWHIVQLLTNCLPECFSNSNHTNVCVLSSM  355
            LH             +L  EL +  PS  S WH++ LL NCLPE FS+ N+T++CVL S+
Sbjct  125  LH-------------KLHSELMSRLPSSPSIWHVMDLLYNCLPERFSHGNYTDMCVLHSV  171

Query  356  KEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGI  535
            +EDL N+IAPL  RPITRWPF+AFLGGA+FCLLASSTCHLLSCHSER+SYIMLRLDYAGI
Sbjct  172  REDLANLIAPLIFRPITRWPFYAFLGGAIFCLLASSTCHLLSCHSERVSYIMLRLDYAGI  231

Query  536  AALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            AALI+TSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  232  AALIATSFYPPVYYSFMCDPFFCNLYLGFI  261



>gb|KHG23872.1| ADIPOR-like receptor protein [Gossypium arboreum]
Length=399

 Score =   301 bits (772),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 155/221 (70%), Positives = 172/221 (78%), Gaps = 25/221 (11%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +KQ LLS+F IHNETLNVWTHL+GFF+FLSLTIYTAMK+P VVD   LQ + DVLRKADL
Sbjct  67   MKQILLSIFRIHNETLNVWTHLIGFFIFLSLTIYTAMKVPKVVDLHALQQITDVLRKADL  126

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFP------SLSNWHIVQLLTNCLPECFSNS  322
            H        CLPSL +IPDLH+LREELKT+ P      S S+WH+++ L +CLPE  S  
Sbjct  127  HKLQAEILTCLPSLPNIPDLHKLREELKTSIPLMDLIPSFSSWHVMEHLYSCLPELSSAG  186

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            NH +  VL S+KE            PITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS
Sbjct  187  NHIDPHVLESVKE------------PITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  234

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALI+TSFYPPVYYSFMC PFFCNLYLG I
Sbjct  235  YIMLRLDYAGIAALIATSFYPPVYYSFMCDPFFCNLYLGSI  275



>ref|XP_010936139.1| PREDICTED: heptahelical transmembrane protein ADIPOR3-like [Elaeis 
guineensis]
 ref|XP_010936140.1| PREDICTED: heptahelical transmembrane protein ADIPOR3-like [Elaeis 
guineensis]
 ref|XP_010936141.1| PREDICTED: heptahelical transmembrane protein ADIPOR3-like [Elaeis 
guineensis]
Length=404

 Score =   301 bits (772),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 180/221 (81%), Gaps = 17/221 (8%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLS+FTIHNETLNVWTHL+GFFLFL+LTIYTAMK+P VVD  +LQ+LPD L+KA L
Sbjct  64   LKQTLLSIFTIHNETLNVWTHLIGFFLFLALTIYTAMKVPQVVDLQSLQHLPDALKKAHL  123

Query  182  H-------ACLPSLLHIPDLHRLREELKTA------FPSLSNWHIVQLLTNCLPECFSNS  322
                    ACLPSL H+PDL RL++ELKT+      FPSL   H+++LL+NCLP+ FS++
Sbjct  124  QKIQSEIMACLPSLPHLPDLQRLKDELKTSLASMDMFPSLPRLHLLELLSNCLPQRFSHT  183

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            N TN     S K+D+ N+IAPL  RPI RWPFFAFLGGAMFCLLASS CHLLSCHS R++
Sbjct  184  NQTNW----SFKDDMANMIAPLLVRPIPRWPFFAFLGGAMFCLLASSACHLLSCHSRRVA  239

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALI+TSFYP VYYSFMC PFFCNLYLGFI
Sbjct  240  YIMLRLDYAGIAALITTSFYPMVYYSFMCNPFFCNLYLGFI  280



>ref|XP_007156701.1| hypothetical protein PHAVU_002G010000g [Phaseolus vulgaris]
 gb|ESW28695.1| hypothetical protein PHAVU_002G010000g [Phaseolus vulgaris]
Length=373

 Score =   297 bits (761),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/215 (71%), Positives = 166/215 (77%), Gaps = 31/215 (14%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +KQ LLS+FTIHNETLNVWTHLVGFF+FL+LT+YTAMKIP VVD  +LQ+ PD+L K DL
Sbjct  59   IKQVLLSMFTIHNETLNVWTHLVGFFIFLALTVYTAMKIPKVVDLNSLQHFPDILMKTDL  118

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
                     CLPS   IPDL RL+EE+       SNWHI + L NCLP            
Sbjct  119  QKLQSELLTCLPS---IPDLQRLKEEI-------SNWHIKEYLYNCLPH-----------  157

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
               S+KEDL NIIAPL  RPITRWPFFAFLGGAMFCLLASS CHLLSCHSER++YIMLRL
Sbjct  158  ---SVKEDLANIIAPLIIRPITRWPFFAFLGGAMFCLLASSVCHLLSCHSERMAYIMLRL  214

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI
Sbjct  215  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  249



>ref|XP_003611558.1| Adiponectin receptor protein [Medicago truncatula]
Length=316

 Score =   293 bits (749),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 166/215 (77%), Gaps = 30/215 (14%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +KQ LLS+F IHNETLNVWTHL+GFFLFL+LTIYTAMK+P  VD  +L +LPD L+ ADL
Sbjct  1    MKQVLLSIFRIHNETLNVWTHLIGFFLFLALTIYTAMKVPQAVDLSSLPHLPDFLKNADL  60

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H        CLPS+   PDL RLRE                LL NCLP  FS+SNHT+  
Sbjct  61   HKLQSELLTCLPSM---PDLQRLRE----------------LLYNCLPGRFSSSNHTD--  99

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
               ++KEDL NIIAPL  RPITRWPF+AFLGGAMFCLLASS CHLLSCHSER+SYIMLRL
Sbjct  100  --HNVKEDLANIIAPLVIRPITRWPFYAFLGGAMFCLLASSVCHLLSCHSERVSYIMLRL  157

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI
Sbjct  158  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  192



>ref|XP_004985131.1| PREDICTED: ADIPOR-like receptor CG5315-like isoform X2 [Setaria 
italica]
Length=387

 Score =   294 bits (752),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 171/209 (82%), Gaps = 14/209 (7%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L Q LLS F+IHNETLNVWTHL+GFF+FL+LTIYTA ++P+VVD  +L++LPDVLR AD+
Sbjct  68   LPQVLLSAFSIHNETLNVWTHLIGFFIFLALTIYTATQVPNVVDIQSLKHLPDVLRNADI  127

Query  182  HACLPSLLHIPDLHRLREELKTAFPSL-SNWHIVQLLTNCLPECFSNSNHTNVCVLSSMK  358
            H             +++ EL +  PSL S WH+++LL+NCLP  F+++N T++ VL SMK
Sbjct  128  H-------------KIQAELVSCLPSLPSRWHLLELLSNCLPHRFTHTNETSLSVLQSMK  174

Query  359  EDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIA  538
            +D+ N+IAP   RPI RWPFFAFLGGAMFCLLASSTCHLLSCHS RL+YIMLRLDYAGIA
Sbjct  175  DDIANMIAPELIRPIARWPFFAFLGGAMFCLLASSTCHLLSCHSRRLAYIMLRLDYAGIA  234

Query  539  ALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            ALI+TSFYPPVYYSFMCYPFFCNLYL FI
Sbjct  235  ALIATSFYPPVYYSFMCYPFFCNLYLSFI  263



>ref|XP_006572848.1| PREDICTED: uncharacterized protein LOC100778227 isoform X1 [Glycine 
max]
Length=366

 Score =   293 bits (750),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 150/215 (70%), Positives = 167/215 (78%), Gaps = 31/215 (14%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +KQ LLS FTIHNETLNVWTHL+GFF+FL+LTIYTAMKIP VVD  +LQ+ PD+L+KADL
Sbjct  52   IKQVLLSAFTIHNETLNVWTHLIGFFIFLALTIYTAMKIPKVVDLNSLQHFPDMLKKADL  111

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H        CLPS+   PDLHRLR+E+       S+WHI + L NCLP            
Sbjct  112  HKLQSEILTCLPSM---PDLHRLRDEI-------SSWHIKEYLYNCLP------------  149

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
               S+K+DL NIIAPL  RPITRWPFFAFLGGAMFCLLASS CHLLSCHS R++YIMLRL
Sbjct  150  --LSVKDDLANIIAPLMIRPITRWPFFAFLGGAMFCLLASSICHLLSCHSARMAYIMLRL  207

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  208  DYAGIAALISTSFYPPVYYSFMCDPFFCNLYLGFI  242



>ref|XP_008790240.1| PREDICTED: adiponectin receptor protein-like [Phoenix dactylifera]
Length=414

 Score =   294 bits (753),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 176/221 (80%), Gaps = 17/221 (8%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLS+FTIHNETLNVWTHL+GFFLFL+LTIYTAMK+P VVD  +LQ+LPD L++A L
Sbjct  74   LKQTLLSIFTIHNETLNVWTHLIGFFLFLALTIYTAMKVPQVVDLQSLQHLPDALKRAHL  133

Query  182  H-------ACLPSLLHIPDLHRLREELKTA------FPSLSNWHIVQLLTNCLPECFSNS  322
                    ACLPSL H+ DL RL++E KT+      FPSL   H+++LL+NCLP+ FS++
Sbjct  134  QKIQSEIMACLPSLPHLRDLQRLKDEFKTSLASMDMFPSLPRLHLLELLSNCLPQRFSHT  193

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            N TN     S K+D+ N+IAPL  RPI RWPFFAFLGGAMFCLLASS CHLLSCHS R +
Sbjct  194  NQTN----RSFKDDMANMIAPLLVRPIPRWPFFAFLGGAMFCLLASSACHLLSCHSRRFA  249

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALI+TSFYP VYYSFMC PFFCNLYL FI
Sbjct  250  YIMLRLDYAGIAALITTSFYPMVYYSFMCNPFFCNLYLSFI  290



>gb|AES94516.2| heptahelical protein [Medicago truncatula]
Length=375

 Score =   292 bits (748),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 166/215 (77%), Gaps = 30/215 (14%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +KQ LLS+F IHNETLNVWTHL+GFFLFL+LTIYTAMK+P  VD  +L +LPD L+ ADL
Sbjct  60   MKQVLLSIFRIHNETLNVWTHLIGFFLFLALTIYTAMKVPQAVDLSSLPHLPDFLKNADL  119

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H        CLPS+   PDL RLRE                LL NCLP  FS+SNHT+  
Sbjct  120  HKLQSELLTCLPSM---PDLQRLRE----------------LLYNCLPGRFSSSNHTD--  158

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
               ++KEDL NIIAPL  RPITRWPF+AFLGGAMFCLLASS CHLLSCHSER+SYIMLRL
Sbjct  159  --HNVKEDLANIIAPLVIRPITRWPFYAFLGGAMFCLLASSVCHLLSCHSERVSYIMLRL  216

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI
Sbjct  217  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  251



>ref|XP_010687835.1| PREDICTED: heptahelical transmembrane protein 4-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=408

 Score =   292 bits (748),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 171/221 (77%), Gaps = 13/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLS+FTIHNETLNVWTHL+GFFLFL+LTIYTA K+PDV D+  LQ+  ++L+KA L
Sbjct  64   LKQLLLSIFTIHNETLNVWTHLIGFFLFLTLTIYTATKVPDVGDYYPLQHFAEMLKKAGL  123

Query  182  H-------ACLPSLLHIPDLHRLREELKTAFP------SLSNWHIVQLLTNCLPECFSNS  322
            H        C+PSL  IP+   L+ EL+ + P      S+S WHI++ L  CLPE FS+ 
Sbjct  124  HDVHSKLVKCVPSLSSIPNFSTLKGELRASLPYINALSSVSGWHIIEHLAKCLPESFSHL  183

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            N T   +L SMK+ L+N IAP++  PITRWPF+AFLGGAMFCLLASS CHLL CHSERLS
Sbjct  184  NQTRDYLLWSMKDSLLNTIAPMSFHPITRWPFYAFLGGAMFCLLASSACHLLCCHSERLS  243

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALI+TSFYPPVYYSFMC PFFC LYL FI
Sbjct  244  YIMLRLDYAGIAALIATSFYPPVYYSFMCNPFFCYLYLSFI  284



>ref|XP_010664499.1| PREDICTED: heptahelical transmembrane protein 4 isoform X2 [Vitis 
vinifera]
Length=377

 Score =   289 bits (740),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 162/208 (78%), Gaps = 25/208 (12%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ +LS+FTIHNETLNVWTHL+GFFLFLSLTIYTAM++P+VVD  + Q+LPD LR+ADL
Sbjct  71   LKQVILSIFTIHNETLNVWTHLIGFFLFLSLTIYTAMRVPEVVDLRSFQHLPDFLRRADL  130

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
            H                            WH+++LL+NCLPE FS +N T+ CVL ++KE
Sbjct  131  HNI-------------------------RWHVLELLSNCLPERFSPTNQTSDCVLCAVKE  165

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
               N+IAPL  +PITRWPFFAFLGGAMFCLL+SS CHLLSCHSERLSYIMLRLDYAGIAA
Sbjct  166  GAANLIAPLMFQPITRWPFFAFLGGAMFCLLSSSICHLLSCHSERLSYIMLRLDYAGIAA  225

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            LISTSFYPPVYYSFMC PFFC LYLGFI
Sbjct  226  LISTSFYPPVYYSFMCNPFFCRLYLGFI  253



>gb|ABR16950.1| unknown [Picea sitchensis]
Length=432

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 164/221 (74%), Gaps = 13/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLS+FTIHNETLNVWTHLVGFF+FL LTIYT  K+P+VVD   + +L  +  + D 
Sbjct  88   LKQVLLSMFTIHNETLNVWTHLVGFFIFLCLTIYTVTKLPNVVDLARVHHLSHIPSRDDF  147

Query  182  HAC-------LPSLLHIPDLHRLREELKTAFPS------LSNWHIVQLLTNCLPECFSNS  322
            H         LPSL +  +  RL+ ELK A PS      LSNWH+  LL +CLPE  S+ 
Sbjct  148  HKLQRELMTFLPSLPNKVNFQRLQAELKIALPSMASLSSLSNWHLPDLLASCLPESLSHI  207

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            N T  CVL +MK+D+ N+IAP   RPITRWPFF FLGGAMFCLLASS+CHLLSCHSE  S
Sbjct  208  NRTEQCVLQTMKQDVANMIAPYLQRPITRWPFFVFLGGAMFCLLASSSCHLLSCHSELFS  267

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YIMLRLDYAGIAALISTSFYPPVYY+FMC PFF N+YLG I
Sbjct  268  YIMLRLDYAGIAALISTSFYPPVYYTFMCKPFFKNMYLGII  308



>ref|XP_007209192.1| hypothetical protein PRUPE_ppa006423mg [Prunus persica]
 gb|EMJ10391.1| hypothetical protein PRUPE_ppa006423mg [Prunus persica]
Length=412

 Score =   278 bits (712),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 173/220 (79%), Gaps = 12/220 (5%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ  LS+F+IHNETLNVWTHL+GFFLFL LTIYTA K PD++D  + Q LPD++RKA+ 
Sbjct  69   LKQVFLSIFSIHNETLNVWTHLIGFFLFLFLTIYTATKAPDIMDLSSFQRLPDMIRKAEF  128

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLS-----NWHIVQLLTNCLPECFSNSN  325
            +        CLPSL ++ D++RL++ELK + PS+      + +I +LL  CLPE FS++ 
Sbjct  129  YKIHPELLNCLPSLPNLSDIYRLKDELKPSLPSMDFISSVSGNIRELLAKCLPERFSHAY  188

Query  326  HTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSY  505
             T   VL  + +D++N++APL  RPITRWPFF FLGGAMFCLLASSTCHLL+CHS RLSY
Sbjct  189  QTENSVLHGVTDDVMNMVAPLMYRPITRWPFFVFLGGAMFCLLASSTCHLLACHSARLSY  248

Query  506  IMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            I+LR DYAGIAALI+TSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  249  IVLRCDYAGIAALITTSFYPPVYYSFMCNPFFCNLYLGFI  288



>ref|XP_008238506.1| PREDICTED: ADIPOR-like receptor IZH1 [Prunus mume]
 ref|XP_008238507.1| PREDICTED: ADIPOR-like receptor IZH1 [Prunus mume]
Length=412

 Score =   276 bits (705),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 139/220 (63%), Positives = 173/220 (79%), Gaps = 12/220 (5%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ  LS+F+IHNETLNVWTHL+GFFLFL LTIYTA K PD++D  + Q LPD++RKA+ 
Sbjct  69   LKQVFLSIFSIHNETLNVWTHLIGFFLFLFLTIYTATKAPDIMDLSSFQRLPDMIRKAEF  128

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLS-----NWHIVQLLTNCLPECFSNSN  325
            +        CLPSL ++ D++RL++ELK + PS+      + +I +LL  C+P+ FS++ 
Sbjct  129  YKIHPELVNCLPSLPNLSDIYRLKDELKPSLPSMDFISSVSGNIRELLAKCVPKRFSHAY  188

Query  326  HTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSY  505
             T   VL  + +D++N++APL  RPITRWPFF FLGGAMFCLLASSTCHLL+CHS RLSY
Sbjct  189  QTENSVLHGVTDDVMNMVAPLMYRPITRWPFFVFLGGAMFCLLASSTCHLLACHSARLSY  248

Query  506  IMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            I+LR DYAGIAALI+TSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  249  IVLRCDYAGIAALITTSFYPPVYYSFMCNPFFCNLYLGFI  288



>ref|XP_006590276.1| PREDICTED: uncharacterized protein LOC100776175 isoform X2 [Glycine 
max]
 ref|XP_006590277.1| PREDICTED: uncharacterized protein LOC100776175 isoform X3 [Glycine 
max]
Length=360

 Score =   274 bits (700),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 160/215 (74%), Gaps = 37/215 (17%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            ++Q LLS FTIHNETLNVWTHL+GFF+FL+LTIYTAM      +  +LQ  PD+L+KADL
Sbjct  52   IRQVLLSAFTIHNETLNVWTHLIGFFIFLALTIYTAM------NLNSLQQFPDMLKKADL  105

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H        CLPS+   PDLH LRE        +S+WHI + L NCLP            
Sbjct  106  HKLQSEILTCLPSM---PDLHILRE-------GISSWHIKEYLYNCLPH-----------  144

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
               S+K+DL NIIAPL  RPITRWPFFAFLGGAMFCLLASS CHLLSCHS R++YIMLRL
Sbjct  145  ---SVKDDLANIIAPLMIRPITRWPFFAFLGGAMFCLLASSICHLLSCHSARMAYIMLRL  201

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI
Sbjct  202  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  236



>ref|XP_009797606.1| PREDICTED: heptahelical transmembrane protein 4-like isoform 
X3 [Nicotiana sylvestris]
Length=287

 Score =   268 bits (686),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 149/183 (81%), Gaps = 19/183 (10%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQALLSVFTIHNETLNVWTHL+GF LFL LTIYTAMK+PD+VD  TLQNLP+ LRKADL
Sbjct  75   LKQALLSVFTIHNETLNVWTHLIGFILFLVLTIYTAMKVPDIVDLQTLQNLPEKLRKADL  134

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H        C+PSL H+PDLH+LRE+L            +QLL+NCLPE FSNSN T+V 
Sbjct  135  HKLQAELLPCIPSLPHMPDLHKLREDL------------LQLLSNCLPERFSNSNRTDVG  182

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
            VL S+KED+ N+IAPL   PITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL
Sbjct  183  VLRSVKEDVANMIAPLLVTPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  242

Query  521  DYA  529
            DYA
Sbjct  243  DYA  245



>gb|KEH35830.1| hemolysin-III-like protein [Medicago truncatula]
Length=396

 Score =   263 bits (671),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/220 (63%), Positives = 171/220 (78%), Gaps = 23/220 (10%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ +LS+F+IHNETLNVWTHL+GFFLFL LTIYTAM+ P +VD  +LQ+LPDV+ KADL
Sbjct  64   LKQIILSIFSIHNETLNVWTHLIGFFLFLFLTIYTAMRAPMIVD--SLQHLPDVIGKADL  121

Query  182  HA-------CLPSLLHIPDLHRLREELKTA-----FPSLSNWHIVQLLTNCLPECFSNSN  325
                     CLPSL +I +LH+ + EL T+     F SLS W++++ +T CLPE FS   
Sbjct  122  KKIHEELLKCLPSLPNITNLHKFKNELSTSLHALNFSSLSGWNVMEHVTKCLPEHFS---  178

Query  326  HTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSY  505
                  L+ +K++ ++ ++P    PITRWPF+AFLGGAMFCLLASSTCHLL+CHS+RLSY
Sbjct  179  ------LNGLKDETMDFVSPSIVPPITRWPFYAFLGGAMFCLLASSTCHLLACHSQRLSY  232

Query  506  IMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            IMLR+DYAGIAALI+TSFYPPVYYSFMC PFFC LYLGFI
Sbjct  233  IMLRIDYAGIAALIATSFYPPVYYSFMCNPFFCYLYLGFI  272



>ref|XP_002510080.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52267.1| conserved hypothetical protein [Ricinus communis]
Length=416

 Score =   262 bits (670),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 167/221 (76%), Gaps = 13/221 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLS+F IHNETLN WTHL+GFFLFL LT+YT+M++PDV D  +LQ LPD+L+KAD 
Sbjct  72   LKQVLLSIFKIHNETLNFWTHLIGFFLFLFLTVYTSMQVPDVADISSLQRLPDMLQKADF  131

Query  182  HA-------CLPSLLHIPDLHRLREELKT-----AFPSLSNWHIVQLLTNCLPECFSNSN  325
            H        CLPSL ++PDLH  + +LK+      F S  + + ++LL NCLPE ++   
Sbjct  132  HNIHLDLLNCLPSLPNMPDLHNFKVDLKSYLLPMEFLSSLSENFLELLINCLPERYARMY  191

Query  326  H-TNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            H  N   L S+  D  N+  P T  P+TRWPFFAF+GGAMFCLLASSTCHLLSCHSER+S
Sbjct  192  HEANDNALQSLTNDFSNMTTPPTFHPVTRWPFFAFMGGAMFCLLASSTCHLLSCHSERMS  251

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YI+ R+DYAGIAALI+TSFYPPVYYSF+C PFFCN+YLGFI
Sbjct  252  YIVHRVDYAGIAALIATSFYPPVYYSFLCNPFFCNIYLGFI  292



>ref|XP_004300330.1| PREDICTED: heptahelical transmembrane protein 4-like [Fragaria 
vesca subsp. vesca]
Length=399

 Score =   261 bits (667),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 167/214 (78%), Gaps = 7/214 (3%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ  LS+F+IHNETLNVWTHL+GFFLFL LTIYTA + P+++D   LQ LPD++R AD 
Sbjct  63   LKQVFLSMFSIHNETLNVWTHLIGFFLFLFLTIYTATRAPEIIDLHYLQRLPDMIRSADF  122

Query  182  HACLPSLLH-IPDLHRLREELKTAFPSLS-----NWHIVQLLTNCLPECFSNSNHTNVCV  343
            H   P LL+ +P L  L  + KT+ PS+      + ++V+L+TNCLPE  S+S   +  V
Sbjct  123  HKIHPELLNCLPSLPNL-SDFKTSLPSMDFLSSVSGNLVELVTNCLPERLSHSYQADNSV  181

Query  344  LSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLD  523
               + +D+++++APL  RPITRWPFFAFLGGAMFCLLASS CHLL+CHS RLSYI+LR D
Sbjct  182  PHGVTDDVMDMVAPLMVRPITRWPFFAFLGGAMFCLLASSACHLLACHSARLSYIVLRCD  241

Query  524  YAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YAGIAALI+TSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  242  YAGIAALIATSFYPPVYYSFMCNPFFCNLYLGFI  275



>ref|XP_009371039.1| PREDICTED: heptahelical transmembrane protein 4-like [Pyrus x 
bretschneideri]
Length=397

 Score =   259 bits (661),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 165/214 (77%), Gaps = 15/214 (7%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ  LS+F+IHNETLNVWTHL+GFFLFL LTIYTA K PD++D  +LQ L D++R+ADL
Sbjct  69   LKQVFLSIFSIHNETLNVWTHLIGFFLFLFLTIYTATKAPDLMDLSSLQRLSDMIRRADL  128

Query  182  HACLPSLLH-IPDLHRLREELKTAFPSLS-----NWHIVQLLTNCLPECFSNSNHTNVCV  343
            H   P LL+ +P L         AFPS+      + +I +LL NCLPE FS++N T   V
Sbjct  129  HKIHPELLNCLPSL---------AFPSMDFLSSVSGNIRELLANCLPERFSHANQTENSV  179

Query  344  LSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLD  523
            L  + +D++N++APL  + ITRWPFFAFLGGAMFCLLASSTCHLL+CHS RLSYI+LR D
Sbjct  180  LHGITDDVMNMVAPLMNQSITRWPFFAFLGGAMFCLLASSTCHLLACHSARLSYIVLRCD  239

Query  524  YAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YAGIAALI+TSFYPPVYYSFMC PFF NLYL FI
Sbjct  240  YAGIAALITTSFYPPVYYSFMCNPFFRNLYLSFI  273



>ref|XP_008373649.1| PREDICTED: adiponectin receptor protein-like [Malus domestica]
Length=397

 Score =   259 bits (661),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 165/214 (77%), Gaps = 15/214 (7%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ  LS+F+IHNETLNVWTHL+GFFLFL LTIYTA K PD++D  +LQ L D++R+ADL
Sbjct  69   LKQVFLSIFSIHNETLNVWTHLIGFFLFLFLTIYTATKAPDLMDLSSLQRLSDMIRRADL  128

Query  182  HACLPSLLH-IPDLHRLREELKTAFPSLS-----NWHIVQLLTNCLPECFSNSNHTNVCV  343
            H   P LL+ +P L         AFPS+      + +I +LL NCLP+ FS++N T   +
Sbjct  129  HKIHPELLNCLPSL---------AFPSMDFLSSVSGNIRELLANCLPDRFSHANQTENSI  179

Query  344  LSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLD  523
            L  + +D++N++APL  R ITRWPFFAFLGGAMFCLLASSTCHLL+CHS RLSYI+LR D
Sbjct  180  LHGVTDDVMNMVAPLMNRSITRWPFFAFLGGAMFCLLASSTCHLLACHSARLSYIVLRCD  239

Query  524  YAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YAGIAALI+TSFYPPVYYSFMC PFF NLYL FI
Sbjct  240  YAGIAALITTSFYPPVYYSFMCNPFFRNLYLSFI  273



>ref|XP_008340762.1| PREDICTED: adiponectin receptor protein-like [Malus domestica]
Length=397

 Score =   258 bits (660),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 161/214 (75%), Gaps = 15/214 (7%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ  LS+F+IHNETLNVWTHL+GFFLFL LTIYTA K PD++D  +LQ L D++R+ADL
Sbjct  69   LKQVFLSIFSIHNETLNVWTHLIGFFLFLFLTIYTATKAPDLMDLSSLQRLSDMIRRADL  128

Query  182  HACLPSLLH-IPDLHRLREELKTAFPSLS-----NWHIVQLLTNCLPECFSNSNHTNVCV  343
            H   P LL+ +P L         + PS+      + +I +LL NCLP+ FS+ N T   V
Sbjct  129  HRIHPELLNCLPSL---------SLPSMDFXXSXSGNIRELLANCLPDRFSHGNQTENSV  179

Query  344  LSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLD  523
            L  + +D++N +APL  RPITRWPFF FLGGAMFCLLASSTCHLLSCHS RLSYI+ R D
Sbjct  180  LDGVTDDVMNXVAPLMYRPITRWPFFVFLGGAMFCLLASSTCHLLSCHSARLSYIVHRCD  239

Query  524  YAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YAGIAALI TSFYPPVYYSFMC PF CNLYLGFI
Sbjct  240  YAGIAALIVTSFYPPVYYSFMCNPFLCNLYLGFI  273



>ref|XP_008353207.1| PREDICTED: adiponectin receptor protein-like [Malus domestica]
Length=397

 Score =   258 bits (660),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 161/214 (75%), Gaps = 15/214 (7%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ  LS+F+IHNETLNVWTHL+GFFLFL LTIYTA K PD++D  +LQ L D++R+ADL
Sbjct  69   LKQVFLSIFSIHNETLNVWTHLIGFFLFLFLTIYTATKAPDLMDLSSLQRLSDMIRRADL  128

Query  182  HACLPSLLH-IPDLHRLREELKTAFPSLS-----NWHIVQLLTNCLPECFSNSNHTNVCV  343
            H   P LL+ +P L         + PS+      + +I +LL NCLP+ FS+ N T   V
Sbjct  129  HRIHPELLNCLPSL---------SLPSMDFLSSVSGNIRELLANCLPDRFSHGNQTENSV  179

Query  344  LSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLD  523
            L  + +D++N +APL  RPITRWPFF FLGGAMFCLLASSTCHLLSCHS RLSYI+ R D
Sbjct  180  LDGVTDDVMNXVAPLMYRPITRWPFFVFLGGAMFCLLASSTCHLLSCHSARLSYIVHRCD  239

Query  524  YAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YAGIAALI TSFYPPVYYSFMC PF CNLYLGFI
Sbjct  240  YAGIAALIVTSFYPPVYYSFMCNPFLCNLYLGFI  273



>ref|XP_006581272.1| PREDICTED: adiponectin receptor protein 2-like isoform X1 [Glycine 
max]
 ref|XP_006581273.1| PREDICTED: adiponectin receptor protein 2-like isoform X2 [Glycine 
max]
 ref|XP_006581274.1| PREDICTED: adiponectin receptor protein 2-like isoform X3 [Glycine 
max]
Length=402

 Score =   256 bits (653),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 174/220 (79%), Gaps = 24/220 (11%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ  LS+F+IHNETLNVWTHL+GFFLFL LTIYTA + P +VDF ++Q+L +++ KADL
Sbjct  71   LKQIFLSIFSIHNETLNVWTHLIGFFLFLFLTIYTAKRAPMIVDFNSVQHLSEMIGKADL  130

Query  182  HA-------CLPSLLHIPDLHRLREELKTA-----FPSLSNWHIVQLLTNCLPECFSNSN  325
            +        CLPSL ++P++ +L  +L T+     F SLS W +V+LLTNCLPE FS   
Sbjct  131  NKIRLELLKCLPSLPNMPEILKL-NDLSTSLYSLDFSSLSGWALVELLTNCLPEQFS---  186

Query  326  HTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSY  505
                  L+ +K+D+ N+++PL  +PITRWPF+AFLGGAMFCLLASSTCHLL+CHS+RLSY
Sbjct  187  ------LNGLKDDM-NMVSPLM-QPITRWPFYAFLGGAMFCLLASSTCHLLTCHSQRLSY  238

Query  506  IMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            IMLR+DYAGIAALI+TSFYPPVYYSFMC PFFC LYLGFI
Sbjct  239  IMLRIDYAGIAALIATSFYPPVYYSFMCNPFFCYLYLGFI  278



>ref|XP_003523624.1| PREDICTED: adiponectin receptor protein 1-like [Glycine max]
Length=402

 Score =   254 bits (648),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 171/219 (78%), Gaps = 22/219 (10%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ  LS+F+IHNETLNVWTHL+GFFLFL LTIYTAM+ P VVDF ++Q+L +++ KADL
Sbjct  71   LKQIFLSIFSIHNETLNVWTHLIGFFLFLFLTIYTAMRAPMVVDFNSVQDLSEMIGKADL  130

Query  182  H-------ACLPSLLHIPD---LHRLREELKT-AFPSLSNWHIVQLLTNCLPECFSNSNH  328
            +        CL SL ++P+   L+ L E L +  F SLS W +V+LLTNCLPE FS    
Sbjct  131  NMIRLDLLKCLASLPNMPEILKLNDLSESLYSLDFSSLSGWTLVELLTNCLPEQFS----  186

Query  329  TNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYI  508
                 L+ +K D+ N+++PL  +PITRWPF+AFLGGAMFCLLASS CHLL+CHS+RLSYI
Sbjct  187  -----LNGLKGDM-NMVSPLM-QPITRWPFYAFLGGAMFCLLASSACHLLTCHSQRLSYI  239

Query  509  MLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            MLR+DYAGIAALI+TSFYPPVYYSFMC PFFC LYLGFI
Sbjct  240  MLRIDYAGIAALIATSFYPPVYYSFMCNPFFCYLYLGFI  278



>ref|XP_004501515.1| PREDICTED: ADIPOR-like receptor CG5315-like [Cicer arietinum]
Length=403

 Score =   251 bits (640),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 137/220 (62%), Positives = 167/220 (76%), Gaps = 23/220 (10%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK   LS+F+IHNETLNVWTHL+GFFLFL LTIYTAM+ P VVD  +LQ+L + L KADL
Sbjct  71   LKHVFLSIFSIHNETLNVWTHLIGFFLFLFLTIYTAMRTPTVVD--SLQHLHEFLGKADL  128

Query  182  HA-------CLPSLLHIPDLHRLREELKTA-----FPSLSNWHIVQLLTNCLPECFSNSN  325
            +        CL SL  +PDLH+++ EL T+     F SLS  +I++LLT+C P+ FS + 
Sbjct  129  NKIHEELLKCLHSLPIMPDLHKIKNELSTSLHSMNFSSLSGLNIIELLTSCFPKKFSPNE  188

Query  326  HTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSY  505
                     +K++ +  ++P   +PITRWPF+AFLGGAMFCLLASSTCHLL+CHS+RLSY
Sbjct  189  ---------LKDETMEFVSPSIIQPITRWPFYAFLGGAMFCLLASSTCHLLACHSQRLSY  239

Query  506  IMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            IMLR+DYAGIAALISTSFYPPVYYSFMC PFFC LYLGFI
Sbjct  240  IMLRIDYAGIAALISTSFYPPVYYSFMCNPFFCFLYLGFI  279



>gb|KDP41605.1| hypothetical protein JCGZ_16012 [Jatropha curcas]
Length=409

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/220 (60%), Positives = 162/220 (74%), Gaps = 18/220 (8%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLS+F IHNETLNVWTHL+GFFLFL LT+YTA ++PDV      ++LPD+LRK D 
Sbjct  72   LKQVLLSIFKIHNETLNVWTHLIGFFLFLFLTVYTASEVPDVA-----EHLPDMLRKTDF  126

Query  182  HA-------CLPSLLHIPDLHRLREELKTA-----FPSLSNWHIVQLLTNCLPECFSNSN  325
            H        CLPSL ++PDL + +E+L+ +     F S  + + V+ LTNCLPE F+   
Sbjct  127  HKIHLDLMKCLPSLPNMPDLQKFKEDLRLSLLRMEFLSSLSGNFVERLTNCLPERFTRM-  185

Query  326  HTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSY  505
            + +  +    + D+  +IAPL   PITRWPFFAFL GAMFCLLASS CHLLSCHSER+SY
Sbjct  186  YNDSILQQGTENDMSKMIAPLMFHPITRWPFFAFLAGAMFCLLASSICHLLSCHSERMSY  245

Query  506  IMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            I+ R+DYAGIAALI+TSFYPPVYYSFMC P  CNLYLGFI
Sbjct  246  IVHRVDYAGIAALIATSFYPPVYYSFMCNPLLCNLYLGFI  285



>ref|XP_011466189.1| PREDICTED: heptahelical transmembrane protein 4-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=278

 Score =   241 bits (615),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 130/152 (86%), Gaps = 6/152 (4%)
 Frame = +2

Query  188  CLPSLLHIPDLHRLREELKTAFPS------LSNWHIVQLLTNCLPECFSNSNHTNVCVLS  349
            CLPSL ++P L++LREELKT+ PS      LS WH+++LL NCLP+ FS+ NHT+VCVL 
Sbjct  3    CLPSLPNMPALNKLREELKTSLPSMDLLPSLSGWHVMELLNNCLPQRFSHGNHTDVCVLH  62

Query  350  SMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYA  529
            SMKEDL NIIAPL  RPITRWPFFAFLGGAMFCLL+SS CHLLSCHSER SYIMLRLDYA
Sbjct  63   SMKEDLANIIAPLVMRPITRWPFFAFLGGAMFCLLSSSACHLLSCHSERTSYIMLRLDYA  122

Query  530  GIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            GIAALISTSFYP VYYSFMC PFFC LY+GFI
Sbjct  123  GIAALISTSFYPLVYYSFMCNPFFCTLYMGFI  154



>ref|XP_009138522.1| PREDICTED: adiponectin receptor protein 2-like isoform X2 [Brassica 
rapa]
Length=289

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 141/178 (79%), Gaps = 15/178 (8%)
 Frame = +2

Query  98   IYTAMKIPDVVDFPTLQN-LPDVLRKADLHACLPSLLHIPDLHRLREELKTAFPSL-SNW  271
            ++   K+P VVD  +LQ+ LPD+LRK DLH             +L  +L +  PS  S W
Sbjct  1    MFGPTKVPSVVDLHSLQDRLPDILRKTDLH-------------KLHSDLMSHLPSSPSKW  47

Query  272  HIVQLLTNCLPECFSNSNHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCL  451
            H+++LL NCLPE FS+ N+T++CVL S+KEDL N+IAPL  RPITRWPF+AFLGGAMFCL
Sbjct  48   HVMELLYNCLPERFSHGNYTDMCVLHSVKEDLANMIAPLIFRPITRWPFYAFLGGAMFCL  107

Query  452  LASSTCHLLSCHSERLSYIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            LASSTCHLLSCHSER+SYIMLRLDYAGIAALI+TSFYPPVYYSFMC PFFCNLYLGFI
Sbjct  108  LASSTCHLLSCHSERVSYIMLRLDYAGIAALIATSFYPPVYYSFMCDPFFCNLYLGFI  165



>ref|XP_006472313.1| PREDICTED: adiponectin receptor protein 1-like [Citrus sinensis]
Length=382

 Score =   243 bits (620),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 156/215 (73%), Gaps = 26/215 (12%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLS+F+IHNETLNVWTHL+GFFLFL LTIYTAM++P VV   +LQ   D+L  AD 
Sbjct  63   LKQILLSIFSIHNETLNVWTHLIGFFLFLFLTIYTAMRVPAVVHLDSLQRFRDMLPVADW  122

Query  182  H-------ACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H       +C PS+ +IPD HRL + LK       +W  +  LT+ L  C          
Sbjct  123  HKIQEQLLSCFPSMPNIPDPHRLMDVLKIKM----SWPSMDFLTS-LSAC----------  167

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
                +K+D+VN +AP+T + ITRWP F FLGGAMFCLLASSTCHLL CHSERLSYIMLRL
Sbjct  168  ----LKDDVVNKVAPITVQAITRWPIFTFLGGAMFCLLASSTCHLLCCHSERLSYIMLRL  223

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPP+YYSFMCYPF CNLYLGFI
Sbjct  224  DYAGIAALISTSFYPPIYYSFMCYPFLCNLYLGFI  258



>gb|KDO81490.1| hypothetical protein CISIN_1g016259mg [Citrus sinensis]
Length=392

 Score =   243 bits (621),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 156/215 (73%), Gaps = 26/215 (12%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLS+F+IHNETLNVWTHL+GFFLFL LTIYTAM++P VV   +LQ   D+L  AD 
Sbjct  73   LKQILLSIFSIHNETLNVWTHLIGFFLFLFLTIYTAMRVPAVVHLDSLQRFRDMLPVADW  132

Query  182  H-------ACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H       +C PS+ +IPD HRL + LK       +W  +  LT+ L  C          
Sbjct  133  HKIQEQLLSCFPSMPNIPDPHRLMDVLKIKM----SWPSMDFLTS-LSAC----------  177

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
                +K+D+VN +AP+T + ITRWP F FLGGAMFCLLASSTCHLL CHSERLSYIMLRL
Sbjct  178  ----LKDDVVNKLAPITVQAITRWPIFTFLGGAMFCLLASSTCHLLCCHSERLSYIMLRL  233

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPP+YYSFMCYPF CNLYLGFI
Sbjct  234  DYAGIAALISTSFYPPIYYSFMCYPFLCNLYLGFI  268



>ref|XP_006433647.1| hypothetical protein CICLE_v10001488mg [Citrus clementina]
 ref|XP_006433648.1| hypothetical protein CICLE_v10001488mg [Citrus clementina]
 gb|ESR46887.1| hypothetical protein CICLE_v10001488mg [Citrus clementina]
 gb|ESR46888.1| hypothetical protein CICLE_v10001488mg [Citrus clementina]
 gb|KDO81491.1| hypothetical protein CISIN_1g016259mg [Citrus sinensis]
Length=382

 Score =   243 bits (619),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 156/215 (73%), Gaps = 26/215 (12%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ LLS+F+IHNETLNVWTHL+GFFLFL LTIYTAM++P VV   +LQ   D+L  AD 
Sbjct  63   LKQILLSIFSIHNETLNVWTHLIGFFLFLFLTIYTAMRVPAVVHLDSLQRFRDMLPVADW  122

Query  182  H-------ACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            H       +C PS+ +IPD HRL + LK       +W  +  LT+ L  C          
Sbjct  123  HKIQEQLLSCFPSMPNIPDPHRLMDVLKIKM----SWPSMDFLTS-LSAC----------  167

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
                +K+D+VN +AP+T + ITRWP F FLGGAMFCLLASSTCHLL CHSERLSYIMLRL
Sbjct  168  ----LKDDVVNKLAPITVQAITRWPIFTFLGGAMFCLLASSTCHLLCCHSERLSYIMLRL  223

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            DYAGIAALISTSFYPP+YYSFMCYPF CNLYLGFI
Sbjct  224  DYAGIAALISTSFYPPIYYSFMCYPFLCNLYLGFI  258



>ref|XP_010943142.1| PREDICTED: heptahelical transmembrane protein 4-like [Elaeis 
guineensis]
Length=333

 Score =   240 bits (613),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 153/209 (73%), Gaps = 27/209 (13%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK+ +LS+F+IHNETLN+WTHL+GF +FLSLT++TAM IP    FP++Q+          
Sbjct  27   LKETILSIFSIHNETLNIWTHLIGFLIFLSLTVFTAMMIPKDAPFPSMQH----------  76

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFS-NSNHTNVCVLSSMK  358
                              EL+ A P+L +WH+ +LL NCLP+ FS  SN T+ CVL+S+K
Sbjct  77   ----------------PGELENAMPALISWHLPELLVNCLPKRFSYASNVTDPCVLTSVK  120

Query  359  EDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIA  538
            +D+ +II+PL  +P+TRWPFFAFL GAMFCLL SS CHL+ CHSER+++IMLRLDY GIA
Sbjct  121  DDVTSIISPLLMKPVTRWPFFAFLCGAMFCLLTSSICHLILCHSERMAFIMLRLDYVGIA  180

Query  539  ALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            ALI TSFYP VYYSFMC PF+C+LY+GFI
Sbjct  181  ALIVTSFYPLVYYSFMCQPFYCHLYMGFI  209



>ref|XP_007136770.1| hypothetical protein PHAVU_009G072600g [Phaseolus vulgaris]
 gb|ESW08764.1| hypothetical protein PHAVU_009G072600g [Phaseolus vulgaris]
Length=457

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 165/219 (75%), Gaps = 21/219 (10%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ  LS+F+IHNETLNVWTHL+GFFLFL LTIYTA K P V DF ++Q+L +++ KADL
Sbjct  125  LKQIFLSIFSIHNETLNVWTHLMGFFLFLFLTIYTAAKSPMVADFNSVQHLSELIGKADL  184

Query  182  HA-------CLPSLLHIPDLHRLREELKTAFPSLS----NWHIVQLLTNCLPECFSNSNH  328
            ++       CLPSL ++ ++ +L +   +           W +V+LLTNCLPE FS    
Sbjct  185  NSIRLELLKCLPSLPNMHEILKLNDLSTSLHSLDLSSLSGWTVVELLTNCLPEQFS----  240

Query  329  TNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYI  508
                 L+ +K D+ N+++PL  +PITRWPF+AFLGGAMFCLLASSTCHLL+CHS+RLSYI
Sbjct  241  -----LNGLKGDM-NMVSPLMVQPITRWPFYAFLGGAMFCLLASSTCHLLACHSQRLSYI  294

Query  509  MLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            MLR+DYAGI+ALI+TSFYPPVYY+FMC PF C LYLGFI
Sbjct  295  MLRIDYAGISALIATSFYPPVYYTFMCNPFSCYLYLGFI  333



>ref|XP_008340785.1| PREDICTED: adiponectin receptor protein 1-like [Malus domestica]
Length=397

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 154/214 (72%), Gaps = 15/214 (7%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ  LS+F+IHN+TLNVWTHL+GFFLFL LTIYTA K PD++D  +LQ L D++R+ADL
Sbjct  69   LKQVFLSIFSIHNZTLNVWTHLIGFFLFLFLTIYTATKAPDLMDLSSLQRLSDMIRRADL  128

Query  182  HACLPSLLH-IPDLHRLREELKTAFPSLS-----NWHIVQLLTNCLPECFSNSNHTNVCV  343
            H   P LL+ +P L         + PS+      + +I +LL NCLP+ FS+ N T   V
Sbjct  129  HRIHPELLNCLPSL---------SLPSMDFXXSXSGNIRELLANCLPDRFSHGNQTENSV  179

Query  344  LSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLD  523
            L  + +D++N++APL  RPITR PFF FLGG MFCLLASSTCH ++CHS RLS I  R D
Sbjct  180  LDGVXDDVMNMVAPLMYRPITRRPFFVFLGGVMFCLLASSTCHXVACHSARLSXIXXRCD  239

Query  524  YAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YAGI  LI TSFYP VYYSFMC PF CNLYLGFI
Sbjct  240  YAGIXXLIXTSFYPXVYYSFMCNPFLCNLYLGFI  273



>ref|XP_008795674.1| PREDICTED: uncharacterized protein LOC103711343 [Phoenix dactylifera]
Length=435

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/214 (56%), Positives = 157/214 (73%), Gaps = 12/214 (6%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK+ +LS+F+IHNETLNVWTHL+GF  FL LT++TAM IP     P++Q      +   L
Sbjct  104  LKETILSIFSIHNETLNVWTHLIGFLFFLFLTVFTAMMIPRDATVPSMQ------QSGQL  157

Query  182  HACLPSLLHIPDLHRLRE-----ELKTAFPSLSNWHIVQLLTNCLPECFSNS-NHTNVCV  343
                 S++    + RL       EL+T  P+L +WH+ +LL NCLP+ FS++ NHT+ CV
Sbjct  158  TETNSSIVQSGVIDRLSSPLRAGELETTMPALGSWHVPELLVNCLPKRFSHAGNHTDPCV  217

Query  344  LSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLD  523
            L+S+K D+ +II+PL  +P+TRWPFFAFL GAMFCLL SS CHL+ CHSER++YIMLRLD
Sbjct  218  LASVKNDVTSIISPLLMQPVTRWPFFAFLCGAMFCLLTSSMCHLILCHSERMAYIMLRLD  277

Query  524  YAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            Y GI ALI TSFYP V+YSF+C PF+C+LY+GFI
Sbjct  278  YIGITALIVTSFYPLVFYSFVCQPFYCHLYMGFI  311



>gb|ABK22411.1| unknown [Picea sitchensis]
Length=355

 Score =   232 bits (591),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 148/208 (71%), Gaps = 11/208 (5%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK  LLS+FTIHNETLNVWTHL GF LFL LTIYTA K+P+V D P + N  ++ R  + 
Sbjct  35   LKHTLLSIFTIHNETLNVWTHLAGFVLFLCLTIYTATKLPNVADLP-VPNKANLYRLQNE  93

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                P  +++P++  L+ EL+T+ P   NW     + NC+P  FS SN T  C+L ++KE
Sbjct  94   IRAWP--MYLPNMAELQAELRTSLP---NW-----VGNCIPGNFSYSNQTEHCILQTIKE  143

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
            D+ N++ P + RPITRWPF  FLG A +CL AS+T HLLSCHS+RL YIMLRLDY+GI A
Sbjct  144  DVTNMVFPHSQRPITRWPFLVFLGAATYCLFASATFHLLSCHSKRLYYIMLRLDYSGIVA  203

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            LI+ SFYPPVYYSFMC PFF  LYL  I
Sbjct  204  LIAASFYPPVYYSFMCAPFFRKLYLTAI  231



>ref|XP_010939046.1| PREDICTED: heptahelical transmembrane protein 4-like [Elaeis 
guineensis]
Length=436

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/216 (55%), Positives = 157/216 (73%), Gaps = 15/216 (7%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L++ +LS+F+IHNETLNVWTHL+GF +FLSLTI+TA  IP  ++ P++Q     + +A L
Sbjct  104  LRETILSIFSIHNETLNVWTHLIGFLIFLSLTIFTATMIPREMNVPSMQQSSSQVTEASL  163

Query  182  H-------ACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNS-NHTNV  337
                    ACLPS L +       +EL+T+ P+ S WH+ +LL NCLP+ FS++ N TN 
Sbjct  164  PMKQSGVIACLPSPLPV-------DELETSTPASSIWHLPELLVNCLPKRFSHARNITNP  216

Query  338  CVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLR  517
            C+L S+ + + NII+ L  + +TRWPFFAFL GAMFCLL SS CHL+ CHS+R +YIMLR
Sbjct  217  CILISVTDHMANIISQLLMKEVTRWPFFAFLCGAMFCLLTSSICHLIFCHSKRTAYIMLR  276

Query  518  LDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            LDY GI ALI TSFYP VYYSF+C PF+C+LY+ FI
Sbjct  277  LDYTGITALIVTSFYPLVYYSFLCEPFYCHLYMSFI  312



>ref|XP_010687843.1| PREDICTED: heptahelical transmembrane protein ADIPOR3-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=317

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/193 (60%), Positives = 140/193 (73%), Gaps = 13/193 (7%)
 Frame = +2

Query  86   LSLTIYTAMKIPDVVDFPTLQNLPDVLRKADLH-------ACLPSLLHIPDLHRLREELK  244
            + L ++   K+PDV D+  LQ+  ++L+KA LH        C+PSL  IP+   L+ EL+
Sbjct  1    MRLLMFGPTKVPDVGDYYPLQHFAEMLKKAGLHDVHSKLVKCVPSLSSIPNFSTLKGELR  60

Query  245  TAFP------SLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKEDLVNIIAPLTTRPIT  406
             + P      S+S WHI++ L  CLPE FS+ N T   +L SMK+ L+N IAP++  PIT
Sbjct  61   ASLPYINALSSVSGWHIIEHLAKCLPESFSHLNQTRDYLLWSMKDSLLNTIAPMSFHPIT  120

Query  407  RWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAALISTSFYPPVYYSFM  586
            RWPF+AFLGGAMFCLLASS CHLL CHSERLSYIMLRLDYAGIAALI+TSFYPPVYYSFM
Sbjct  121  RWPFYAFLGGAMFCLLASSACHLLCCHSERLSYIMLRLDYAGIAALIATSFYPPVYYSFM  180

Query  587  CYPFFCNLYLGFI  625
            C PFFC LYL FI
Sbjct  181  CNPFFCYLYLSFI  193



>ref|XP_008810106.1| PREDICTED: uncharacterized protein LOC103721614 [Phoenix dactylifera]
Length=645

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 154/216 (71%), Gaps = 15/216 (7%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK  +LS+F+IHNETLNVWTHL+GF +FLSLT  TAM IP  ++ P++Q+   ++ + +L
Sbjct  68   LKDTILSIFSIHNETLNVWTHLIGFLIFLSLTALTAMMIPREMNVPSMQHSSSLVTETNL  127

Query  182  H-------ACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNS-NHTNV  337
                    ACLPS L +       +E K + P+LS+WH+ +LL NC P  FS++ N TN 
Sbjct  128  SMGQPGVIACLPSPLPV-------DESKNSTPALSSWHLPELLVNCFPRRFSHARNITNP  180

Query  338  CVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLR  517
            C L+S+   + N  +PL  + ++RWPFFAFL GAMFCLL SS CHL+ CHSER++Y+MLR
Sbjct  181  CALTSVTNPMTNKTSPLLMKEVSRWPFFAFLCGAMFCLLTSSICHLILCHSERMAYVMLR  240

Query  518  LDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            LDY GI ALI TSFYP VYYSF+C PF+C+LY+ FI
Sbjct  241  LDYTGITALIVTSFYPLVYYSFLCEPFYCHLYMSFI  276



>ref|XP_008440416.1| PREDICTED: adiponectin receptor protein 2-like isoform X2 [Cucumis 
melo]
Length=250

 Score =   221 bits (562),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +2

Query  257  SLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGG  436
            SLS WH+V+LL NCLP+ FS+ N T+ CVL SMKE++ N+IAPL  RPITRWPFFAFLGG
Sbjct  4    SLSRWHVVELLYNCLPQRFSHGNQTDDCVLRSMKEEVANMIAPLAMRPITRWPFFAFLGG  63

Query  437  AMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYL  616
            AMFCLLASSTCHLLSCHSER+SYIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFC+LY+
Sbjct  64   AMFCLLASSTCHLLSCHSERVSYIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCSLYM  123

Query  617  GFI  625
            GFI
Sbjct  124  GFI  126



>ref|XP_006581275.1| PREDICTED: adiponectin receptor protein 2-like isoform X4 [Glycine 
max]
Length=304

 Score =   209 bits (531),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 143/188 (76%), Gaps = 24/188 (13%)
 Frame = +2

Query  98   IYTAMKIPDVVDFPTLQNLPDVLRKADLHA-------CLPSLLHIPDLHRLREELKTA--  250
            +Y   + P +VDF ++Q+L +++ KADL+        CLPSL ++P++ +L  +L T+  
Sbjct  5    MYGPKRAPMIVDFNSVQHLSEMIGKADLNKIRLELLKCLPSLPNMPEILKL-NDLSTSLY  63

Query  251  ---FPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFF  421
               F SLS W +V+LLTNCLPE FS         L+ +K+D+ N+++PL  +PITRWPF+
Sbjct  64   SLDFSSLSGWALVELLTNCLPEQFS---------LNGLKDDM-NMVSPLM-QPITRWPFY  112

Query  422  AFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAALISTSFYPPVYYSFMCYPFF  601
            AFLGGAMFCLLASSTCHLL+CHS+RLSYIMLR+DYAGIAALI+TSFYPPVYYSFMC PFF
Sbjct  113  AFLGGAMFCLLASSTCHLLTCHSQRLSYIMLRIDYAGIAALIATSFYPPVYYSFMCNPFF  172

Query  602  CNLYLGFI  625
            C LYLGFI
Sbjct  173  CYLYLGFI  180



>gb|KHN04432.1| ADIPOR-like receptor CG5315-like protein [Glycine soja]
Length=296

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 138/183 (75%), Gaps = 22/183 (12%)
 Frame = +2

Query  110  MKIPDVVDFPTLQNLPDVLRKADLH-------ACLPSLLHIPD---LHRLREELKT-AFP  256
            M+ P VVDF ++Q+L +++ KADL+        CL SL ++P+   L+ L E L +  F 
Sbjct  1    MRAPMVVDFNSVQDLSEMIGKADLNMIRLDLLKCLASLPNMPEILKLNDLSESLYSLDFS  60

Query  257  SLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGG  436
            SLS W +V+LLTNCLPE FS         L+ +K D+ N+++PL  +PITRWPF+AFLGG
Sbjct  61   SLSGWTLVELLTNCLPEQFS---------LNGLKGDM-NMVSPLM-QPITRWPFYAFLGG  109

Query  437  AMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYL  616
            AMFCLLASS CHLL+CHS+RLSYIMLR+DYAGIAALI+TSFYPPVYYSFMC PFFC LYL
Sbjct  110  AMFCLLASSACHLLTCHSQRLSYIMLRIDYAGIAALIATSFYPPVYYSFMCNPFFCYLYL  169

Query  617  GFI  625
            GFI
Sbjct  170  GFI  172



>gb|KHN45137.1| Adiponectin receptor protein 2 [Glycine soja]
Length=292

 Score =   202 bits (514),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 137/179 (77%), Gaps = 24/179 (13%)
 Frame = +2

Query  125  VVDFPTLQNLPDVLRKADLHA-------CLPSLLHIPDLHRLREELKTA-----FPSLSN  268
            +VDF ++Q+L +++ KADL+        CLPSL ++P++ +L  +L T+     F SLS 
Sbjct  2    IVDFNSVQHLSEMIGKADLNKIRLELLKCLPSLPNMPEILKL-NDLSTSLYSLDFSSLSG  60

Query  269  WHIVQLLTNCLPECFSNSNHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFC  448
            W +V+LLTNCLPE FS         L+ +K D+ N+++PL  +PITRWPF+AFLGGAMFC
Sbjct  61   WALVELLTNCLPEQFS---------LNGLKGDM-NMVSPLM-QPITRWPFYAFLGGAMFC  109

Query  449  LLASSTCHLLSCHSERLSYIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            LLASS CHLL+CHS+RLSYIMLR+DYAGIAALI+TSFYPPVYYSFMC PFFC LYLGFI
Sbjct  110  LLASSACHLLTCHSQRLSYIMLRIDYAGIAALIATSFYPPVYYSFMCNPFFCYLYLGFI  168



>ref|XP_008353215.1| PREDICTED: uncharacterized protein LOC103416771 [Malus domestica]
Length=518

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 127/178 (71%), Gaps = 5/178 (3%)
 Frame = +2

Query  95   TIYTAMKIPDVVDFPTLQNLPDVLRKADLHACLPSLLH-IPDLHRLREELKTAFPSLSNW  271
            TIYTA K PD++D  +LQ L D++R+ADLH   P LL+ +P L     +    FP  ++ 
Sbjct  221  TIYTATKAPDLMDLSSLQRLSDMIRRADLHRIHPELLNCLPSLSLPSMD----FPPSASG  276

Query  272  HIVQLLTNCLPECFSNSNHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCL  451
            +I +LL NCLP+ FS+ N T   VL  + +D++N++APL  RPITR PFF FLGG MFCL
Sbjct  277  NIRELLANCLPDRFSHGNQTENSVLDGVMDDVMNMVAPLMYRPITRRPFFVFLGGVMFCL  336

Query  452  LASSTCHLLSCHSERLSYIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            LASSTCH ++CHS RLS IM R DYAGI  LI TSFYP VYYSFMC PF CNLYLGFI
Sbjct  337  LASSTCHXVACHSARLSSIMQRCDYAGITXLIMTSFYPTVYYSFMCNPFLCNLYLGFI  394



>gb|KDO81492.1| hypothetical protein CISIN_1g016259mg [Citrus sinensis]
Length=287

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 118/174 (68%), Gaps = 26/174 (15%)
 Frame = +2

Query  125  VVDFPTLQNLPDVLRKADLH-------ACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQ  283
            VV   +LQ   D+L  AD H       +C PS+ +IPD HRL + LK       +W  + 
Sbjct  9    VVHLDSLQRFRDMLPVADWHKIQEQLLSCFPSMPNIPDPHRLMDVLKIKM----SWPSMD  64

Query  284  LLTNCLPECFSNSNHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASS  463
             LT+ L  C              +K+D+VN +AP+T + ITRWP F FLGGAMFCLLASS
Sbjct  65   FLTS-LSAC--------------LKDDVVNKLAPITVQAITRWPIFTFLGGAMFCLLASS  109

Query  464  TCHLLSCHSERLSYIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            TCHLL CHSERLSYIMLRLDYAGIAALISTSFYPP+YYSFMCYPF CNLYLGFI
Sbjct  110  TCHLLCCHSERLSYIMLRLDYAGIAALISTSFYPPIYYSFMCYPFLCNLYLGFI  163



>ref|XP_001757760.1| predicted protein [Physcomitrella patens]
 gb|EDQ77400.1| predicted protein [Physcomitrella patens]
Length=432

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/218 (46%), Positives = 140/218 (64%), Gaps = 26/218 (12%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +++ LLS+FTIHNETLN+WTHL+GF LFL+LTIYT  ++P               ++  L
Sbjct  101  MRETLLSIFTIHNETLNIWTHLIGFLLFLALTIYTMRQVP---------------KEGAL  145

Query  182  HACLPSLLHIP---DLHRLREELKTAFPSLSN------WHIVQLLTNCLPEC-FSNSNHT  331
               L S++H+P   DLH+L  EL T FP+L+N       H+  +L+ C+P+     +N T
Sbjct  146  AERLSSMVHMPKRGDLHQLHVELVTCFPALANVPSFLQEHLPHILSKCVPDTPIIAANST  205

Query  332  NVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIM  511
              C + +MK+ L   +  +     TR PF  F+GG+MFCLL+SS CHLLSCHS  L+Y +
Sbjct  206  QQCFMQTMKDSLGEELD-MMIAGATRVPFLVFMGGSMFCLLSSSFCHLLSCHSSTLTYWL  264

Query  512  LRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            LRLDY GIA +I+TSF+PPVYY F+C P + ++YL  I
Sbjct  265  LRLDYVGIATMIATSFFPPVYYVFLCQPMWRHIYLTGI  302



>ref|XP_001778966.1| predicted protein [Physcomitrella patens]
 gb|EDQ56221.1| predicted protein [Physcomitrella patens]
Length=434

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/215 (46%), Positives = 138/215 (64%), Gaps = 26/215 (12%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK+ LLS+FTIHNETLN+WTHL+GF +FL+LTI+T  ++P               ++A +
Sbjct  102  LKETLLSIFTIHNETLNIWTHLIGFLVFLALTIFTVRQVP---------------KEAVV  146

Query  182  HACLPSLLHIP---DLHRLREELKTAFPSLSNW------HIVQLLTNCLPEC-FSNSNHT  331
               L +L+ +P   DLH+L  EL T FP+L+N       H+  +L  C+P+     +N T
Sbjct  147  PERLANLIQMPNRGDLHQLHVELVTCFPALANVPSFLQDHLPHILAKCVPDTPIIAANST  206

Query  332  NVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIM  511
              C + +MK D + +   +     TR PF  F+GGAMFCL +SS CHLLSC+S  L+Y +
Sbjct  207  QQCFMQTMK-DALGVELDMIVAGATRVPFLVFMGGAMFCLFSSSFCHLLSCYSSDLTYWL  265

Query  512  LRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYL  616
            LRLDYAGIA +I+TSFYPPVYY F+C P + ++YL
Sbjct  266  LRLDYAGIATMIATSFYPPVYYVFLCQPMWRHVYL  300



>ref|XP_010943141.1| PREDICTED: heptahelical transmembrane protein 4-like [Elaeis 
guineensis]
Length=370

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 127/210 (60%), Gaps = 41/210 (20%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ +LS+F+IHNET+NVWTHL+GFFLFLSLT +T M +P                  D 
Sbjct  76   LKQTILSIFSIHNETINVWTHLIGFFLFLSLTAFTVMMVP-----------------MDT  118

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                P+ LH+ +L        T+  ++S+           P    N +H  +  +SS+++
Sbjct  119  TVSSPAPLHLANL--------TSTTNVSD-----------P---LNLHHHGLVTMSSLRQ  156

Query  362  -DLVNIIAPLTTRPIT-RWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGI  535
             +L N I     R IT RWPF+A+L GAMFCL+ SS CHLLSCHSE   Y+MLRLDY GI
Sbjct  157  ANLTNKIETDQARQITTRWPFYAYLCGAMFCLIMSSACHLLSCHSEHTCYVMLRLDYGGI  216

Query  536  AALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
             ALI TSFYP VYYSFMC PFF  LY+ FI
Sbjct  217  TALIVTSFYPLVYYSFMCDPFFQTLYISFI  246



>ref|XP_009134009.1| PREDICTED: adiponectin receptor protein-like isoform X2 [Brassica 
rapa]
Length=208

 Score =   164 bits (414),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +2

Query  374  IIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAALIST  553
            +IAPL  RPITRWPF+AFLGGAMFCLLASSTCHLLSCHSER+SYIMLRLDYAGIAALIST
Sbjct  1    MIAPLIFRPITRWPFYAFLGGAMFCLLASSTCHLLSCHSERVSYIMLRLDYAGIAALIST  60

Query  554  SFYPPVYYSFMCYPFFCNLYLGFI  625
            SFYPPVYYSFMC PFFCNLYLGFI
Sbjct  61   SFYPPVYYSFMCDPFFCNLYLGFI  84



>ref|XP_004962901.1| PREDICTED: ADIPOR-like receptor CG5315-like isoform X2 [Setaria 
italica]
Length=424

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 98/226 (43%), Positives = 123/226 (54%), Gaps = 32/226 (14%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDV------------------  127
            +K+ +LS+F+IHNETLNVW+HL+GF LFL LTI+TAM IP                    
Sbjct  88   MKETILSIFSIHNETLNVWSHLIGFLLFLCLTIFTAMVIPRDGNSNSSSWSSSRSRAAYW  147

Query  128  VDFPTLQNLPDVLRKADLHACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPE  307
             D   + N+   LR   L AC            L      A   LS     Q+ T+C P 
Sbjct  148  GDLVEMANMTVALRHEALAACF-----------LLPPSAAAEAGLSE-DGQQIPTSCPPN  195

Query  308  CFSNSNHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCH  487
              S+  H  + +  +       ++A     P+TRWP FA+L GAM CLL SS CHL+ CH
Sbjct  196  TSSSHVHHGIQIQDTNGTATDALVA--AGEPVTRWPLFAYLAGAMVCLLTSSACHLILCH  253

Query  488  SERLSYIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            SER +Y+ LRLDYAGIAALI TSFYP  YYSF+C P    LY+G I
Sbjct  254  SERTAYVTLRLDYAGIAALIVTSFYPLAYYSFLCAPSLQRLYMGSI  299



>ref|XP_002442218.1| hypothetical protein SORBIDRAFT_08g016470 [Sorghum bicolor]
 gb|EES16056.1| hypothetical protein SORBIDRAFT_08g016470 [Sorghum bicolor]
Length=393

 Score =   164 bits (416),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 102/229 (45%), Positives = 127/229 (55%), Gaps = 33/229 (14%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIP---------------DVVDF  136
            +K+ +LS+F+IHNETLNVW+HL+GF LFL LTI+TAM IP               D+V+ 
Sbjct  52   MKETILSIFSIHNETLNVWSHLIGFLLFLCLTIFTAMVIPRSGSSSRSSTAYQLGDLVEM  111

Query  137  PTLQNLPDVLRKADLHACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFS  316
                N+   LR   L AC               E     P           T+C P   S
Sbjct  112  AR-ANMTVALRHEALAACFLLPPSAAAASAALSEDGQQIP-----------TSCPPNTSS  159

Query  317  NSNHTNVCVL------SSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLL  478
            +S+H +   +      +S+ +D    IA     PITRWP FA+LGGAM CLL SS CHL+
Sbjct  160  SSSHHHAIQIQGSTGNTSVTKDAGAAIATAAADPITRWPLFAYLGGAMVCLLTSSACHLI  219

Query  479  SCHSERLSYIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
             CHSER +Y+ LRLDYAGIAALI TSFYP  YYSF+C P    LY+G I
Sbjct  220  LCHSERTAYVTLRLDYAGIAALIVTSFYPLAYYSFLCAPALQRLYMGSI  268



>ref|XP_008795675.1| PREDICTED: adiponectin receptor protein 2-like [Phoenix dactylifera]
Length=357

 Score =   163 bits (413),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 121/209 (58%), Gaps = 40/209 (19%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQ +LS+F+IHNET+NVWTHL+GFFLF SLT  T M +P  +D      +P  L     
Sbjct  64   LKQTILSIFSIHNETINVWTHLIGFFLFFSLTACTVMMVP--MDATVSSPVPLPL-----  116

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
             A LPS  ++ D                                 N  H  +  ++S + 
Sbjct  117  -ANLPSTTNVSDP-------------------------------LNPRHHGLVAMASPQG  144

Query  362  DLVNIIAPLTTRPIT-RWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIA  538
            +L + I     R IT RWPF+A+L GAMFCL+ SS CHLLSCHSE   Y+MLRLDY GI+
Sbjct  145  NLTDKIETDPARGITTRWPFYAYLCGAMFCLIMSSACHLLSCHSEHTCYVMLRLDYGGIS  204

Query  539  ALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            ALI TSFYP VYYSFMC PFF +LYL FI
Sbjct  205  ALIVTSFYPLVYYSFMCDPFFQSLYLCFI  233



>ref|XP_004962900.1| PREDICTED: ADIPOR-like receptor CG5315-like isoform X1 [Setaria 
italica]
Length=432

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 99/232 (43%), Positives = 123/232 (53%), Gaps = 36/232 (16%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDV------------------  127
            +K+ +LS+F+IHNETLNVW+HL+GF LFL LTI+TAM IP                    
Sbjct  88   MKETILSIFSIHNETLNVWSHLIGFLLFLCLTIFTAMVIPRDGNSNSSSWSSSRSRAAYW  147

Query  128  VDFPTLQNLPDVLRKADLHACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPE  307
             D   + N+   LR   L AC            L      A   LS     Q+ T+C P 
Sbjct  148  GDLVEMANMTVALRHEALAACF-----------LLPPSAAAEAGLSE-DGQQIPTSCPPN  195

Query  308  CFSNSNHTNVCVLSSMKEDLVNIIAPLT------TRPITRWPFFAFLGGAMFCLLASSTC  469
              S+  H  + +    +  L +     T        P+TRWP FA+L GAM CLL SS C
Sbjct  196  TSSSHVHHGIQIQIRQRLHLQDTNGTATDALVAAGEPVTRWPLFAYLAGAMVCLLTSSAC  255

Query  470  HLLSCHSERLSYIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            HL+ CHSER +Y+ LRLDYAGIAALI TSFYP  YYSF+C P    LY+G I
Sbjct  256  HLILCHSERTAYVTLRLDYAGIAALIVTSFYPLAYYSFLCAPSLQRLYMGSI  307



>ref|XP_006649572.1| PREDICTED: adiponectin receptor protein 1-like [Oryza brachyantha]
Length=387

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/212 (42%), Positives = 121/212 (57%), Gaps = 39/212 (18%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +KQALLS F +HNET+NVWTHL+GFF+FL+ T+  A  +P                ++ +
Sbjct  87   IKQALLSAFAVHNETINVWTHLIGFFMFLAFTVCAATMVP---------------MESGV  131

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLS----  349
             A + +              KT   +  +  +V  +          SN   V V +    
Sbjct  132  SASMATS-------------KTQANNTGSRMVVMTMGY-------GSNGAAVAVRALRNV  171

Query  350  SMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYA  529
            S++ +L+ + +      + RWPF+A+L GAMFCLL SS CHLL+CHSE  SY++LRLDYA
Sbjct  172  SVESELIAVASLSAGSQVARWPFYAYLCGAMFCLLMSSACHLLACHSEHASYVLLRLDYA  231

Query  530  GIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            GI  LI TSFYP VYY+F+C PFF  LYLGFI
Sbjct  232  GITGLIVTSFYPLVYYTFLCDPFFRTLYLGFI  263



>ref|XP_003575484.1| PREDICTED: heptahelical transmembrane protein 4-like [Brachypodium 
distachyon]
Length=398

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 98/226 (43%), Positives = 125/226 (55%), Gaps = 35/226 (15%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVV-----------------  130
            +K+ +LSVF++HNETLNVW+HL+GF LFL LT+ TA  IP                    
Sbjct  59   MKETILSVFSVHNETLNVWSHLMGFLLFLCLTVLTAAVIPRDGSGSSDRFDDASSVRSYW  118

Query  131  -DFPTLQNLPDVLRKADLHACLPSLLHIPDLHRL---REELKTAFPSLSNWHIVQLLTNC  298
             D   + N+   LR    H    SLL  P    L    E++ T+ P+ +        ++ 
Sbjct  119  GDLMAVANVTGALR----HEAACSLLLTPAAAELCGDEEKIPTSCPTNA--------SSS  166

Query  299  LPECFSNSNHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLL  478
            LP   +     +     +   D+V I A     PITRWP FA+LGGAM CLL SS CHL 
Sbjct  167  LPHSQAMIQEASGGPQRAAAADVVFITA--DPNPITRWPLFAYLGGAMACLLTSSVCHLF  224

Query  479  SCHSERLSYIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYL  616
             CHSER +Y+ LRLDYAGIAALI TSFYP VYYSF+C+P    LY+
Sbjct  225  LCHSERAAYLTLRLDYAGIAALIVTSFYPVVYYSFLCHPALRTLYI  270



>ref|XP_001785325.1| predicted protein [Physcomitrella patens]
 gb|EDQ49866.1| predicted protein [Physcomitrella patens]
Length=340

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 118/208 (57%), Gaps = 46/208 (22%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +K+AL S+F +HNET NVWTHLVGF LFL LTIYTA  +P++V+  TL         + +
Sbjct  52   VKRALFSIFEMHNETFNVWTHLVGFLLFLGLTIYTATHLPNIVEPNTLHRW-----HSGI  106

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
               LPS LH+P+                       L++C+P  F  +  T          
Sbjct  107  MESLPSYLHLPEA----------------------LSSCVPGTFDGTRLT----------  134

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
                       RPITRWPFF FL GAMFCLLAS+ CHL SC S    Y ++R+DYAGI+ 
Sbjct  135  ---------VQRPITRWPFFVFLAGAMFCLLASAICHLFSCLSATAFYALMRIDYAGIST  185

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            LI+ SFYPPVYYSFMC P  C +YLG I
Sbjct  186  LIAASFYPPVYYSFMCNPVLCKMYLGLI  213



>ref|NP_001130559.1| uncharacterized protein LOC100191658 [Zea mays]
 gb|ACF78823.1| unknown [Zea mays]
Length=380

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 99/221 (45%), Positives = 125/221 (57%), Gaps = 29/221 (13%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIP-------------DVVDFPT  142
            +K+ +LS+F+IHNETLNVW+HL+GF LFL L I+TAM IP              + D   
Sbjct  51   MKETVLSIFSIHNETLNVWSHLLGFLLFLCLAIFTAMVIPRNGSSRSSNSAAYQLGDLVE  110

Query  143  LQNLPDVLRKADLHACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNS  322
            + N+   LR   L AC    L  P    L E+ +   P           T+C P   ++S
Sbjct  111  MANMTVALRHEALAACF---LLPPSAAALSEDGQQQIP-----------TSCPPN--TSS  154

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            +H +   + S       + A     PITRWP FA+L GAM CLL SS CHL+ CHSER +
Sbjct  155  SHHHAIQIQSSTGTAATVDAGTAADPITRWPLFAYLVGAMVCLLTSSVCHLILCHSERTA  214

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            Y+ LRLDYAGIAALI TSFYP  YYSF+C P    LY+G I
Sbjct  215  YVTLRLDYAGIAALIVTSFYPLAYYSFLCNPALQRLYMGSI  255



>gb|AFW74657.1| hypothetical protein ZEAMMB73_526410 [Zea mays]
Length=882

 Score =   162 bits (409),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 99/221 (45%), Positives = 125/221 (57%), Gaps = 29/221 (13%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIP-------------DVVDFPT  142
            +K+ +LS+F+IHNETLNVW+HL+GF LFL L I+TAM IP              + D   
Sbjct  553  MKETVLSIFSIHNETLNVWSHLLGFLLFLCLAIFTAMVIPRNGSSRSSNSAAYQLGDLVE  612

Query  143  LQNLPDVLRKADLHACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNS  322
            + N+   LR   L AC    L  P    L E+ +   P           T+C P   ++S
Sbjct  613  MANMTVALRHEALAACF---LLPPSAAALSEDGQQQIP-----------TSCPPN--TSS  656

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            +H +   + S       + A     PITRWP FA+L GAM CLL SS CHL+ CHSER +
Sbjct  657  SHHHAIQIQSSTGTAATVDAGTAADPITRWPLFAYLVGAMVCLLTSSVCHLILCHSERTA  716

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            Y+ LRLDYAGIAALI TSFYP  YYSF+C P    LY+G I
Sbjct  717  YVTLRLDYAGIAALIVTSFYPLAYYSFLCNPALQRLYMGSI  757



>gb|ACR38470.1| unknown [Zea mays]
Length=393

 Score =   157 bits (396),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 99/221 (45%), Positives = 125/221 (57%), Gaps = 29/221 (13%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIP-------------DVVDFPT  142
            +K+ +LS+F+IHNETLNVW+HL+GF LFL L I+TAM IP              + D   
Sbjct  64   MKETVLSIFSIHNETLNVWSHLLGFLLFLCLAIFTAMVIPRNGSSRSSNSAAYQLGDLVE  123

Query  143  LQNLPDVLRKADLHACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNS  322
            + N+   LR   L AC    L  P    L E+ +   P           T+C P   ++S
Sbjct  124  MANMTVALRHEALAACF---LLPPSAAALSEDGQQQIP-----------TSCPPN--TSS  167

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
            +H +   + S       + A     PITRWP FA+L GAM CLL SS CHL+ CHSER +
Sbjct  168  SHHHAIQIQSSTGTAATVDAGTAADPITRWPLFAYLVGAMVCLLTSSVCHLILCHSERTA  227

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            Y+ LRLDYAGIAALI TSFYP  YYSF+C P    LY+G I
Sbjct  228  YVTLRLDYAGIAALIVTSFYPLAYYSFLCNPALQRLYMGSI  268



>tpg|DAA44187.1| TPA: hypothetical protein ZEAMMB73_882874, partial [Zea mays]
Length=199

 Score =   151 bits (382),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 99/130 (76%), Gaps = 13/130 (10%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L Q LLS F+IHNETLNVWTHL+GFF+FL+LTIYTA ++P+ VD  +LQ+LPDVLRKAD+
Sbjct  58   LPQVLLSAFSIHNETLNVWTHLIGFFIFLALTIYTATQVPNAVDIRSLQHLPDVLRKADI  117

Query  182  H-------ACLPSLLHIPDLHRLREELKTAF------PSLSNWHIVQLLTNCLPECFSNS  322
            H       +CLPSL H+ DL +L++ELKT++      PSLS WH+++LL NCLP  F++ 
Sbjct  118  HKIQAELVSCLPSLPHLSDLQKLKDELKTSWNSMEVLPSLSRWHLLELLANCLPHRFTHP  177

Query  323  NHTNVCVLSS  352
            N T++ VL S
Sbjct  178  NETSLSVLVS  187



>ref|XP_009389658.1| PREDICTED: heptahelical transmembrane protein 4-like [Musa acuminata 
subsp. malaccensis]
Length=377

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 116/208 (56%), Gaps = 39/208 (19%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +KQA+LS+F+IHNET+NVWTHL+GFF+FL+LT+  AM +P       + +       +DL
Sbjct  84   MKQAILSIFSIHNETINVWTHLIGFFIFLALTVGAAMMVP-------VGSSMASSGASDL  136

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                 ++  I    RL                               +H  +  LS    
Sbjct  137  ANVSSTITDISGSLRL-------------------------------HHHELVALSLSPA  165

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
            +L    A    +  TRWPF+A+L GAM CLL SSTCHLL CHSE   Y+MLRLDYAGI A
Sbjct  166  NLTGATADAVEQA-TRWPFYAYLCGAMLCLLMSSTCHLLYCHSEHTCYLMLRLDYAGIIA  224

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            LI TSFYP VYYSF+C P+F  LYL FI
Sbjct  225  LIVTSFYPLVYYSFLCQPYFQYLYLSFI  252



>ref|NP_001183583.1| uncharacterized protein LOC100502176 [Zea mays]
 gb|ACR37648.1| unknown [Zea mays]
Length=243

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 99/130 (76%), Gaps = 13/130 (10%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L Q LLS F+IHNETLNVWTHL+GFF+FL+LTIYTA ++P+ VD  +LQ+LPDVLRKAD+
Sbjct  58   LPQVLLSAFSIHNETLNVWTHLIGFFIFLALTIYTATQVPNAVDIRSLQHLPDVLRKADI  117

Query  182  H-------ACLPSLLHIPDLHRLREELKTAF------PSLSNWHIVQLLTNCLPECFSNS  322
            H       +CLPSL H+ DL +L++ELKT++      PSLS WH+++LL NCLP  F++ 
Sbjct  118  HKIQAELVSCLPSLPHLSDLQKLKDELKTSWNSMEVLPSLSRWHLLELLANCLPHRFTHP  177

Query  323  NHTNVCVLSS  352
            N T++ VL S
Sbjct  178  NETSLSVLVS  187



>gb|EEC69364.1| hypothetical protein OsI_38488 [Oryza sativa Indica Group]
Length=445

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 129/229 (56%), Gaps = 34/229 (15%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDV------------------  127
            +K+ +LS+F+IHNETLNVWTHL+GF LFL L I+TAM IP                    
Sbjct  68   MKETILSIFSIHNETLNVWTHLIGFLLFLCLAIFTAMVIPSGDNLHSNSSRSRSNATAMD  127

Query  128  -----VDFPTLQNLPDVLRKADLHACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLT  292
                  D   + N+  VLR   L A    LLH P      E++ T+ P+          T
Sbjct  128  YYYIHGDLMVMSNMTRVLRHEALAAAACLLLHDPADLSQHEQIPTSCPTN---------T  178

Query  293  NCLPECFSNSNHTNVCVLSSMKE--DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASST  466
            +     FS+ ++ +     ++++  ++    A + T PITRWP FA+LGGAM CLLAS+ 
Sbjct  179  SSYYSSFSHLHNVHQQRQHAIRDAGEVTAATAAVITEPITRWPVFAYLGGAMACLLASTA  238

Query  467  CHLLSCHSERLSYIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLY  613
            CHLL CHSER +Y+ LRLDYAGIAALI  SF P V+YSF+C P+    Y
Sbjct  239  CHLLLCHSERANYVTLRLDYAGIAALIVASFLPIVHYSFLCDPWLRYAY  287



>ref|XP_004987123.1| PREDICTED: adiponectin receptor protein 1-like [Setaria italica]
Length=384

 Score =   154 bits (388),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 85/214 (40%), Positives = 119/214 (56%), Gaps = 42/214 (20%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +K+ALLS F+IHNET+NVWTHL+GFF+FL+LT+  A  +P                    
Sbjct  83   VKEALLSAFSIHNETINVWTHLIGFFVFLALTVCAATMVP--------------------  122

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                             E   +  P +++  +  +  N +     +++   V  + +++ 
Sbjct  123  ----------------MEYEVSHTPLVASTGLDNITGNAMVLRSYSADGAAVVAMKALRS  166

Query  362  D------LVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLD  523
            +      L   ++P     + RWPF+A+L GAMFCLL SS CHLL+CHSE  SY++LRLD
Sbjct  167  NVSVETGLAAALSPPAGLRVARWPFYAYLCGAMFCLLMSSACHLLACHSEHASYVLLRLD  226

Query  524  YAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YAGI  LI TSFYP VYY+F+C P F  LYLGFI
Sbjct  227  YAGITGLIVTSFYPLVYYTFLCDPLFQALYLGFI  260



>gb|ABF94486.1| Haemolysin-III related family protein, expressed [Oryza sativa 
Japonica Group]
 gb|EAY88921.1| hypothetical protein OsI_10405 [Oryza sativa Indica Group]
 gb|EAZ25946.1| hypothetical protein OsJ_09801 [Oryza sativa Japonica Group]
Length=379

 Score =   153 bits (387),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 119/208 (57%), Gaps = 36/208 (17%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +KQALLS F +HNET+NVWTHL+GFF+FL+LT+  A  +P       +++    +  A+ 
Sbjct  84   IKQALLSAFAVHNETVNVWTHLIGFFMFLALTVCAATMVP-------MESSATSMTMAN-  135

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
            +   P +L           +  ++ S      VQ L N                  S++ 
Sbjct  136  NTGNPMVL-----------MMMSYGSNGAAMAVQALRNV-----------------SVES  167

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
            +L           + RWPF+A+L GAMFCLL SS CHLL+CHSE  SY++LRLDYAGI  
Sbjct  168  ELAAAALSAAGDQVARWPFYAYLCGAMFCLLMSSACHLLACHSEHASYVLLRLDYAGITG  227

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            LI TSFYP VYY+F+C PFF  LYLGFI
Sbjct  228  LIVTSFYPLVYYTFLCDPFFRTLYLGFI  255



>tpg|DAA44186.1| TPA: hypothetical protein ZEAMMB73_882874 [Zea mays]
Length=241

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 98/128 (77%), Gaps = 13/128 (10%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L Q LLS F+IHNETLNVWTHL+GFF+FL+LTIYTA ++P+ VD  +LQ+LPDVLRKAD+
Sbjct  58   LPQVLLSAFSIHNETLNVWTHLIGFFIFLALTIYTATQVPNAVDIRSLQHLPDVLRKADI  117

Query  182  H-------ACLPSLLHIPDLHRLREELKTAF------PSLSNWHIVQLLTNCLPECFSNS  322
            H       +CLPSL H+ DL +L++ELKT++      PSLS WH+++LL NCLP  F++ 
Sbjct  118  HKIQAELVSCLPSLPHLSDLQKLKDELKTSWNSMEVLPSLSRWHLLELLANCLPHRFTHP  177

Query  323  NHTNVCVL  346
            N T++ VL
Sbjct  178  NETSLSVL  185



>ref|XP_008652310.1| PREDICTED: adiponectin receptor protein 1-like [Zea mays]
 tpg|DAA43950.1| TPA: hypothetical protein ZEAMMB73_859192 [Zea mays]
Length=391

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/214 (41%), Positives = 118/214 (55%), Gaps = 37/214 (17%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +K+ALLS F+IHNET+NVWTHL+GFF+FL+LT+  A  +P      T    P        
Sbjct  85   VKEALLSAFSIHNETINVWTHLIGFFVFLALTVCAATMVPT-----TEYESP--------  131

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMK-  358
                               L  A  S +   +  +  N +     +++   V  + +++ 
Sbjct  132  ------------------HLALATSSSTGLTMTNITGNAMVLRSYSADDGAVMAMKALRN  173

Query  359  ----EDLVNIIAPLTTRP-ITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLD  523
                E    ++     R  + RWPF+A+L GAMFCLL SS CHLL+CHSE  SY+ LRLD
Sbjct  174  VSAAETAAAVLPAGAGRGRVARWPFYAYLCGAMFCLLMSSACHLLACHSEHASYVFLRLD  233

Query  524  YAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            YAGI  LI TSFYP VYY+F+C PF+  LYLGFI
Sbjct  234  YAGITGLIVTSFYPLVYYTFLCDPFYQALYLGFI  267



>gb|AGT16350.1| hypothetical protein SHCRBa_020_D23_F_70 [Saccharum hybrid cultivar 
R570]
Length=385

 Score =   151 bits (382),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 118/213 (55%), Gaps = 37/213 (17%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +K+ALLS F++HNET+NVWTHL+GFF+FL+LT+  A  +P   + P +            
Sbjct  81   IKEALLSAFSVHNETINVWTHLIGFFVFLTLTVCAATMVPTEYESPHMAT----------  130

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPE-----CFSNSNHTNVCVL  346
                                 T+F  LSN     ++             +     N  V+
Sbjct  131  ---------------------TSFTGLSNITGNAMVLRSYSADRAILAMTMKAFRNGSVV  169

Query  347  SSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDY  526
             +    +++  A    R + RWPF+A+L GAMFCLL SS CHLL+CHSE  SY+ LRLDY
Sbjct  170  ETEAAAVLSAGAAGHGR-VPRWPFYAYLCGAMFCLLMSSACHLLACHSEHASYVFLRLDY  228

Query  527  AGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            AGI  LI TSFYP VYY+F+C+PF+  LYLGFI
Sbjct  229  AGITGLIVTSFYPLVYYTFLCHPFYQALYLGFI  261



>ref|XP_003561941.1| PREDICTED: heptahelical transmembrane protein 4-like [Brachypodium 
distachyon]
Length=390

 Score =   151 bits (381),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 90/221 (41%), Positives = 113/221 (51%), Gaps = 51/221 (23%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFP-----------TLQ  148
            +KQALLS F +HNET+NVWTHL+GFF+FL+LT+  A  +P                 +  
Sbjct  84   VKQALLSAFAVHNETINVWTHLIGFFVFLALTVCAATMVPTETSVSHSATSTALTHNSTG  143

Query  149  NLPDVLRKADLHACLPSLLHIPDLHRLR--EELKTAFPSLSNWHIVQLLTNCLPECFSNS  322
              P +L  +         +  P         E + A PS S+ HI+              
Sbjct  144  GNPMILTSSYTTVGAAVAMQAPPTRNASFLVEQELAAPSPSSGHIIHR------------  191

Query  323  NHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLS  502
                                      + RWPF+A+L GAMFCLL SS CHLLSCHSE  S
Sbjct  192  --------------------------VARWPFYAYLCGAMFCLLMSSACHLLSCHSEHAS  225

Query  503  YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            Y++LRLDYAGI  LI TSFYP VYY+F+C PF  +LYLGFI
Sbjct  226  YVLLRLDYAGITGLIVTSFYPLVYYTFLCDPFPLSLYLGFI  266



>ref|XP_002468327.1| hypothetical protein SORBIDRAFT_01g043860 [Sorghum bicolor]
 gb|EER95325.1| hypothetical protein SORBIDRAFT_01g043860 [Sorghum bicolor]
Length=383

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 117/208 (56%), Gaps = 29/208 (14%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +K+ALLS F+IHNET+NVWTHL+GFF+FL+  +  A  +P   + P +      L     
Sbjct  81   IKEALLSAFSIHNETINVWTHLIGFFVFLAFAVCAATVVPAEYESPHMATTG--LGNITG  138

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
            +A +    +  D   L   +K AF                          NV V+ +   
Sbjct  139  NAVVLRSYYSADGAILASTMK-AF-------------------------RNVSVVETETA  172

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
                +++    R + RWPF+A+L GAMFCLL SS CHLL+CHSE  SY+ LRLDYAGI  
Sbjct  173  TAAAVLSAAGGR-VARWPFYAYLCGAMFCLLMSSACHLLACHSEHASYVFLRLDYAGITG  231

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            LI TSFYP VYY+F+C PF+  +YLGFI
Sbjct  232  LIVTSFYPLVYYTFLCNPFYQAVYLGFI  259



>ref|NP_001066867.1| Os12g0511200 [Oryza sativa Japonica Group]
 gb|ABA99043.1| Haemolysin-III related family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29886.1| Os12g0511200 [Oryza sativa Japonica Group]
Length=418

 Score =   149 bits (375),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 95/232 (41%), Positives = 122/232 (53%), Gaps = 40/232 (17%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDV------------------  127
            +K+ +LS+F+IHNETLNVWTHL+GF LFL L I+TAM IP                    
Sbjct  70   MKETILSIFSIHNETLNVWTHLIGFLLFLCLAIFTAMVIPSGDNLHSNSSRSRSNATAMD  129

Query  128  -----VDFPTLQNLPDVLRKADLHACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQL--  286
                  D   + N+  VLR   L A    LLH P      E++ T+ P+ ++        
Sbjct  130  YYYIHGDLMVMSNMTRVLRHEALAAAACLLLHDPADLSQHEQISTSCPTNTSSCYTSSSS  189

Query  287  ---LTNCLPECFSNSNHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLA  457
               L N       ++        +++ E            PITRWP FA+LGGAM CLLA
Sbjct  190  FSHLHNVRQHAIQDAGKVTAATAAAIAE------------PITRWPVFAYLGGAMACLLA  237

Query  458  SSTCHLLSCHSERLSYIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLY  613
            S+ CHLL CHSER +Y+ LRLDYAGIAALI  SF P V+YSF+C P+    Y
Sbjct  238  STACHLLLCHSERANYVTLRLDYAGIAALIVASFLPIVHYSFLCDPWLRRAY  289



>gb|KJB83211.1| hypothetical protein B456_013G235700 [Gossypium raimondii]
Length=353

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 117/208 (56%), Gaps = 41/208 (20%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L++AL S+F  HNETLNVWTHL GF LFL LT+ + +++P V+D                
Sbjct  63   LREALFSIFRWHNETLNVWTHLFGFVLFLGLTMASLIEVPQVLD----------------  106

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                           L   +  +FP   N ++ Q L        + SN  ++  +++ + 
Sbjct  107  ---------------LIAFITRSFPVSGNINVSQDLV-----LGTASNLIDLKPITASES  146

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
            D+      LT  P+TRWPF+  L G+MFCLL+SS CHL SCHS RL+ +++R+DY GIA 
Sbjct  147  DIT-----LTETPVTRWPFYVLLAGSMFCLLSSSICHLFSCHSHRLNIMLMRMDYTGIAI  201

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            +I  +F+PPVYYSF C P +  +YLG I
Sbjct  202  MIIATFFPPVYYSFPCDPQWQFIYLGGI  229



>ref|XP_006474409.1| PREDICTED: adiponectin receptor protein 1-like [Citrus sinensis]
Length=374

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 111/208 (53%), Gaps = 35/208 (17%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +K+AL S+F  HNETLNVWTHL+GF +F++LT+   M++P V    +             
Sbjct  77   IKEALFSIFRWHNETLNVWTHLIGFIIFVALTVANLMEVPQVAGLVSF------------  124

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                                  +FP+  + ++    ++     F+     N+  L  +  
Sbjct  125  -------------------FTRSFPNSGDTNV----SHGSNGFFTGGGAKNLVDLKQIAS  161

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
              +    P  T P+TRWPF  FL G+MFCLL+SS CHL  CHS RL+ ++LR+DY+GI  
Sbjct  162  SEMGANIPPATTPVTRWPFLVFLAGSMFCLLSSSICHLFCCHSRRLNILLLRIDYSGITV  221

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            +I TSF+PP+YY F C P +  +YLG +
Sbjct  222  MIITSFFPPIYYIFQCEPRWHFIYLGGV  249



>gb|KDO73472.1| hypothetical protein CISIN_1g017287mg [Citrus sinensis]
Length=374

 Score =   143 bits (360),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 115/209 (55%), Gaps = 37/209 (18%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +K+AL S+F  HNETLNVWTHL+GF +F++LT+   M++P V    +             
Sbjct  77   IKEALFSIFRWHNETLNVWTHLIGFIIFVALTVANLMEVPQVAGLISF------------  124

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSM-K  358
                                  +FP+  + ++    ++     F+    TN+  L  +  
Sbjct  125  -------------------FTRSFPNSGDTNV----SHGSNGFFTGGGATNLVDLKQIAS  161

Query  359  EDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIA  538
             ++   I P TT P+TRWPF  FL G+MFCLL+SS CHL  CHS RL+ ++LR+DY+GI 
Sbjct  162  SEMGANITPATT-PVTRWPFLVFLAGSMFCLLSSSICHLFCCHSRRLNILLLRIDYSGIT  220

Query  539  ALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
             +I TSF+PP+YY F C P +  +YLG +
Sbjct  221  VMIITSFFPPIYYIFQCEPRWHFIYLGGV  249



>ref|XP_006664585.1| PREDICTED: uncharacterized protein LOC102712044 [Oryza brachyantha]
Length=341

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 99/230 (43%), Positives = 131/230 (57%), Gaps = 37/230 (16%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDV------------------  127
            +K+ +LS+F+IHNETLNVWTHL+GF LFL LTI+TAM IP+                   
Sbjct  109  MKETILSIFSIHNETLNVWTHLLGFLLFLCLTIFTAMVIPNGGSSSRTSSRSRSNATAMD  168

Query  128  -----VDFPTLQNLPDVLRKAD-LHACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLL  289
                  D   + N+  +LR  + L ACL  LLH   L +  E++ T+ P+ ++       
Sbjct  169  YYHYWGDLMVMANMTGLLRDHEALAACL--LLHPAHLSQ-HEQISTSCPTNTSSSF----  221

Query  290  TNCLPECFSNSNHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTC  469
                    S+ +H       +M++      A   + PITRWP FA+LGGAM CLLAS+ C
Sbjct  222  ------SLSHHHHHQQQQQHAMQDAGEVAAAAAVSEPITRWPVFAYLGGAMACLLASTAC  275

Query  470  HLLSCHSERLSYIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLG  619
            HLL CHSER +Y+ LRLDYAGIAALI  SF P V+YSF+C  +   LY G
Sbjct  276  HLLLCHSERANYVTLRLDYAGIAALIVASFLPIVHYSFLCDAWLRRLYTG  325



>ref|XP_011015262.1| PREDICTED: heptahelical transmembrane protein 1-like [Populus 
euphratica]
Length=377

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/208 (42%), Positives = 112/208 (54%), Gaps = 39/208 (19%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK+AL SVF  HNETLNVWTHL+GFFLF+ LT+   M++P V D   L     +   A  
Sbjct  81   LKKALFSVFRWHNETLNVWTHLLGFFLFVGLTVANLMQVPQVADLLGLFTW-SIFTSAQR  139

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
            +    S     D +    EL               L + LP                MK 
Sbjct  140  NVSNDS----KDFYLGTTELLD-------------LGHNLP----------------MKT  166

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
            D+ ++       P TRWPF+ FLGG+MFCLL+SS CHL SCHS  L+ ++LR+DY GI  
Sbjct  167  DVSSL-----GMPATRWPFYVFLGGSMFCLLSSSICHLFSCHSHSLNILLLRIDYVGIVM  221

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            +I TSF+PP+YY F C P +  +YLG I
Sbjct  222  MIITSFFPPMYYIFQCEPHWQFIYLGGI  249



>ref|XP_006453094.1| hypothetical protein CICLE_v10010628mg [Citrus clementina]
 gb|ESR66334.1| hypothetical protein CICLE_v10010628mg [Citrus clementina]
Length=766

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 111/208 (53%), Gaps = 35/208 (17%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +K+AL S+F  HNETLNVWTHL+GF +F++LT+   M++P V    +             
Sbjct  17   IKEALFSIFRWHNETLNVWTHLIGFIIFVALTVANLMEVPQVAGLVSF------------  64

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                                  +FP+  + ++    ++     F+     N+  L  +  
Sbjct  65   -------------------FTRSFPNSGDTNV----SHGSNGFFTGGGAKNLVDLKQIAS  101

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
              +    P  T P+TRWPF  FL G+MFCLL+SS CHL  CHS RL+ ++LR+DY+GI  
Sbjct  102  SEMGANIPPATTPVTRWPFLVFLAGSMFCLLSSSICHLFCCHSRRLNILLLRIDYSGITV  161

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            +I TSF+PP+YY F C P +  +YLG +
Sbjct  162  MIITSFFPPIYYIFQCEPRWHFIYLGGV  189



>ref|XP_002947829.1| hypothetical protein VOLCADRAFT_43835 [Volvox carteri f. nagariensis]
 gb|EFJ50817.1| hypothetical protein VOLCADRAFT_43835 [Volvox carteri f. nagariensis]
Length=351

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 110/212 (52%), Gaps = 20/212 (9%)
 Frame = +2

Query  5    KQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADLH  184
            KQ L S+F IHNET NVWTHL+GF +F  LT Y  + +        L  + D      LH
Sbjct  26   KQTLRSLFDIHNETGNVWTHLLGFLVFAGLTFYLWLAVQG-----RLHGMAD-----HLH  75

Query  185  ACLPSLLHIPDL----HRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSS  352
                 L H+PDL    H+L+E L     SL   H VQ       +   +  H+       
Sbjct  76   HLQGRLPHLPDLSANLHQLQERLVHNVDSLV--HEVQEEVQNAAQALHHRMHSISDNFHY  133

Query  353  MKEDLVNIIAPLTTR----PITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
              E L ++I    +     P+ RWP + F+ GAM CLL S+ CHL  C S+ L+ I+ R 
Sbjct  134  ATERLNSLIQEAVSDVLMWPVPRWPVYVFMAGAMTCLLLSAVCHLFGCCSKHLAQIIWRF  193

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYL  616
            DYAGIA LI  SFYPPVYY F+C P++   YL
Sbjct  194  DYAGIAILIVASFYPPVYYGFLCQPYWRVFYL  225



>emb|CDY60375.1| BnaCnng36160D [Brassica napus]
Length=357

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 108/209 (52%), Gaps = 49/209 (23%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            ++ A  SVF+ HNE+LNVWTHL+GF LF+ LT+   M       FP  Q  P V      
Sbjct  73   IRDAFFSVFSFHNESLNVWTHLLGFILFVGLTVANIMHHDKF--FPVKQIAPSVFL----  126

Query  182  HACLPSLLHIPD-LHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMK  358
                  +LHIPD LH L + +K A+                                   
Sbjct  127  ------MLHIPDFLHILIKHIKFAY-----------------------------------  145

Query  359  EDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIA  538
               V I    +   +TRWPFF FLGG+MFCLL+SS CHL  CHS+ L+  +LR+DYAGI 
Sbjct  146  -SFVFIFDAKSPGNVTRWPFFVFLGGSMFCLLSSSICHLFCCHSKELNVFLLRIDYAGIT  204

Query  539  ALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            A+I TSF+PP+YY F C P +  +YL  I
Sbjct  205  AMIITSFFPPIYYIFQCTPRWYFIYLAGI  233



>ref|XP_006358328.1| PREDICTED: ADIPOR-like receptor CG5315-like [Solanum tuberosum]
Length=375

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 116/214 (54%), Gaps = 48/214 (22%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTL--QNLPDVLRKA  175
            +KQALLS+F  HNETLNVWTHL+GF LF++LT+   +++P + DF T+   N P      
Sbjct  78   IKQALLSIFRWHNETLNVWTHLLGFILFVALTLSNVVQVPQLSDFMTMFIWNFP---MSG  134

Query  176  DLHACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSM  355
            D +A                                  +N   E F   +      L  +
Sbjct  135  DANA----------------------------------SNNSKEFFQGPSR-----LIDL  155

Query  356  KED----LVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLD  523
            K+D    L N+++  + +  T WPF+ FL G+MFCLL+SS CHL  CHS +L+ ++LR+D
Sbjct  156  KQDQHLQLDNMMSTKSIQSETTWPFYVFLVGSMFCLLSSSICHLFCCHSHKLNILLLRMD  215

Query  524  YAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            Y GI  +I TSF+PP+YY F C P +  +YLG I
Sbjct  216  YVGITVMIITSFFPPIYYIFQCSPHWQIVYLGGI  249



>ref|XP_009778210.1| PREDICTED: heptahelical transmembrane protein 1-like [Nicotiana 
sylvestris]
Length=375

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/211 (37%), Positives = 112/211 (53%), Gaps = 43/211 (20%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +K+A  S+F  HNETLNVWTHL+GF LF+ LTI   +++P + DF T+            
Sbjct  78   IKEAFFSIFRWHNETLNVWTHLLGFILFVGLTIVNVVEVPQLADFMTM------------  125

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                                   FP+    ++    +N   E F  S       L  +K+
Sbjct  126  -------------------FIWNFPTSGGANV----SNNSKEFFQGSGR-----LIDLKQ  157

Query  362  DL---VNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAG  532
            D    ++I++    +  T WPF+ FL G+MFCLL+SS CHL SCHS +L+ ++LR+DY G
Sbjct  158  DQHLQLDIMSTKNVQSETTWPFYVFLAGSMFCLLSSSICHLFSCHSHKLNILLLRMDYVG  217

Query  533  IAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            I  +I TSF+PP+YY F C P +  +YL  I
Sbjct  218  ITVMIITSFFPPIYYIFQCSPHWQIVYLSGI  248



>ref|XP_001780544.1| predicted protein [Physcomitrella patens]
 gb|EDQ54638.1| predicted protein [Physcomitrella patens]
Length=379

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 121/197 (61%), Gaps = 13/197 (7%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK +LLS+F++HNET N+W+HL+GF LFL LTIYTAM +P +V+  TL        ++++
Sbjct  62   LKHSLLSIFSMHNETFNIWSHLIGFLLFLGLTIYTAMHVPTIVEPSTLHRW-----QSEI  116

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
            +  +PS L      +L E L +  P    +   Q +   +P   ++  +  + +LS +  
Sbjct  117  NDVMPSYL------QLNEALSSCVPG--TFDGTQCIQVVIPSLTASPLYDPMNLLSIILH  168

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
                       +PITRWPFF FLGGAMFC+LAS+ CHLL C S +  Y+++R+DYAGIA 
Sbjct  169  SFRTACFQSANKPITRWPFFVFLGGAMFCMLASTLCHLLGCRSAKTFYLLMRMDYAGIAT  228

Query  542  LISTSFYPPVYYSFMCY  592
            LI+ SF+PPV +  + Y
Sbjct  229  LIAASFFPPVRFCIIAY  245



>ref|XP_009606704.1| PREDICTED: heptahelical transmembrane protein 1-like [Nicotiana 
tomentosiformis]
Length=375

 Score =   137 bits (346),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 78/211 (37%), Positives = 114/211 (54%), Gaps = 43/211 (20%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +K+A LS+F  HNETLNVWTHL+GF LF+ LTI   +++P + DF T+            
Sbjct  78   IKEAFLSIFRWHNETLNVWTHLLGFILFVGLTIVNVVEVPQLADFMTM------------  125

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                                   FP+  + ++    +N   E F  S       L  +K+
Sbjct  126  -------------------FIWNFPTSGDANV----SNNSKEFFQGSGR-----LIDLKQ  157

Query  362  DL---VNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAG  532
            D    ++I++  + +  T WPF+ FL G+MFCLL+SS CHL SCHS +L+ ++LR+DY G
Sbjct  158  DQNLQLDIMSTQSVQSETTWPFYVFLAGSMFCLLSSSICHLFSCHSHKLNILLLRMDYVG  217

Query  533  IAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            I  +I TSF+PP+YY F C   +  +YL  I
Sbjct  218  ITVMIITSFFPPIYYIFQCSQHWQIVYLSGI  248



>ref|XP_004242752.1| PREDICTED: heptahelical transmembrane protein 1 [Solanum lycopersicum]
Length=379

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/212 (38%), Positives = 116/212 (55%), Gaps = 44/212 (21%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +KQALLS+F  HNETLNVWTHL+GF LF++LT+   +++P + DF T+            
Sbjct  82   IKQALLSIFRWHNETLNVWTHLLGFILFVALTLSNVVQVPQLSDFMTM------------  129

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                                   FP   + ++    +N   E F   +      L  +K+
Sbjct  130  -------------------FIWNFPMGGDANV----SNNSKEFFQGPSR-----LIDLKQ  161

Query  362  D----LVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYA  529
            D    L N+++  + +  T WPF+ FL G+MFCLL+SS CHL  CHS +L+ ++LR+DY 
Sbjct  162  DQHLQLENMMSTKSIQSETTWPFYVFLVGSMFCLLSSSICHLFCCHSHKLNILLLRMDYV  221

Query  530  GIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            GI  +I TSF+PP+YY F C P +  +YLG I
Sbjct  222  GITVMIITSFFPPIYYIFQCSPHWQIVYLGCI  253



>ref|XP_008242828.1| PREDICTED: adiponectin receptor protein 1 [Prunus mume]
Length=392

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 106/209 (51%), Gaps = 39/209 (19%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L QAL SVF  HNETLNVWTHL+GF LFL LT+   +++P V D      L    R   +
Sbjct  92   LPQALFSVFRWHNETLNVWTHLIGFVLFLGLTMANLLRVPQVADL-----LGFFARSTPI  146

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
             A                                 +TN      S    TN+  L  M  
Sbjct  147  SA---------------------------------VTNVSRNFISGIITTNLIDLKQMPS  173

Query  362  DLVNIIAPL-TTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIA  538
              + I A       +  WPF+ FLGG+MFCLL+SS CHL SCHS  L+ ++LR+DYAGI 
Sbjct  174  QEMEIAAAGHEMGGVVYWPFYVFLGGSMFCLLSSSICHLFSCHSHPLNLLLLRIDYAGIT  233

Query  539  ALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
             +I TSF+PP+YY F C P +  +YLG I
Sbjct  234  MMIITSFFPPIYYIFQCDPRWQFIYLGGI  262



>gb|ACJ85151.1| unknown [Medicago truncatula]
Length=269

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 110/208 (53%), Gaps = 42/208 (20%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK+A  S+F  HNETLNVWTHLVGF LFL LT+   MK P VVD   LQ     +     
Sbjct  73   LKEAFFSLFRWHNETLNVWTHLVGFILFLGLTLANLMK-PHVVDL--LQQFTRSISSGGE  129

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                 S+          + L TA        ++  L + LP             L+   E
Sbjct  130  KNVSDSI----------KVLGTA--------LLFDLNHQLP-------------LTMEVE  158

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
             L  +IA        RWPFF FLGG+MFCLL+SS CHL SCHS  L+  +LR+DY GIA 
Sbjct  159  SLEFVIA--------RWPFFVFLGGSMFCLLSSSICHLFSCHSHDLNLFLLRIDYVGIAV  210

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            +I TSF+P +YY F+C P +  +YL  I
Sbjct  211  MIITSFFPQIYYVFLCQPHWQLIYLAGI  238



>ref|XP_009624873.1| PREDICTED: heptahelical transmembrane protein 4-like isoform 
X2 [Nicotiana tomentosiformis]
Length=186

 Score =   129 bits (325),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/62 (100%), Positives = 62/62 (100%), Gaps = 0/62 (0%)
 Frame = +2

Query  440  MFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLG  619
            MFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLG
Sbjct  1    MFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLG  60

Query  620  FI  625
            FI
Sbjct  61   FI  62



>ref|XP_007204648.1| hypothetical protein PRUPE_ppa001571mg [Prunus persica]
 gb|EMJ05847.1| hypothetical protein PRUPE_ppa001571mg [Prunus persica]
Length=800

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 83/209 (40%), Positives = 105/209 (50%), Gaps = 39/209 (19%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L QAL SVF  HNETLNVWTHL+GF LFL LT+   +++P V D      L    R   +
Sbjct  26   LPQALFSVFRWHNETLNVWTHLIGFVLFLGLTMVNLLRVPQVADL-----LGFFARSTPI  80

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
             A                                 +TN      S    TN+  L  M  
Sbjct  81   SA---------------------------------VTNVSRNFISGIMTTNLIELKQMTS  107

Query  362  DLVNIIAPL-TTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIA  538
              + I A       +  WPF+ FLGG+MFCL +SS CHL SCHS  L+ ++LR+DYAGI 
Sbjct  108  QEMEIAAAGHEMGGVAYWPFYVFLGGSMFCLFSSSICHLFSCHSHPLNLLLLRIDYAGIT  167

Query  539  ALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
             +I TSF+PP+YY F C P +  +YLG I
Sbjct  168  MMIITSFFPPIYYIFQCDPRWQFIYLGGI  196



>ref|XP_010687884.1| PREDICTED: heptahelical transmembrane protein 1 [Beta vulgaris 
subsp. vulgaris]
Length=360

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 104/209 (50%), Gaps = 41/209 (20%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVD-FPTLQNLPDVLRKAD  178
            +KQA  S+F  HNETLNVWTHL+GF LF+ LT+  A  +   VD F   +N P  L K  
Sbjct  68   VKQAFFSLFQWHNETLNVWTHLLGFALFVVLTVVNAAHVSQAVDLFGIFRNYPSGLEKNS  127

Query  179  LHACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMK  358
             H      + +                                       TN+  L+++ 
Sbjct  128  SHDSTNIFMGV---------------------------------------TNLVDLNNIS  148

Query  359  EDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIA  538
                N I  + +  + RWPF+ +L G+MFCLL+S+ CHL  CHS  ++  +LR+DY GI 
Sbjct  149  NQGGNEIQHMNSEAV-RWPFYVYLSGSMFCLLSSTICHLFCCHSHHMNLWLLRMDYTGIT  207

Query  539  ALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
             +I TSF+PP+YY F C P +  +YL  I
Sbjct  208  VMIITSFFPPIYYIFQCQPLWQIIYLSGI  236



>gb|KGN65108.1| hypothetical protein Csa_1G224880 [Cucumis sativus]
Length=351

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 110/208 (53%), Gaps = 27/208 (13%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK+ALLSVF  HNETLNVWTHL+GF LFL L +   M           + +P V   ADL
Sbjct  43   LKRALLSVFQWHNETLNVWTHLIGFVLFLGLCLVNLM-----------EGIPQV---ADL  88

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                            R  L + + ++S++    L+ +  PE    +        S    
Sbjct  89   FGFFS-----------RSMLTSLYTNISSYASKDLIGSTTPELMELAGSILPYDGSPTSS  137

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
              +N I   ++    RWPFF FL G+MFCLL+SS CHL  CHS  L+ ++LR+DY GI  
Sbjct  138  GHINSITNKSS--TERWPFFVFLSGSMFCLLSSSICHLFCCHSHPLNILLLRIDYVGITV  195

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            +I TSF+PP+YY F C P +  +YL  I
Sbjct  196  MIITSFFPPIYYIFQCDPLWQIVYLAGI  223



>ref|XP_008443935.1| PREDICTED: adiponectin receptor protein [Cucumis melo]
Length=352

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 112/209 (54%), Gaps = 28/209 (13%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK+ALLSVF  HNETLNVWTHL+GF LFL L +   M           + +P V   ADL
Sbjct  43   LKRALLSVFQWHNETLNVWTHLIGFVLFLGLCLANLM-----------EEIPQV---ADL  88

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                            R  L + + ++S++     + +  PE    +    +        
Sbjct  89   FGFFS-----------RSMLTSLYTNISSYASKDFIGSTAPELMELAG--TILPYDGPAT  135

Query  362  DLVNIIAPLTTRPIT-RWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIA  538
             + +I + +T R  T RWPFF FL G+MFCLL+SS CHL  CHS  L+ ++LR+DY GI 
Sbjct  136  SVGHINSIITNRSSTERWPFFVFLSGSMFCLLSSSICHLFCCHSHPLNILLLRIDYVGIT  195

Query  539  ALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
             +I TSF+PP+YY F C P +  +YL  I
Sbjct  196  VMIITSFFPPIYYIFQCDPLWQIVYLAGI  224



>gb|KCW82943.1| hypothetical protein EUGRSUZ_C04321 [Eucalyptus grandis]
Length=345

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 109/208 (52%), Gaps = 40/208 (19%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L +A  S+F  HNETLNVWTHL+GF +FL LT+   + +P V D   L +  +       
Sbjct  84   LAEAARSLFRWHNETLNVWTHLIGFLVFLGLTVANFVDVPQVADLLGLFSWSNS------  137

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                                 +A  ++S    + L TN L              LS + E
Sbjct  138  --------------------TSAGTNISYSKELLLGTNSLVN------------LSQITE  165

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
            + + + +      +TRWPFF FLGG+MFCLL+SS CHL SCHS  L+  +LR+DY GI  
Sbjct  166  EEMKVGS--LQAAVTRWPFFVFLGGSMFCLLSSSICHLFSCHSPCLNIQLLRMDYVGITV  223

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            +I TSF+PP+YY F C P +  +YLG I
Sbjct  224  MIITSFFPPIYYIFQCEPHWQLIYLGGI  251



>gb|AES91625.2| hemolysin-III-like protein [Medicago truncatula]
Length=365

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 110/208 (53%), Gaps = 42/208 (20%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK+A  S+F  HNETLNVWTHLVGF LFL LT+   MK P VVD   LQ     +     
Sbjct  73   LKEAFFSLFRWHNETLNVWTHLVGFILFLGLTLANLMK-PHVVDL--LQQFTRSISSGGE  129

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                 S+          + L TA        ++  L + LP             L+   E
Sbjct  130  KNVSDSI----------KVLGTA--------LLFDLNHQLP-------------LTMEVE  158

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
             L  +IA        RWPFF FLGG+MFCLL+SS CHL SCHS  L+  +LR+DY GIA 
Sbjct  159  SLEFVIA--------RWPFFVFLGGSMFCLLSSSICHLFSCHSHDLNLFLLRIDYVGIAV  210

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            +I TSF+P +YY F+C P +  +YL  I
Sbjct  211  MIITSFFPQIYYVFLCQPHWQLIYLAGI  238



>ref|XP_008352233.1| PREDICTED: adiponectin receptor protein-like [Malus domestica]
Length=378

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/210 (38%), Positives = 110/210 (52%), Gaps = 41/210 (20%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L +A  SVF  HNETLNVWTHL+GF LFL LT+   +++P V D                
Sbjct  93   LAEAFFSVFRWHNETLNVWTHLIGFVLFLGLTMANLLEVPQVADL---------------  137

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                                  AF S S    ++ +TN +   F++   TN+  L  M  
Sbjct  138  ---------------------LAFFSRST--PIRAVTN-VSHNFTSGMTTNLTELKQMTS  173

Query  362  DLVNIIAPLTTRP--ITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGI  535
              +   + + +    +T WPF+ FL G+MFCLL+S+ CHL SCHS  L+ ++LR+DYAGI
Sbjct  174  QDMEFASSVASAEMGVTYWPFYVFLAGSMFCLLSSTICHLFSCHSHPLNLMLLRIDYAGI  233

Query  536  AALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
              +I TSF+PP+YY F C   +  +YLG I
Sbjct  234  TTMIITSFFPPIYYIFQCDSRWQFIYLGGI  263



>ref|XP_010050089.1| PREDICTED: heptahelical transmembrane protein 1-like [Eucalyptus 
grandis]
Length=379

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 109/208 (52%), Gaps = 40/208 (19%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L +A  S+F  HNETLNVWTHL+GF +FL LT+   + +P V D   L +  +       
Sbjct  84   LAEAARSLFRWHNETLNVWTHLIGFLVFLGLTVANFVDVPQVADLLGLFSWSNS------  137

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                                 +A  ++S    + L TN L              LS + E
Sbjct  138  --------------------TSAGTNISYSKELLLGTNSLVN------------LSQITE  165

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
            + + + +      +TRWPFF FLGG+MFCLL+SS CHL SCHS  L+  +LR+DY GI  
Sbjct  166  EEMKVGS--LQAAVTRWPFFVFLGGSMFCLLSSSICHLFSCHSPCLNIQLLRMDYVGITV  223

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            +I TSF+PP+YY F C P +  +YLG I
Sbjct  224  MIITSFFPPIYYIFQCEPHWQLIYLGGI  251



>ref|XP_003609428.1| Adiponectin receptor protein [Medicago truncatula]
Length=394

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 110/208 (53%), Gaps = 42/208 (20%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK+A  S+F  HNETLNVWTHLVGF LFL LT+   MK P VVD   LQ     +     
Sbjct  73   LKEAFFSLFRWHNETLNVWTHLVGFILFLGLTLANLMK-PHVVDL--LQQFTRSISSGGE  129

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                 S+          + L TA        ++  L + LP             L+   E
Sbjct  130  KNVSDSI----------KVLGTA--------LLFDLNHQLP-------------LTMEVE  158

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
             L  +IA        RWPFF FLGG+MFCLL+SS CHL SCHS  L+  +LR+DY GIA 
Sbjct  159  SLEFVIA--------RWPFFVFLGGSMFCLLSSSICHLFSCHSHDLNLFLLRIDYVGIAV  210

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            +I TSF+P +YY F+C P +  +YL  I
Sbjct  211  MIITSFFPQIYYVFLCQPHWQLIYLAGI  238



>ref|XP_004287273.1| PREDICTED: heptahelical transmembrane protein 1 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=414

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 107/207 (52%), Gaps = 41/207 (20%)
 Frame = +2

Query  8    QALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADLHA  187
            +AL SVF  HNETLN+WTHL+GF LF+ LT+    ++P V D     N            
Sbjct  116  EALFSVFRWHNETLNIWTHLIGFVLFVGLTMANLWEVPQVSDLLGFFN------------  163

Query  188  CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSM-KED  364
                              ++ F + +N          +   FS      V  L  +  ++
Sbjct  164  ------------------RSTFSAATN----------VSHNFSAETTNFVHDLKELTSQE  195

Query  365  LVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAAL  544
            + NI  P     +T WPF+ FL G+MFCLL+S+ CHL SCHS  L+ ++LR+DYAGI  +
Sbjct  196  MNNIALPGDRLNVTLWPFYVFLSGSMFCLLSSTICHLFSCHSHPLNVLLLRIDYAGITTM  255

Query  545  ISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            I TSF+PP+YY F C P +  +YLG I
Sbjct  256  IITSFFPPIYYIFQCDPRWQVIYLGGI  282



>ref|XP_007013572.1| Heptahelical transmembrane protein1 isoform 1 [Theobroma cacao]
 gb|EOY31191.1| Heptahelical transmembrane protein1 isoform 1 [Theobroma cacao]
Length=379

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 118/208 (57%), Gaps = 39/208 (19%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +K+AL S+F  HNETLNVWTHL+GF LFL LT+   +++P V D  T             
Sbjct  87   IKEALFSIFRWHNETLNVWTHLLGFVLFLGLTMANLVEVPQVADLITF------------  134

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                               L  +FP  ++ ++    ++   E F  +  TN+  L  +  
Sbjct  135  -------------------LARSFPISADSNV----SHDSKELFMGA--TNLIDLKRITT  169

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
              ++I  P++  P+TRWPF+ FLGG+MFCLL+SS CHL SCHS  L+  +LR+DYAGI  
Sbjct  170  PELDITPPVS--PVTRWPFYVFLGGSMFCLLSSSICHLFSCHSHHLNLTLLRIDYAGITT  227

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            +I TSF+PP+YY F C P +  +YLG I
Sbjct  228  MIITSFFPPIYYIFQCDPQWHFVYLGGI  255



>ref|XP_009782054.1| PREDICTED: heptahelical transmembrane protein 1-like [Nicotiana 
sylvestris]
Length=347

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/205 (39%), Positives = 105/205 (51%), Gaps = 47/205 (23%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK+A  S+F  HNETLNVWTHL+GF LF+ LTI  A  +  + DF T+      +R    
Sbjct  60   LKEAFFSIFRWHNETLNVWTHLIGFILFMVLTIANAEHVSQLADFMTM-----FIRN---  111

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                                   FP+  N +I         + FS   H        M  
Sbjct  112  -----------------------FPTSGNANISHS-----SKAFSQDRHI------QMDI  137

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
             L N +    T     WPF+ FL GAMFCLL+SS CHL SCHS++L+  ++++DY GIA 
Sbjct  138  TLSNRVTNEAT-----WPFYVFLAGAMFCLLSSSICHLFSCHSQKLNLFLVQMDYVGIAV  192

Query  542  LISTSFYPPVYYSFMCYPFFCNLYL  616
            +I TSF+PP+YY F C P +  +YL
Sbjct  193  MIITSFFPPMYYIFQCSPHWQIVYL  217



>ref|XP_008336977.1| PREDICTED: adiponectin receptor protein isoform X1 [Malus domestica]
Length=390

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/210 (38%), Positives = 109/210 (52%), Gaps = 41/210 (20%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L +A  SVF  HNETLNVWTHL+GF LFL LT+   +++P V D                
Sbjct  93   LAEAFFSVFRWHNETLNVWTHLIGFVLFLGLTMANLLEVPQVADL---------------  137

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                                  AF S S    ++ +TN +   F +   TN+  L  M  
Sbjct  138  ---------------------LAFFSRST--PIRAVTN-VSHNFXSGMTTNLTELKQMTS  173

Query  362  DLVNIIAPLTTRP--ITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGI  535
              +   + + +    +T WPF+ FL G+MFCLL+S+ CHL SCHS  L+ ++LR+DYAGI
Sbjct  174  QDMEFASSVASAEMGVTYWPFYVFLAGSMFCLLSSTICHLFSCHSHPLNLMLLRIDYAGI  233

Query  536  AALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
              +I TSF+PP+YY F C   +  +YLG I
Sbjct  234  TTMIITSFFPPIYYIFQCDSRWQFIYLGGI  263



>ref|XP_010239850.1| PREDICTED: heptahelical transmembrane protein ADIPOR1 [Brachypodium 
distachyon]
Length=380

 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 80/207 (39%), Positives = 103/207 (50%), Gaps = 44/207 (21%)
 Frame = +2

Query  11   ALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADLHAC  190
            A LS+F+ HNET+N+WTHLVGF +FL LT++   +      FP + +L   L        
Sbjct  89   AALSLFSWHNETINIWTHLVGFMVFLGLTVWHLAQY-----FPQVAHLIGHL--------  135

Query  191  LPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKED--  364
                                     +W I ++  N      SN         S M+ +  
Sbjct  136  -------------------------SWPISKVAENVS----SNIGDAISGAASFMQANPG  166

Query  365  LVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAAL  544
            L    A     P TRWPFF FL GAMFCLL+S  CHLLSCHS RL+  ++RLDY GIA +
Sbjct  167  LAEAFAGAGVGPTTRWPFFVFLAGAMFCLLSSCACHLLSCHSHRLNLFLIRLDYTGIAVM  226

Query  545  ISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            I  SF+PP+YY F C P +   YL  I
Sbjct  227  IVVSFFPPIYYIFQCEPRWQLAYLSAI  253



>gb|KJB23591.1| hypothetical protein B456_004G106400 [Gossypium raimondii]
Length=362

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 79/205 (39%), Positives = 110/205 (54%), Gaps = 38/205 (19%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK  LLSVF++HNET+N+WTHL GF LF+ LT++++M+     DF    +L     KA +
Sbjct  66   LKDILLSVFSLHNETINIWTHLAGFLLFVGLTVFSSME-----DFGD-GSLITSFSKAQV  119

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                PS++ + D++   +   + F      HI QL                      +K+
Sbjct  120  SG--PSMMMMNDVN-ASDNKHSIFQGSELRHIPQL---------------------DLKK  155

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
            D  N         I +WP+F FL GAM CL+ SS  HL +CHS R S    RLDYAGI+ 
Sbjct  156  DRYN--------AIPKWPWFVFLSGAMGCLVCSSVSHLFACHSRRFSLFFWRLDYAGISL  207

Query  542  LISTSFYPPVYYSFMCYPFFCNLYL  616
            +I  SF+ PVYY+F C+P+ C  YL
Sbjct  208  MIVCSFFAPVYYAFFCHPYSCLFYL  232



>ref|XP_007013573.1| Heptahelical transmembrane protein1 isoform 2 [Theobroma cacao]
 gb|EOY31192.1| Heptahelical transmembrane protein1 isoform 2 [Theobroma cacao]
Length=380

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 120/208 (58%), Gaps = 38/208 (18%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +K+AL S+F  HNETLNVWTHL+GF LFL LT+   +++P V               ADL
Sbjct  87   IKEALFSIFRWHNETLNVWTHLLGFVLFLGLTMANLVEVPQV---------------ADL  131

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
               L S                +FP  ++ ++    ++   E F  +  TN+  L  +  
Sbjct  132  ITFLAS---------------RSFPISADSNV----SHDSKELFMGA--TNLIDLKRITT  170

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
              ++I  P++  P+TRWPF+ FLGG+MFCLL+SS CHL SCHS  L+  +LR+DYAGI  
Sbjct  171  PELDITPPVS--PVTRWPFYVFLGGSMFCLLSSSICHLFSCHSHHLNLTLLRIDYAGITT  228

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            +I TSF+PP+YY F C P +  +YLG I
Sbjct  229  MIITSFFPPIYYIFQCDPQWHFVYLGGI  256



>ref|XP_009340651.1| PREDICTED: heptahelical transmembrane protein 1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009340655.1| PREDICTED: heptahelical transmembrane protein 1-like isoform 
X1 [Pyrus x bretschneideri]
Length=391

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 111/208 (53%), Gaps = 37/208 (18%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L +A  SVF  HNETLNVWTH +GF LFL LT+   +++P V               ADL
Sbjct  94   LAEAFFSVFRWHNETLNVWTHFIGFVLFLGLTMANLLEVPQV---------------ADL  138

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
             A              R    +A  ++S+  I  + TN           T++  ++S   
Sbjct  139  LAFFS-----------RSTPISAVTNVSHDFISGMTTNL----------TDLKQMTSQDM  177

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
            +  + +A      +T WPF+ FL G+MFCLL+S+ CHL SCHS  L+ ++LR+DYAGI  
Sbjct  178  EFASSVAS-PEMGVTYWPFYVFLAGSMFCLLSSTICHLFSCHSHPLNLMLLRIDYAGITT  236

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            +I TSF+PP+YY F C   +  +YLG I
Sbjct  237  MIITSFFPPIYYIFQCDSRWQFIYLGGI  264



>ref|XP_002960615.1| hypothetical protein SELMODRAFT_65678, partial [Selaginella moellendorffii]
 gb|EFJ38154.1| hypothetical protein SELMODRAFT_65678, partial [Selaginella moellendorffii]
Length=288

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 97/171 (57%), Gaps = 14/171 (8%)
 Frame = +2

Query  113  KIPDVVDFPTLQNLPDVLRKADLHACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLT  292
            K  ++VD+     LPD LR  +         +I   +R+   LK    S+ + H   L  
Sbjct  8    KAYNLVDY---HALPDYLRDNE---------YILKHYRVNWPLKQTILSMFSIHNETL--  53

Query  293  NCLPECFSNSNHTNVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCH  472
            N    C        + +   +  ++  ++A L   P  RWP + FLGGAMFCL +SS  H
Sbjct  54   NFWTHCVGFLLFVFLTINVILTVEIPTLVAELLHAPTARWPIYTFLGGAMFCLFSSSVAH  113

Query  473  LLSCHSERLSYIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            LL CHSER SY++LRLDYAGIA+LISTSFYPPVYYSFMC P + NLYL  I
Sbjct  114  LLGCHSERASYLLLRLDYAGIASLISTSFYPPVYYSFMCSPLWRNLYLAVI  164



>ref|XP_009363962.1| PREDICTED: heptahelical transmembrane protein 1-like [Pyrus x 
bretschneideri]
Length=392

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 79/210 (38%), Positives = 106/210 (50%), Gaps = 41/210 (20%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L +AL SVF  HNETLNVWTHL+GF LFL LT+   +++P V               ADL
Sbjct  95   LPEALFSVFRWHNETLNVWTHLIGFVLFLGLTMANLLEVPQV---------------ADL  139

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                    HI  +                       TN +   F +   TN   L  M  
Sbjct  140  LGFFARSTHISGV-----------------------TN-VSRNFISGMTTNFIDLKQMTP  175

Query  362  DLVNIIAPLTTRP--ITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGI  535
              +   + + +    +  WPF+ FL G+MFCLL+S+ CHL SCHS  L+ ++LR+DYAGI
Sbjct  176  QDMEFASSVASAEMGVAHWPFYVFLAGSMFCLLSSTICHLFSCHSHPLNLMLLRIDYAGI  235

Query  536  AALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
              +I TSF+PP+YY F C   +  +YLG I
Sbjct  236  TTMIITSFFPPIYYIFQCDSRWQFIYLGGI  265



>gb|ACU17599.1| unknown [Glycine max]
Length=186

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +2

Query  440  MFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLG  619
            MFCLLASS CHLLSCHS R++YIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLG
Sbjct  1    MFCLLASSICHLLSCHSARMAYIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLG  60

Query  620  FI  625
            FI
Sbjct  61   FI  62



>gb|KJB64686.1| hypothetical protein B456_010G060500 [Gossypium raimondii]
Length=360

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 87/208 (42%), Positives = 114/208 (55%), Gaps = 39/208 (19%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK+AL SVF  HNETLNVWTHL+GF LFL LT+   +++P V               ADL
Sbjct  68   LKEALFSVFRWHNETLNVWTHLLGFLLFLGLTMANLLELPQV---------------ADL  112

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
               L     I     +  + +  F  ++N  +V L     PE                  
Sbjct  113  ITFLTRSFLINGHTNVSYDSEDLFLGITN--LVNLRQITTPES-----------------  153

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
               ++  P+T  P+TRWPF+ FLGG++FCLL+SS CHL SCHS  L+  +LRLDYAGI  
Sbjct  154  ---DVTLPVT--PVTRWPFYVFLGGSLFCLLSSSVCHLFSCHSHHLNLTLLRLDYAGITT  208

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            +I TSF+PP+YY F C P +  +YLG I
Sbjct  209  MIITSFFPPIYYIFQCDPQWHFVYLGGI  236



>ref|XP_001774065.1| predicted protein [Physcomitrella patens]
 gb|EDQ61117.1| predicted protein [Physcomitrella patens]
Length=286

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +2

Query  389  TTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAALISTSFYPP  568
            T +PITRWPFFAFLGGAMFC+ AS+ CHLL C S +  Y+++RLDYAGIA LI+TSF+PP
Sbjct  81   TIKPITRWPFFAFLGGAMFCMFASTMCHLLGCRSAKTFYLLMRLDYAGIATLIATSFFPP  140

Query  569  VYYSFMCYPFFCNLYLGFI  625
            VYYSFMC P  C +YLG I
Sbjct  141  VYYSFMCNPALCKMYLGMI  159


 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDV  127
            LK +LLS+F++HNET N+W+HL+GF LFL LTIYTAM IP +
Sbjct  41   LKHSLLSIFSMHNETFNIWSHLIGFLLFLGLTIYTAMHIPTI  82



>ref|XP_002983423.1| hypothetical protein SELMODRAFT_234248 [Selaginella moellendorffii]
 gb|EFJ15765.1| hypothetical protein SELMODRAFT_234248 [Selaginella moellendorffii]
Length=305

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = +2

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
            ++  ++A L   P  RWP + FLGGAMFCL +SS  HLL CHSER SY++LRLDYAGIA+
Sbjct  91   EIPTLVAELLHAPTARWPIYTFLGGAMFCLFSSSVAHLLGCHSERASYLLLRLDYAGIAS  150

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            LISTSFYPPVYYSFMC P + NLYL  I
Sbjct  151  LISTSFYPPVYYSFMCSPLWRNLYLAVI  178



>ref|XP_004287274.1| PREDICTED: heptahelical transmembrane protein 1 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=399

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 74/206 (36%), Positives = 102/206 (50%), Gaps = 54/206 (26%)
 Frame = +2

Query  8    QALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADLHA  187
            +AL SVF  HNETLN+WTHL+GF LF+ LT+    ++P V D     N            
Sbjct  116  EALFSVFRWHNETLNIWTHLIGFVLFVGLTMANLWEVPQVSDLLGFFN------------  163

Query  188  CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKEDL  367
                              ++ F + +N                        V  +   ++
Sbjct  164  ------------------RSTFSAATN------------------------VSHNFSAEM  181

Query  368  VNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAALI  547
             NI  P     +T WPF+ FL G+MFCLL+S+ CHL SCHS  L+ ++LR+DYAGI  +I
Sbjct  182  NNIALPGDRLNVTLWPFYVFLSGSMFCLLSSTICHLFSCHSHPLNVLLLRIDYAGITTMI  241

Query  548  STSFYPPVYYSFMCYPFFCNLYLGFI  625
             TSF+PP+YY F C P +  +YLG I
Sbjct  242  ITSFFPPIYYIFQCDPRWQVIYLGGI  267



>ref|XP_008362888.1| PREDICTED: progestin and adipoQ receptor-like protein 1 [Malus 
domestica]
Length=392

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 108/208 (52%), Gaps = 37/208 (18%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L +AL SVF  HNETLNVWTHL+GF LFL LT+   +++P V D      L    R   +
Sbjct  95   LPEALFSVFRWHNETLNVWTHLIGFVLFLGLTMANLLEVPPVADL-----LGXFARSTPI  149

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                                     ++S   I  + TN +          ++  ++S   
Sbjct  150  SGVX---------------------NVSRNFISGMTTNLI----------BLKQMTSQDM  178

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
            +  +  AP     +  WPF+ FL G+MFCLL+S+ CHL SCHS  L+ ++LR+DYAGI  
Sbjct  179  EFASS-APSAEMGVIYWPFYVFLAGSMFCLLSSTICHLFSCHSHPLNLMLLRIDYAGITT  237

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            +I TSF+PP+YY F C   +  +YLG I
Sbjct  238  MIITSFFPPIYYIFQCDSRWQFIYLGGI  265



>ref|XP_004965759.1| PREDICTED: adiponectin receptor protein 1-like [Setaria italica]
Length=372

 Score =   126 bits (317),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 79/210 (38%), Positives = 106/210 (50%), Gaps = 49/210 (23%)
 Frame = +2

Query  8    QALLSVFTIHNETLNVWTHLVGFFLFLSLT-IYTAMKIPDVVDFPTLQNLPDVLRKADLH  184
             A+LS+F+ HNET+N+WTHL+GF LF  LT ++     P V D                 
Sbjct  81   NAVLSLFSWHNETINIWTHLLGFMLFFGLTLVHLGQYFPQVADL----------------  124

Query  185  ACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKED  364
                 + H+                  +W I ++  N       +SN  +V   ++M   
Sbjct  125  -----IGHL------------------SWPISKVAENV------SSNIGDVLSGAAMFIQ  155

Query  365  LVNIIAPLTT---RPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGI  535
                +A   T      TRWPFF FL GAMFCLL+SS CHLLSCHS RL+  ++RLDY GI
Sbjct  156  TNPTLASYGTAVASQTTRWPFFVFLAGAMFCLLSSSACHLLSCHSHRLNLFLIRLDYTGI  215

Query  536  AALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            A +I  SF+PP+YY F C P +  +YL  I
Sbjct  216  AVMIVVSFFPPIYYIFQCEPRWQAVYLSAI  245



>gb|AGT17177.1| adiponectin receptor [Saccharum hybrid cultivar R570]
Length=371

 Score =   126 bits (317),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 110/210 (52%), Gaps = 49/210 (23%)
 Frame = +2

Query  8    QALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADLHA  187
             A+LS+F+ HNET+N+WTHL+GF LF  LT+    +     DFP + +L   L       
Sbjct  80   NAVLSLFSWHNETINIWTHLLGFMLFFGLTLVHLGQ-----DFPQVADLIGHL-------  127

Query  188  CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSM----  355
                                      +W I ++  N       +SN  +V   ++M    
Sbjct  128  --------------------------SWPISKVAENV------SSNIGDVLSGAAMFIQT  155

Query  356  KEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGI  535
               LV+    +T++  TRWPFF FL GAMFCLL+SS CHLLSCHS  L+  ++RLDY GI
Sbjct  156  NPTLVSYGVAVTSQ-TTRWPFFVFLAGAMFCLLSSSACHLLSCHSHGLNLFLIRLDYRGI  214

Query  536  AALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            A +I  SF+PP+YY F C P +  +YL  I
Sbjct  215  AVMIVVSFFPPIYYIFQCEPHWQVVYLSAI  244



>ref|XP_002438737.1| hypothetical protein SORBIDRAFT_10g025230 [Sorghum bicolor]
 gb|EER90104.1| hypothetical protein SORBIDRAFT_10g025230 [Sorghum bicolor]
Length=377

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 110/207 (53%), Gaps = 43/207 (21%)
 Frame = +2

Query  8    QALLSVFTIHNETLNVWTHLVGFFLFLSLT-IYTAMKIPDVVDFPTLQNLPDVLRKADLH  184
             A+LS+F+ HNET+N+WTHL+GF LF  LT ++     P V D     + P         
Sbjct  86   NAVLSLFSWHNETINIWTHLLGFMLFFGLTLVHLGQYFPQVADLIGHLSWP---------  136

Query  185  ACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKED  364
                       + ++ E + +        +I  +L+      F  +N T           
Sbjct  137  -----------ISKVAENVSS--------NIGDVLSGA--AMFIQTNPT-----------  164

Query  365  LVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAAL  544
            LV+  A +T++  TRWPFF FL GAMFCLL+SS CHLLSCHS  L+  ++RLDY GIA +
Sbjct  165  LVSYGAAVTSQ-TTRWPFFVFLAGAMFCLLSSSACHLLSCHSHSLNLFLIRLDYTGIAVM  223

Query  545  ISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            I  SF+PP+YY F C P +  +YL  I
Sbjct  224  IVVSFFPPIYYIFQCEPHWQVVYLSAI  250



>ref|XP_006345277.1| PREDICTED: ADIPOR-like receptor CG5315-like [Solanum tuberosum]
Length=328

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/205 (37%), Positives = 106/205 (52%), Gaps = 49/205 (24%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LKQA  S+F+ HNETLNVWTHL+GF LF+ LTI  A  +  + DF T+      +R    
Sbjct  43   LKQAFFSIFSWHNETLNVWTHLIGFILFVVLTIANAEHLSQIADFMTM-----FIRN---  94

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                                   FP+  + +I             NS      +   ++ 
Sbjct  95   -----------------------FPTSGDANIPH-----------NSKGETRLIDQHLQM  120

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
            D+       T+     WPF+ FL GAMFCLL+SS CHL SCHS++L+ +++++DY GI  
Sbjct  121  DI-------TSTNEATWPFYVFLVGAMFCLLSSSICHLFSCHSQKLNLLLVQMDYVGITI  173

Query  542  LISTSFYPPVYYSFMCYPFFCNLYL  616
            +I TSF+PP+YY F C P +  +YL
Sbjct  174  MIITSFFPPMYYIFQCSPLWQIVYL  198



>gb|KHG16208.1| adipor-like receptor izh1 [Gossypium arboreum]
Length=360

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 113/208 (54%), Gaps = 39/208 (19%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK+AL SVF  HNETLNVWTHL+GF LFL LT+   +++P V               ADL
Sbjct  68   LKEALFSVFRWHNETLNVWTHLLGFLLFLGLTMANLLELPQV---------------ADL  112

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
               L     I     +  + +  F  ++N  +V L     PE                  
Sbjct  113  ITFLTRSFLINGHTNVSYDSEDLFLGITN--LVNLRQITTPES-----------------  153

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
               ++  P+T  P+TRWPF+ FLGG++FCLL+SS CHL SCHS  L+  +LRLDY GI  
Sbjct  154  ---DVTLPVT--PVTRWPFYVFLGGSLFCLLSSSVCHLFSCHSHHLNLTLLRLDYTGITT  208

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            +I TSF+PP+YY F C P +  +YLG I
Sbjct  209  MIITSFFPPIYYIFQCDPQWHFVYLGGI  236



>ref|XP_008649040.1| PREDICTED: adiponectin receptor protein 1 [Zea mays]
 gb|AFW76203.1| hypothetical protein ZEAMMB73_611924 [Zea mays]
Length=374

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 106/210 (50%), Gaps = 49/210 (23%)
 Frame = +2

Query  8    QALLSVFTIHNETLNVWTHLVGFFLFLSLT-IYTAMKIPDVVDFPTLQNLPDVLRKADLH  184
             A+LS+F+ HNET+NVWTHL+GF LF  LT ++     P V D                 
Sbjct  83   NAVLSLFSWHNETINVWTHLLGFMLFFGLTLVHLGQYFPQVADL----------------  126

Query  185  ACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKED  364
                 + H+                  +W I ++  N       +SN  +V   ++M   
Sbjct  127  -----IGHL------------------SWPISKVAENV------SSNIGDVLSGAAMFIQ  157

Query  365  LVNIIAPLTT---RPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGI  535
                +A   T      TRWPFF FL GAMFCLL+SS CHLLSCHS RL+ +++RLDY GI
Sbjct  158  TNPSLASHGTAVASQTTRWPFFVFLAGAMFCLLSSSACHLLSCHSHRLNLLLIRLDYTGI  217

Query  536  AALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            A +I  SF+PP+YY F C P +   YL  I
Sbjct  218  AVMIVVSFFPPIYYIFQCEPRWRAAYLSAI  247



>ref|XP_002263728.1| PREDICTED: heptahelical transmembrane protein 1 [Vitis vinifera]
Length=386

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 110/208 (53%), Gaps = 39/208 (19%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK+AL SVF  HNET+NVWTHL+GF LFL LT+   M++P   DF T           + 
Sbjct  93   LKEALFSVFRWHNETVNVWTHLLGFILFLGLTLANLMQVPQFADFFT-----------NF  141

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                P    I   H  ++       SL   +++QL     PE                  
Sbjct  142  SWSFPLCAAINASHDSKDF------SLGTSNLIQLKQITQPE------------------  177

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
                 ++P      TRWPFF FLGG+MFCLL+SS CHL SCHS  L+ ++LR+DY GIA 
Sbjct  178  --TEFLSP--EMATTRWPFFIFLGGSMFCLLSSSVCHLFSCHSRSLNILLLRMDYVGIAV  233

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            +I TSF+PP+YY F C P +  +YL  I
Sbjct  234  MIITSFFPPIYYIFQCDPHWQFIYLAGI  261



>emb|CBI25538.3| unnamed protein product [Vitis vinifera]
Length=427

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 110/208 (53%), Gaps = 39/208 (19%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK+AL SVF  HNET+NVWTHL+GF LFL LT+   M++P   DF T           + 
Sbjct  93   LKEALFSVFRWHNETVNVWTHLLGFILFLGLTLANLMQVPQFADFFT-----------NF  141

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                P    I   H  ++       SL   +++QL     PE                  
Sbjct  142  SWSFPLCAAINASHDSKDF------SLGTSNLIQLKQITQPE------------------  177

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
                 ++P      TRWPFF FLGG+MFCLL+SS CHL SCHS  L+ ++LR+DY GIA 
Sbjct  178  --TEFLSP--EMATTRWPFFIFLGGSMFCLLSSSVCHLFSCHSRSLNILLLRMDYVGIAV  233

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            +I TSF+PP+YY F C P +  +YL  I
Sbjct  234  MIITSFFPPIYYIFQCDPHWQFIYLAGI  261



>gb|AGT15921.1| hypothetical protein SHCRBa_179_G22_F_140 [Saccharum hybrid cultivar 
R570]
 gb|AGT16395.1| hypothetical protein SHCRBa_181_K17_F_110 [Saccharum hybrid cultivar 
R570]
Length=371

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 109/211 (52%), Gaps = 51/211 (24%)
 Frame = +2

Query  8    QALLSVFTIHNETLNVWTHLVGFFLFLSLT-IYTAMKIPDVVDFPTLQNLPDVLRKADLH  184
             A+LS+F+ HNET+N+WTHL+GF LF  LT ++     P V D                 
Sbjct  80   NAVLSLFSWHNETINIWTHLLGFMLFFGLTLVHLGQYFPQVADL----------------  123

Query  185  ACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSM---  355
                 + H+                  +W I ++  N       +SN  +V   ++M   
Sbjct  124  -----IGHL------------------SWPISKVAENV------SSNIGDVLSGAAMFIQ  154

Query  356  -KEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAG  532
                LV+    +T++  TRWPFF FL GAMFCLL+SS CHLLSCHS  L+  ++RLDY G
Sbjct  155  TNPTLVSYGVAVTSQ-TTRWPFFVFLAGAMFCLLSSSACHLLSCHSHGLNLFLIRLDYTG  213

Query  533  IAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            IA +I  SF+PP+YY F C P +  +YL  I
Sbjct  214  IAVMIVVSFFPPIYYIFQCEPHWQVVYLSAI  244



>ref|XP_009611748.1| PREDICTED: heptahelical transmembrane protein 1-like [Nicotiana 
tomentosiformis]
Length=346

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 77/205 (38%), Positives = 104/205 (51%), Gaps = 47/205 (23%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK+A  S+F  HNETLNVWTHL+GF LF+ LTI  A  +  + DF T+      +R    
Sbjct  59   LKEAFFSIFRWHNETLNVWTHLIGFILFMVLTIANAEHVSQLADFMTM-----FIRN---  110

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                                   FP+  N +I         + FS   H        M  
Sbjct  111  -----------------------FPTSGNANISHS-----SKAFSQDRHL------PMDI  136

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
             L N +    T     WPF+ FL GAMFCLL+SS CHL  CHS++L+  ++++DY GI+ 
Sbjct  137  TLSNRVTNEAT-----WPFYVFLAGAMFCLLSSSICHLFLCHSQKLNLFLVQMDYVGISV  191

Query  542  LISTSFYPPVYYSFMCYPFFCNLYL  616
            +I TSF+PP+YY F C P +  +YL
Sbjct  192  MIITSFFPPMYYIFQCSPHWQIVYL  216



>gb|AGT17002.1| hypothetical protein SHCRBa_063_N24_F_260 [Saccharum hybrid cultivar 
R570]
Length=371

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 104/207 (50%), Gaps = 43/207 (21%)
 Frame = +2

Query  8    QALLSVFTIHNETLNVWTHLVGFFLFLSLT-IYTAMKIPDVVDFPTLQNLPDVLRKADLH  184
             A+LS+F+ HNET+N+WTHL+GF LF  LT ++     P V D     + P         
Sbjct  80   NAVLSLFSWHNETINIWTHLLGFMLFFGLTLVHLGQYFPQVADLIGHLSWP---------  130

Query  185  ACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKED  364
                       + ++ E + +        +I  +L+      F  +N T V         
Sbjct  131  -----------ISKVAENVSS--------NIGDVLSGA--AMFIQTNPTMVS--------  161

Query  365  LVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAAL  544
                     T   TRWPFF FL GAMFCLL+SS CHLLSCHS  L+  ++RLDY GIA +
Sbjct  162  ----YGVAVTSQTTRWPFFVFLAGAMFCLLSSSACHLLSCHSHGLNLFLIRLDYTGIAVM  217

Query  545  ISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            I  SF+PP+YY F C P +  +YL  I
Sbjct  218  IVVSFFPPIYYIFQCEPHWQVVYLSAI  244



>gb|KDP30239.1| hypothetical protein JCGZ_17021 [Jatropha curcas]
Length=353

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 108/206 (52%), Gaps = 40/206 (19%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK+AL S+F  HNETLNVWTHL GF LFL LT+   M++P+V D   L            
Sbjct  60   LKEALFSIFRWHNETLNVWTHLFGFLLFLGLTVANIMQVPEVADLLGLFT----------  109

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLS-NWHIVQLLTNCLPECFSNSNHTNVCVLSSMK  358
                            R  L +   ++S N    QL +  L +   + NHT         
Sbjct  110  ----------------RSILTSGEANISCNSKDFQLGSTKLLD-LKHINHTKTE------  146

Query  359  EDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIA  538
                  I PL   P TRWPF+ FLGG+MFCLL+SS CHL SCHS  L+  +LR+DY GI 
Sbjct  147  ------ITPLPGTPATRWPFYVFLGGSMFCLLSSSVCHLFSCHSHNLNIFLLRIDYVGIT  200

Query  539  ALISTSFYPPVYYSFMCYPFFCNLYL  616
             +I TSF+PP+YY F C   +  +YL
Sbjct  201  IMIITSFFPPIYYIFQCETHWHYVYL  226



>gb|EPS71737.1| hypothetical protein M569_03024 [Genlisea aurea]
Length=360

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 107/211 (51%), Gaps = 62/211 (29%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIP-DVVDFPT-----LQNLPDV  163
             K++LLS+F  HNETLNVWTHL+GF +F+ LT+  ++  P  + DF T     L++  + 
Sbjct  76   FKESLLSLFRWHNETLNVWTHLIGFLVFVGLTVVNSIDAPPQLADFITIFTGHLESNMNS  135

Query  164  LRKADLHACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCV  343
             RK D                + E LK A                      + NH     
Sbjct  136  SRKRDF---------------VSEHLKLA----------------------DINHQ----  154

Query  344  LSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLD  523
                           ++ P T WPF+ FL GAMFCLL SSTCHL  CHS++LS  +L+LD
Sbjct  155  ---------------SSPPATNWPFYVFLSGAMFCLLTSSTCHLFFCHSKKLSLHLLQLD  199

Query  524  YAGIAALISTSFYPPVYYSFMCYPFFCNLYL  616
            Y GI  +I TSF+PP++Y F+C P +  LYL
Sbjct  200  YVGITVMIITSFFPPIFYIFLCSPHWQLLYL  230



>gb|KJB83217.1| hypothetical protein B456_013G235800 [Gossypium raimondii]
Length=346

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 114/208 (55%), Gaps = 45/208 (22%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK+AL S+F  HNETLNVWTHL+GF LFL LT+   +++P V D                
Sbjct  60   LKEALFSIFRWHNETLNVWTHLLGFVLFLGLTMANLIEVPQVSD----------------  103

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                           L   L ++FP   + ++ Q      P   + +N  ++  +++ + 
Sbjct  104  ---------------LIAFLTSSFPISGDSNVSQD-----PLLGTTTNLVDLKQITASEP  143

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
            D+          P+TRWPF+ FL G+MFCLL+SS CHL SCHS  L+  +LRLDYAGI  
Sbjct  144  DV---------SPVTRWPFYVFLAGSMFCLLSSSICHLFSCHSHHLNLSLLRLDYAGITT  194

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            +I TSF+PP+YY F C P +  +YLG I
Sbjct  195  MIITSFFPPIYYIFQCDPQWHFIYLGGI  222



>emb|CDP03234.1| unnamed protein product [Coffea canephora]
Length=186

 Score =   119 bits (299),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  440  MFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLG  619
            MFCLLASSTCHLL CHSERLSYIMLRLDYAGIAALISTS YPPVY+SFMCYP FCNLYLG
Sbjct  1    MFCLLASSTCHLLLCHSERLSYIMLRLDYAGIAALISTSSYPPVYHSFMCYPVFCNLYLG  60

Query  620  FI  625
            FI
Sbjct  61   FI  62



>gb|AGT16223.1| hypothetical protein SHCRBa_014_G09_R_50 [Saccharum hybrid cultivar 
R570]
Length=371

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/211 (37%), Positives = 108/211 (51%), Gaps = 51/211 (24%)
 Frame = +2

Query  8    QALLSVFTIHNETLNVWTHLVGFFLFLSLT-IYTAMKIPDVVDFPTLQNLPDVLRKADLH  184
             A+LS+F+ HNET+N+WTHL+GF LF  L  ++     P V D                 
Sbjct  80   NAVLSLFSWHNETINIWTHLLGFMLFFGLALVHLGQYFPQVADL----------------  123

Query  185  ACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSM---  355
                 + H+                  +W I ++  N       +SN  +V   ++M   
Sbjct  124  -----IGHL------------------SWPISKVAENV------SSNIGDVLSGAAMFIQ  154

Query  356  -KEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAG  532
                LV+    +T++  TRWPFF FL GAMFCLL+SS CHLLSCHS  L+  ++RLDY G
Sbjct  155  TNPTLVSYGVAVTSQ-TTRWPFFVFLAGAMFCLLSSSACHLLSCHSHGLNLFLIRLDYTG  213

Query  533  IAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            IA +I  SF+PP+YY F C P +  +YL  I
Sbjct  214  IAVMIVVSFFPPIYYIFQCEPHWQVVYLSAI  244



>ref|XP_006656288.1| PREDICTED: adiponectin receptor protein 1-like [Oryza brachyantha]
Length=367

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/207 (37%), Positives = 102/207 (49%), Gaps = 44/207 (21%)
 Frame = +2

Query  8    QALLSVFTIHNETLNVWTHLVGFFLFLSLTI-YTAMKIPDVVDFPTLQNLPDVLRKADLH  184
             A+LS+F+ HNET+N+WTHL+GF +F  LT+ +     P V D                 
Sbjct  78   NAVLSLFSWHNETINIWTHLLGFVVFFGLTVLHLGQYFPQVADL----------------  121

Query  185  ACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKED  364
                 + H+                  +W I ++  N      SN         S M+  
Sbjct  122  -----IGHL------------------SWPISKVAENVS----SNIGDVLSGAASLMQAS  154

Query  365  LVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAAL  544
               + A       TRWPFF FL GAMFCLL+S+ CHLLSCHS RL+  ++RLDY GIA +
Sbjct  155  PAALAAVAPQAATTRWPFFVFLAGAMFCLLSSAACHLLSCHSHRLNLFLIRLDYTGIAVM  214

Query  545  ISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            I  SF+PP+YY F C P +  +YL  I
Sbjct  215  IVVSFFPPIYYIFQCEPRWQVVYLSAI  241



>ref|XP_011084126.1| PREDICTED: heptahelical transmembrane protein 1-like [Sesamum 
indicum]
Length=350

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/207 (38%), Positives = 107/207 (52%), Gaps = 46/207 (22%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTL--QNLPDVLRKA  175
            LK AL S+F  HNETLN+WTHL+GF +F+ LT+     +P VVDF T+    LP     +
Sbjct  59   LKVALRSLFQCHNETLNIWTHLLGFLVFVGLTVGNLADVPQVVDFITMFSGQLP-----S  113

Query  176  DLHACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSM  355
                 + S L +  +  +  + K                                  SS+
Sbjct  114  SAEGNVSSKLSLGPVKPIDLQQK----------------------------------SSL  139

Query  356  KEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGI  535
            + D   I +  T+ P   WPF+ FL G+MFCLL+SS CHL  CHS RL+  +L+LDY GI
Sbjct  140  EGD---INSRETSTP--NWPFYVFLCGSMFCLLSSSMCHLFCCHSRRLNEYLLQLDYVGI  194

Query  536  AALISTSFYPPVYYSFMCYPFFCNLYL  616
              +I TSF+PP+YY F C P +  +YL
Sbjct  195  TIMIITSFFPPIYYIFQCTPHWQFVYL  221



>ref|XP_006852868.1| hypothetical protein AMTR_s00033p00203190 [Amborella trichopoda]
 gb|ERN14335.1| hypothetical protein AMTR_s00033p00203190 [Amborella trichopoda]
Length=332

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 105/208 (50%), Gaps = 46/208 (22%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK+A LSVF+ HNETLNVWTH  GFFLFL LTI   +++P V++                
Sbjct  43   LKEAFLSVFSWHNETLNVWTHFGGFFLFLGLTIMHLVEMPGVLE----------------  86

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
               L S +  P                       LL       +   N T    L  M  
Sbjct  87   ---LLSRIFWP-----------------------LLLTSSKASYKFGNSTMTTALLQMPG  120

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
             LV    P++     RWP F FLGG+MFCLL SS CHLL CHS+RL++ + RLDY GI+ 
Sbjct  121  PLV----PVSGTQANRWPLFVFLGGSMFCLLTSSLCHLLCCHSQRLNHFLWRLDYGGISI  176

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            +I  SF+PP+YY F C P F  LYL  I
Sbjct  177  MIVASFFPPIYYIFQCEPLFQVLYLSAI  204



>ref|XP_010051735.1| PREDICTED: heptahelical transmembrane protein 1-like [Eucalyptus 
grandis]
Length=360

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 103/206 (50%), Gaps = 39/206 (19%)
 Frame = +2

Query  8    QALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADLHA  187
            +A  S+F  HNETLN+WT L+ F +FL LT+   + +P V D   L              
Sbjct  86   KAARSLFRWHNETLNIWTRLIEFLVFLGLTVANFVDVPQVADLLGL-----------FSR  134

Query  188  CLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKEDL  367
            C  S     ++   +E L              + TN L        + N      MK   
Sbjct  135  CSNSTSAGTNISYSKELL--------------MGTNSLV-------NLNKITEEEMK---  170

Query  368  VNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAALI  547
            V  + P  TR    WPFF FLGG+MFCLL+SS CHL SCHS  L+  +LR+DY GI  +I
Sbjct  171  VGSLQPAATR----WPFFIFLGGSMFCLLSSSICHLFSCHSHCLNIQLLRMDYVGITVMI  226

Query  548  STSFYPPVYYSFMCYPFFCNLYLGFI  625
             TSF+PP+YY F C P +  +YLG I
Sbjct  227  ITSFFPPIYYIFQCEPHWQLIYLGGI  252



>ref|XP_008336978.1| PREDICTED: adiponectin receptor protein isoform X2 [Malus domestica]
Length=375

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 104/208 (50%), Gaps = 52/208 (25%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L +A  SVF  HNETLNVWTHL+GF LFL LT+   +++P V               ADL
Sbjct  93   LAEAFFSVFRWHNETLNVWTHLIGFVLFLGLTMANLLEVPQV---------------ADL  137

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                                  AF S S    ++ +TN      S+    +    + M  
Sbjct  138  ---------------------LAFFSRST--PIRAVTNVSHNFXSDMEFASSVASAEMG-  173

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
                         +T WPF+ FL G+MFCLL+S+ CHL SCHS  L+ ++LR+DYAGI  
Sbjct  174  -------------VTYWPFYVFLAGSMFCLLSSTICHLFSCHSHPLNLMLLRIDYAGITT  220

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            +I TSF+PP+YY F C   +  +YLG I
Sbjct  221  MIITSFFPPIYYIFQCDSRWQFIYLGGI  248



>ref|XP_001691252.1| hypothetical protein CHLREDRAFT_128250 [Chlamydomonas reinhardtii]
 gb|EDP04985.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=393

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 89/219 (41%), Positives = 121/219 (55%), Gaps = 29/219 (13%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPD---VVDFPTLQNLPDVLRK  172
            LK+ L S+F IHNET NVWTHL+GF +FL LT Y  +K+P     +    L  L   ++ 
Sbjct  64   LKRTLWSLFDIHNETGNVWTHLLGFLMFLGLTFYV-IKLPPQPLAMGKHQLDTLWHSVQD  122

Query  173  ADLHACLPSL--LHIP--------DLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNS  322
              +H    SL  LH+P        +LH L+E L          H V  L + + E   ++
Sbjct  123  -RVHGISDSLQHLHLPHSLGDLSANLHSLQESLH---------HGVDTLVHGVQEEVQHA  172

Query  323  NHTNVCVLSS-MKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERL  499
             H     L S ++E L ++I      P+ RWP + F+GGAM CL  S+ CHL  C ++ +
Sbjct  173  AHLLTHGLQSVLQESLSDVI----QWPVPRWPVYVFMGGAMTCLFLSAACHLFGCCAQHI  228

Query  500  SYIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYL  616
            + ++ R DYAGIA LI TSFYPPVYYSFMC P +   YL
Sbjct  229  TQLIWRFDYAGIAILIVTSFYPPVYYSFMCEPSWRVFYL  267



>ref|XP_006845419.1| hypothetical protein AMTR_s00019p00084530 [Amborella trichopoda]
 gb|ERN07094.1| hypothetical protein AMTR_s00019p00084530 [Amborella trichopoda]
Length=351

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 75/210 (36%), Positives = 107/210 (51%), Gaps = 49/210 (23%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVD--FPTLQNLPDVLRKA  175
            LK+A  S+F+ HNETLN+WTHL+GF LFL+LT+   + +P V+D  +   +++P VL   
Sbjct  64   LKEACFSIFSWHNETLNIWTHLIGFLLFLALTVINVLGMPTVLDIIYGFSRSVPSVLS--  121

Query  176  DLHACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSM  355
                                       ++S+++  +           + +HT    LS  
Sbjct  122  --------------------------ANISSYYFQEFTVG------KSQHHTESGDLS--  147

Query  356  KEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGI  535
                       TT P  +WP   FL GAM CLL SS  HLL+CHS  L+  + RLDY+GI
Sbjct  148  -----------TTNPTPQWPMLVFLCGAMTCLLCSSISHLLACHSRHLNLFLWRLDYSGI  196

Query  536  AALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            A +I TSF  P+YY+F C+P +   YL  I
Sbjct  197  ALMIVTSFIAPIYYAFHCHPIYRFFYLSTI  226



>ref|XP_010040847.1| PREDICTED: heptahelical transmembrane protein 2-like, partial 
[Eucalyptus grandis]
Length=311

 Score =   120 bits (301),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/211 (37%), Positives = 109/211 (52%), Gaps = 43/211 (20%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK A+LS F  HNETLNVWTHL GF +F++LT+ + M+   +        L D  R    
Sbjct  14   LKDAILSAFAWHNETLNVWTHLGGFIIFVALTVMSLMEKTGMRGL-----LGDFSR----  64

Query  182  HACLPSLLHIPDLHRLREELKTAFPS---LSNWHIVQLLTNCLPECFSNSNHTNVCVLSS  352
             A +P+       H     +K A  S   +++ H+ Q+  + + + F  SNH N      
Sbjct  65   -ATVPA-------HSTTAAIKNASASANAVNDSHLGQIQHSLILDAF-ESNHEN------  109

Query  353  MKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAG  532
                            I  WP+F FL GAM CL+ SS  HLL+ HS +  +   RLDYAG
Sbjct  110  ----------------IPGWPWFVFLAGAMCCLICSSLSHLLASHSRKFYFFFWRLDYAG  153

Query  533  IAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            I+ +I  SF+ P+YY+F C+P+ C  YLG I
Sbjct  154  ISVMIVCSFFAPIYYAFYCHPYSCFFYLGTI  184



>gb|KCW81147.1| hypothetical protein EUGRSUZ_C02517 [Eucalyptus grandis]
Length=381

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 78/211 (37%), Positives = 109/211 (52%), Gaps = 43/211 (20%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK A+LS F  HNETLNVWTHL GF +F++LT+ + M+   +        L D  R    
Sbjct  84   LKDAILSAFAWHNETLNVWTHLGGFIIFVALTVMSLMEKTGMRGL-----LGDFSR----  134

Query  182  HACLPSLLHIPDLHRLREELKTAFPS---LSNWHIVQLLTNCLPECFSNSNHTNVCVLSS  352
             A +P+       H     +K A  S   +++ H+ Q+  + + + F  SNH N      
Sbjct  135  -ATVPA-------HSTTAAIKNASASANAVNDSHLGQIQHSLILDAF-ESNHEN------  179

Query  353  MKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAG  532
                            I  WP+F FL GAM CL+ SS  HLL+ HS +  +   RLDYAG
Sbjct  180  ----------------IPGWPWFVFLAGAMCCLICSSLSHLLASHSRKFYFFFWRLDYAG  223

Query  533  IAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            I+ +I  SF+ P+YY+F C+P+ C  YLG I
Sbjct  224  ISVMIVCSFFAPIYYAFYCHPYSCFFYLGTI  254



>ref|XP_002531943.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30425.1| conserved hypothetical protein [Ricinus communis]
Length=359

 Score =   120 bits (302),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 105/206 (51%), Gaps = 42/206 (20%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +K+A  S+F  HNETLNVWTHL+GF LFL LTI + M++P V D   +            
Sbjct  70   IKEAFFSIFCWHNETLNVWTHLIGFLLFLGLTIASVMQVPQVADLLGM-----------F  118

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
             + + ++ H P    L                                 T +  L  + E
Sbjct  119  TSAVANVSHNPKDFFL-------------------------------GATKLVDLKQITE  147

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
              +    P T  P+TRWPF+ FLGG+MFCLL+SS CHL SCHS  L+  +LR+DY GI  
Sbjct  148  PTMGTAQPGTVMPVTRWPFYVFLGGSMFCLLSSSICHLFSCHSHSLNIFLLRIDYVGIIT  207

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLG  619
            +I TSF+P ++Y F C   +  +YLG
Sbjct  208  MIITSFFPAIHYIFQCDQHWEYVYLG  233



>ref|XP_004514143.1| PREDICTED: adiponectin receptor protein 1-like isoform X1 [Cicer 
arietinum]
Length=349

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 105/208 (50%), Gaps = 36/208 (17%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +K A+LSVF +HNETLNVWTHL GFF+F ++ +   M +P  V    L            
Sbjct  45   VKDAMLSVFALHNETLNVWTHLGGFFIFAAMAV---MSLPAGVTTMELGG----------  91

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSS--M  355
               L ++  +  +  LR  ++                       S S +T V V     +
Sbjct  92   GGFLSNIYRVGAMGLLRTRIQING--------------------SASQNTRVQVFQDFHL  131

Query  356  KEDL-VNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAG  532
            K+ L V+I   +    I RWP+F FLGG M CL  SS  HLL+CHS+R +    RLDYAG
Sbjct  132  KQILEVSIFDGVREYGIPRWPWFIFLGGGMCCLACSSVSHLLACHSKRFNLFFWRLDYAG  191

Query  533  IAALISTSFYPPVYYSFMCYPFFCNLYL  616
            I+ +I  SFY P+YY F C P+   +YL
Sbjct  192  ISIMIVCSFYAPIYYVFFCNPYAKLIYL  219



>gb|KJB83216.1| hypothetical protein B456_013G235800 [Gossypium raimondii]
Length=341

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 109/208 (52%), Gaps = 50/208 (24%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK+AL S+F  HNETLNVWTHL+GF LFL LT+   +++P V D      L   L   D 
Sbjct  60   LKEALFSIFRWHNETLNVWTHLLGFVLFLGLTMANLIEVPQVSD------LIAFLTSGDS  113

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
            +     LL                                    + +N  ++  +++ + 
Sbjct  114  NVSQDPLLG-----------------------------------TTTNLVDLKQITASEP  138

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
            D+          P+TRWPF+ FL G+MFCLL+SS CHL SCHS  L+  +LRLDYAGI  
Sbjct  139  DV---------SPVTRWPFYVFLAGSMFCLLSSSICHLFSCHSHHLNLSLLRLDYAGITT  189

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            +I TSF+PP+YY F C P +  +YLG I
Sbjct  190  MIITSFFPPIYYIFQCDPQWHFIYLGGI  217



>ref|XP_010241589.1| PREDICTED: heptahelical transmembrane protein 1-like [Nelumbo 
nucifera]
Length=366

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 81/205 (40%), Positives = 105/205 (51%), Gaps = 40/205 (20%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK+AL SVF  HNETLNVWTHL+GFFLFL LTI   M++P V  F +             
Sbjct  72   LKEALSSVFLWHNETLNVWTHLLGFFLFLGLTITNLMQVPQVAHFLS-------------  118

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                              +   +FP       V   TN   +  S   +     L  +++
Sbjct  119  ------------------QFTRSFP-------VAAATNAFND--SKDFYLGAARLVELEK  151

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
             +   I         RWPFF F+GG+MFCLL+SS CHL  CHS  L+ +M R+DY GIA 
Sbjct  152  MVPTEIVAAAVTKAPRWPFFVFMGGSMFCLLSSSICHLFCCHSHSLNVLMFRIDYVGIAV  211

Query  542  LISTSFYPPVYYSFMCYPFFCNLYL  616
            +I TSF+PP+YY F C P +  +YL
Sbjct  212  MIVTSFFPPIYYIFQCSPHWQLIYL  236



>ref|XP_009340652.1| PREDICTED: heptahelical transmembrane protein 1-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009340656.1| PREDICTED: heptahelical transmembrane protein 1-like isoform 
X2 [Pyrus x bretschneideri]
Length=376

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 102/208 (49%), Gaps = 52/208 (25%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L +A  SVF  HNETLNVWTH +GF LFL LT+   +++P V               ADL
Sbjct  94   LAEAFFSVFRWHNETLNVWTHFIGFVLFLGLTMANLLEVPQV---------------ADL  138

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                                  AF S S    +  +TN   +  S+    +      M  
Sbjct  139  ---------------------LAFFSRST--PISAVTNVSHDFISDMEFASSVASPEMG-  174

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
                         +T WPF+ FL G+MFCLL+S+ CHL SCHS  L+ ++LR+DYAGI  
Sbjct  175  -------------VTYWPFYVFLAGSMFCLLSSTICHLFSCHSHPLNLMLLRIDYAGITT  221

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            +I TSF+PP+YY F C   +  +YLG I
Sbjct  222  MIITSFFPPIYYIFQCDSRWQFIYLGGI  249



>gb|KDP38730.1| hypothetical protein JCGZ_04083 [Jatropha curcas]
Length=347

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 109/199 (55%), Gaps = 38/199 (19%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK++LLSVF++HNE+LN+WTHL GFF+FL+LT+ + M+  ++  F T      V R+   
Sbjct  51   LKESLLSVFSLHNESLNIWTHLGGFFIFLALTVMSCMEKTELGGFIT-----GVPRR---  102

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                          ++   L     + S+ + V   ++ LP+            L  + +
Sbjct  103  --------------KVSGPLMMMMTTKSHEYNVSDNSHMLPDA----------QLRHISK  138

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
            DLV       +  I +WP+F FL GAM CL+ SS  HLL+ HS+R + I  RLDYAGI+ 
Sbjct  139  DLV------ISEAIPKWPWFVFLSGAMGCLICSSLSHLLASHSKRFNVIFWRLDYAGISL  192

Query  542  LISTSFYPPVYYSFMCYPF  598
            +I  SF+ P+YY F C PF
Sbjct  193  MIVCSFFAPIYYVFYCNPF  211



>ref|XP_010548494.1| PREDICTED: heptahelical transmembrane protein 2-like [Tarenaya 
hassleriana]
Length=365

 Score =   118 bits (295),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 68/208 (33%), Positives = 108/208 (52%), Gaps = 33/208 (16%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            L+   LS+F++HNETLN+WTHL GF +F+++T+ ++M+  ++     +      + +   
Sbjct  64   LRDTFLSIFSLHNETLNIWTHLGGFLIFVAMTVVSSMETTELGLAGIINGFSGAVIR---  120

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                                   +PS+   + V L +N      S+ NHT       +  
Sbjct  121  -----------------------WPSMLTGNDVYLSSNDTLLHDSSLNHT-------LHN  150

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
             L      +    + +WP+F FLGGAM CL+ SS  HL +CHS+R +    RLDYAGI+ 
Sbjct  151  SLFYPNGEVGQETVPKWPWFVFLGGAMGCLICSSLSHLFACHSKRFNLFFWRLDYAGISL  210

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            +I  SF+ P+YY+F C+P++  LYL  I
Sbjct  211  MIVCSFFAPIYYAFSCHPYWRLLYLSSI  238



>ref|XP_010250377.1| PREDICTED: heptahelical transmembrane protein 1-like [Nelumbo 
nucifera]
Length=390

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 102/208 (49%), Gaps = 40/208 (19%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK+A  SVF  HNETLNVWTHL+GF LFL LT+   M++P V D                
Sbjct  82   LKEAAASVFRWHNETLNVWTHLLGFLLFLGLTMVNLMQLPQVAD----------------  125

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                           L  +   +FP       V   TN   +           V   M E
Sbjct  126  ---------------LLGQFTRSFP-------VAAATNAFNDSKDFILEATRLVELEMVE  163

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
              +   + +TT    RWPFF +L G+MFCLL S  CHL SCHS  L+  MLR+DY GIA 
Sbjct  164  AEITPTSSVTT--AARWPFFVYLAGSMFCLLCSGICHLFSCHSHSLTVQMLRMDYLGIAV  221

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            +I TSF+PPVYY F C P +  +YL  I
Sbjct  222  MIVTSFFPPVYYIFQCAPLWQFVYLAGI  249



>ref|XP_002274323.1| PREDICTED: heptahelical transmembrane protein 2 [Vitis vinifera]
Length=372

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 110/213 (52%), Gaps = 44/213 (21%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYT---AMKIPDVV-----DFPTLQNLP  157
            LK A+LSVF+ HNETLNVWTHL+GF +F +L + +     KI D+V     D  T Q + 
Sbjct  58   LKDAILSVFSWHNETLNVWTHLIGFMIFAALAVVSLSGKTKIEDLVMSFFRDPVTAQTMK  117

Query  158  DVLRKADLHACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNV  337
             ++ K                 R+ +    AF            T+     FS  +  N+
Sbjct  118  MMMIK-----------------RMNQS-GNAF------------TDSQLRHFSQPSALNM  147

Query  338  CVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLR  517
                   ED    I P+ +  I  WP+F FL GAM CL+ SS  HLL+CHS+R ++   R
Sbjct  148  N-----GEDSSEAI-PILSEAIPIWPWFVFLAGAMACLVCSSLSHLLACHSQRFNFFFWR  201

Query  518  LDYAGIAALISTSFYPPVYYSFMCYPFFCNLYL  616
            LDYAGI+ +I  SF+ P+YY+F C+P+    YL
Sbjct  202  LDYAGISLMIICSFFAPIYYAFSCHPYSRLFYL  234



>ref|XP_008378958.1| PREDICTED: ADIPOR-like receptor SPBC12C2.09c [Malus domestica]
Length=363

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 99/199 (50%), Gaps = 30/199 (15%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK  L SVF  HNETLN+WTHLVGF +FL LT+ T              N P  LR    
Sbjct  57   LKDLLFSVFACHNETLNIWTHLVGFLIFLGLTVMT-----------LTNNSPLELRIFSR  105

Query  182  HACLPS-LLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMK  358
               +P  L+++         +    P   +          L    S+  H        + 
Sbjct  106  AIAVPGPLINVSSSSSSSHNVDAFLPRSPD----------LKGHASSIIHAKANANQEVG  155

Query  359  EDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIA  538
             D +N        P+T WP+F FLGGAM CL+ SS  HL++CHS+R ++   RLDYAGI+
Sbjct  156  YDGIN--------PLTMWPWFVFLGGAMGCLVCSSLSHLVACHSKRFNFYFWRLDYAGIS  207

Query  539  ALISTSFYPPVYYSFMCYP  595
             +I +SF+ PVYY+F C P
Sbjct  208  LMIVSSFFAPVYYAFSCNP  226



>ref|XP_011018079.1| PREDICTED: heptahelical transmembrane protein 2 [Populus euphratica]
Length=369

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 100/199 (50%), Gaps = 29/199 (15%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK A  SVF+ HNETLNVWTHL GF +FL L + + M+         ++ L     +A +
Sbjct  64   LKDAFFSVFSWHNETLNVWTHLGGFLIFLGLLVLSFMEEST----ENIEGLITSFSRAKV  119

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
               L +L+ +     L       FP            + L    S  +  N       K+
Sbjct  120  SGPLMTLMMMKKNQDLNVSDNHMFPD-----------SVLMRHISQQSVVN-------KQ  161

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
            D  + + P       RWP+F FL GAM CL+ SS  HLL+CHS+R +    RLDYAGI+ 
Sbjct  162  DGSDKVIP-------RWPWFVFLSGAMMCLVCSSLSHLLACHSKRFNLFFWRLDYAGISL  214

Query  542  LISTSFYPPVYYSFMCYPF  598
            +I  SF+ P+YY+F C P+
Sbjct  215  MIVCSFFAPIYYAFYCNPY  233



>emb|CBI36585.3| unnamed protein product [Vitis vinifera]
Length=321

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 108/207 (52%), Gaps = 44/207 (21%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYT---AMKIPDVV-----DFPTLQNLP  157
            LK A+LSVF+ HNETLNVWTHL+GF +F +L + +     KI D+V     D  T Q + 
Sbjct  58   LKDAILSVFSWHNETLNVWTHLIGFMIFAALAVVSLSGKTKIEDLVMSFFRDPVTAQTMK  117

Query  158  DVLRKADLHACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNV  337
             ++ K                 R+ +    AF            T+     FS  +  N+
Sbjct  118  MMMIK-----------------RMNQS-GNAF------------TDSQLRHFSQPSALNM  147

Query  338  CVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLR  517
                   ED    I P+ +  I  WP+F FL GAM CL+ SS  HLL+CHS+R ++   R
Sbjct  148  N-----GEDSSEAI-PILSEAIPIWPWFVFLAGAMACLVCSSLSHLLACHSQRFNFFFWR  201

Query  518  LDYAGIAALISTSFYPPVYYSFMCYPF  598
            LDYAGI+ +I  SF+ P+YY+F C+P+
Sbjct  202  LDYAGISLMIICSFFAPIYYAFSCHPY  228



>gb|EAZ20641.1| hypothetical protein OsJ_36257 [Oryza sativa Japonica Group]
Length=394

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 104/214 (49%), Gaps = 40/214 (19%)
 Frame = +2

Query  56   WTHLVGFFLFLSLTIYTAMKIPDV-----------------------VDFPTLQNLPDVL  166
            + HL+GF LFL L I+TAM IP                          D   + N+  VL
Sbjct  64   YRHLIGFLLFLCLAIFTAMVIPSGDNLHSNSSRSRSNATAMDYYYIHGDLMVMSNMTRVL  123

Query  167  RKADLHACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQL-----LTNCLPECFSNSNHT  331
            R   L A    LLH P      E++ T+ P+ ++           L N       ++   
Sbjct  124  RHEALAAAACLLLHDPADLSQHEQISTSCPTNTSSCYTSSSSFSHLHNVRQHAIQDAGKV  183

Query  332  NVCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIM  511
                 +++ E            PITRWP FA+LGGAM CLLAS+ CHLL CHSER +Y+ 
Sbjct  184  TAATAAAIAE------------PITRWPVFAYLGGAMACLLASTACHLLLCHSERANYVT  231

Query  512  LRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLY  613
            LRLDYAGIAALI  SF P V+YSF+C P+    Y
Sbjct  232  LRLDYAGIAALIVASFLPIVHYSFLCDPWLRRAY  265



>ref|XP_010051045.1| PREDICTED: heptahelical transmembrane protein 2 [Eucalyptus grandis]
Length=418

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 80/226 (35%), Positives = 114/226 (50%), Gaps = 36/226 (16%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK A+LS F  HNETLNVWTHL GF +F++LT+ + M+   +        L D  R    
Sbjct  84   LKDAILSAFAWHNETLNVWTHLGGFIIFVALTVMSLMEKTGMRGL-----LGDFSR----  134

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPE--CFSNSN-------HTN  334
             A +P+       H     +K A  S +N   V++  N   +   FS+SN       +  
Sbjct  135  -ATVPA-------HSTTAAIKNASAS-ANAVNVKVWINIYEDFNVFSDSNFDWRVTKYGQ  185

Query  335  VCV---------LSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCH  487
            + +         L  ++  L+          I  WP+F FL GAM CL+ SS  HLL+ H
Sbjct  186  IPIFWFCLQDSHLGQIQHSLILDAFESNHENIPGWPWFVFLAGAMCCLICSSLSHLLASH  245

Query  488  SERLSYIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            S +  +   RLDYAGI+ +I  SF+ P+YY+F C+P+ C  YLG I
Sbjct  246  SRKFYFFFWRLDYAGISVMIVCSFFAPIYYAFYCHPYSCFFYLGTI  291



>ref|XP_008339440.1| PREDICTED: uncharacterized protein LOC103402466 isoform X1 [Malus 
domestica]
Length=282

 Score =   114 bits (286),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 74/202 (37%), Positives = 105/202 (52%), Gaps = 30/202 (15%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK  L SVF  HNETLN+WTHLVGFF+FL LT+ T        D  T+     ++ K   
Sbjct  56   LKDLLFSVFAFHNETLNIWTHLVGFFIFLGLTLITLTD----NDSLTVAAAFCLVGKYGR  111

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSN---HTNVCVLSS  352
               +P  L                 ++S+ H V     C P+   +++   H NV   + 
Sbjct  112  AVAVPGPL----------------INVSSSHNVNAFLPCSPDSERHASSIIHANVNASAK  155

Query  353  MKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAG  532
             + D   I+ P+       WP+  FL GAM CL+ SS  HLL+CHS+  ++   RLDYAG
Sbjct  156  QEVDYDGILLPM-------WPWLVFLSGAMGCLVCSSLSHLLACHSKCFNFFFWRLDYAG  208

Query  533  IAALISTSFYPPVYYSFMCYPF  598
            I+ +I +SF+ P+YY+F C P+
Sbjct  209  ISLMIVSSFFAPIYYAFSCNPY  230



>gb|EYU18238.1| hypothetical protein MIMGU_mgv1a009140mg [Erythranthe guttata]
Length=352

 Score =   115 bits (287),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 97/205 (47%), Gaps = 57/205 (28%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK A LS+F  HNETLNVWTHLVGF LF+ LT+                           
Sbjct  73   LKLAFLSLFRWHNETLNVWTHLVGFLLFVGLTV---------------------------  105

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                  L+H+  L          FPS +  +I                        S K 
Sbjct  106  ----AKLMHVTQLADFITMFTEQFPSRAEANI------------------------SNKY  137

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
             LV       T   T+WPF+  L G+MFCLL+SS CHL  CHS+RL+  +LR+DY GI  
Sbjct  138  SLVK--QTTITTTTTKWPFYVILSGSMFCLLSSSMCHLFCCHSKRLNTHLLRMDYVGITV  195

Query  542  LISTSFYPPVYYSFMCYPFFCNLYL  616
            +I TSF+PP+YY F+C P +  +YL
Sbjct  196  MIITSFFPPMYYIFICTPHWQIIYL  220



>emb|CDP10463.1| unnamed protein product [Coffea canephora]
 emb|CDP10464.1| unnamed protein product [Coffea canephora]
Length=398

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 84/212 (40%), Positives = 112/212 (53%), Gaps = 53/212 (25%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTL--QNLP-----D  160
            LK+A  S+F  HNETLNVWTHL+GF LFL LTI  ++    V DF T+  ++ P     +
Sbjct  104  LKEAFFSLFRWHNETLNVWTHLLGFVLFLGLTIANSVHFSRVADFITMFTRHFPTSASTN  163

Query  161  VLRKADLHACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVC  340
            V   ++  +  P+ L   DL R   +L+    S              PE  S S      
Sbjct  164  VSHNSEDFSVGPTKL--IDLKR-EPQLQMEMTS--------------PEMASTS------  200

Query  341  VLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRL  520
                                   WPFF FLGG+MFCLL+SS CHL SCHS+RL+ ++L++
Sbjct  201  -----------------------WPFFIFLGGSMFCLLSSSICHLFSCHSQRLNLLLLQM  237

Query  521  DYAGIAALISTSFYPPVYYSFMCYPFFCNLYL  616
            DYAGI  +I TSF+PP+YY F C P +  +YL
Sbjct  238  DYAGITVMIITSFFPPIYYVFQCSPHWQLVYL  269



>gb|EYU34968.1| hypothetical protein MIMGU_mgv1a008266mg [Erythranthe guttata]
Length=379

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 108/209 (52%), Gaps = 44/209 (21%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            +KQA  S+F+ HNETLNVWTHL+GF LF+ LT+   + +P V DF T+            
Sbjct  86   VKQAFFSLFSWHNETLNVWTHLLGFLLFVGLTVANVVDVPQVADFITM------------  133

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                               +   FPS +               FSN        L  +K+
Sbjct  134  -------------------ITEQFPSSAT------------ANFSNDFSPGPTKLLDLKQ  162

Query  362  DLVNIIAPLTTRPIT-RWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIA  538
            +  ++   +TT   T  WPF+ FL G+MFCLL+SSTCHL SCHS RL+  +L +DY GI 
Sbjct  163  ESSHMKMDVTTETTTTNWPFYVFLSGSMFCLLSSSTCHLFSCHSHRLNCHLLHVDYVGIT  222

Query  539  ALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
             +I TSF+PP+YY F C P +  LYL  I
Sbjct  223  IMIITSFFPPIYYIFQCTPLYQILYLTGI  251



>gb|KCW81148.1| hypothetical protein EUGRSUZ_C02517 [Eucalyptus grandis]
Length=387

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/217 (36%), Positives = 109/217 (50%), Gaps = 49/217 (23%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWT------HLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDV  163
            LK A+LS F  HNETLNVWT      HL GF +F++LT+ + M+   +        L D 
Sbjct  84   LKDAILSAFAWHNETLNVWTCVAKTSHLGGFIIFVALTVMSLMEKTGMRGL-----LGDF  138

Query  164  LRKADLHACLPSLLHIPDLHRLREELKTAFPS---LSNWHIVQLLTNCLPECFSNSNHTN  334
             R     A +P+       H     +K A  S   +++ H+ Q+  + + + F  SNH N
Sbjct  139  SR-----ATVPA-------HSTTAAIKNASASANAVNDSHLGQIQHSLILDAF-ESNHEN  185

Query  335  VCVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIML  514
                                  I  WP+F FL GAM CL+ SS  HLL+ HS +  +   
Sbjct  186  ----------------------IPGWPWFVFLAGAMCCLICSSLSHLLASHSRKFYFFFW  223

Query  515  RLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            RLDYAGI+ +I  SF+ P+YY+F C+P+ C  YLG I
Sbjct  224  RLDYAGISVMIVCSFFAPIYYAFYCHPYSCFFYLGTI  260



>emb|CAN61543.1| hypothetical protein VITISV_008489 [Vitis vinifera]
Length=553

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 111/216 (51%), Gaps = 44/216 (20%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYT---AMKIPDVV-----DFPTLQNLP  157
            LK A+LSVF+ HNETLNVWTHL+GF +F +L + +     KI D+V     D  T Q + 
Sbjct  239  LKDAILSVFSWHNETLNVWTHLIGFMIFAALAVVSLSGKTKIEDLVMSFFRDPVTAQTMK  298

Query  158  DVLRKADLHACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNV  337
             ++ K                 R+ +    AF            T+     FS  +  N+
Sbjct  299  MMMIK-----------------RMNQS-GNAF------------TDSQLRHFSQPSALNM  328

Query  338  CVLSSMKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLR  517
                   ED    I P+ +  I  WP+F FL GAM CL+ SS  HLL+CHS+R ++   R
Sbjct  329  N-----GEDSSEAI-PILSEAIPIWPWFVFLAGAMACLVCSSLSHLLACHSQRFNFFFWR  382

Query  518  LDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            LDYAGI+ +I  SF+ P+YY+F C+P+    YL  I
Sbjct  383  LDYAGISLMIICSFFAPIYYAFSCHPYSRLFYLTSI  418



>ref|XP_006453549.1| hypothetical protein CICLE_v10008677mg [Citrus clementina]
 gb|ESR66789.1| hypothetical protein CICLE_v10008677mg [Citrus clementina]
Length=374

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 109/205 (53%), Gaps = 27/205 (13%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK A LSVF+ HNETLN+WTHLVGFF+F  L + ++M+  ++     ++      R  ++
Sbjct  67   LKDACLSVFSWHNETLNIWTHLVGFFIFAVLVVMSSMEKLELESSFIMKKF--FSRPGEI  124

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                  ++           +K    ++S+ H++          F  S   N+   S    
Sbjct  125  FGPFVPMMM----------MKNDTMNVSDNHMM----------FPGSLMNNITEPSGF--  162

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
               ++   +T   I +WP+F FL GAM CL+ SS  HLL+CHS R +    RLDYAGI+ 
Sbjct  163  ---HVREQVTQEAIPKWPWFVFLFGAMGCLICSSLSHLLACHSRRFNIFFWRLDYAGISL  219

Query  542  LISTSFYPPVYYSFMCYPFFCNLYL  616
            +I +SF+ P+YY+F C+P    LYL
Sbjct  220  MIVSSFFAPIYYTFYCHPQTRFLYL  244



>gb|KDO62306.1| hypothetical protein CISIN_1g017277mg [Citrus sinensis]
Length=374

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/205 (36%), Positives = 109/205 (53%), Gaps = 27/205 (13%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK A LSVF+ HNETLN+WTHLVGFF+F  L + ++M+  ++     ++      R  ++
Sbjct  67   LKDACLSVFSWHNETLNIWTHLVGFFIFAVLVVMSSMEKLELESSFIMKKF--FSRPGEI  124

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
                  ++           +K    ++S+ H++          F  S   N+   S    
Sbjct  125  FGPFVPMMM----------MKNDTMNVSDNHMM----------FPGSLMNNITEPSGF--  162

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
               +I   +T   I +WP+F FL GAM CL+ SS  HLL+CHS R +    RLDYAGI+ 
Sbjct  163  ---HIREQVTQEVIPKWPWFVFLFGAMGCLICSSLSHLLACHSRRFNIFFWRLDYAGISL  219

Query  542  LISTSFYPPVYYSFMCYPFFCNLYL  616
            +I +SF+ P+YY+F C+P    LYL
Sbjct  220  MIVSSFFAPIYYTFYCHPQTRFLYL  244



>ref|XP_009355394.1| PREDICTED: heptahelical transmembrane protein 2-like [Pyrus x 
bretschneideri]
Length=363

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 102/211 (48%), Gaps = 34/211 (16%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK  L SVF  HNETLN+WTHLVGF +F+ LT+ T            L N          
Sbjct  57   LKDLLFSVFACHNETLNIWTHLVGFLIFVGLTVMT------------LTN----------  94

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNC---LPECFSNSNHTNVCVLSS  352
                 SLL   +LH     +    P ++         N    LP       H +  + + 
Sbjct  95   ----NSLL---ELHIFSRAVAVPGPLINVSSSSSSSHNVDAFLPRSPDLKGHASSIIHA-  146

Query  353  MKEDLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAG  532
             K +    +      P+T WP+F FLGGAM CL+ SS  HLL+CHS+R ++   RLDY G
Sbjct  147  -KANANQEVGYDGINPLTMWPWFVFLGGAMGCLVCSSLSHLLACHSKRFNFFFWRLDYVG  205

Query  533  IAALISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            I+ +I +SF+ P+YY F C P  C  YL  I
Sbjct  206  ISLMIVSSFFAPIYYVFSCNPCSCFFYLSSI  236



>ref|XP_006350145.1| PREDICTED: ADIPOR-like receptor CG5315-like [Solanum tuberosum]
Length=368

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/208 (34%), Positives = 105/208 (50%), Gaps = 41/208 (20%)
 Frame = +2

Query  2    LKQALLSVFTIHNETLNVWTHLVGFFLFLSLTIYTAMKIPDVVDFPTLQNLPDVLRKADL  181
            LK+  LSVF+ HNETLN+WTHLVGF +F++LT+ + M+                  K  +
Sbjct  71   LKEVALSVFSWHNETLNIWTHLVGFVVFVTLTVTSLME------------------KTAM  112

Query  182  HACLPSLLHIPDLHRLREELKTAFPSLSNWHIVQLLTNCLPECFSNSNHTNVCVLSSMKE  361
               L        + R        +P++ +        +  P+ ++ S+ +N   L +  +
Sbjct  113  ETLLAGFSRPAGVGR--------WPTMKS----NGSADSFPDSYT-SHISNPSFLGAYGD  159

Query  362  DLVNIIAPLTTRPITRWPFFAFLGGAMFCLLASSTCHLLSCHSERLSYIMLRLDYAGIAA  541
                         +  WP+F FLGGAM CL+ SS  HL +CHS + +    RLDY+GI+ 
Sbjct  160  GY----------EVAIWPWFVFLGGAMICLVFSSVSHLFACHSHKFTLFFWRLDYSGISI  209

Query  542  LISTSFYPPVYYSFMCYPFFCNLYLGFI  625
            +I  SF+ PVYY+F C P +C LYL  I
Sbjct  210  MIICSFFAPVYYTFCCQPHWCLLYLSSI  237



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380