BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP007E12 659 bp,

Length=625
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011075483.1|  PREDICTED: 40S ribosomal protein S9-2              350   9e-120   Sesamum indicum [beniseed]
ref|XP_004135180.1|  PREDICTED: 40S ribosomal protein S9-2-like         347   1e-118   Cucumis sativus [cucumbers]
ref|XP_002517490.1|  40S ribosomal protein S9, putative                 346   3e-118   Ricinus communis
ref|NP_001275235.1|  uncharacterized protein LOC102577830               346   5e-118   Solanum tuberosum [potatoes]
ref|XP_010029297.1|  PREDICTED: 40S ribosomal protein S9-2              345   6e-118   Eucalyptus grandis [rose gum]
gb|EYU34659.1|  hypothetical protein MIMGU_mgv1a014209mg                345   6e-118   Erythranthe guttata [common monkey flower]
ref|XP_010091216.1|  40S ribosomal protein S9-2                         345   7e-118   Morus notabilis
gb|KDP31233.1|  hypothetical protein JCGZ_11609                         345   1e-117   Jatropha curcas
ref|XP_004238784.1|  PREDICTED: 40S ribosomal protein S9-2              345   1e-117   Solanum lycopersicum
ref|XP_004228395.1|  PREDICTED: 40S ribosomal protein S9-2              345   1e-117   Solanum lycopersicum
gb|KDP41175.1|  hypothetical protein JCGZ_15582                         344   2e-117   Jatropha curcas
gb|EYU22431.1|  hypothetical protein MIMGU_mgv1a014214mg                344   2e-117   Erythranthe guttata [common monkey flower]
ref|XP_010256989.1|  PREDICTED: 40S ribosomal protein S9-2-like         344   3e-117   Nelumbo nucifera [Indian lotus]
ref|XP_009604777.1|  PREDICTED: 40S ribosomal protein S9-2-like         343   5e-117   Nicotiana tomentosiformis
ref|XP_011085760.1|  PREDICTED: 40S ribosomal protein S9-2-like         343   5e-117   Sesamum indicum [beniseed]
ref|XP_010037164.1|  PREDICTED: 40S ribosomal protein S9-2-like         343   6e-117   Eucalyptus grandis [rose gum]
ref|XP_011098613.1|  PREDICTED: 40S ribosomal protein S9-2              343   6e-117   Sesamum indicum [beniseed]
gb|EYU28732.1|  hypothetical protein MIMGU_mgv1a014218mg                343   7e-117   Erythranthe guttata [common monkey flower]
ref|XP_009627396.1|  PREDICTED: 40S ribosomal protein S9-2              342   9e-117   Nicotiana tomentosiformis
gb|KCW56189.1|  hypothetical protein EUGRSUZ_I01938                     342   1e-116   Eucalyptus grandis [rose gum]
ref|XP_002511557.1|  40S ribosomal protein S9, putative                 342   1e-116   Ricinus communis
ref|XP_009798560.1|  PREDICTED: 40S ribosomal protein S9-2-like         342   2e-116   Nicotiana sylvestris
ref|XP_010029477.1|  PREDICTED: 40S ribosomal protein S9-2              342   2e-116   Eucalyptus grandis [rose gum]
emb|CDP02222.1|  unnamed protein product                                342   2e-116   Coffea canephora [robusta coffee]
ref|NP_001274868.1|  40S ribosomal protein S9-2-like                    342   2e-116   Solanum tuberosum [potatoes]
ref|XP_002522398.1|  40S ribosomal protein S9, putative                 342   2e-116   Ricinus communis
ref|XP_009778292.1|  PREDICTED: 40S ribosomal protein S9-2              342   2e-116   Nicotiana sylvestris
ref|XP_002283256.1|  PREDICTED: 40S ribosomal protein S9-2              341   3e-116   Vitis vinifera
ref|XP_011004198.1|  PREDICTED: 40S ribosomal protein S9-2 isofor...    341   5e-116   Populus euphratica
ref|XP_009779308.1|  PREDICTED: 40S ribosomal protein S9-2-like         341   5e-116   Nicotiana sylvestris
ref|XP_010242426.1|  PREDICTED: 40S ribosomal protein S9-2              340   6e-116   Nelumbo nucifera [Indian lotus]
gb|ABQ32300.1|  putative 40S ribosomal protein S9                       340   7e-116   Artemisia annua [sweet Annie]
ref|XP_006367430.1|  PREDICTED: 40S ribosomal protein S9-2-like i...    340   7e-116   Solanum tuberosum [potatoes]
ref|XP_009598709.1|  PREDICTED: 40S ribosomal protein S9-2-like         340   8e-116   Nicotiana tomentosiformis
ref|XP_009600364.1|  PREDICTED: 40S ribosomal protein S9-2-like         340   8e-116   Nicotiana tomentosiformis
ref|XP_002323418.1|  hypothetical protein POPTR_0016s07730g             339   2e-115   Populus trichocarpa [western balsam poplar]
gb|EPS73776.1|  hypothetical protein M569_00980                         339   2e-115   Genlisea aurea
ref|XP_006367431.1|  PREDICTED: 40S ribosomal protein S9-2-like i...    338   3e-115   Solanum tuberosum [potatoes]
ref|XP_007037295.1|  Ribosomal protein S4                               338   4e-115   Theobroma cacao [chocolate]
ref|XP_011004201.1|  PREDICTED: 40S ribosomal protein S9-2-like i...    338   7e-115   Populus euphratica
ref|XP_011004703.1|  PREDICTED: 40S ribosomal protein S9-2-like         338   7e-115   Populus euphratica
gb|KJB74899.1|  hypothetical protein B456_012G055000                    338   7e-115   Gossypium raimondii
gb|KJB70960.1|  hypothetical protein B456_011G097500                    338   7e-115   Gossypium raimondii
gb|KJB33600.1|  hypothetical protein B456_006G020700                    338   7e-115   Gossypium raimondii
gb|KHG16530.1|  40S ribosomal S9-2 -like protein                        338   7e-115   Gossypium arboreum [tree cotton]
gb|KJB11057.1|  hypothetical protein B456_001G238700                    337   9e-115   Gossypium raimondii
ref|XP_002324730.1|  hypothetical protein POPTR_0018s07520g             337   9e-115   Populus trichocarpa [western balsam poplar]
gb|AFK46709.1|  unknown                                                 337   1e-114   Lotus japonicus
ref|XP_007032505.1|  Ribosomal protein S4                               337   1e-114   Theobroma cacao [chocolate]
emb|CDP00311.1|  unnamed protein product                                337   1e-114   Coffea canephora [robusta coffee]
ref|XP_004499428.1|  PREDICTED: 40S ribosomal protein S9-2-like         337   2e-114   Cicer arietinum [garbanzo]
emb|CAG47084.1|  40S ribosomal protein S9                               337   2e-114   Catharanthus roseus [chatas]
gb|ABK21901.1|  unknown                                                 337   2e-114   Picea sitchensis
ref|XP_007138197.1|  hypothetical protein PHAVU_009G188600g             337   2e-114   Phaseolus vulgaris [French bean]
ref|XP_003549666.1|  PREDICTED: 40S ribosomal protein S9-2-like         336   4e-114   Glycine max [soybeans]
ref|XP_007155321.1|  hypothetical protein PHAVU_003G191200g             336   4e-114   Phaseolus vulgaris [French bean]
ref|XP_010917021.1|  PREDICTED: 40S ribosomal protein S9-2              336   4e-114   Elaeis guineensis
ref|NP_001276185.1|  40S ribosomal protein S9-2-like                    335   6e-114   Glycine max [soybeans]
ref|XP_004508755.1|  PREDICTED: 40S ribosomal protein S9-2-like         335   6e-114   Cicer arietinum [garbanzo]
ref|XP_002276284.1|  PREDICTED: 40S ribosomal protein S9-2              335   8e-114   Vitis vinifera
gb|ACU15321.1|  unknown                                                 335   1e-113   Glycine max [soybeans]
ref|XP_002317362.1|  hypothetical protein POPTR_0011s09670g             334   2e-113   Populus trichocarpa [western balsam poplar]
ref|XP_007215987.1|  hypothetical protein PRUPE_ppa011733mg             334   2e-113   Prunus persica
ref|XP_006380606.1|  hypothetical protein POPTR_0007s09750g             334   3e-113   Populus trichocarpa [western balsam poplar]
ref|XP_006282728.1|  hypothetical protein CARUB_v10005777mg             333   3e-113   Capsella rubella
ref|XP_009389620.1|  PREDICTED: 40S ribosomal protein S9-2-like         333   3e-113   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010554004.1|  PREDICTED: 40S ribosomal protein S9-2              333   4e-113   Tarenaya hassleriana [spider flower]
ref|XP_010435836.1|  PREDICTED: 40S ribosomal protein S9-2              333   4e-113   Camelina sativa [gold-of-pleasure]
ref|XP_009414866.1|  PREDICTED: 40S ribosomal protein S9-2              333   5e-113   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403622.1|  PREDICTED: 40S ribosomal protein S9-2-like         333   5e-113   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003577383.1|  PREDICTED: 40S ribosomal protein S9-2-like         333   6e-113   Brachypodium distachyon [annual false brome]
ref|NP_001238740.1|  uncharacterized protein LOC100305663               333   6e-113   Glycine max [soybeans]
ref|XP_003598026.1|  40S ribosomal protein S9                           333   7e-113   Medicago truncatula
gb|ABR17162.1|  unknown                                                 332   1e-112   Picea sitchensis
ref|XP_008780681.1|  PREDICTED: 40S ribosomal protein S9-2              332   1e-112   Phoenix dactylifera
gb|AFK40975.1|  unknown                                                 332   1e-112   Medicago truncatula
ref|XP_003576178.1|  PREDICTED: 40S ribosomal protein S9-2-like         332   2e-112   Brachypodium distachyon [annual false brome]
ref|XP_007209623.1|  hypothetical protein PRUPE_ppa011764mg             332   2e-112   Prunus persica
ref|XP_002870751.1|  40S ribosomal protein S9                           332   2e-112   Arabidopsis lyrata subsp. lyrata
ref|XP_009383889.1|  PREDICTED: 40S ribosomal protein S9-2-like         331   2e-112   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK33188.1|  hypothetical protein AALP_AA6G341500                    331   3e-112   Arabis alpina [alpine rockcress]
ref|XP_006405589.1|  hypothetical protein EUTSA_v10027944mg             331   3e-112   Eutrema salsugineum
ref|NP_198801.1|  40S ribosomal protein S9-2                            331   4e-112   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001049004.1|  Os03g0154700                                       330   8e-112   
ref|XP_006438663.1|  hypothetical protein CICLE_v10032800mg             329   1e-111   Citrus clementina
ref|XP_010937076.1|  PREDICTED: 40S ribosomal protein S9-2-like         329   2e-111   Elaeis guineensis
ref|XP_004304310.1|  PREDICTED: 40S ribosomal protein S9-2              329   2e-111   Fragaria vesca subsp. vesca
ref|XP_002442158.1|  hypothetical protein SORBIDRAFT_08g015270          328   4e-111   Sorghum bicolor [broomcorn]
ref|XP_003623232.1|  40S ribosomal protein S9                           328   4e-111   Medicago truncatula
ref|XP_004962962.1|  PREDICTED: 40S ribosomal protein S9-2-like         328   5e-111   Setaria italica
ref|XP_008341561.1|  PREDICTED: 40S ribosomal protein S9-2              328   5e-111   Malus domestica [apple tree]
ref|XP_004299381.1|  PREDICTED: 40S ribosomal protein S9-2-like         328   6e-111   Fragaria vesca subsp. vesca
ref|XP_010939529.1|  PREDICTED: 40S ribosomal protein S9-2-like         328   7e-111   Elaeis guineensis
ref|XP_008379343.1|  PREDICTED: 40S ribosomal protein S9-2              328   7e-111   Malus domestica [apple tree]
ref|NP_001131442.1|  uncharacterized protein LOC100192774               327   7e-111   Zea mays [maize]
ref|XP_006663032.1|  PREDICTED: 40S ribosomal protein S9-2-like         327   1e-110   Oryza brachyantha
ref|XP_003557815.1|  PREDICTED: 40S ribosomal protein S9-2              327   1e-110   Brachypodium distachyon [annual false brome]
ref|XP_006664031.1|  PREDICTED: 40S ribosomal protein S9-2-like         327   1e-110   Oryza brachyantha
ref|NP_001278530.1|  40S ribosomal protein S9                           327   2e-110   Zea mays [maize]
ref|XP_010092050.1|  40S ribosomal protein S9-2                         329   2e-110   Morus notabilis
ref|XP_010683223.1|  PREDICTED: 40S ribosomal protein S9-2              326   2e-110   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010695717.1|  PREDICTED: 40S ribosomal protein S9-2-like         326   3e-110   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_003637511.1|  40S ribosomal protein S9                           327   3e-110   
ref|XP_004984207.1|  PREDICTED: 40S ribosomal protein S9-2-like         325   8e-110   Setaria italica
ref|XP_009124855.1|  PREDICTED: 40S ribosomal protein S9-2              325   8e-110   Brassica rapa
emb|CDX74423.1|  BnaA04g09660D                                          325   8e-110   Brassica napus [oilseed rape]
ref|XP_006650139.1|  PREDICTED: 40S ribosomal protein S9-2-like         325   1e-109   Oryza brachyantha
gb|ACG33443.1|  40S ribosomal protein S9                                324   1e-109   Zea mays [maize]
gb|EMS50632.1|  40S ribosomal protein S9-2                              324   2e-109   Triticum urartu
ref|XP_001754369.1|  predicted protein                                  323   4e-109   Physcomitrella patens
ref|XP_001767226.1|  predicted protein                                  323   4e-109   Physcomitrella patens
gb|AAT08735.1|  40S ribosomal protein S9                                322   7e-109   Hyacinthus orientalis [common hyacinth]
ref|XP_001777561.1|  predicted protein                                  322   8e-109   Physcomitrella patens
ref|NP_001149705.1|  40S ribosomal protein S9                           322   1e-108   Zea mays [maize]
ref|XP_010420178.1|  PREDICTED: 40S ribosomal protein S9-1              322   1e-108   Camelina sativa [gold-of-pleasure]
ref|XP_006288701.1|  hypothetical protein CARUB_v10002009mg             322   1e-108   Capsella rubella
ref|XP_006400037.1|  hypothetical protein EUTSA_v10014722mg             322   1e-108   Eutrema salsugineum
ref|XP_001754496.1|  predicted protein                                  322   1e-108   Physcomitrella patens
ref|NP_197024.1|  40S ribosomal protein S9-1                            322   2e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002463229.1|  hypothetical protein SORBIDRAFT_02g040120          320   4e-108   Sorghum bicolor [broomcorn]
ref|XP_002463225.1|  hypothetical protein SORBIDRAFT_02g040080          320   4e-108   Sorghum bicolor [broomcorn]
ref|XP_002873713.1|  40S ribosomal protein S9                           321   4e-108   Arabidopsis lyrata subsp. lyrata
ref|XP_004958404.1|  PREDICTED: 40S ribosomal protein S9-2-like         320   6e-108   Setaria italica
ref|XP_003562635.1|  PREDICTED: 40S ribosomal protein S9-2-like         320   7e-108   Brachypodium distachyon [annual false brome]
ref|XP_002985335.1|  hypothetical protein SELMODRAFT_157263             319   1e-107   Selaginella moellendorffii
ref|XP_006657990.1|  PREDICTED: 40S ribosomal protein S9-2-like         319   2e-107   Oryza brachyantha
gb|ABA94602.1|  40S ribosomal protein S9, putative, expressed           318   2e-107   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001762390.1|  predicted protein                                  318   4e-107   Physcomitrella patens
gb|EMS59613.1|  40S ribosomal protein S9-2                              318   4e-107   Triticum urartu
ref|XP_009131450.1|  PREDICTED: 40S ribosomal protein S9-1              318   5e-107   Brassica rapa
ref|XP_006827176.1|  hypothetical protein AMTR_s00010p00256040          319   5e-107   
gb|KHG14244.1|  40S ribosomal S9-2 -like protein                        318   5e-107   Gossypium arboreum [tree cotton]
gb|KHG14681.1|  40S ribosomal S9-2 -like protein                        317   5e-107   Gossypium arboreum [tree cotton]
dbj|BAJ90873.1|  predicted protein                                      317   6e-107   Hordeum vulgare subsp. vulgare [barley]
ref|XP_002960852.1|  hypothetical protein SELMODRAFT_74302              317   2e-106   Selaginella moellendorffii
gb|KFK25765.1|  hypothetical protein AALP_AA8G156800                    314   2e-105   Arabis alpina [alpine rockcress]
ref|XP_010551858.1|  PREDICTED: 40S ribosomal protein S9-2-like         312   7e-105   Tarenaya hassleriana [spider flower]
ref|XP_010550058.1|  PREDICTED: 40S ribosomal protein S9-2-like         312   1e-104   Tarenaya hassleriana [spider flower]
ref|XP_010545191.1|  PREDICTED: 40S ribosomal protein S9-2-like         312   1e-104   Tarenaya hassleriana [spider flower]
gb|KHG06711.1|  40S ribosomal S9-2 -like protein                        314   1e-104   Gossypium arboreum [tree cotton]
gb|ADB77797.1|  40S ribosomal protein S9                                311   2e-104   Chlamydomonas reinhardtii
ref|XP_001702303.1|  ribosomal protein S9, component of cytosolic...    310   3e-104   Chlamydomonas reinhardtii
ref|XP_010524330.1|  PREDICTED: 40S ribosomal protein S9-2-like         310   4e-104   Tarenaya hassleriana [spider flower]
gb|EEC74543.1|  hypothetical protein OsI_10067                          314   4e-104   Oryza sativa Indica Group [Indian rice]
gb|KDP41176.1|  hypothetical protein JCGZ_15583                         310   5e-104   Jatropha curcas
ref|XP_002958222.1|  component of cytosolic 80S ribosome and 40S ...    309   8e-104   Volvox carteri f. nagariensis
gb|KHN30826.1|  40S ribosomal protein S9-2                              308   2e-103   Glycine soja [wild soybean]
ref|XP_009126038.1|  PREDICTED: 40S ribosomal protein S9-1-like         307   6e-103   Brassica rapa
pdb|3J60|J  Chain J, Localization Of The Small Subunit Ribosomal ...    306   2e-102   Triticum aestivum [Canadian hard winter wheat]
gb|EAY83173.1|  hypothetical protein OsI_38384                          305   3e-102   Oryza sativa Indica Group [Indian rice]
emb|CDY30273.1|  BnaC04g31840D                                          326   1e-101   Brassica napus [oilseed rape]
ref|XP_006431128.1|  hypothetical protein CICLE_v10013599mg             301   2e-100   Citrus clementina
gb|KIZ06357.1|  40S ribosomal protein S9-2                              297   8e-99    Monoraphidium neglectum
emb|CEF99084.1|  Ribosomal protein S4/S9, eukaryotic/archaeal           296   2e-98    Ostreococcus tauri
ref|XP_005648482.1|  ribosomal protein S9 component of cytosolic ...    295   3e-98    Coccomyxa subellipsoidea C-169
ref|XP_005849917.1|  hypothetical protein CHLNCDRAFT_56085              295   5e-98    Chlorella variabilis
ref|XP_002500609.1|  predicted protein                                  294   1e-97    Micromonas commoda
ref|XP_001419792.1|  Ribosomal protein S9, component of cytosolic...    293   2e-97    Ostreococcus lucimarinus CCE9901
ref|XP_003056784.1|  predicted protein                                  290   3e-96    Micromonas pusilla CCMP1545
ref|XP_002467783.1|  hypothetical protein SORBIDRAFT_01g033980          286   7e-95    Sorghum bicolor [broomcorn]
ref|XP_008367548.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    287   8e-95    
ref|XP_006381973.1|  hypothetical protein POPTR_0006s22640g             281   4e-93    Populus trichocarpa [western balsam poplar]
gb|EAY83171.1|  hypothetical protein OsI_38381                          281   2e-92    Oryza sativa Indica Group [Indian rice]
ref|XP_011399104.1|  40S ribosomal protein S9-1                         276   7e-91    Auxenochlorella protothecoides
ref|XP_006438664.1|  hypothetical protein CICLE_v10033755mg             276   7e-91    Citrus clementina
dbj|BAA78592.1|  40S ribosomal protein S9                               276   9e-91    Chlamydomonas sp. HS-5
gb|KCW87774.1|  hypothetical protein EUGRSUZ_A00153                     274   2e-90    Eucalyptus grandis [rose gum]
gb|KIZ02547.1|  40S ribosomal protein S9-2                              276   3e-90    Monoraphidium neglectum
ref|XP_003609048.1|  40S ribosomal protein S9                           274   9e-90    
ref|XP_005708491.1|  40S ribosomal protein S9e                          271   6e-89    Galdieria sulphuraria
gb|ADB77798.1|  40S ribosomal protein S9                                271   6e-89    Cladophora coelothrix
gb|KCW56188.1|  hypothetical protein EUGRSUZ_I01938                     270   1e-88    Eucalyptus grandis [rose gum]
gb|KCW56192.1|  hypothetical protein EUGRSUZ_I01938                     270   1e-88    Eucalyptus grandis [rose gum]
emb|CBN76630.1|  conserved unknown protein                              270   3e-88    Ectocarpus siliculosus
ref|XP_008808061.1|  PREDICTED: 40S ribosomal protein S9-2-like         267   2e-87    Phoenix dactylifera
gb|KDD75683.1|  hypothetical protein H632_c551p0                        268   3e-87    Helicosporidium sp. ATCC 50920
ref|XP_010274527.1|  PREDICTED: 40S ribosomal protein S9-2-like         267   9e-87    Nelumbo nucifera [Indian lotus]
gb|ESA03224.1|  hypothetical protein GLOINDRAFT_243564                  265   2e-86    Rhizophagus irregularis DAOM 181602
gb|EXX79184.1|  ribosomal 40S subunit protein S9A                       265   2e-86    Rhizophagus irregularis DAOM 197198w
ref|XP_662407.1|  RS9_PODAN 40S ribosomal protein S9 (S7)               265   2e-86    Aspergillus nidulans FGSC A4
ref|XP_005767233.1|  hypothetical protein EMIHUDRAFT_61745              265   3e-86    Emiliania huxleyi CCMP1516
ref|XP_002367195.1|  40S ribosomal protein S9, putative                 265   3e-86    Toxoplasma gondii ME49
gb|EXX62810.1|  ribosomal 40S subunit protein S9A                       265   4e-86    Rhizophagus irregularis DAOM 197198w
emb|CDR95115.1|  40S ribosomal subunit protein S9, putative             264   5e-86    Babesia bigemina
ref|XP_004336000.1|  ribosomal protein S4, putative                     264   5e-86    Acanthamoeba castellanii str. Neff
ref|XP_003886044.1|  hypothetical protein NCLIV_064440                  264   5e-86    Neospora caninum Liverpool
ref|XP_001824638.1|  40S ribosomal protein S9                           264   7e-86    Aspergillus oryzae RIB40
gb|EGD95527.1|  ribosomal protein S9                                    263   1e-85    Trichophyton tonsurans CBS 112818
ref|XP_003237660.1|  40S ribosomal protein S9                           263   2e-85    Trichophyton rubrum CBS 118892
tpg|DAA41535.1|  TPA: hypothetical protein ZEAMMB73_424707              265   2e-85    Zea mays [maize]
tpg|DAA55417.1|  TPA: hypothetical protein ZEAMMB73_005048              261   2e-85    Zea mays [maize]
ref|XP_009022737.1|  hypothetical protein HELRODRAFT_155894             262   3e-85    Helobdella robusta
ref|XP_001400515.1|  40S ribosomal protein S9                           262   3e-85    Aspergillus niger CBS 513.88
ref|XP_001263755.1|  40S ribosomal protein S9                           262   3e-85    Aspergillus fischeri NRRL 181
ref|XP_001217311.1|  40S ribosomal protein S9                           262   3e-85    Aspergillus terreus NIH2624
ref|XP_011115175.1|  hypothetical protein H072_9617                     262   3e-85    Dactylellina haptotyla CBS 200.50
ref|XP_003172904.1|  40S ribosomal protein S9                           262   3e-85    Microsporum gypseum CBS 118893
emb|CDJ32982.1|  40S ribosomal protein S9, putative                     262   4e-85    Eimeria mitis
ref|XP_002842953.1|  40S ribosomal protein S9                           262   4e-85    Arthroderma otae CBS 113480
emb|CDI78299.1|  40S ribosomal protein S9, putative                     261   5e-85    Eimeria acervulina
gb|KDQ62955.1|  hypothetical protein JAAARDRAFT_28926                   261   6e-85    Jaapia argillacea MUCL 33604
ref|XP_005534862.1|  40S ribosomal protein S9                           261   6e-85    Cyanidioschyzon merolae strain 10D
emb|CDS04034.1|  Putative 40S ribosomal protein S9                      261   6e-85    Lichtheimia ramosa
ref|XP_003026421.1|  40S ribosomal protein S9                           261   7e-85    Schizophyllum commune H4-8
ref|XP_001270715.1|  40S ribosomal protein S9                           261   7e-85    Aspergillus clavatus NRRL 1
gb|AET50489.1|  hypothetical protein                                    261   7e-85    Eimeria tenella
gb|ABF94049.1|  40S ribosomal protein S9, putative, expressed           260   8e-85    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007860645.1|  ribosomal protein S4                               261   1e-84    Gloeophyllum trabeum ATCC 11539
gb|ABA94598.1|  40S ribosomal protein S9, putative, expressed           259   1e-84    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002629546.1|  40S ribosomal protein S9                           261   1e-84    Blastomyces gilchristii SLH14081
dbj|BAN20249.1|  ribosomal protein S9                                   261   1e-84    Riptortus pedestris
ref|XP_001609790.1|  40S ribosomal subunit protein S9                   260   1e-84    Babesia bovis T2Bo
ref|XP_009540632.1|  hypothetical protein HETIRDRAFT_456594             260   1e-84    Heterobasidion irregulare TC 32-1
emb|CCF75909.1|  unnamed protein product                                260   2e-84    Babesia microti strain RI
ref|XP_002110068.1|  S9 ribosomal protein                               260   2e-84    Trichoplax adhaerens
ref|XP_001829481.1|  40S ribosomal protein S9                           260   2e-84    Coprinopsis cinerea okayama7#130
emb|CDJ50108.1|  40S ribosomal protein S9, putative                     260   2e-84    Eimeria brunetti
gb|KIM82299.1|  hypothetical protein PILCRDRAFT_475098                  260   3e-84    Piloderma croceum F 1598
ref|XP_006964217.1|  ribosomal protein S9, S4 family                    259   3e-84    Trichoderma reesei QM6a
ref|XP_011122298.1|  hypothetical protein AOL_s00079g121                259   3e-84    Arthrobotrys oligospora ATCC 24927
ref|XP_008623589.1|  40S ribosomal protein                              259   4e-84    Plasmodium vinckei vinckei
gb|ETB62408.1|  40S ribosomal protein S9                                259   4e-84    Plasmodium yoelii 17X
emb|CAH04322.1|  S9e ribosomal protein                                  259   5e-84    Meladema coriacea
gb|ABG01900.1|  S9 ribosomal protein                                    258   5e-84    Gryllus rubens
gb|AGH70193.1|  40S ribosomal protein S9                                259   5e-84    Placozoa sp. H4
ref|XP_009038600.1|  hypothetical protein AURANDRAFT_28757              259   6e-84    Aureococcus anophagefferens
ref|XP_005852611.1|  small subunit ribosomal protein S9e                259   6e-84    Nannochloropsis gaditana CCMP526
emb|CDS49582.1|  40S ribosomal protein S9, putative                     259   6e-84    Plasmodium berghei ANKA
ref|XP_007510860.1|  40S ribosomal protein S9                           261   7e-84    Bathycoccus prasinos
ref|XP_011180539.1|  PREDICTED: 40S ribosomal protein S9                259   7e-84    Bactrocera cucurbitae [melon fruit fly]
ref|XP_008544905.1|  PREDICTED: 40S ribosomal protein S9                259   7e-84    Microplitis demolitor
ref|XP_001613757.1|  40S ribosomal protein S9                           259   7e-84    Plasmodium vivax Sal-1
emb|CDH55798.1|  40s ribosomal protein s9                               259   7e-84    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_007307288.1|  40S ribosomal protein S9                           259   7e-84    Stereum hirsutum FP-91666 SS1
gb|KIM31691.1|  hypothetical protein M408DRAFT_236801                   259   8e-84    Serendipita vermifera MAFF 305830
ref|XP_004518997.1|  PREDICTED: 40S ribosomal protein S9-like           259   8e-84    Ceratitis capitata
ref|XP_008032443.1|  40S ribosomal protein S9                           258   9e-84    Trametes versicolor FP-101664 SS1
ref|XP_001351758.1|  40S ribosomal protein S9, putative                 258   9e-84    Plasmodium falciparum 3D7
gb|KJA19242.1|  hypothetical protein HYPSUDRAFT_204799                  258   1e-83    Hypholoma sublateritium FD-334 SS-4
ref|XP_011497696.1|  PREDICTED: 40S ribosomal protein S9                258   1e-83    Ceratosolen solmsi marchali
gb|AAX62465.1|  ribosomal protein S9                                    258   1e-83    Lysiphlebus testaceipes
emb|CDO63078.1|  40S ribosomal protein S9, putative                     258   1e-83    Plasmodium reichenowi
gb|KII94201.1|  hypothetical protein PLICRDRAFT_695235                  258   1e-83    Plicaturopsis crispa FD-325 SS-3
ref|XP_007391198.1|  hypothetical protein PHACADRAFT_248675             258   1e-83    Phanerochaete carnosa HHB-10118-sp
ref|XP_004222815.1|  40S ribosomal protein S9                           258   1e-83    Plasmodium cynomolgi strain B
ref|XP_008815169.1|  40S ribosomal protein                              258   1e-83    Plasmodium inui San Antonio 1
gb|ADT80642.1|  ribosomal protein S9                                    258   1e-83    Euphydryas aurinia [marsh fritillary]
ref|NP_001037265.1|  ribosomal protein S9                               258   1e-83    Bombyx mori [silk moth]
ref|XP_006671722.1|  40S ribosomal protein S9 (S7)                      258   1e-83    Cordyceps militaris CM01
gb|ADO95157.1|  ribosomal protein S9                                    258   2e-83    Antheraea yamamai [Japanese oak silk moth]
gb|EJK71823.1|  hypothetical protein THAOC_06697                        258   2e-83    Thalassiosira oceanica
emb|CCA67900.1|  probable 40S ribosomal protein S9                      258   2e-83    Serendipita indica DSM 11827
ref|XP_001956309.1|  GF24655                                            258   2e-83    Drosophila ananassae
emb|CCQ18585.1|  40S ribosomal protein S9                               258   2e-83    Sycon ciliatum
ref|XP_007853601.1|  40s ribosomal protein s9                           258   2e-83    Moniliophthora roreri MCA 2997
ref|XP_001984182.1|  GH15146                                            258   2e-83    Drosophila grimshawi
gb|AAR09821.1|  similar to Drosophila melanogaster RpS9                 258   2e-83    Drosophila yakuba
emb|CDO74409.1|  hypothetical protein BN946_scf184867.g7                258   2e-83    Trametes cinnabarina
ref|XP_008601048.1|  40S ribosomal protein S9                           258   2e-83    Beauveria bassiana ARSEF 2860
ref|XP_002289706.1|  RS9, ribosomal protein 9                           258   2e-83    Thalassiosira pseudonana CCMP1335
gb|ABG01896.1|  S9 ribosomal protein                                    257   2e-83    Gryllus firmus
ref|XP_002047289.1|  GJ13353                                            258   2e-83    Drosophila virilis
ref|NP_524004.2|  ribosomal protein S9, isoform A                       258   2e-83    Drosophila melanogaster
ref|XP_002259613.1|  40S ribosomal subunit protein S9                   257   2e-83    Plasmodium knowlesi strain H
gb|EQL04090.1|  Ribosomal protein S4/S9                                 257   2e-83    Ophiocordyceps sinensis CO18
dbj|BAM17690.1|  ribosomal protein S9                                   258   2e-83    Papilio xuthus [Chinese swallowtail]
gb|KIY51995.1|  ribosomal protein S4                                    257   2e-83    Fistulina hepatica ATCC 64428
ref|XP_007265130.1|  40S ribosomal protein S9                           257   2e-83    Fomitiporia mediterranea MF3/22
ref|XP_001352621.1|  GA28351                                            258   3e-83    Drosophila pseudoobscura pseudoobscura
gb|EHJ71338.1|  ribosomal protein S9                                    257   3e-83    Danaus plexippus [American monarch]
gb|KIK68304.1|  hypothetical protein GYMLUDRAFT_35690                   257   3e-83    Gymnopus luxurians FD-317 M1
gb|KIO25495.1|  hypothetical protein M407DRAFT_91820                    257   3e-83    Tulasnella calospora MUT 4182
dbj|BAM19012.1|  ribosomal protein S9                                   257   3e-83    Papilio polytes
gb|KDQ31494.1|  hypothetical protein PLEOSDRAFT_1054562                 257   3e-83    Pleurotus ostreatus PC15
gb|EKC97706.1|  40S ribosomal protein S9-A                              257   4e-83    Trichosporon asahii var. asahii CBS 8904
tpe|CAL69096.1|  TPA: putative 40S ribosomal protein S9                 257   4e-83    Spadella cephaloptera
gb|EMD42348.1|  40S ribosomal protein S9                                257   4e-83    Gelatoporia subvermispora B
ref|XP_003400837.1|  PREDICTED: 40S ribosomal protein S9-like           257   5e-83    
gb|ABX26127.1|  ribosomal protein S9                                    256   5e-83    Haliotis discus discus
ref|XP_001873539.1|  40S ribosomal protein S9                           256   5e-83    
dbj|BAJ85708.1|  predicted protein                                      257   5e-83    
emb|CEI90627.1|  Putative 40S ribosomal protein S9                      256   5e-83    
ref|XP_001873538.1|  40S ribosomal protein S9                           256   5e-83    
gb|KIM47402.1|  hypothetical protein M413DRAFT_199385                   256   5e-83    
gb|KIL71469.1|  hypothetical protein M378DRAFT_155038                   256   5e-83    
ref|XP_007379209.1|  40S ribosomal protein S9                           256   5e-83    
ref|XP_002471051.1|  ribosomal protein S9                               256   6e-83    
gb|ACY95323.1|  ribosomal protein S9                                    256   6e-83    
ref|XP_730059.1|  ribosomal protein S4                                  257   7e-83    
gb|KFG83429.1|  40S ribosomal protein S9 (S7)                           256   7e-83    
ref|XP_001945527.1|  PREDICTED: 40S ribosomal protein S9                256   7e-83    
ref|XP_007811695.1|  40S ribosomal protein S9                           256   7e-83    
gb|ACO10247.1|  40S ribosomal protein S9                                256   8e-83    
ref|XP_002007973.1|  GI12083                                            256   8e-83    
gb|EWM23131.1|  40s ribosomal protein s9                                258   8e-83    
ref|XP_005181976.1|  PREDICTED: 40S ribosomal protein S9                256   8e-83    
gb|EHK22520.1|  hypothetical protein TRIVIDRAFT_216043                  256   8e-83    
gb|ACO15505.1|  40S ribosomal protein S9                                256   9e-83    
ref|XP_001894478.1|  40S ribosomal protein S9                           256   9e-83    
gb|ACY71248.1|  ribosomal protein S9                                    256   9e-83    
ref|XP_007256932.1|  PREDICTED: 40S ribosomal protein S9-like           256   9e-83    
ref|XP_003147914.1|  40S ribosomal protein S9                           256   9e-83    
ref|XP_967635.1|  PREDICTED: 40S ribosomal protein S9                   256   1e-82    
gb|KIJ95270.1|  hypothetical protein K443DRAFT_332076                   256   1e-82    
gb|KDR16262.1|  40S ribosomal protein S9                                256   1e-82    
ref|XP_007360763.1|  40S ribosomal protein S9                           256   1e-82    
emb|CAJ17220.1|  ribosomal protein S9e                                  255   1e-82    
gb|EER45719.1|  40S ribosomal protein S9                                255   2e-82    
gb|EPS99409.1|  hypothetical protein FOMPIDRAFT_1024265                 255   2e-82    
gb|EHK42959.1|  hypothetical protein TRIATDRAFT_258286                  255   2e-82    
ref|XP_007763855.1|  40S ribosomal protein S9                           255   2e-82    
gb|ACO12686.1|  40S ribosomal protein S9                                255   2e-82    
ref|XP_011066131.1|  PREDICTED: 40S ribosomal protein S9                255   2e-82    
dbj|BAD26701.1|  ribosomal protein S9                                   255   3e-82    
ref|XP_004830832.1|  40S ribosomal protein S9, putative                 254   3e-82    
gb|ADK11698.1|  ribosomal protein S9                                    254   3e-82    
gb|ADO28208.1|  40S ribosomal protein s9                                254   3e-82    
ref|NP_001187074.1|  40S ribosomal protein S9                           254   3e-82    
gb|EIE83578.1|  40S ribosomal protein S9                                254   3e-82    
ref|XP_001608270.1|  PREDICTED: 40S ribosomal protein S9                254   3e-82    
gb|KFH63847.1|  40S ribosomal protein S9                                254   3e-82    
ref|XP_002119507.1|  PREDICTED: 40S ribosomal protein S9                254   4e-82    
ref|XP_006015023.1|  PREDICTED: 40S ribosomal protein S9-like           254   4e-82    
ref|XP_011144040.1|  PREDICTED: 40S ribosomal protein S9                254   4e-82    
gb|AHB33642.1|  40S ribosomal protein S9                                254   4e-82    
ref|XP_002603611.1|  hypothetical protein BRAFLDRAFT_126921             254   4e-82    
gb|EIE83453.1|  40S ribosomal protein S9                                254   4e-82    
gb|KDR85862.1|  hypothetical protein GALMADRAFT_132501                  254   4e-82    
ref|XP_005367975.1|  PREDICTED: 40S ribosomal protein S9-like           254   4e-82    
emb|CEJ91392.1|  Putative 40S ribosomal protein S9 (S7)                 254   5e-82    
gb|KIP02503.1|  hypothetical protein PHLGIDRAFT_20458                   254   5e-82    
ref|XP_003387673.1|  PREDICTED: 40S ribosomal protein S9-like           254   5e-82    
ref|XP_005534243.1|  PREDICTED: 40S ribosomal protein S9-like           254   6e-82    
ref|XP_005433872.1|  PREDICTED: 40S ribosomal protein S9-like           254   6e-82    
emb|CEG69035.1|  Putative 40S ribosomal protein S9                      254   6e-82    
ref|NP_001232711.1|  putative 40S ribosomal protein S9                  254   6e-82    
ref|XP_007538773.1|  PREDICTED: 40S ribosomal protein S9                254   6e-82    
ref|XP_006897356.1|  PREDICTED: 40S ribosomal protein S9                254   6e-82    
gb|AAX29348.1|  ribosomal protein S9                                    254   6e-82    
gb|ABM55670.1|  putative ribosomal protein S9                           254   6e-82    
ref|NP_001004.2|  40S ribosomal protein S9                              254   6e-82    
gb|KIO07111.1|  hypothetical protein M404DRAFT_998525                   254   6e-82    
gb|AGM32374.1|  putative S9e ribosomal protein                          254   7e-82    
emb|CCM02260.1|  predicted protein                                      254   7e-82    
gb|KIY62147.1|  ribosomal protein S4                                    254   7e-82    
ref|XP_002430661.1|  40S ribosomal protein S9, putative                 254   7e-82    
gb|KDQ15631.1|  hypothetical protein BOTBODRAFT_31523                   254   7e-82    
ref|XP_005090825.1|  PREDICTED: 40S ribosomal protein S9-like iso...    254   8e-82    
dbj|BAA82319.1|  ribosomal protein S9 homolog                           253   8e-82    
ref|NP_595840.1|  40S ribosomal protein S9                              253   8e-82    
gb|AAT76788.1|  40S ribosomal protein S9                                253   8e-82    
ref|XP_007324335.1|  hypothetical protein SERLADRAFT_480346             253   8e-82    
emb|CDQ94630.1|  unnamed protein product                                253   9e-82    
ref|XP_007002505.1|  40S ribosomal protein S9                           253   9e-82    
gb|KIM62296.1|  hypothetical protein SCLCIDRAFT_1215157                 253   1e-81    
gb|ACH85276.1|  ribosomal protein S9                                    253   1e-81    
ref|XP_570885.1|  hypothetical protein CNE02160                         253   1e-81    
ref|XP_791000.2|  PREDICTED: 40S ribosomal protein S9-like              253   1e-81    
emb|CAA47013.1|  ribosomal protein S9                                   253   1e-81    
gb|AEA39492.1|  ribosomal protein S9                                    253   1e-81    
ref|XP_003194223.1|  40S ribosomal protein S9-A                         253   1e-81    
ref|XP_009265857.1|  40S ribosomal protein S9-B                         253   1e-81    
gb|KIJ53746.1|  hypothetical protein M422DRAFT_58531                    253   1e-81    
ref|XP_001747599.1|  hypothetical protein                               253   1e-81    
ref|XP_003977663.1|  PREDICTED: 40S ribosomal protein S9-like           253   1e-81    
gb|AEE62422.1|  unknown                                                 253   1e-81    
gb|ACO11706.1|  40S ribosomal protein S9                                253   1e-81    
gb|KDE04206.1|  40S ribosomal protein S9-A                              253   1e-81    
ref|NP_001290865.1|  ribosomal protein S9                               253   1e-81    
gb|EMP40612.1|  40S ribosomal protein S9                                254   1e-81    
ref|XP_005312659.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    253   2e-81    
ref|NP_001006813.1|  ribosomal protein S9                               253   2e-81    
ref|NP_001085809.1|  ribosomal protein S9                               253   2e-81    
ref|XP_003450729.1|  PREDICTED: 40S ribosomal protein S9-like           253   2e-81    
gb|EPY49628.1|  40S ribosomal protein S9                                253   2e-81    
ref|NP_957146.1|  40S ribosomal protein S9                              253   2e-81    
gb|AAX48885.1|  S9                                                      253   2e-81    
gb|ABD98740.1|  putative S9e ribosomal protein                          253   2e-81    
ref|NP_592945.1|  40S ribosomal protein S9                              253   2e-81    
ref|XP_007922661.1|  hypothetical protein MYCFIDRAFT_60241              253   2e-81    
ref|XP_003325266.1|  40S ribosomal protein S9                           253   2e-81    
gb|AAY66962.1|  40S ribosomal protein S9                                253   2e-81    
ref|NP_001080124.1|  ribosomal protein S9                               253   2e-81    
emb|CCO33607.1|  40S ribosomal protein S9-A                             253   2e-81    
gb|EUC58677.1|  40S ribosomal protein S9                                252   2e-81    
ref|NP_001119227.1|  40S ribosomal protein S9-1                         251   2e-81    
ref|XP_011445733.1|  PREDICTED: 40S ribosomal protein S9                252   2e-81    
ref|XP_533590.3|  PREDICTED: 40S ribosomal protein S9                   254   2e-81    
ref|XP_001625568.1|  predicted protein                                  252   2e-81    
emb|CEP13692.1|  hypothetical protein                                   252   3e-81    
dbj|GAN01898.1|  40S ribosomal protein S9                               252   3e-81    
dbj|GAN07351.1|  40S ribosomal protein S9                               252   3e-81    
gb|EPB81471.1|  40S ribosomal protein S9                                252   3e-81    
ref|XP_010786813.1|  PREDICTED: 40S ribosomal protein S9                252   3e-81    
ref|XP_008876439.1|  ribosomal protein S4                               252   3e-81    
gb|AAS49601.1|  ribosomal protein S9                                    251   3e-81    
ref|XP_008486802.1|  PREDICTED: 40S ribosomal protein S9                252   3e-81    
gb|ABE68882.1|  40S ribosomal protein S9                                252   3e-81    
gb|EPE04605.1|  40s ribosomal protein s9                                252   4e-81    
gb|KIN07697.1|  hypothetical protein OIDMADRAFT_16275                   252   4e-81    
ref|XP_009045417.1|  hypothetical protein LOTGIDRAFT_230231             252   4e-81    
gb|KDN39854.1|  40S ribosomal protein S9                                252   4e-81    
dbj|BAA24900.1|  ribosomal protein S9                                   251   4e-81    
gb|ABE68880.1|  40S ribosomal protein S9                                251   5e-81    
ref|XP_004363804.1|  30S ribosomal protein S4                           251   5e-81    
gb|KFH67080.1|  small subunit ribosomal protein S9e                     255   5e-81    
gb|KIK29928.1|  hypothetical protein PISMIDRAFT_671906                  251   5e-81    
gb|EME38681.1|  ribosomal protein S9-like protein                       251   6e-81    
ref|XP_004077978.1|  PREDICTED: 40S ribosomal protein S9                251   6e-81    
gb|KFB48005.1|  40S ribosomal protein S9                                251   6e-81    
ref|XP_001546443.1|  40S ribosomal protein S9                           251   6e-81    
ref|XP_004341959.2|  40S ribosomal protein S9                           251   6e-81    
ref|XP_313936.2|  AGAP005061-PB                                         251   6e-81    
gb|KIJ58198.1|  hypothetical protein HYDPIDRAFT_119825                  251   6e-81    
ref|XP_002139923.1|  40S ribosomal protein S9                           251   7e-81    
ref|XP_007439934.1|  PREDICTED: 40S ribosomal protein S9-like iso...    251   7e-81    
gb|EJU02852.1|  40S ribosomal protein S9                                251   7e-81    
ref|XP_002416200.1|  40S ribosomal protein S9, putative                 251   8e-81    
ref|XP_006691696.1|  40S ribosomal protein s9-like protein              251   8e-81    
gb|ACI68776.1|  40S ribosomal protein S9                                251   1e-80    
gb|ABX44781.1|  putative 40S ribosomal protein RPS9                     251   1e-80    
ref|XP_002179777.1|  predicted protein                                  250   1e-80    
gb|ETE72572.1|  40S ribosomal protein S9                                251   1e-80    
ref|XP_005880022.1|  PREDICTED: 40S ribosomal protein S9 isoform X1     251   1e-80    
ref|XP_008116661.1|  PREDICTED: 40S ribosomal protein S9                251   1e-80    
gb|KIW50177.1|  40S ribosomal protein S9                                251   1e-80    
ref|XP_001653969.1|  AAEL001759-PA                                      251   1e-80    
gb|KEF58004.1|  40S ribosomal protein S9                                251   1e-80    
ref|XP_635999.1|  ribosomal protein 1024                                250   1e-80    
gb|KIV80024.1|  40S ribosomal protein S9                                251   1e-80    
gb|AFK33393.1|  unknown                                                 251   1e-80    
gb|KJE98318.1|  40S ribosomal protein S9                                251   1e-80    
gb|KIW15420.1|  40S ribosomal protein S9                                251   1e-80    
ref|XP_005836916.1|  small subunit ribosomal protein S9e, cytopla...    250   1e-80    
gb|KIW44874.1|  40S ribosomal protein S9                                250   1e-80    
gb|ACF72878.1|  ribosomal protein S9                                    251   1e-80    
gb|AAW31599.1|  ribosomal protein S9                                    250   1e-80    
ref|XP_007782986.1|  40S ribosomal protein S9                           250   2e-80    
gb|EKG11582.1|  Ribosomal protein S4/S9                                 250   2e-80    
gb|EPS34246.1|  hypothetical protein PDE_09210                          250   2e-80    
gb|KIW73335.1|  40S ribosomal protein S9                                250   2e-80    
ref|XP_008722253.1|  40S ribosomal protein S9                           250   2e-80    
ref|XP_009846369.1|  ribosomal protein S4                               250   2e-80    
ref|XP_005715372.1|  40S ribosomal protein S9                           250   2e-80    
ref|XP_002156853.1|  PREDICTED: 40S ribosomal protein S9-like iso...    250   2e-80    
gb|KIK97704.1|  hypothetical protein PAXRUDRAFT_824663                  250   2e-80    
gb|KIJ13786.1|  hypothetical protein PAXINDRAFT_170109                  250   2e-80    
gb|ESZ90022.1|  40S ribosomal protein S9                                250   2e-80    
ref|XP_002741225.1|  PREDICTED: 40S ribosomal protein S9-like           250   2e-80    
ref|XP_001846568.1|  conserved hypothetical protein                     250   2e-80    
ref|XP_007877369.1|  hypothetical protein PFL1_01668                    251   2e-80    
gb|EPX74976.1|  40S ribosomal protein S9                                250   3e-80    
ref|XP_007674573.1|  hypothetical protein BAUCODRAFT_66115              250   3e-80    
ref|XP_007724904.1|  40S ribosomal protein S9                           249   3e-80    
ref|XP_009155008.1|  40S ribosomal protein S9                           249   3e-80    
ref|XP_007731850.1|  40S ribosomal protein S9                           249   3e-80    
gb|KFM58001.1|  40S ribosomal protein S9                                249   3e-80    
gb|ABW23205.1|  ribosomal protein rps9                                  249   3e-80    
dbj|GAM43906.1|  40S ribosomal protein                                  249   3e-80    
ref|XP_006453937.1|  40S ribosomal protein S9                           249   3e-80    
gb|KIW07901.1|  40S ribosomal protein S9                                249   3e-80    
ref|XP_007698387.1|  hypothetical protein COCSADRAFT_35730              249   3e-80    
emb|CEP13909.1|  hypothetical protein                                   249   3e-80    
ref|XP_004995440.1|  40S ribosomal protein S9                           249   4e-80    
ref|XP_001937443.1|  40S ribosomal protein S9                           249   4e-80    
ref|XP_007587858.1|  putative 40s ribosomal protein s9 protein          249   4e-80    
ref|XP_007750565.1|  40S ribosomal protein S9                           249   4e-80    
gb|KIW24305.1|  40S ribosomal protein S9                                249   5e-80    
ref|XP_007913411.1|  putative 40s ribosomal protein s9 protein          249   5e-80    
gb|ACD65142.1|  putative 40S ribosomal protein RPS9                     249   5e-80    
ref|XP_005090824.1|  PREDICTED: 40S ribosomal protein S9-like iso...    249   5e-80    
ref|XP_003303583.1|  40S ribosomal protein S9                           252   5e-80    
ref|XP_002152417.1|  40S ribosomal protein S9                           249   5e-80    
gb|AAA85659.1|  ribosomal protein S9                                    249   5e-80    
ref|XP_003838270.1|  similar to 40S ribosomal protein S9                249   5e-80    
ref|XP_007288535.1|  40S ribosomal protein S9                           249   5e-80    
ref|XP_001791646.1|  hypothetical protein SNOG_00985                    249   5e-80    
gb|EMF08137.1|  40S ribosomal protein S9                                249   5e-80    
ref|XP_001594205.1|  40S ribosomal protein S9                           249   6e-80    
gb|EPS26866.1|  hypothetical protein PDE_01806                          249   6e-80    
ref|XP_003286040.1|  rp1024 protein                                     248   7e-80    
gb|AFK45767.1|  unknown                                                 249   7e-80    
gb|ETN81469.1|  ribosomal protein S4                                    248   7e-80    
ref|XP_002486003.1|  40S ribosomal protein S9                           248   8e-80    
ref|XP_007687378.1|  hypothetical protein COCMIDRAFT_93683              248   8e-80    
gb|KDN65245.1|  putative ribosomal protein S4                           248   8e-80    
gb|EPZ32298.1|  40S ribosomal protein S9                                248   8e-80    
ref|XP_008618158.1|  30S ribosomal protein S4                           248   8e-80    
ref|XP_007829664.1|  40S ribosomal protein S9                           248   9e-80    
gb|KEQ66339.1|  40S ribosomal protein S9                                248   9e-80    
gb|AAS49576.1|  ribosomal protein S9                                    248   1e-79    
gb|KIV89206.1|  40S ribosomal protein S9                                248   1e-79    
ref|XP_006902935.1|  PREDICTED: 40S ribosomal protein S9-like           248   1e-79    
ref|XP_009531030.1|  hypothetical protein PHYSODRAFT_354997             248   1e-79    
gb|KEQ72499.1|  40S ribosomal protein S9                                248   1e-79    
dbj|BAF45897.1|  ribosomal protein S9                                   248   1e-79    
gb|KGG50458.1|  putative 40S ribosomal protein S9                       248   1e-79    
ref|XP_001246606.1|  40S ribosomal protein S9                           248   1e-79    
gb|KIX06477.1|  40S ribosomal protein S9                                248   2e-79    
gb|KHJ32708.1|  putative 40s ribosomal protein s9                       248   2e-79    



>ref|XP_011075483.1| PREDICTED: 40S ribosomal protein S9-2 [Sesamum indicum]
 ref|XP_011075484.1| PREDICTED: 40S ribosomal protein S9-2 [Sesamum indicum]
Length=197

 Score =   350 bits (898),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 169/174 (97%), Positives = 174/174 (100%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_004135180.1| PREDICTED: 40S ribosomal protein S9-2-like [Cucumis sativus]
 ref|XP_004141548.1| PREDICTED: 40S ribosomal protein S9-2-like [Cucumis sativus]
 ref|XP_004172155.1| PREDICTED: 40S ribosomal protein S9-2-like [Cucumis sativus]
 ref|XP_004173021.1| PREDICTED: 40S ribosomal protein S9-2-like [Cucumis sativus]
 ref|XP_008446334.1| PREDICTED: 40S ribosomal protein S9-2 [Cucumis melo]
 ref|XP_008459594.1| PREDICTED: 40S ribosomal protein S9-2 [Cucumis melo]
 gb|KGN51904.1| hypothetical protein Csa_5G604980 [Cucumis sativus]
 gb|KGN52667.1| hypothetical protein Csa_5G649850 [Cucumis sativus]
Length=197

 Score =   347 bits (891),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/174 (96%), Positives = 174/174 (100%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQKHIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQKHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_002517490.1| 40S ribosomal protein S9, putative [Ricinus communis]
 gb|EEF45032.1| 40S ribosomal protein S9, putative [Ricinus communis]
Length=196

 Score =   346 bits (888),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 166/174 (95%), Positives = 173/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|NP_001275235.1| uncharacterized protein LOC102577830 [Solanum tuberosum]
 ref|XP_006367429.1| PREDICTED: 40S ribosomal protein S9-2-like [Solanum tuberosum]
 gb|ABA46767.1| unknown [Solanum tuberosum]
Length=197

 Score =   346 bits (887),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 167/174 (96%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVNV SF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVASFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_010029297.1| PREDICTED: 40S ribosomal protein S9-2 [Eucalyptus grandis]
 gb|KCW56190.1| hypothetical protein EUGRSUZ_I01938 [Eucalyptus grandis]
Length=197

 Score =   345 bits (886),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 173/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>gb|EYU34659.1| hypothetical protein MIMGU_mgv1a014209mg [Erythranthe guttata]
Length=197

 Score =   345 bits (886),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 166/174 (95%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVCFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDP+RIFEG+ALLRRMN+Y LLDESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKDPKRIFEGEALLRRMNKYALLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_010091216.1| 40S ribosomal protein S9-2 [Morus notabilis]
 gb|EXB43471.1| 40S ribosomal protein S9-2 [Morus notabilis]
Length=199

 Score =   345 bits (886),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 166/174 (95%), Positives = 174/174 (100%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNR+GLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRHGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQKHIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQKHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>gb|KDP31233.1| hypothetical protein JCGZ_11609 [Jatropha curcas]
Length=197

 Score =   345 bits (884),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 173/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_004238784.1| PREDICTED: 40S ribosomal protein S9-2 [Solanum lycopersicum]
Length=197

 Score =   345 bits (884),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/174 (95%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVNV SF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVASFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_004228395.1| PREDICTED: 40S ribosomal protein S9-2 [Solanum lycopersicum]
 ref|XP_004228398.1| PREDICTED: 40S ribosomal protein S9-2-like [Solanum lycopersicum]
 ref|XP_010319448.1| PREDICTED: 40S ribosomal protein S9-2 [Solanum lycopersicum]
 gb|AAU93594.1| 40S ribosomal protein S9 , putative [Solanum demissum]
Length=197

 Score =   345 bits (884),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/174 (95%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVNV SF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVASFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>gb|KDP41175.1| hypothetical protein JCGZ_15582 [Jatropha curcas]
Length=197

 Score =   344 bits (883),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 173/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>gb|EYU22431.1| hypothetical protein MIMGU_mgv1a014214mg [Erythranthe guttata]
Length=197

 Score =   344 bits (883),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/174 (95%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV  YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVCVYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDP+RIFEG+ALLRRMNRYGLLDESQ+KLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKDPKRIFEGEALLRRMNRYGLLDESQSKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQKHIRVGRQVVNVPSF+VR+DSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQKHIRVGRQVVNVPSFMVRMDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_010256989.1| PREDICTED: 40S ribosomal protein S9-2-like [Nelumbo nucifera]
 ref|XP_010269850.1| PREDICTED: 40S ribosomal protein S9-2-like [Nelumbo nucifera]
Length=197

 Score =   344 bits (882),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 173/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_009604777.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana tomentosiformis]
Length=197

 Score =   343 bits (880),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRP+EKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVL+LTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLSLTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_011085760.1| PREDICTED: 40S ribosomal protein S9-2-like [Sesamum indicum]
Length=196

 Score =   343 bits (880),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 167/174 (96%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPFGGGR GRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRAGRV  174



>ref|XP_010037164.1| PREDICTED: 40S ribosomal protein S9-2-like [Eucalyptus grandis]
 gb|KCW48831.1| hypothetical protein EUGRSUZ_K02467 [Eucalyptus grandis]
Length=197

 Score =   343 bits (880),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGR GRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRAGRV  174



>ref|XP_011098613.1| PREDICTED: 40S ribosomal protein S9-2 [Sesamum indicum]
Length=196

 Score =   343 bits (879),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 166/174 (95%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIR+GRQVVNVPSF+VRVDSQKHIDFSL+SPFGGGR GRV
Sbjct  121  AKSIHHARVLIRQRHIRIGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRAGRV  174



>gb|EYU28732.1| hypothetical protein MIMGU_mgv1a014218mg [Erythranthe guttata]
Length=197

 Score =   343 bits (879),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVCFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+AL+RRMN+Y LLDESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKDPRRIFEGEALMRRMNKYALLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_009627396.1| PREDICTED: 40S ribosomal protein S9-2 [Nicotiana tomentosiformis]
Length=197

 Score =   342 bits (878),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+AL+RRMNRYGLLDESQNKLDYVL+LTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALMRRMNRYGLLDESQNKLDYVLSLTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VR+DSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRLDSQKHIDFSLTSPFGGGRPGRV  174



>gb|KCW56189.1| hypothetical protein EUGRSUZ_I01938 [Eucalyptus grandis]
Length=176

 Score =   342 bits (876),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/173 (95%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGR  580
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGR
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGR  173



>ref|XP_002511557.1| 40S ribosomal protein S9, putative [Ricinus communis]
 gb|EEF52159.1| 40S ribosomal protein S9, putative [Ricinus communis]
Length=197

 Score =   342 bits (878),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 173/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VR+DSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRIDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_009798560.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana sylvestris]
Length=197

 Score =   342 bits (877),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRP+EKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVL+LTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLSLTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_010029477.1| PREDICTED: 40S ribosomal protein S9-2 [Eucalyptus grandis]
 gb|KCW83573.1| hypothetical protein EUGRSUZ_B00467 [Eucalyptus grandis]
Length=197

 Score =   342 bits (877),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+ SF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIASFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>emb|CDP02222.1| unnamed protein product [Coffea canephora]
Length=197

 Score =   342 bits (877),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVNVPSFLVRVDSQKHIDFS++SPFGGGR GRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFLVRVDSQKHIDFSITSPFGGGRAGRV  174



>ref|NP_001274868.1| 40S ribosomal protein S9-2-like [Solanum tuberosum]
 gb|AFW90596.1| putative 40S ribosomal protein S9 [Solanum tuberosum]
Length=197

 Score =   342 bits (876),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKD RRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDSRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVNV SF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVASFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_002522398.1| 40S ribosomal protein S9, putative [Ricinus communis]
 gb|EEF39890.1| 40S ribosomal protein S9, putative [Ricinus communis]
Length=196

 Score =   342 bits (876),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNQRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_009778292.1| PREDICTED: 40S ribosomal protein S9-2 [Nicotiana sylvestris]
Length=197

 Score =   342 bits (876),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+AL+RRMNRYGLLDESQNKLDYVL+LTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALMRRMNRYGLLDESQNKLDYVLSLTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VR+DSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRLDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_002283256.1| PREDICTED: 40S ribosomal protein S9-2 [Vitis vinifera]
 ref|XP_002275166.1| PREDICTED: 40S ribosomal protein S9-2 [Vitis vinifera]
 emb|CBI22191.3| unnamed protein product [Vitis vinifera]
 emb|CBI15244.3| unnamed protein product [Vitis vinifera]
Length=197

 Score =   341 bits (875),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSFLVR+DSQKHIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFLVRMDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_011004198.1| PREDICTED: 40S ribosomal protein S9-2 isoform X1 [Populus euphratica]
 ref|XP_011004199.1| PREDICTED: 40S ribosomal protein S9-2 isoform X1 [Populus euphratica]
 ref|XP_011004200.1| PREDICTED: 40S ribosomal protein S9-2 isoform X2 [Populus euphratica]
Length=197

 Score =   341 bits (874),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLI+Q+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_009779308.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana sylvestris]
Length=197

 Score =   341 bits (874),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRP+EKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVL+LTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLSLTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VR+DSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRLDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_010242426.1| PREDICTED: 40S ribosomal protein S9-2 [Nelumbo nucifera]
Length=197

 Score =   340 bits (873),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQKHIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQKHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>gb|ABQ32300.1| putative 40S ribosomal protein S9 [Artemisia annua]
Length=197

 Score =   340 bits (873),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVPFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL+EKDPRRIFEG+AL+RRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLEEKDPRRIFEGEALMRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLI+Q+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_006367430.1| PREDICTED: 40S ribosomal protein S9-2-like isoform X1 [Solanum 
tuberosum]
Length=197

 Score =   340 bits (873),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK PR IFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKAPRPIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVNV SF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVASFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_009598709.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana tomentosiformis]
Length=197

 Score =   340 bits (872),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRP+EKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVL+LTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLSLTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPFG GRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGSGRPGRV  174



>ref|XP_009600364.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana tomentosiformis]
 ref|XP_009782105.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana sylvestris]
Length=197

 Score =   340 bits (872),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVL+LTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLSLTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VR+DSQKHIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRLDSQKHIDFSLISPFGGGRPGRV  174



>ref|XP_002323418.1| hypothetical protein POPTR_0016s07730g [Populus trichocarpa]
 ref|XP_002322813.2| 40S ribosomal protein S9 [Populus trichocarpa]
 gb|ABK93151.1| unknown [Populus trichocarpa]
 gb|ABK96412.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEF05179.1| hypothetical protein POPTR_0016s07730g [Populus trichocarpa]
 gb|EEF04574.2| 40S ribosomal protein S9 [Populus trichocarpa]
Length=197

 Score =   339 bits (870),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+ RRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNSRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLI+QKHIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIKQKHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>gb|EPS73776.1| hypothetical protein M569_00980 [Genlisea aurea]
Length=197

 Score =   339 bits (870),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNART  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+H+RVGRQVVNVPSF+VR+DSQKHIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHVRVGRQVVNVPSFMVRLDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_006367431.1| PREDICTED: 40S ribosomal protein S9-2-like isoform X2 [Solanum 
tuberosum]
Length=197

 Score =   338 bits (868),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK PR IFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKAPRPIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVNV SF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVASFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_007037295.1| Ribosomal protein S4 [Theobroma cacao]
 gb|EOY21796.1| Ribosomal protein S4 [Theobroma cacao]
Length=197

 Score =   338 bits (868),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+H+RVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHVRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_011004201.1| PREDICTED: 40S ribosomal protein S9-2-like isoform X1 [Populus 
euphratica]
 ref|XP_011004202.1| PREDICTED: 40S ribosomal protein S9-2-like isoform X2 [Populus 
euphratica]
Length=197

 Score =   338 bits (866),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+ RRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNSRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLI+Q+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_011004703.1| PREDICTED: 40S ribosomal protein S9-2-like [Populus euphratica]
Length=197

 Score =   338 bits (866),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+ RRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNSRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLI+Q+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>gb|KJB74899.1| hypothetical protein B456_012G055000 [Gossypium raimondii]
Length=197

 Score =   338 bits (866),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>gb|KJB70960.1| hypothetical protein B456_011G097500 [Gossypium raimondii]
Length=197

 Score =   338 bits (866),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>gb|KJB33600.1| hypothetical protein B456_006G020700 [Gossypium raimondii]
Length=197

 Score =   338 bits (866),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>gb|KHG16530.1| 40S ribosomal S9-2 -like protein [Gossypium arboreum]
 gb|KJB39897.1| hypothetical protein B456_007G036500 [Gossypium raimondii]
Length=197

 Score =   338 bits (866),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>gb|KJB11057.1| hypothetical protein B456_001G238700 [Gossypium raimondii]
 gb|KJB11058.1| hypothetical protein B456_001G238700 [Gossypium raimondii]
Length=197

 Score =   337 bits (865),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_002324730.1| hypothetical protein POPTR_0018s07520g [Populus trichocarpa]
 ref|XP_006381972.1| hypothetical protein POPTR_0006s22630g [Populus trichocarpa]
 gb|ABK93418.1| unknown [Populus trichocarpa]
 gb|ABK95800.1| unknown [Populus trichocarpa]
 gb|ABK96647.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEF03295.1| hypothetical protein POPTR_0018s07520g [Populus trichocarpa]
 gb|ERP59769.1| hypothetical protein POPTR_0006s22630g [Populus trichocarpa]
Length=197

 Score =   337 bits (865),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+ RRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNQRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLI+Q+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>gb|AFK46709.1| unknown [Lotus japonicus]
Length=197

 Score =   337 bits (865),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_007032505.1| Ribosomal protein S4 [Theobroma cacao]
 gb|EOY03431.1| Ribosomal protein S4 [Theobroma cacao]
Length=197

 Score =   337 bits (865),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNR+GLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRHGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>emb|CDP00311.1| unnamed protein product [Coffea canephora]
Length=197

 Score =   337 bits (864),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRR+FEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRVFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPFGGGR GRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRAGRV  174



>ref|XP_004499428.1| PREDICTED: 40S ribosomal protein S9-2-like [Cicer arietinum]
Length=197

 Score =   337 bits (864),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>emb|CAG47084.1| 40S ribosomal protein S9 [Catharanthus roseus]
Length=197

 Score =   337 bits (863),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNAARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDE QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDEGQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVG+QVVNVPSF+VRVDSQKHIDFS++SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGKQVVNVPSFMVRVDSQKHIDFSITSPFGGGRPGRV  174



>gb|ABK21901.1| unknown [Picea sitchensis]
 gb|ACN40156.1| unknown [Picea sitchensis]
Length=197

 Score =   337 bits (863),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY LSRIRN ARM
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYTLSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQ+KLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQSKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_007138197.1| hypothetical protein PHAVU_009G188600g [Phaseolus vulgaris]
 gb|ESW10191.1| hypothetical protein PHAVU_009G188600g [Phaseolus vulgaris]
Length=197

 Score =   337 bits (863),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLI+Q+HIRVGRQVVN+PSFLVRVDSQKHIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNIPSFLVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_003549666.1| PREDICTED: 40S ribosomal protein S9-2-like [Glycine max]
 gb|KHN18541.1| 40S ribosomal protein S9-2 [Glycine soja]
 gb|KHN48678.1| 40S ribosomal protein S9-2 [Glycine soja]
Length=197

 Score =   336 bits (861),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_007155321.1| hypothetical protein PHAVU_003G191200g [Phaseolus vulgaris]
 gb|ESW27315.1| hypothetical protein PHAVU_003G191200g [Phaseolus vulgaris]
Length=197

 Score =   336 bits (861),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_010917021.1| PREDICTED: 40S ribosomal protein S9-2 [Elaeis guineensis]
Length=197

 Score =   336 bits (861),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYSLSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDENQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSFLVRVDS KHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFLVRVDSAKHIDFSLTSPFGGGRPGRV  174



>ref|NP_001276185.1| 40S ribosomal protein S9-2-like [Glycine max]
 ref|XP_003523030.1| PREDICTED: 40S ribosomal protein S9-2-like [Glycine max]
 ref|XP_007137996.1| hypothetical protein PHAVU_009G172300g [Phaseolus vulgaris]
 gb|ACU20562.1| unknown [Glycine max]
 gb|ESW09990.1| hypothetical protein PHAVU_009G172300g [Phaseolus vulgaris]
Length=197

 Score =   335 bits (860),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLI+Q+HIRVGRQVVN+PSFLVRVDSQKHIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNIPSFLVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_004508755.1| PREDICTED: 40S ribosomal protein S9-2-like [Cicer arietinum]
 ref|XP_004508756.1| PREDICTED: 40S ribosomal protein S9-2-like [Cicer arietinum]
Length=197

 Score =   335 bits (860),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_002276284.1| PREDICTED: 40S ribosomal protein S9-2 [Vitis vinifera]
 emb|CBI31983.3| unnamed protein product [Vitis vinifera]
Length=197

 Score =   335 bits (859),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMN+YGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNKYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRV+SQKHIDF+ +SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVESQKHIDFANTSPLGGGRPGRV  174



>gb|ACU15321.1| unknown [Glycine max]
Length=222

 Score =   335 bits (860),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKT KKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTLKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_002317362.1| hypothetical protein POPTR_0011s09670g [Populus trichocarpa]
 gb|ABK93285.1| unknown [Populus trichocarpa]
 gb|EEE97974.1| hypothetical protein POPTR_0011s09670g [Populus trichocarpa]
Length=197

 Score =   334 bits (856),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E+QNKLDYVLALTVE+FLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEENQNKLDYVLALTVESFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLI+Q+HIRVGRQ VN+PSF+VRVDSQKHIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIKQRHIRVGRQAVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_007215987.1| hypothetical protein PRUPE_ppa011733mg [Prunus persica]
 ref|XP_008230756.1| PREDICTED: 40S ribosomal protein S9-2 [Prunus mume]
 gb|EMJ17186.1| hypothetical protein PRUPE_ppa011733mg [Prunus persica]
Length=198

 Score =   334 bits (856),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK PRRIFEG+ALLRRMNRYGLL+E+QNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKSPRRIFEGEALLRRMNRYGLLEETQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFS++SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSITSPLGGGRPGRV  174



>ref|XP_006380606.1| hypothetical protein POPTR_0007s09750g [Populus trichocarpa]
 gb|ERP58403.1| hypothetical protein POPTR_0007s09750g [Populus trichocarpa]
Length=197

 Score =   334 bits (856),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E+QNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEENQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLI+Q+H RVGRQVVN+PSF+VRVDSQKHIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIKQRHTRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_006282728.1| hypothetical protein CARUB_v10005777mg [Capsella rubella]
 gb|EOA15626.1| hypothetical protein CARUB_v10005777mg [Capsella rubella]
Length=198

 Score =   333 bits (855),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVNVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIR+GRQ+VN+PSF+VRV+SQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRIGRQLVNIPSFMVRVESQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_009389620.1| PREDICTED: 40S ribosomal protein S9-2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009411686.1| PREDICTED: 40S ribosomal protein S9-2-like [Musa acuminata subsp. 
malaccensis]
Length=197

 Score =   333 bits (855),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEEGQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDS KHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSAKHIDFSLTSPFGGGRPGRV  174



>ref|XP_010554004.1| PREDICTED: 40S ribosomal protein S9-2 [Tarenaya hassleriana]
Length=197

 Score =   333 bits (855),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+V+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVNVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMN+YGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNKYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+V+VDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVKVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_010435836.1| PREDICTED: 40S ribosomal protein S9-2 [Camelina sativa]
 ref|XP_010441098.1| PREDICTED: 40S ribosomal protein S9-2 [Camelina sativa]
 ref|XP_010450759.1| PREDICTED: 40S ribosomal protein S9-2 [Camelina sativa]
Length=197

 Score =   333 bits (854),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVNVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+SQKH+DFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESQKHVDFSLTSPFGGGRPGRV  174



>ref|XP_009414866.1| PREDICTED: 40S ribosomal protein S9-2 [Musa acuminata subsp. 
malaccensis]
Length=197

 Score =   333 bits (854),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEEGQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDS KHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSAKHIDFSLTSPFGGGRPGRV  174



>ref|XP_009403622.1| PREDICTED: 40S ribosomal protein S9-2-like [Musa acuminata subsp. 
malaccensis]
Length=197

 Score =   333 bits (854),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEEGQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDS KHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSAKHIDFSLTSPFGGGRPGRV  174



>ref|XP_003577383.1| PREDICTED: 40S ribosomal protein S9-2-like [Brachypodium distachyon]
Length=195

 Score =   333 bits (853),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VRVDS+KHIDFSL+SPFGGG PGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGKQIVNIPSFMVRVDSEKHIDFSLTSPFGGGNPGRV  174



>ref|NP_001238740.1| uncharacterized protein LOC100305663 [Glycine max]
 gb|ACU13464.1| unknown [Glycine max]
Length=197

 Score =   333 bits (853),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNY KTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYEKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_003598026.1| 40S ribosomal protein S9 [Medicago truncatula]
 ref|XP_003598028.1| 40S ribosomal protein S9 [Medicago truncatula]
 ref|XP_003604908.1| 40S ribosomal protein S9 [Medicago truncatula]
 gb|ACJ85917.1| unknown [Medicago truncatula]
 gb|AES68277.1| 40S ribosomal S9-like protein [Medicago truncatula]
 gb|AES68279.1| 40S ribosomal S9-like protein [Medicago truncatula]
 gb|AES87105.1| 40S ribosomal S9-like protein [Medicago truncatula]
 gb|AFK39708.1| unknown [Medicago truncatula]
 gb|AFK43821.1| unknown [Medicago truncatula]
Length=197

 Score =   333 bits (853),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNART  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM ++GLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFKHGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGG PGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGLPGRV  174



>gb|ABR17162.1| unknown [Picea sitchensis]
 gb|ACN39805.1| unknown [Picea sitchensis]
 gb|ACN39957.1| unknown [Picea sitchensis]
 gb|ACN40724.1| unknown [Picea sitchensis]
 gb|ADE77363.1| unknown [Picea sitchensis]
Length=197

 Score =   332 bits (852),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY LSRIRN ARM
Sbjct  1    MVHVVFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYTLSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE+Q+KLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDETQSKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_008780681.1| PREDICTED: 40S ribosomal protein S9-2 [Phoenix dactylifera]
 ref|XP_008780688.1| PREDICTED: 40S ribosomal protein S9-2 [Phoenix dactylifera]
 ref|XP_008780693.1| PREDICTED: 40S ribosomal protein S9-2 [Phoenix dactylifera]
Length=197

 Score =   332 bits (852),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQ+ALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQFALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDEMQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDS KHIDFSL+SPFGGG PGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSAKHIDFSLTSPFGGGCPGRV  174



>gb|AFK40975.1| unknown [Medicago truncatula]
Length=197

 Score =   332 bits (852),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNART  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM ++GLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFKHGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGG PGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGLPGRV  174



>ref|XP_003576178.1| PREDICTED: 40S ribosomal protein S9-2-like [Brachypodium distachyon]
Length=195

 Score =   332 bits (850),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQ+VNVPSF+VRV+S+KHIDFSL+SPFGGG+PGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQIVNVPSFMVRVESEKHIDFSLTSPFGGGQPGRV  174



>ref|XP_007209623.1| hypothetical protein PRUPE_ppa011764mg [Prunus persica]
 ref|XP_008239810.1| PREDICTED: 40S ribosomal protein S9-2-like [Prunus mume]
 gb|EMJ10822.1| hypothetical protein PRUPE_ppa011764mg [Prunus persica]
Length=197

 Score =   332 bits (850),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E QNKLDYVLALTVENFLERRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEEGQNKLDYVLALTVENFLERRLQTIVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+ SFLVR DS+KHIDFSL+SP G GRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNISSFLVRCDSEKHIDFSLTSPLGAGRPGRV  174



>ref|XP_002870751.1| 40S ribosomal protein S9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47010.1| 40S ribosomal protein S9 [Arabidopsis lyrata subsp. lyrata]
Length=197

 Score =   332 bits (850),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVNVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+SQKH+DFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESQKHVDFSLTSPFGGGRPGRV  174



>ref|XP_009383889.1| PREDICTED: 40S ribosomal protein S9-2-like [Musa acuminata subsp. 
malaccensis]
Length=197

 Score =   331 bits (849),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEEGQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+ SF+VRVDS KHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIASFMVRVDSAKHIDFSLTSPFGGGRPGRV  174



>gb|KFK33188.1| hypothetical protein AALP_AA6G341500 [Arabis alpina]
Length=197

 Score =   331 bits (849),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVQVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALT+ENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTIENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+SQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_006405589.1| hypothetical protein EUTSA_v10027944mg [Eutrema salsugineum]
 gb|ESQ47042.1| hypothetical protein EUTSA_v10027944mg [Eutrema salsugineum]
Length=198

 Score =   331 bits (848),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVQVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNR GLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRSGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+V+VDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVKVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|NP_198801.1| 40S ribosomal protein S9-2 [Arabidopsis thaliana]
 sp|Q9FLF0.1|RS92_ARATH RecName: Full=40S ribosomal protein S9-2 [Arabidopsis thaliana]
 dbj|BAB10209.1| 40S ribosomal protein S9 [Arabidopsis thaliana]
 gb|AAM65655.1| 40S ribosomal protein S9-like [Arabidopsis thaliana]
 gb|ABD94071.1| At5g39850 [Arabidopsis thaliana]
 gb|AED94483.1| 40S ribosomal protein S9-2 [Arabidopsis thaliana]
Length=197

 Score =   331 bits (848),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVNVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE+QNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDETQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+SQKH+DFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESQKHVDFSLTSPFGGGRPGRV  174



>ref|NP_001049004.1| Os03g0154700 [Oryza sativa Japonica Group]
 ref|NP_001068233.1| Os11g0602600 [Oryza sativa Japonica Group]
 gb|ABA94599.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA94601.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF94048.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABG22548.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10918.1| Os03g0154700 [Oryza sativa Japonica Group]
 dbj|BAF28596.1| Os11g0602600 [Oryza sativa Japonica Group]
 gb|EAY81477.1| hypothetical protein OsI_36650 [Oryza sativa Indica Group]
 gb|EAZ18880.1| hypothetical protein OsJ_34422 [Oryza sativa Japonica Group]
 gb|ABR25448.1| 40S ribosomal protein S9 [Oryza sativa Indica Group]
 dbj|BAG96424.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87870.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93092.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96556.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96871.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96935.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC68442.1| hypothetical protein OsI_36651 [Oryza sativa Indica Group]
 gb|EEE52362.1| hypothetical protein OsJ_34424 [Oryza sativa Japonica Group]
 gb|EEE58343.1| hypothetical protein OsJ_09456 [Oryza sativa Japonica Group]
Length=195

 Score =   330 bits (846),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+S+KHIDFSL+SPFGGG PGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQIVNIPSFMVRVESEKHIDFSLTSPFGGGPPGRV  174



>ref|XP_006438663.1| hypothetical protein CICLE_v10032800mg [Citrus clementina]
 ref|XP_006483187.1| PREDICTED: 40S ribosomal protein S9-2-like [Citrus sinensis]
 ref|XP_006483188.1| PREDICTED: 40S ribosomal protein S9-2-like [Citrus sinensis]
 gb|ESR51903.1| hypothetical protein CICLE_v10032800mg [Citrus clementina]
Length=197

 Score =   329 bits (844),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM+RYG L+ESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMHRYGFLEESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVDSQKHI+FSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFVVRVDSQKHIEFSLTSPFGGGRPGRV  174



>ref|XP_010937076.1| PREDICTED: 40S ribosomal protein S9-2-like [Elaeis guineensis]
Length=197

 Score =   329 bits (843),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE+QNKLDYVLALTVENFLERRLQT VFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDENQNKLDYVLALTVENFLERRLQTQVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDS KHIDF+L+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSAKHIDFALNSPFGGGRPGRV  174



>ref|XP_004304310.1| PREDICTED: 40S ribosomal protein S9-2 [Fragaria vesca subsp. 
vesca]
Length=197

 Score =   329 bits (843),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVVFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQT VFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTQVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VR+DS+KHIDF+++SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRIDSEKHIDFAITSPLGGGRPGRV  174



>ref|XP_002442158.1| hypothetical protein SORBIDRAFT_08g015270 [Sorghum bicolor]
 gb|EES15996.1| hypothetical protein SORBIDRAFT_08g015270 [Sorghum bicolor]
Length=195

 Score =   328 bits (841),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLI+Q+HIRVGRQ+VNVPSF+VRV+S+KHIDFSLSSPFGGG PGRV
Sbjct  121  AKSIHHARVLIKQRHIRVGRQIVNVPSFMVRVESEKHIDFSLSSPFGGGPPGRV  174



>ref|XP_003623232.1| 40S ribosomal protein S9 [Medicago truncatula]
 gb|AES79450.1| 40S ribosomal S9-like protein [Medicago truncatula]
Length=197

 Score =   328 bits (841),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLV EYGLRCKRELWRVQYALSRIRNN+R 
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVREYGLRCKRELWRVQYALSRIRNNSRT  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM ++GLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFKHGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGG PGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGLPGRV  174



>ref|XP_004962962.1| PREDICTED: 40S ribosomal protein S9-2-like [Setaria italica]
Length=195

 Score =   328 bits (841),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLI+Q+HIRVGRQ+VNVPSF+VRV+S+KHIDFSLSSPFGGG PGRV
Sbjct  121  AKSIHHARVLIKQRHIRVGRQIVNVPSFMVRVESEKHIDFSLSSPFGGGPPGRV  174



>ref|XP_008341561.1| PREDICTED: 40S ribosomal protein S9-2 [Malus domestica]
Length=197

 Score =   328 bits (841),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV  YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVVHYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYSLSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKXGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|XP_004299381.1| PREDICTED: 40S ribosomal protein S9-2-like [Fragaria vesca subsp. 
vesca]
Length=198

 Score =   328 bits (840),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVVFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E QNKLDYVLALTVENFLERRLQT+VFK G+
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEEGQNKLDYVLALTVENFLERRLQTVVFKKGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VR DS+KHIDF+++SP GGG PGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRCDSEKHIDFAITSPLGGGGPGRV  174



>ref|XP_010939529.1| PREDICTED: 40S ribosomal protein S9-2-like [Elaeis guineensis]
Length=197

 Score =   328 bits (840),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNR+GLLDE+QNKLDYVLALTVENFLERRLQT VFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRFGLLDENQNKLDYVLALTVENFLERRLQTQVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVDS KHIDF+L+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVDSAKHIDFALNSPFGGGRPGRV  174



>ref|XP_008379343.1| PREDICTED: 40S ribosomal protein S9-2 [Malus domestica]
Length=197

 Score =   328 bits (840),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV  YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVVHYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYSLSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVDSQKHIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  174



>ref|NP_001131442.1| uncharacterized protein LOC100192774 [Zea mays]
 gb|ACG30355.1| 40S ribosomal protein S9 [Zea mays]
 gb|AFW87984.1| 40S ribosomal protein S9 [Zea mays]
Length=193

 Score =   327 bits (839),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVDS+KHIDFSL+SP GGG PGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVDSEKHIDFSLTSPLGGGEPGRV  174



>ref|XP_006663032.1| PREDICTED: 40S ribosomal protein S9-2-like [Oryza brachyantha]
Length=195

 Score =   327 bits (838),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+S+KHIDFSL+SPFGGG  GRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQIVNIPSFMVRVESEKHIDFSLTSPFGGGPAGRV  174



>ref|XP_003557815.1| PREDICTED: 40S ribosomal protein S9-2 [Brachypodium distachyon]
Length=195

 Score =   327 bits (838),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKSPRRIFEGEALLRRMNRYGLLAEDQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVD++KHIDFSL+SP GGG PGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVDTEKHIDFSLTSPLGGGEPGRV  174



>ref|XP_006664031.1| PREDICTED: 40S ribosomal protein S9-2-like [Oryza brachyantha]
Length=195

 Score =   327 bits (837),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQ+VNVPSF+VR++S+KHIDFSL+SPFGGG PGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQIVNVPSFMVRLESEKHIDFSLTSPFGGGPPGRV  174



>ref|NP_001278530.1| 40S ribosomal protein S9 [Zea mays]
 gb|ACG32995.1| 40S ribosomal protein S9 [Zea mays]
 gb|ACG34689.1| 40S ribosomal protein S9 [Zea mays]
 gb|ACL52933.1| unknown [Zea mays]
 tpg|DAA55418.1| TPA: 40S ribosomal protein S9 isoform 1 [Zea mays]
 tpg|DAA55419.1| TPA: 40S ribosomal protein S9 isoform 2 [Zea mays]
Length=194

 Score =   327 bits (837),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLI+Q+HIRVGRQ+VNVPSF+VRV+S+KHIDFSLSSPFGGG  GRV
Sbjct  121  AKSIHHARVLIKQRHIRVGRQIVNVPSFMVRVESEKHIDFSLSSPFGGGPAGRV  174



>ref|XP_010092050.1| 40S ribosomal protein S9-2 [Morus notabilis]
 gb|EXB49964.1| 40S ribosomal protein S9-2 [Morus notabilis]
Length=271

 Score =   329 bits (843),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/164 (96%), Positives = 164/164 (100%), Gaps = 0/164 (0%)
 Frame = +2

Query  92   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  271
            GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK+PR
Sbjct  85   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKNPR  144

Query  272  RIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVL  451
            RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GMAKSIHHARVL
Sbjct  145  RIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGMAKSIHHARVL  204

Query  452  IRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            IRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  205  IRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  248



>ref|XP_010683223.1| PREDICTED: 40S ribosomal protein S9-2 [Beta vulgaris subsp. vulgaris]
Length=197

 Score =   326 bits (836),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV +YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYVLSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMN++GLLDE QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNKHGLLDEGQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_010695717.1| PREDICTED: 40S ribosomal protein S9-2-like [Beta vulgaris subsp. 
vulgaris]
Length=197

 Score =   326 bits (836),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY LSRIRN AR 
Sbjct  1    MVHVCFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYVLSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM+R+GLLDE QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMHRHGLLDEGQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLI+Q+HIRVGRQVVN+PSF+VRVDSQKHIDFSLSSPFGGGRPGRV
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLSSPFGGGRPGRV  174



>ref|XP_003637511.1| 40S ribosomal protein S9 [Medicago truncatula]
 gb|KEH42383.1| 40S ribosomal S9-like protein [Medicago truncatula]
Length=224

 Score =   327 bits (838),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  28   MVKVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  87

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM ++GLLDE+QNKLDYVLALTVENFLERRLQTL FK+GM
Sbjct  88   LLTLDEKNPRRIFEGEALLRRMFKHGLLDETQNKLDYVLALTVENFLERRLQTLAFKSGM  147

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGG PGRV
Sbjct  148  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGLPGRV  201



>ref|XP_004984207.1| PREDICTED: 40S ribosomal protein S9-2-like [Setaria italica]
Length=194

 Score =   325 bits (832),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVDS+KH+DFSL+SP GGG PGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVDSEKHVDFSLTSPLGGGEPGRV  174



>ref|XP_009124855.1| PREDICTED: 40S ribosomal protein S9-2 [Brassica rapa]
Length=197

 Score =   325 bits (833),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVQVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIF+G+ALLRRMN+ GLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPRRIFQGEALLRRMNKNGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+V+V+SQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVKVESQKHIDFSLTSPFGGGRPGRV  174



>emb|CDX74423.1| BnaA04g09660D [Brassica napus]
Length=198

 Score =   325 bits (833),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVQVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIF+G+ALLRRMN+ GLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPRRIFQGEALLRRMNKNGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+V+V+SQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVKVESQKHIDFSLTSPFGGGRPGRV  174



>ref|XP_006650139.1| PREDICTED: 40S ribosomal protein S9-2-like [Oryza brachyantha]
Length=195

 Score =   325 bits (832),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VR+DS+KHIDFSL+SP GGG PGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRLDSEKHIDFSLTSPLGGGEPGRV  174



>gb|ACG33443.1| 40S ribosomal protein S9 [Zea mays]
Length=194

 Score =   324 bits (831),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+P RIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPHRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLI+Q+HIRVGRQ+VNVPSF+VRV+S+KHIDFSLSSPFGGG  GRV
Sbjct  121  AKSIHHARVLIKQRHIRVGRQIVNVPSFMVRVESEKHIDFSLSSPFGGGPAGRV  174



>gb|EMS50632.1| 40S ribosomal protein S9-2 [Triticum urartu]
 gb|EMT06699.1| 40S ribosomal protein S9-2 [Aegilops tauschii]
Length=195

 Score =   324 bits (830),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG ALLRRMNRYGLL E Q+KLDYVLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGAALLRRMNRYGLLAEGQDKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQ+VNVPSF+VRV+S+KHIDFSL+SPFGGG  GRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQIVNVPSFMVRVESEKHIDFSLTSPFGGGPAGRV  174



>ref|XP_001754369.1| predicted protein [Physcomitrella patens]
 ref|XP_001761244.1| predicted protein [Physcomitrella patens]
 gb|EDQ73966.1| predicted protein [Physcomitrella patens]
 gb|EDQ80819.1| predicted protein [Physcomitrella patens]
Length=198

 Score =   323 bits (828),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV  +RNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQYALSRIRNNARM
Sbjct  1    MVHVASFRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDE+Q+KLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNTRRIFEGEALLRRMNRYGLLDENQSKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLI+Q+HIRVG+Q+V+VPSF+VRVDSQKH+DF+LSSP GGGRPGRV
Sbjct  121  AKSIHHARVLIKQRHIRVGKQIVDVPSFMVRVDSQKHVDFALSSPLGGGRPGRV  174



>ref|XP_001767226.1| predicted protein [Physcomitrella patens]
 gb|EDQ67907.1| predicted protein [Physcomitrella patens]
Length=198

 Score =   323 bits (828),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV  +RNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQYALSRIRNNARM
Sbjct  1    MVHVASFRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDE+Q+KLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNTRRIFEGEALLRRMNRYGLLDENQSKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLI+Q+HIRVG+Q+V+VPSF+VRVDSQKH+DF+LSSP GGGRPGRV
Sbjct  121  AKSIHHARVLIKQRHIRVGKQIVDVPSFMVRVDSQKHVDFALSSPLGGGRPGRV  174



>gb|AAT08735.1| 40S ribosomal protein S9 [Hyacinthus orientalis]
Length=197

 Score =   322 bits (826),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY LSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYVLSRIRNAARQ  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDE+DPRR+FEG+ALLRRM++YGLLDE QNKLDYVLALTVENFLERRLQT VFK GM
Sbjct  61   LLTLDERDPRRVFEGEALLRRMHKYGLLDEEQNKLDYVLALTVENFLERRLQTQVFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVNVPSFLV+++S KHIDF+LSSPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFLVKLESGKHIDFALSSPFGGGRPGRV  174



>ref|XP_001777561.1| predicted protein [Physcomitrella patens]
 gb|EDQ57604.1| predicted protein [Physcomitrella patens]
Length=197

 Score =   322 bits (826),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV  +RNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQYALSRIRNNARM
Sbjct  1    MVHVASFRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDE+Q+KLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNTRRIFEGEALLRRMNRYGLLDENQSKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLI+Q+HIRVG+Q+V+VPSF+VRVDSQKH+DF+LSSP GGGRPGRV
Sbjct  121  AKSIHHARVLIKQRHIRVGKQIVDVPSFMVRVDSQKHVDFALSSPLGGGRPGRV  174



>ref|NP_001149705.1| 40S ribosomal protein S9 [Zea mays]
 gb|ACG36447.1| 40S ribosomal protein S9 [Zea mays]
 gb|AFR11274.1| ribosomal protein S9 [Zea mays]
 tpg|DAA41536.1| TPA: 40S ribosomal protein S9 [Zea mays]
Length=193

 Score =   322 bits (825),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+S+KHIDFSL+SP GGG  GRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESEKHIDFSLTSPLGGGPAGRV  174



>ref|XP_010420178.1| PREDICTED: 40S ribosomal protein S9-1 [Camelina sativa]
Length=198

 Score =   322 bits (825),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHH+RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQKHIDF+L+SPFGGGRPGRV
Sbjct  121  AKSIHHSRVLIRQRHIRVGKQLVNIPSFMVRLDSQKHIDFALTSPFGGGRPGRV  174



>ref|XP_006288701.1| hypothetical protein CARUB_v10002009mg [Capsella rubella]
 ref|XP_010453649.1| PREDICTED: 40S ribosomal protein S9-1-like [Camelina sativa]
 ref|XP_010492346.1| PREDICTED: 40S ribosomal protein S9-1-like [Camelina sativa]
 gb|EOA21599.1| hypothetical protein CARUB_v10002009mg [Capsella rubella]
Length=197

 Score =   322 bits (825),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHH+RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQKHIDF+L+SPFGGGRPGRV
Sbjct  121  AKSIHHSRVLIRQRHIRVGKQLVNIPSFMVRLDSQKHIDFALTSPFGGGRPGRV  174



>ref|XP_006400037.1| hypothetical protein EUTSA_v10014722mg [Eutrema salsugineum]
 gb|ESQ41490.1| hypothetical protein EUTSA_v10014722mg [Eutrema salsugineum]
Length=198

 Score =   322 bits (825),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHH+RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQKHIDF+L+SPFGGGRPGRV
Sbjct  121  AKSIHHSRVLIRQRHIRVGKQLVNIPSFMVRLDSQKHIDFALTSPFGGGRPGRV  174



>ref|XP_001754496.1| predicted protein [Physcomitrella patens]
 gb|EDQ80466.1| predicted protein [Physcomitrella patens]
Length=198

 Score =   322 bits (824),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV  +RNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQYALSRIRNNARM
Sbjct  1    MVHVASFRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDESQ KLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNTRRIFEGEALLRRMNRYGLLDESQCKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLI+Q+HIRVG+Q+V+VPSF+VR+DSQKH+DF+LSSP GGGRPGRV
Sbjct  121  AKSIHHARVLIKQRHIRVGKQIVDVPSFMVRLDSQKHVDFALSSPLGGGRPGRV  174



>ref|NP_197024.1| 40S ribosomal protein S9-1 [Arabidopsis thaliana]
 sp|Q9LXG1.1|RS91_ARATH RecName: Full=40S ribosomal protein S9-1 [Arabidopsis thaliana]
 emb|CAB89330.1| 40S ribosomal protein-like [Arabidopsis thaliana]
 gb|AAR24214.1| At5g15200 [Arabidopsis thaliana]
 gb|AAR92351.1| At5g15200 [Arabidopsis thaliana]
 dbj|BAF00367.1| 40S ribosomal protein - like [Arabidopsis thaliana]
 gb|AED92128.1| 40S ribosomal protein S9-1 [Arabidopsis thaliana]
Length=198

 Score =   322 bits (824),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKSPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHH+RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQKHIDF+L+SPFGGGRPGRV
Sbjct  121  AKSIHHSRVLIRQRHIRVGKQLVNIPSFMVRLDSQKHIDFALTSPFGGGRPGRV  174



>ref|XP_002463229.1| hypothetical protein SORBIDRAFT_02g040120 [Sorghum bicolor]
 gb|EER99750.1| hypothetical protein SORBIDRAFT_02g040120 [Sorghum bicolor]
Length=194

 Score =   320 bits (821),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+S+KHIDFSL+SP GGG  GRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESEKHIDFSLTSPLGGGPAGRV  174



>ref|XP_002463225.1| hypothetical protein SORBIDRAFT_02g040080 [Sorghum bicolor]
 gb|EER99746.1| hypothetical protein SORBIDRAFT_02g040080 [Sorghum bicolor]
Length=194

 Score =   320 bits (821),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+S+KHIDFSL+SP GGG  GRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESEKHIDFSLTSPLGGGPAGRV  174



>ref|XP_002873713.1| 40S ribosomal protein S9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49972.1| 40S ribosomal protein S9 [Arabidopsis lyrata subsp. lyrata]
Length=198

 Score =   321 bits (822),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKSPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHH+RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQKHIDF+L+SPFGGGRPGRV
Sbjct  121  AKSIHHSRVLIRQRHIRVGKQLVNIPSFMVRLDSQKHIDFALTSPFGGGRPGRV  174



>ref|XP_004958404.1| PREDICTED: 40S ribosomal protein S9-2-like [Setaria italica]
Length=194

 Score =   320 bits (820),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+S+KHIDFSL+SP GGG  GRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESEKHIDFSLTSPLGGGPAGRV  174



>ref|XP_003562635.1| PREDICTED: 40S ribosomal protein S9-2-like [Brachypodium distachyon]
Length=195

 Score =   320 bits (820),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKSPRRIFEGEALLRRMNRYGLLAEDQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV ++KHIDFSL+SP GGG  GRV
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVATEKHIDFSLTSPLGGGPAGRV  174



>ref|XP_002985335.1| hypothetical protein SELMODRAFT_157263 [Selaginella moellendorffii]
 ref|XP_002987182.1| hypothetical protein SELMODRAFT_235178 [Selaginella moellendorffii]
 gb|EFJ11758.1| hypothetical protein SELMODRAFT_235178 [Selaginella moellendorffii]
 gb|EFJ13465.1| hypothetical protein SELMODRAFT_157263 [Selaginella moellendorffii]
Length=198

 Score =   319 bits (818),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+V+FYRNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWR+QY LSRIRN AR 
Sbjct  1    MVNVSFYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRLQYVLSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEGDALLRRM+RYGLL+E QNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGDALLRRMHRYGLLEEGQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVL+RQ+HIRVG+Q+VNVPSFLVRV+SQKHIDF+L+SPFGGG PGRV
Sbjct  121  AKSIHHARVLVRQRHIRVGKQMVNVPSFLVRVESQKHIDFALTSPFGGGGPGRV  174



>ref|XP_006657990.1| PREDICTED: 40S ribosomal protein S9-2-like [Oryza brachyantha]
Length=194

 Score =   319 bits (817),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHAR+LIRQ+HIRVGRQ+VN+PSF+VR++S+KHIDFSL+SP GGG  GRV
Sbjct  121  AKSIHHARILIRQRHIRVGRQLVNIPSFMVRLESEKHIDFSLTSPLGGGPAGRV  174



>gb|ABA94602.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
Length=192

 Score =   318 bits (816),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 166/174 (95%), Gaps = 3/174 (2%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HI   RQ+VN+PSF+VRV+S+KHIDFSL+SPFGGG PGRV
Sbjct  121  AKSIHHARVLIRQRHI---RQIVNIPSFMVRVESEKHIDFSLTSPFGGGPPGRV  171



>ref|XP_001762390.1| predicted protein [Physcomitrella patens]
 gb|EDQ72857.1| predicted protein [Physcomitrella patens]
Length=198

 Score =   318 bits (815),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV  +RNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQY LSRIRNNARM
Sbjct  1    MVHVASFRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYVLSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDESQ KLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNTRRIFEGEALLRRMNRYGLLDESQCKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLI+Q+HIRVG+Q+V+VPSF+VR++SQKH+DF+LSSP GGGRPGRV
Sbjct  121  AKSIHHARVLIKQRHIRVGKQIVDVPSFMVRLESQKHVDFALSSPLGGGRPGRV  174



>gb|EMS59613.1| 40S ribosomal protein S9-2 [Triticum urartu]
 gb|EMT26225.1| 40S ribosomal protein S9-2 [Aegilops tauschii]
Length=195

 Score =   318 bits (814),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KREL+RVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELYRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG ALLRRMNRYGLL E QNKLDYVLALTV+NFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGAALLRRMNRYGLLTEEQNKLDYVLALTVDNFLQRRLQTIVFKNGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VRVD++KH+DFSL+SP GGG+PGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGKQLVNIPSFMVRVDTEKHVDFSLTSPLGGGQPGRV  174



>ref|XP_009131450.1| PREDICTED: 40S ribosomal protein S9-1 [Brassica rapa]
 ref|XP_009121599.1| PREDICTED: 40S ribosomal protein S9-1 [Brassica rapa]
 emb|CDX91003.1| BnaC02g05940D [Brassica napus]
 emb|CDX85559.1| BnaA02g02540D [Brassica napus]
 emb|CDX85058.1| BnaC05g19970D [Brassica napus]
 emb|CDX78618.1| BnaA03g05300D [Brassica napus]
 emb|CDX70599.1| BnaC03g06830D [Brassica napus]
 emb|CDX69542.1| BnaA10g18910D [Brassica napus]
Length=197

 Score =   318 bits (815),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV +YRNYGKTFK PRRP+EKERLD+ELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPFEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+P+RIFEG+ALLR+MNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRKMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHH+RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQKHIDF+L+SPFGGGRPGRV
Sbjct  121  AKSIHHSRVLIRQRHIRVGKQLVNIPSFMVRLDSQKHIDFALTSPFGGGRPGRV  174



>ref|XP_006827176.1| hypothetical protein AMTR_s00010p00256040 [Amborella trichopoda]
 gb|ERM94413.1| hypothetical protein AMTR_s00010p00256040 [Amborella trichopoda]
Length=227

 Score =   319 bits (817),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +2

Query  77   FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLD  256
            F   +GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR LLTLD
Sbjct  36   FIEVHGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARELLTLD  95

Query  257  EKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIH  436
            EK+P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GMAKSIH
Sbjct  96   EKNPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGMAKSIH  155

Query  437  HARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            HARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP GGGRPGRV
Sbjct  156  HARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLGGGRPGRV  204



>gb|KHG14244.1| 40S ribosomal S9-2 -like protein [Gossypium arboreum]
Length=191

 Score =   318 bits (814),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  92   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  271
            GKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR LLTLDEK+PR
Sbjct  5    GKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARDLLTLDEKNPR  64

Query  272  RIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVL  451
            RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GMAKSIHHARVL
Sbjct  65   RIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGMAKSIHHARVL  124

Query  452  IRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            IRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  125  IRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  168



>gb|KHG14681.1| 40S ribosomal S9-2 -like protein [Gossypium arboreum]
Length=189

 Score =   317 bits (813),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  92   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  271
            GKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR LLTLDEK+PR
Sbjct  3    GKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARDLLTLDEKNPR  62

Query  272  RIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVL  451
            RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GMAKSIHHARVL
Sbjct  63   RIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGMAKSIHHARVL  122

Query  452  IRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            IRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  123  IRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  166



>dbj|BAJ90873.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99877.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=195

 Score =   317 bits (813),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK PRRIFEG ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKSPRRIFEGAALLRRMNRYGLLSEDQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VRVD++KH+DFSL+SP GGG  GRV
Sbjct  121  AKSIHHARVLIRQRHIRVGKQLVNIPSFMVRVDTEKHVDFSLTSPLGGGPAGRV  174



>ref|XP_002960852.1| hypothetical protein SELMODRAFT_74302 [Selaginella moellendorffii]
 ref|XP_002967162.1| hypothetical protein SELMODRAFT_144850 [Selaginella moellendorffii]
 gb|EFJ31761.1| hypothetical protein SELMODRAFT_144850 [Selaginella moellendorffii]
 gb|EFJ38391.1| hypothetical protein SELMODRAFT_74302 [Selaginella moellendorffii]
Length=198

 Score =   317 bits (811),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV  YRNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQY LSRIRN +R 
Sbjct  1    MVHVCVYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYVLSRIRNASRH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM+RYGLL+E QNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMHRYGLLEEGQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVL+RQ+HIRVG+Q+VNVPSFLVRV+SQKHIDF+L+SPFGGG PGRV
Sbjct  121  AKSIHHARVLVRQRHIRVGKQMVNVPSFLVRVESQKHIDFALTSPFGGGGPGRV  174



>gb|KFK25765.1| hypothetical protein AALP_AA8G156800 [Arabis alpina]
Length=197

 Score =   314 bits (804),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHH+RVLIRQ+HIRVG+Q+VN+PSF+VR++SQKHIDF+L+SP GGGR GRV
Sbjct  121  AKSIHHSRVLIRQRHIRVGKQLVNIPSFMVRLESQKHIDFALTSPLGGGRAGRV  174



>ref|XP_010551858.1| PREDICTED: 40S ribosomal protein S9-2-like [Tarenaya hassleriana]
Length=197

 Score =   312 bits (800),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+VN+YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVNVNYYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+P+RIFEG+ALLRRMNR+GLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRFGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  559
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VRVDSQKHIDF+L+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGKQLVNIPSFMVRVDSQKHIDFALTSPF  166



>ref|XP_010550058.1| PREDICTED: 40S ribosomal protein S9-2-like [Tarenaya hassleriana]
Length=197

 Score =   312 bits (799),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+V++YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVNVSYYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  559
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VRVDSQKHIDF+L+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGKQLVNIPSFMVRVDSQKHIDFALTSPF  166



>ref|XP_010545191.1| PREDICTED: 40S ribosomal protein S9-2-like [Tarenaya hassleriana]
Length=197

 Score =   312 bits (799),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+V++YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVNVSYYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  559
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VRVDSQKHIDF+L+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGKQLVNIPSFMVRVDSQKHIDFALTSPF  166



>gb|KHG06711.1| 40S ribosomal S9-2 -like protein [Gossypium arboreum]
Length=250

 Score =   314 bits (804),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = +2

Query  92   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  271
              TFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR LLTLDEK+PR
Sbjct  64   ATTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARDLLTLDEKNPR  123

Query  272  RIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVL  451
            RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GMAKSIHHARVL
Sbjct  124  RIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGMAKSIHHARVL  183

Query  452  IRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            IRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  184  IRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  227



>gb|ADB77797.1| 40S ribosomal protein S9 [Chlamydomonas reinhardtii]
Length=178

 Score =   311 bits (796),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  + FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQ  LS+IRN AR+
Sbjct  1    MPKIGFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRNAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDP+RIFEG+AL+RRMNRYGLL+ESQ+KLDYVLALT ++FLERRLQTLVFK G+
Sbjct  61   LLTLDEKDPKRIFEGNALMRRMNRYGLLNESQDKLDYVLALTPQDFLERRLQTLVFKQGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVG+QVVNVPSF+VRVDSQKHIDF+L+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGKQVVNVPSFMVRVDSQKHIDFALTSPFGGGRPGRV  174



>ref|XP_001702303.1| ribosomal protein S9, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 gb|EDO97033.1| ribosomal protein S9, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
Length=190

 Score =   310 bits (795),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  + FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQ  LS+IRN AR+
Sbjct  1    MPKIGFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRNAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDP+RIFEG+AL+RRMNRYGLL+ESQ+KLDYVLALT ++FLERRLQTLVFK G+
Sbjct  61   LLTLDEKDPKRIFEGNALMRRMNRYGLLNESQDKLDYVLALTPQDFLERRLQTLVFKQGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVG+QVVNVPSF+VRVDSQKHIDF+L+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGKQVVNVPSFMVRVDSQKHIDFALTSPFGGGRPGRV  174



>ref|XP_010524330.1| PREDICTED: 40S ribosomal protein S9-2-like [Tarenaya hassleriana]
Length=197

 Score =   310 bits (795),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+V++YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVNVSYYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+P+RIFEG+ALLRRMNR+GLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRFGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  559
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VRVDSQKHIDF+L+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGKQLVNIPSFMVRVDSQKHIDFALTSPF  166



>gb|EEC74543.1| hypothetical protein OsI_10067 [Oryza sativa Indica Group]
Length=292

 Score =   314 bits (804),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 150/165 (91%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = +2

Query  89   YGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDP  268
            YGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR LLTLDEK+P
Sbjct  107  YGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARHLLTLDEKNP  166

Query  269  RRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARV  448
            RRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVFKAGMAKSIHHARV
Sbjct  167  RRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGMAKSIHHARV  226

Query  449  LIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            LIRQ+HIRVGRQ+VN+PSF+VRV+S+KHIDFSL+SPFGGG PGRV
Sbjct  227  LIRQRHIRVGRQIVNIPSFMVRVESEKHIDFSLTSPFGGGPPGRV  271



>gb|KDP41176.1| hypothetical protein JCGZ_15583 [Jatropha curcas]
Length=201

 Score =   310 bits (795),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 162/172 (94%), Gaps = 2/172 (1%)
 Frame = +2

Query  68   HVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLL  247
            H++F  +    F   RRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARMLL
Sbjct  9    HIDF--SLTSPFGGGRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARMLL  66

Query  248  TLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAK  427
            TLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GMAK
Sbjct  67   TLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGMAK  126

Query  428  SIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            SIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  127  SIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  178



>ref|XP_002958222.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ40676.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=190

 Score =   309 bits (792),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  + FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQ  LS+IRN AR+
Sbjct  1    MPKIGFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRNAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL+EKDP+RIFEG+AL+RRMNRYGLL ESQ+KLDYVLALT ++FLERRLQTLVFK G+
Sbjct  61   LLTLEEKDPKRIFEGNALMRRMNRYGLLSESQDKLDYVLALTPQDFLERRLQTLVFKQGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVG+QVVNVPSF+VRVDSQKHIDF+L+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGKQVVNVPSFMVRVDSQKHIDFALTSPFGGGRPGRV  174



>gb|KHN30826.1| 40S ribosomal protein S9-2 [Glycine soja]
Length=188

 Score =   308 bits (790),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 162/174 (93%), Gaps = 9/174 (5%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGE         WRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGE---------WRVQYALSRIRNNARN  51

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  52   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  111

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLI+Q+HIRVGRQVVN+PSFLVRVDSQKHIDFSL+SP GGGRPGRV
Sbjct  112  AKSIHHARVLIKQRHIRVGRQVVNIPSFLVRVDSQKHIDFSLTSPLGGGRPGRV  165



>ref|XP_009126038.1| PREDICTED: 40S ribosomal protein S9-1-like [Brassica rapa]
Length=197

 Score =   307 bits (787),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV +YRNYGKTFK PRRP+EKERLD+ELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPFEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+P+RIFEG+ALLR+MNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRKMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIH +RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQKHI F+L SPFGGGRPG V
Sbjct  121  AKSIHPSRVLIRQRHIRVGKQLVNIPSFMVRLDSQKHIGFALISPFGGGRPGSV  174



>pdb|3J60|J Chain J, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
Length=195

 Score =   306 bits (784),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 160/169 (95%), Gaps = 2/169 (1%)
 Frame = +2

Query  83   RNYGKTF--KKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLD  256
            R Y KT+  KKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR LLTLD
Sbjct  6    RTYSKTYSTKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARHLLTLD  65

Query  257  EKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIH  436
            EK+PRRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVFKAGMAKSIH
Sbjct  66   EKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGMAKSIH  125

Query  437  HARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            HARVLIRQ+HIRVGRQ+VN+PSF+VRV+S+KHIDFSL+SPFGGG PGRV
Sbjct  126  HARVLIRQRHIRVGRQIVNIPSFMVRVESEKHIDFSLTSPFGGGPPGRV  174



>gb|EAY83173.1| hypothetical protein OsI_38384 [Oryza sativa Indica Group]
Length=173

 Score =   305 bits (781),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M+HV+FYRNYGKTFKK RRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MMHVSFYRNYGKTFKKQRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+P RIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPCRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGG  568
            AKSIHHA  LIRQ+HIRVGRQ+VNVPSF+VR++S+KHIDFSL+SPF GG
Sbjct  121  AKSIHHACFLIRQRHIRVGRQIVNVPSFMVRLESEKHIDFSLTSPFSGG  169



>emb|CDY30273.1| BnaC04g31840D [Brassica napus]
Length=965

 Score =   326 bits (836),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  769  MVQVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARE  828

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIF+G+ALLRRMN+ GLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  829  LLTLDEKNPRRIFQGEALLRRMNKNGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  888

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+V+V+SQKHIDFSL+SPFGGGRPGRV
Sbjct  889  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVKVESQKHIDFSLTSPFGGGRPGRV  942



>ref|XP_006431128.1| hypothetical protein CICLE_v10013599mg [Citrus clementina]
 ref|XP_006482573.1| PREDICTED: 40S ribosomal protein S9-2-like [Citrus sinensis]
 gb|ESR44368.1| hypothetical protein CICLE_v10013599mg [Citrus clementina]
 gb|KDO72548.1| hypothetical protein CISIN_1g046291mg [Citrus sinensis]
Length=197

 Score =   301 bits (771),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 161/175 (92%), Gaps = 1/175 (1%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVG +GLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGSFGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRRIFEG ALLRRM RYGLL+ +QNKLDYVLALTVE+FLERRLQT+VFKAG+
Sbjct  61   LLTLDEKDPRRIFEGQALLRRMFRYGLLEATQNKLDYVLALTVESFLERRLQTVVFKAGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFG-GGRPGRV  583
            AKSIHHARVLI+QKHIRVGRQ+VN+PSFLVRVD+Q H+  SL+S     GRPGRV
Sbjct  121  AKSIHHARVLIKQKHIRVGRQIVNIPSFLVRVDAQNHVGVSLTSSLTQTGRPGRV  175



>gb|KIZ06357.1| 40S ribosomal protein S9-2 [Monoraphidium neglectum]
Length=191

 Score =   297 bits (760),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  + FYR+YGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQ  LS+IR  AR+
Sbjct  1    MPKIGFYRSYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRKAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL++KDP+RIFEG+AL+RRM +YGLL+E+Q+KLDYVLAL+ ++FLERRLQTLVFK G+
Sbjct  61   LLTLEDKDPKRIFEGNALMRRMYKYGLLNETQDKLDYVLALSPQDFLERRLQTLVFKQGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVG+QVVN+PSFLVRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGKQVVNIPSFLVRVDSQKHIDFSLTSPFGGGRPGRV  174



>emb|CEF99084.1| Ribosomal protein S4/S9, eukaryotic/archaeal [Ostreococcus tauri]
Length=192

 Score =   296 bits (757),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M    FYRNYGKTFKKPRRP+EK+RLDAELK+VGE+GLR KRELWRVQ+AL+++RN AR+
Sbjct  1    MPSSTFYRNYGKTFKKPRRPFEKDRLDAELKIVGEFGLRNKRELWRVQFALNKLRNAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDP+RIFEG+A++RRM  YGLLDE+Q+KLDYVLALT E FLERRLQTLVFK G+
Sbjct  61   LLTLDEKDPKRIFEGEAIIRRMRAYGLLDETQDKLDYVLALTPETFLERRLQTLVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKS+HHARVLIRQ+HIRVG+Q+VNVPSFLVR DSQKHIDF+L+SP GGGRPGRV
Sbjct  121  AKSVHHARVLIRQRHIRVGKQIVNVPSFLVRTDSQKHIDFALNSPLGGGRPGRV  174



>ref|XP_005648482.1| ribosomal protein S9 component of cytosolic 80S ribosome and 
40S small subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE23938.1| ribosomal protein S9 component of cytosolic 80S ribosome and 
40S small subunit [Coccomyxa subellipsoidea C-169]
Length=180

 Score =   295 bits (754),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 138/173 (80%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M H+++YRNYGKTFKKPRRP+EKERLD+ELKLVGE+GLR KRELWRVQ ALS+IR  AR 
Sbjct  1    MPHISYYRNYGKTFKKPRRPFEKERLDSELKLVGEFGLRNKRELWRVQMALSKIRQAART  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLD+K+ +R+FEG+ALLRRM +YGLL+E+QNKLDYVLALT ++FLERRLQTLVFK G+
Sbjct  61   LLTLDDKETKRLFEGEALLRRMYKYGLLEEAQNKLDYVLALTPQDFLERRLQTLVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGR  580
            AKS+HHARVLIRQ+HIRVG+Q+VNVPSF+VRVDSQKHIDF+L+SPFGGGRPGR
Sbjct  121  AKSMHHARVLIRQRHIRVGKQIVNVPSFMVRVDSQKHIDFALNSPFGGGRPGR  173



>ref|XP_005849917.1| hypothetical protein CHLNCDRAFT_56085 [Chlorella variabilis]
 gb|EFN57815.1| hypothetical protein CHLNCDRAFT_56085 [Chlorella variabilis]
Length=192

 Score =   295 bits (755),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  + FYRNYGKTFKKPRRP+EKERLDAELK+VGE+GLR KRELWRVQ  LS++R  AR 
Sbjct  1    MPSIGFYRNYGKTFKKPRRPFEKERLDAELKVVGEFGLRNKRELWRVQMVLSKLRARARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDP+R+FEG+ALLRRM RYG LDESQNKLDYVLALT  + LERRLQTLVFK G+
Sbjct  61   LLTLDEKDPKRLFEGEALLRRMYRYGFLDESQNKLDYVLALTPADVLERRLQTLVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VRVDSQKHIDF+L+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGKQIVNIPSFMVRVDSQKHIDFALNSPFGGGRPGRV  174



>ref|XP_002500609.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61867.1| predicted protein [Micromonas sp. RCC299]
Length=194

 Score =   294 bits (752),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M    FYR+Y KTFKKPRRP+EKERLD+ELK+VGEYGLR KRELWRVQ+AL+++RN AR+
Sbjct  1    MPSTTFYRSYSKTFKKPRRPFEKERLDSELKIVGEYGLRNKRELWRVQFALNKLRNAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDP+RIFEG+A++RRM RYGLLDESQ+KLDYVLALT E FLERRLQT+VFK G+
Sbjct  61   LLTLDEKDPKRIFEGEAIMRRMYRYGLLDESQDKLDYVLALTPEIFLERRLQTIVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKS+HHARVLI+Q+HIRVG+Q+VN+PSFLVR DSQKHID+SL+SP GGGRPGRV
Sbjct  121  AKSVHHARVLIKQRHIRVGKQIVNIPSFLVRADSQKHIDYSLNSPLGGGRPGRV  174



>ref|XP_001419792.1| Ribosomal protein S9, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO98085.1| Ribosomal protein S9, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=194

 Score =   293 bits (750),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M    +YRNYGKTFKKPRRP+EKERLDAELK+VGE+GLR KRELWRVQ+AL+++RN AR+
Sbjct  1    MPSSTYYRNYGKTFKKPRRPFEKERLDAELKIVGEFGLRNKRELWRVQFALNKLRNAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDP+RIFEG+A++RRM  YGLLDE+Q+KLDYVLAL  E FLERRLQTLVFK G+
Sbjct  61   LLTLDEKDPKRIFEGEAIMRRMRNYGLLDETQDKLDYVLALGPEQFLERRLQTLVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKS+HHARVLIRQ+HIRVG+Q+VNVPSFLVR DSQKHIDF+L+SP GGGRPGRV
Sbjct  121  AKSVHHARVLIRQRHIRVGKQIVNVPSFLVRTDSQKHIDFALNSPLGGGRPGRV  174



>ref|XP_003056784.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58429.1| predicted protein [Micromonas pusilla CCMP1545]
Length=196

 Score =   290 bits (743),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M    FYR+Y KTFKKPRRP+EKERLD ELK VGE+GLR KRELWRVQ+AL+++RN AR+
Sbjct  1    MPSSTFYRSYSKTFKKPRRPFEKERLDNELKTVGEFGLRNKRELWRVQFALNKLRNAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDP+RIFEG+A++RRM RYGLLDE+Q+KLDYVLAL+ + FLERRLQTLVFK G+
Sbjct  61   LLTLDEKDPKRIFEGEAIMRRMYRYGLLDETQDKLDYVLALSADAFLERRLQTLVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKS+HHARVLIRQ+HIRVG+Q+VNVPSFLVR DSQKHIDF+L+SP GGGRPGRV
Sbjct  121  AKSVHHARVLIRQRHIRVGKQIVNVPSFLVRTDSQKHIDFALNSPLGGGRPGRV  174



>ref|XP_002467783.1| hypothetical protein SORBIDRAFT_01g033980 [Sorghum bicolor]
 gb|EER94781.1| hypothetical protein SORBIDRAFT_01g033980 [Sorghum bicolor]
Length=177

 Score =   286 bits (732),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 152/174 (87%), Gaps = 16/174 (9%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+                NKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGE----------------NKLDYVLALTVENFLQRRLQTIVFKNGM  104

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVDS+KHIDFSL+SP  GG PGRV
Sbjct  105  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVDSEKHIDFSLTSPLVGGEPGRV  158



>ref|XP_008367548.1| PREDICTED: LOW QUALITY PROTEIN: 40S ribosomal protein S9-2-like 
[Malus domestica]
Length=197

 Score =   287 bits (734),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M HV+FYRNYGKT KKPRRPYEKERLDAELKLVGE+GLR  RELWRV  + SRIRNNAR 
Sbjct  1    MFHVSFYRNYGKTLKKPRRPYEKERLDAELKLVGEFGLRXPRELWRVSASQSRIRNNARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRI  G+ALLRRMNRY LLDE  NKL YVLAL VENFLERRL T+ FK GM
Sbjct  61   LLTLDEKNPRRIIXGEALLRRMNRYKLLDEGXNKLXYVLALNVENFLERRLXTIXFKTGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIR +HI VGRQV N+PSFLVR D++KHIDFSL+SP GGGRPGRV
Sbjct  121  AKSIHHARVLIRLRHIXVGRQVXNIPSFLVRCDTEKHIDFSLTSPLGGGRPGRV  174



>ref|XP_006381973.1| hypothetical protein POPTR_0006s22640g [Populus trichocarpa]
 gb|ERP59770.1| hypothetical protein POPTR_0006s22640g [Populus trichocarpa]
Length=178

 Score =   281 bits (720),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 148/174 (85%), Gaps = 19/174 (11%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGK FKKPRRPYEKE LDAELKLVGEYGLR KRELWRVQYA SRIRN A M
Sbjct  1    MVHVSFYRNYGKNFKKPRRPYEKECLDAELKLVGEYGLRAKRELWRVQYAFSRIRNAATM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+ R                   +SQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNQR-------------------QSQNKLDYVLALTVENFLERRLQTLVFKAGM  101

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLI+Q+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  102  AKSIHHARVLIKQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  155



>gb|EAY83171.1| hypothetical protein OsI_38381 [Oryza sativa Indica Group]
Length=192

 Score =   281 bits (718),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 158/174 (91%), Gaps = 3/174 (2%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKP+RPYEKERLDAELKLVGEYGLRCKRELWRVQYAL+RIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPKRPYEKERLDAELKLVGEYGLRCKRELWRVQYALNRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMN Y LL E QNKLD VLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNHYRLLAEGQNKLDCVLALTAENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+     R+++NVPSF+VR++S+KHIDFSL+SPFGGG  GRV
Sbjct  121  AKSIHHARVLIRQR---HIRRIINVPSFMVRLESEKHIDFSLTSPFGGGPAGRV  171



>ref|XP_011399104.1| 40S ribosomal protein S9-1 [Auxenochlorella protothecoides]
 gb|KFM26208.1| 40S ribosomal protein S9-1 [Auxenochlorella protothecoides]
Length=192

 Score =   276 bits (707),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  ++ YRNYGKTFKKPRRP+EKERLDAELK VGE+GLR KRELWRVQ  LS+ R+ AR 
Sbjct  1    MPSISCYRNYGKTFKKPRRPFEKERLDAELKTVGEFGLRNKRELWRVQLVLSKFRSRARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL+EKDP+R+FEG+AL+RRM RYG L+  ++KLDYVL+LT +  LERRLQT VFK G+
Sbjct  61   LLTLEEKDPKRLFEGEALMRRMYRYGFLETHEDKLDYVLSLTPDRVLERRLQTQVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVGKQIVNVPSFIVRIDSQKHIDFALNSPFGGGRPGRV  174



>ref|XP_006438664.1| hypothetical protein CICLE_v10033755mg [Citrus clementina]
 gb|ESR51904.1| hypothetical protein CICLE_v10033755mg [Citrus clementina]
Length=178

 Score =   276 bits (706),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 149/174 (86%), Gaps = 19/174 (11%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            L+ L EK  R+                   SQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LVNLGEKKTRK-------------------SQNKLDYVLALTVENFLERRLQTLVFKSGM  101

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVDSQKHI+FSL+SPFGGGRPGRV
Sbjct  102  AKSIHHARVLIRQRHIRVGRQLVNIPSFVVRVDSQKHIEFSLTSPFGGGRPGRV  155



>dbj|BAA78592.1| 40S ribosomal protein S9 [Chlamydomonas sp. HS-5]
Length=192

 Score =   276 bits (706),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  +  YRNYGKTFKKPRRP+EKERLD ELKLVGEYGLR KRELWRVQ  LS+IRN AR 
Sbjct  1    MPKIGQYRNYGKTFKKPRRPFEKERLDGELKLVGEYGLRNKRELWRVQMILSKIRNAARN  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LL  DE D +R+FEG AL+RRM +YGLL+E+Q+KLDYVLAL   +FLERRLQT+VFK G+
Sbjct  61   LLQHDEDDTKRLFEGQALMRRMYKYGLLNETQDKLDYVLALQPNDFLERRLQTVVFKQGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLI+Q HIRVG+QVVN+PSF+VRVDSQKH+DF+L+SPFGGGRPGR 
Sbjct  121  AKSIHHARVLIKQNHIRVGKQVVNIPSFMVRVDSQKHVDFALTSPFGGGRPGRC  174



>gb|KCW87774.1| hypothetical protein EUGRSUZ_A00153 [Eucalyptus grandis]
Length=140

 Score =   274 bits (700),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/139 (96%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVG  478
            AKSIHHARVLIRQ+HIRVG
Sbjct  121  AKSIHHARVLIRQRHIRVG  139



>gb|KIZ02547.1| 40S ribosomal protein S9-2 [Monoraphidium neglectum]
Length=227

 Score =   276 bits (707),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 162/209 (78%), Gaps = 35/209 (17%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  + FYR+YGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQ  LS+IR  AR+
Sbjct  1    MPKIGFYRSYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRKAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL++KDP+RIFEG+AL+RRM +YGLL+E+Q+KLDYVLAL+ ++FLERRLQTLVFK G+
Sbjct  61   LLTLEDKDPKRIFEGNALMRRMYKYGLLNETQDKLDYVLALSPQDFLERRLQTLVFKQGL  120

Query  422  AKSIHHARVLIRQKHIR-----------------------------------VGRQVVNV  496
            AKSIHHARVLIRQ+HI                                    VG+QVVN+
Sbjct  121  AKSIHHARVLIRQRHISSSGSSSSSRPAGMVAGAQQPRVRCNAAGGALSNRWVGKQVVNI  180

Query  497  PSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            PSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  181  PSFMVRVDSQKHIDFSLTSPFGGGRPGRV  209



>ref|XP_003609048.1| 40S ribosomal protein S9 [Medicago truncatula]
Length=200

 Score =   274 bits (701),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 149/174 (86%), Gaps = 13/174 (7%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNART  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRM ++GLLDE+QNKLDYVLALTVENFLE RLQTL    G 
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFKHGLLDETQNKLDYVLALTVENFLECRLQTL---CGS  117

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
              +  H           VGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGG PGRV
Sbjct  118  YLTEAHW----------VGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGLPGRV  161



>ref|XP_005708491.1| 40S ribosomal protein S9e [Galdieria sulphuraria]
 gb|EME31971.1| 40S ribosomal protein S9e [Galdieria sulphuraria]
Length=193

 Score =   271 bits (694),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YR   KT++ PRRP+EKERLDAELKLVGEYGLR KRELWRV++ALS+IR  AR LLTL+E
Sbjct  5    YRTCSKTYRTPRRPFEKERLDAELKLVGEYGLRNKRELWRVEFALSKIRAAARDLLTLEE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  439
            KDPRRIFEG+ALLRR+ R+GLLDE++  LD+VL+L V++ LERRLQT V K G+AKSIHH
Sbjct  65   KDPRRIFEGNALLRRLTRFGLLDETRQSLDHVLSLKVQDLLERRLQTQVLKLGLAKSIHH  124

Query  440  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            ARVLIRQ+HIRVG+Q+VNVPSF+VRVDSQKHIDFSL SPFGGGRPGRV
Sbjct  125  ARVLIRQRHIRVGKQLVNVPSFMVRVDSQKHIDFSLDSPFGGGRPGRV  172



>gb|ADB77798.1| 40S ribosomal protein S9 [Cladophora coelothrix]
Length=179

 Score =   271 bits (693),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 155/175 (89%), Gaps = 1/175 (1%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  + +YR+YGKTF+ PRRP+EKER D+ELKLVGE+GLR KRELWRVQ ALS++R  AR 
Sbjct  1    MPKIAYYRSYGKTFRGPRRPFEKERPDSELKLVGEFGLRNKRELWRVQLALSKLRGAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLD-ESQNKLDYVLALTVENFLERRLQTLVFKAG  418
            LLTLDE DP+RIF+G++LLRRM RYGLLD E QNKLDY+LALT  +FLERRLQT VFK G
Sbjct  61   LLTLDEDDPKRIFQGNSLLRRMYRYGLLDQEKQNKLDYILALTPADFLERRLQTQVFKLG  120

Query  419  MAKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            +AKSIHHARV+IRQ+HIRVG+Q+VNVPSF+VR++SQ HIDF+L+SPF GGRPGRV
Sbjct  121  LAKSIHHARVIIRQRHIRVGKQIVNVPSFMVRMESQGHIDFALTSPFSGGRPGRV  175



>gb|KCW56188.1| hypothetical protein EUGRSUZ_I01938 [Eucalyptus grandis]
Length=164

 Score =   270 bits (690),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 141/174 (81%), Gaps = 33/174 (19%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQ            
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQ------------  48

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
                                 MNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  49   ---------------------MNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  87

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPFGGGRPGRV
Sbjct  88   AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRV  141



>gb|KCW56192.1| hypothetical protein EUGRSUZ_I01938 [Eucalyptus grandis]
Length=147

 Score =   270 bits (689),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 136/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIR  472
            AKSIHHARVLIRQ+HIR
Sbjct  121  AKSIHHARVLIRQRHIR  137



>emb|CBN76630.1| conserved unknown protein [Ectocarpus siliculosus]
Length=194

 Score =   270 bits (690),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  V  +RNY KTFK PRRPYEKERLD+ELKL GEYGLRCKRE+WRVQ+AL++IR  AR 
Sbjct  1    MPKVGIHRNYRKTFKTPRRPYEKERLDSELKLCGEYGLRCKREIWRVQFALAKIRKAARQ  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLD KDP+R+FEG ALLRRM+R+GLL E + +LD+VL LT E  LERRLQT VFK G+
Sbjct  61   LLTLDTKDPKRLFEGPALLRRMSRFGLLGEDEKELDFVLQLTTEKMLERRLQTKVFKQGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLI+ +HIRVG+Q+VNVP F+VR+DS+KHIDFS++SP+G GRPGRV
Sbjct  121  AKSIHHARVLIKHRHIRVGKQLVNVPQFMVRMDSEKHIDFSITSPYGQGRPGRV  174



>ref|XP_008808061.1| PREDICTED: 40S ribosomal protein S9-2-like, partial [Phoenix 
dactylifera]
Length=165

 Score =   267 bits (682),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  158  VGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPRRIFEGDALLRRMNRYGLLDESQ  337
            VGEYGLRCKRELWRVQYALSRIRN AR LLTLDEK+PRRIFEG+ALLRRMNR+GLLDE+Q
Sbjct  1    VGEYGLRCKRELWRVQYALSRIRNAARELLTLDEKNPRRIFEGEALLRRMNRFGLLDENQ  60

Query  338  NKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVLIRQKHIRVGRQVVNVPSFLVRV  517
            NKLDYVLALTVENFLERRLQT VFK+GMAKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRV
Sbjct  61   NKLDYVLALTVENFLERRLQTQVFKSGMAKSIHHARVLIRQRHIRVGRQVVNIPSFMVRV  120

Query  518  DSQKHIDFSLSSPFGGGRPGRV  583
            DS KHIDF+L+SPFGGGRPGRV
Sbjct  121  DSAKHIDFALNSPFGGGRPGRV  142



>gb|KDD75683.1| hypothetical protein H632_c551p0 [Helicosporidium sp. ATCC 50920]
Length=203

 Score =   268 bits (685),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = +2

Query  92   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  271
            GK FK PRRP+EKERLDAELK VGEYGLRCKRELWRVQ  LS+ R+ AR LLTL E D R
Sbjct  22   GKVFKVPRRPFEKERLDAELKTVGEYGLRCKRELWRVQLVLSKFRSRARELLTLPENDAR  81

Query  272  RIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVL  451
            R+FEG+AL+RRM RYG LD SQ+KLDYVL+LT  + LERRLQTLVFK G+AKSIHHARVL
Sbjct  82   RVFEGEALMRRMYRYGFLDASQDKLDYVLSLTPADVLERRLQTLVFKLGLAKSIHHARVL  141

Query  452  IRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGR  580
            IRQ+HIRVG+Q+VNVPSFLVRVDSQKHIDF+L+SPFGGGRPGR
Sbjct  142  IRQRHIRVGKQLVNVPSFLVRVDSQKHIDFALNSPFGGGRPGR  184



>ref|XP_010274527.1| PREDICTED: 40S ribosomal protein S9-2-like [Nelumbo nucifera]
Length=223

 Score =   267 bits (683),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 143/152 (94%), Gaps = 4/152 (3%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNAARM  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLA+TVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLAVTVENFLERRLQTLVFKSGM  120

Query  422  AKSIHHARVLIRQKHIRVGRQVV----NVPSF  505
            AKSIHHARVLIRQ+H+R G+ +V     VP++
Sbjct  121  AKSIHHARVLIRQRHVRRGQVLVVRRSGVPTY  152



>gb|ESA03224.1| hypothetical protein GLOINDRAFT_243564 [Rhizophagus irregularis 
DAOM 181602]
Length=186

 Score =   265 bits (677),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            RN  KT+K PRRP+EKER+D EL+L+GEYGLR KRE+WRV Y LS IR  AR LLTLD+K
Sbjct  6    RNCSKTYKVPRRPFEKERIDQELRLIGEYGLRNKREIWRVAYTLSNIRRAARELLTLDDK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DPRR+FEG+AL+RR+ R G+LDE++ KLDYVLAL +E+FLERRLQT VFK G+AKSIHHA
Sbjct  66   DPRRLFEGNALIRRLVRIGVLDETKMKLDYVLALKIEDFLERRLQTQVFKLGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQKHIDF+L+SP+GGGRPGRV
Sbjct  126  RVLIRQRHIRVGKQIVNIPSFIVRLDSQKHIDFALTSPYGGGRPGRV  172



>gb|EXX79184.1| ribosomal 40S subunit protein S9A [Rhizophagus irregularis DAOM 
197198w]
Length=190

 Score =   265 bits (678),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            RN  KT+K PRRP+EKER+D EL+L+GEYGLR KRE+WRV Y LS IR  AR LLTLD+K
Sbjct  6    RNCSKTYKVPRRPFEKERIDQELRLIGEYGLRNKREIWRVAYTLSNIRRAARELLTLDDK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DPRR+FEG+AL+RR+ R G+LDE++ KLDYVLAL +E+FLERRLQT VFK G+AKSIHHA
Sbjct  66   DPRRLFEGNALIRRLVRIGVLDETKMKLDYVLALKIEDFLERRLQTQVFKLGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQKHIDF+L+SP+GGGRPGRV
Sbjct  126  RVLIRQRHIRVGKQIVNIPSFIVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_662407.1| RS9_PODAN 40S ribosomal protein S9 (S7) [Aspergillus nidulans 
FGSC A4]
 gb|EAA60373.1| RS9_PODAN 40S ribosomal protein S9 (S7) [Aspergillus nidulans 
FGSC A4]
 tpe|CBF76749.1| TPA: hypothetical protein similar to 40S ribosomal protein S9 
(Broad) [Aspergillus nidulans FGSC A4]
Length=193

 Score =   265 bits (677),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ+ LS+IR  AR LLTLDEK
Sbjct  6    RVYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQFTLSKIRRAARELLTLDEK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDESRMKLDYVLALRVEDFLERRLQTCVYKLGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLI+Q+HIRVG+Q+VNVPS++VR+DSQKHIDF+L+SPFGGGRPGRV
Sbjct  126  RVLIKQRHIRVGKQIVNVPSYMVRLDSQKHIDFALTSPFGGGRPGRV  172



>ref|XP_005767233.1| hypothetical protein EMIHUDRAFT_61745 [Emiliania huxleyi CCMP1516]
 gb|EOD14804.1| hypothetical protein EMIHUDRAFT_61745 [Emiliania huxleyi CCMP1516]
Length=194

 Score =   265 bits (677),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 152/173 (88%), Gaps = 0/173 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M H +F RN+GKT + PRRP+EK+RLD E+KL+GE+GL+ KRE+WR Q  L+RIR  AR+
Sbjct  1    MPHASFLRNHGKTARTPRRPFEKQRLDIEMKLIGEFGLKNKREVWRTQLTLARIRKAARV  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL++KDP+R+FEG+ALLRR+ R G+LDES+ +LDYVLAL   +F+ERRLQT VFK G+
Sbjct  61   LLTLEDKDPKRLFEGNALLRRLVRLGVLDESKAQLDYVLALKPADFMERRLQTQVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGR  580
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VR +SQKHIDFS++SPFGGGRPGR
Sbjct  121  AKSIHHARVLIRQRHIRVGKQIVNIPSFMVRTESQKHIDFSITSPFGGGRPGR  173



>ref|XP_002367195.1| 40S ribosomal protein S9, putative [Toxoplasma gondii ME49]
 ref|XP_008883863.1| ribosomal protein RPS9 [Hammondia hammondi]
 gb|EPR63525.1| ribosomal protein RPS9 [Toxoplasma gondii GT1]
 gb|EPT25014.1| ribosomal protein RPS9 [Toxoplasma gondii ME49]
 gb|ESS34279.1| ribosomal protein RPS9 [Toxoplasma gondii VEG]
 gb|KEP65652.1| ribosomal protein RPS9 [Hammondia hammondi]
 gb|KFG46575.1| ribosomal protein RPS9 [Toxoplasma gondii GAB2-2007-GAL-DOM2]
 gb|KFG48357.1| ribosomal protein RPS9 [Toxoplasma gondii p89]
 gb|KFG54080.1| ribosomal protein RPS9 [Toxoplasma gondii FOU]
 gb|KFG64413.1| ribosomal protein RPS9 [Toxoplasma gondii RUB]
 gb|KFH12211.1| ribosomal protein RPS9 [Toxoplasma gondii VAND]
 gb|KFH16022.1| ribosomal protein RPS9 [Toxoplasma gondii MAS]
Length=188

 Score =   265 bits (676),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YR Y KT + P+RP+EKERLD E+KL+GEYGL+ KRE+WRVQYAL++IR+ AR LLTL+E
Sbjct  5    YRTYSKTARSPKRPFEKERLDQEMKLLGEYGLKNKREVWRVQYALAKIRSAARELLTLEE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  439
            KDPRR+F+G ALLRRM R GLL ES+ KLDYVL LTV  FLERRLQT VFK G+AKSIHH
Sbjct  65   KDPRRVFQGTALLRRMVRLGLLGESEQKLDYVLGLTVAKFLERRLQTKVFKLGLAKSIHH  124

Query  440  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            ARVLIRQ+HIRVG+ +V++PSF+VRVDS+KH+D++++SPFGGGRPGRV
Sbjct  125  ARVLIRQRHIRVGKHIVDIPSFMVRVDSEKHVDYAITSPFGGGRPGRV  172



>gb|EXX62810.1| ribosomal 40S subunit protein S9A [Rhizophagus irregularis DAOM 
197198w]
Length=197

 Score =   265 bits (676),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 156/179 (87%), Gaps = 5/179 (3%)
 Frame = +2

Query  62   MVH--VNFYRNYG---KTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIR  226
            M+H  + F++  G   KT+K PRRP+EKER+D EL+L+GEYGLR KRE+WRV Y LS IR
Sbjct  1    MIHHSLPFFKKVGISSKTYKVPRRPFEKERIDQELRLIGEYGLRNKREIWRVAYTLSNIR  60

Query  227  NNARMLLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLV  406
              AR LLTLD+KDPRR+FEG+AL+RR+ R G+LDE++ KLDYVLAL +E+FLERRLQT V
Sbjct  61   RAARELLTLDDKDPRRLFEGNALIRRLVRIGVLDETKMKLDYVLALKIEDFLERRLQTQV  120

Query  407  FKAGMAKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            FK G+AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VR+DSQKHIDF+L+SP+GGGRPGRV
Sbjct  121  FKLGLAKSIHHARVLIRQRHIRVGKQIVNIPSFIVRLDSQKHIDFALTSPYGGGRPGRV  179



>emb|CDR95115.1| 40S ribosomal subunit protein S9, putative [Babesia bigemina]
Length=184

 Score =   264 bits (675),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = +2

Query  71   VNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLT  250
            V  YRNY KTF+ P+RP+EKERLD ELKL+GEYGL+ KRE+WRVQY LS+IR+ AR LLT
Sbjct  2    VGSYRNYSKTFRNPKRPFEKERLDQELKLIGEYGLKNKREVWRVQYVLSKIRSAARYLLT  61

Query  251  LDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKS  430
            LDEKD +R F+GDALLRRM RYGL+ E++ KLD+VL LT+   +ERRLQT VFK G+AKS
Sbjct  62   LDEKDTKRQFQGDALLRRMVRYGLMGENEQKLDFVLGLTLNKMMERRLQTKVFKLGLAKS  121

Query  431  IHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            IHHAR +IRQ+HIRVG+Q+V++PSF+VRVDS+KHIDF+L+SPFGGG PGRV
Sbjct  122  IHHARCMIRQRHIRVGKQIVDIPSFMVRVDSEKHIDFALTSPFGGGHPGRV  172



>ref|XP_004336000.1| ribosomal protein S4, putative, partial [Acanthamoeba castellanii 
str. Neff]
 gb|ELR13987.1| ribosomal protein S4, putative, partial [Acanthamoeba castellanii 
str. Neff]
Length=188

 Score =   264 bits (675),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  92   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  271
            GKT K PRRP+EKERLD ELKL+GE+GL+ KRE+WRV YALS++R NAR LLTL EK P+
Sbjct  1    GKTVKTPRRPFEKERLDHELKLIGEFGLKNKREVWRVHYALSKVRKNARKLLTLPEKHPK  60

Query  272  RIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVL  451
            RIFEG A+LRR++R G+++ES+NKLDYVLAL + +FLERRLQT VFK G+AKSIHHARVL
Sbjct  61   RIFEGSAMLRRLHRMGVMEESKNKLDYVLALKINDFLERRLQTQVFKIGLAKSIHHARVL  120

Query  452  IRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGR  580
            IRQ+HIRVG+Q+VNVPSF+VR DSQKH+DF+++SPFGGGRPGR
Sbjct  121  IRQRHIRVGKQIVNVPSFIVRTDSQKHVDFAINSPFGGGRPGR  163



>ref|XP_003886044.1| hypothetical protein NCLIV_064440 [Neospora caninum Liverpool]
 emb|CBZ56018.1| hypothetical protein NCLIV_064440 [Neospora caninum Liverpool]
Length=188

 Score =   264 bits (675),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YR Y KT + P+RP+EKERLD E+KL+GEYGL+ KRE+WRVQYAL++IR+ AR LLTL+E
Sbjct  5    YRTYSKTARSPKRPFEKERLDQEMKLLGEYGLKNKREVWRVQYALAKIRSAARELLTLEE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  439
            KDPRR+F+G ALLRRM R GLL ES+ KLDYVL LTV  FLERRLQT VFK G+AKSIHH
Sbjct  65   KDPRRLFQGTALLRRMVRLGLLGESEQKLDYVLGLTVAKFLERRLQTKVFKLGLAKSIHH  124

Query  440  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            ARVLIRQ+HIRVG+ +V++PSF+VRVDS+KH+D++++SPFGGGRPGRV
Sbjct  125  ARVLIRQRHIRVGKHIVDIPSFMVRVDSEKHVDYAITSPFGGGRPGRV  172



>ref|XP_001824638.1| 40S ribosomal protein S9 [Aspergillus oryzae RIB40]
 ref|XP_002383988.1| 40S ribosomal protein S9 [Aspergillus flavus NRRL3357]
 dbj|BAE63505.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EED46452.1| 40S ribosomal protein S9 [Aspergillus flavus NRRL3357]
 gb|EIT72324.1| ribosomal protein [Aspergillus oryzae 3.042]
 gb|KDE75201.1| ribosomal protein [Aspergillus oryzae 100-8]
Length=193

 Score =   264 bits (674),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  6    RVYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTLDEK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDESRMKLDYVLALRVEDFLERRLQTCVYKLGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SP+GGGRPGRV
Sbjct  126  RVLIKQRHIRVGKQIVNVPSFMVRLDSQKHIDFALTSPYGGGRPGRV  172



>gb|EGD95527.1| ribosomal protein S9 [Trichophyton tonsurans CBS 112818]
 gb|EGE05828.1| ribosomal protein S9 [Trichophyton equinum CBS 127.97]
 gb|EZF31376.1| 40S ribosomal protein S9 [Trichophyton interdigitale H6]
 gb|KDB21176.1| 40S ribosomal protein S9 [Trichophyton interdigitale MR816]
Length=191

 Score =   263 bits (672),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+K PRRP+E  RLD+ELKLVGEYGLR KRE+WRV   LS+IR  AR LLTLDEK
Sbjct  4    RAYSKTYKVPRRPFESARLDSELKLVGEYGLRNKREVWRVNLTLSKIRRAARELLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYRLGLAKSIHHA  123

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDFSL+SP GGGRPGRV
Sbjct  124  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFSLTSPLGGGRPGRV  170



>ref|XP_003237660.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 118892]
 gb|EGD86111.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 118892]
 gb|EZF11976.1| 40S ribosomal protein S9 [Trichophyton rubrum MR850]
 gb|EZF38837.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 100081]
 gb|EZF49469.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 288.86]
 gb|EZF60077.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 289.86]
 gb|EZF70598.1| 40S ribosomal protein S9 [Trichophyton soudanense CBS 452.61]
 gb|EZF81480.1| 40S ribosomal protein S9 [Trichophyton rubrum MR1448]
 gb|EZF92037.1| 40S ribosomal protein S9 [Trichophyton rubrum MR1459]
 gb|EZG03407.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 735.88]
 gb|EZG13613.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 202.88]
 gb|KDB30580.1| 40S ribosomal protein S9 [Trichophyton rubrum D6]
Length=191

 Score =   263 bits (672),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+K PRRP+E  RLD+ELKLVGEYGLR KRE+WRV   LS+IR  AR LLTLDEK
Sbjct  4    RAYSKTYKVPRRPFESARLDSELKLVGEYGLRNKREVWRVNLTLSKIRRAARELLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYRLGLAKSIHHA  123

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDFSL+SP GGGRPGRV
Sbjct  124  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFSLTSPLGGGRPGRV  170



>tpg|DAA41535.1| TPA: hypothetical protein ZEAMMB73_424707 [Zea mays]
Length=243

 Score =   265 bits (676),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 138/155 (89%), Gaps = 6/155 (4%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  422  AKSIHHARVLIRQKHIR------VGRQVVNVPSFL  508
            AKSIHHARVLIRQ+HIR      + R  +NV   L
Sbjct  121  AKSIHHARVLIRQRHIRFVYMLLIPRLCINVSCIL  155



>tpg|DAA55417.1| TPA: hypothetical protein ZEAMMB73_005048 [Zea mays]
Length=169

 Score =   261 bits (668),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHIRVG  478
            AKSIHHARVLI+Q+HIR  
Sbjct  121  AKSIHHARVLIKQRHIRYA  139



>ref|XP_009022737.1| hypothetical protein HELRODRAFT_155894 [Helobdella robusta]
 gb|ESN98765.1| hypothetical protein HELRODRAFT_155894 [Helobdella robusta]
Length=191

 Score =   262 bits (670),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +2

Query  92   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  271
             KT+  PRRPYEKERLD ELKL+GE+GLR KRE+WRV+YAL++IR  AR LLTLDEKDPR
Sbjct  9    SKTYSTPRRPYEKERLDQELKLIGEFGLRNKREVWRVKYALTKIRTAARELLTLDEKDPR  68

Query  272  RIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVL  451
            R+FEG+ALLRR+ R G+L+ES+ KLDYVL L +E+FLERRLQT VFK G+AKSIHHARVL
Sbjct  69   RLFEGNALLRRLVRIGVLEESKMKLDYVLGLKLEDFLERRLQTQVFKLGLAKSIHHARVL  128

Query  452  IRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            IRQ+HIRV +QVVN+PSF+VR+DSQKHIDFSL SP+GGGRPGRV
Sbjct  129  IRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLKSPYGGGRPGRV  172



>ref|XP_001400515.1| 40S ribosomal protein S9 [Aspergillus niger CBS 513.88]
 emb|CAK37968.1| unnamed protein product [Aspergillus niger]
 gb|EHA23566.1| hypothetical protein ASPNIDRAFT_55644 [Aspergillus niger ATCC 
1015]
 dbj|GAA84261.1| 40S ribosomal protein S9 [Aspergillus kawachii IFO 4308]
Length=193

 Score =   262 bits (670),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  6    RVYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTLDEK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDESRMKLDYVLALRVEDFLERRLQTCVYKLGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLI+Q+HIRVG+Q+VNVPS++VR+DSQKHIDF+L+SP+GGGRPGRV
Sbjct  126  RVLIKQRHIRVGKQIVNVPSYMVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_001263755.1| 40S ribosomal protein S9 [Neosartorya fischeri NRRL 181]
 gb|EAW21858.1| 40S ribosomal protein S9 [Neosartorya fischeri NRRL 181]
Length=193

 Score =   262 bits (670),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  6    RVYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTLDEK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDESRMKLDYVLALRVEDFLERRLQTCVYKLGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLI+Q+HIRVG+Q+VNVPS++VR+DSQKHIDF+L+SP+GGGRPGRV
Sbjct  126  RVLIKQRHIRVGKQIVNVPSYMVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_001217311.1| 40S ribosomal protein S9 [Aspergillus terreus NIH2624]
 gb|EAU30857.1| 40S ribosomal protein S9 [Aspergillus terreus NIH2624]
Length=193

 Score =   262 bits (670),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  6    RVYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTLDEK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDESRMKLDYVLALRVEDFLERRLQTCVYKLGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLI+Q+HIRVG+Q+VNVPS++VR+DSQKHIDF+L+SP+GGGRPGRV
Sbjct  126  RVLIKQRHIRVGKQIVNVPSYMVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_011115175.1| hypothetical protein H072_9617 [Dactylellina haptotyla CBS 200.50]
 gb|EPS36858.1| hypothetical protein H072_9617 [Dactylellina haptotyla CBS 200.50]
Length=192

 Score =   262 bits (670),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+K PRRP+E  RLDAELK VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  6    RTYSKTYKVPRRPFESARLDAELKTVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LD+S+ KLDYVLAL +E+FLERRLQT V+K G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRAGILDDSRMKLDYVLALKIEDFLERRLQTQVYKLGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPFGGGR GR 
Sbjct  126  RVLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPFGGGRAGRT  172



>ref|XP_003172904.1| 40S ribosomal protein S9 [Microsporum gypseum CBS 118893]
 gb|EFR02493.1| 40S ribosomal protein S9 [Microsporum gypseum CBS 118893]
Length=191

 Score =   262 bits (670),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+K PRRP+E  RLD+ELKLVGEYGLR KRE+WRV   LS+IR  AR LLTLDEK
Sbjct  4    RAYSKTYKVPRRPFESARLDSELKLVGEYGLRNKREVWRVNLTLSKIRRAARELLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYRLGLAKSIHHA  123

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDFSL+SP GGGRPGRV
Sbjct  124  RVLIKQRHIRVGKQIVNVPSFVVRLDSQKHIDFSLTSPLGGGRPGRV  170



>emb|CDJ32982.1| 40S ribosomal protein S9, putative [Eimeria mitis]
Length=188

 Score =   262 bits (669),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRN+ KT + P+RP+EKERLD EL+L+GEYGL+ KRE+WRVQYAL++IR+ AR LLTL+E
Sbjct  5    YRNHSKTARNPKRPFEKERLDQELRLLGEYGLKNKREVWRVQYALAKIRSAARELLTLEE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  439
            KDPRRIF+G ALLRRM R GLL E + KLDYVL LTV+ FLERRLQT VFK G+AKSIHH
Sbjct  65   KDPRRIFQGTALLRRMVRLGLLSEGEQKLDYVLGLTVQKFLERRLQTRVFKLGLAKSIHH  124

Query  440  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AR LIRQ+HIRVG+Q+V++PSF+VRVDS+K+I+FSL+SP+GGGRPGRV
Sbjct  125  ARCLIRQRHIRVGKQIVDIPSFMVRVDSEKYIEFSLTSPYGGGRPGRV  172



>ref|XP_002842953.1| 40S ribosomal protein S9 [Arthroderma otae CBS 113480]
 gb|EEQ35217.1| 40S ribosomal protein S9 [Arthroderma otae CBS 113480]
Length=191

 Score =   262 bits (669),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+K PRRP+E  RLD+ELKLVGEYGLR KRE+WRV   LS+IR  AR LLTLDEK
Sbjct  4    RAYSKTYKVPRRPFESARLDSELKLVGEYGLRNKREVWRVNLTLSKIRRAARELLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYRLGLAKSIHHA  123

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDFSL+SP GGGRPGRV
Sbjct  124  RVLIKQRHIRVGKQIVNVPSFVVRLDSQKHIDFSLTSPLGGGRPGRV  170



>emb|CDI78299.1| 40S ribosomal protein S9, putative [Eimeria acervulina]
 emb|CDI87489.1| 40S ribosomal protein S9, putative [Eimeria praecox]
 emb|CDJ56695.1| 40S ribosomal protein S9, putative [Eimeria maxima]
Length=188

 Score =   261 bits (668),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRN+ KT + P+RP+EKERLD EL+L+GEYGL+ KRE+WRVQYAL++IR+ AR LLTL+E
Sbjct  5    YRNHSKTARNPKRPFEKERLDQELRLLGEYGLKNKREVWRVQYALAKIRSAARELLTLEE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  439
            KDPRRIF+G ALLRRM R GLL E + KLDYVL LTV+ FLERRLQT VFK G+AKSIHH
Sbjct  65   KDPRRIFQGTALLRRMVRLGLLSEGEQKLDYVLGLTVQKFLERRLQTRVFKLGLAKSIHH  124

Query  440  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AR LIRQ+HIRVG+Q+V++PSF+VRVDS+K+I+FSL+SP+GGGRPGRV
Sbjct  125  ARCLIRQRHIRVGKQIVDIPSFMVRVDSEKYIEFSLTSPYGGGRPGRV  172



>gb|KDQ62955.1| hypothetical protein JAAARDRAFT_28926 [Jaapia argillacea MUCL 
33604]
Length=193

 Score =   261 bits (668),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            RN+ KT+K PRRP+E  RLDAELKL GEYGLR KRE+WR+   LS+IR  AR LL LDEK
Sbjct  6    RNHSKTYKVPRRPFESARLDAELKLAGEYGLRNKREIWRIALILSKIRRAARELLKLDEK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDE++ +LDYVLAL VE+FLERRLQT VFK+G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDETRMRLDYVLALKVEDFLERRLQTQVFKSGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SP+GGGRPGRV
Sbjct  126  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_005534862.1| 40S ribosomal protein S9 [Cyanidioschyzon merolae strain 10D]
 dbj|BAM80255.1| 40S ribosomal protein S9 [Cyanidioschyzon merolae strain 10D]
Length=193

 Score =   261 bits (668),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRN+ K +K PRRP+EKERLDAELKL GEYGLR KRE+WRVQYALS+IR  AR LLT DE
Sbjct  5    YRNFSKVYKIPRRPFEKERLDAELKLCGEYGLRNKREVWRVQYALSKIRAAARELLTKDE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  439
            KD RRI EG ALLRR+ RYGLLD++Q  L+YVL+L V++FLERRLQT VFK G+AKSIHH
Sbjct  65   KDERRIVEGAALLRRLTRYGLLDQTQQDLNYVLSLKVQDFLERRLQTQVFKLGLAKSIHH  124

Query  440  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPG  577
            ARVLI Q+HIRVG+Q+V VPSF+VRVDSQKHIDF+ +SPFGGGRPG
Sbjct  125  ARVLILQRHIRVGKQLVTVPSFMVRVDSQKHIDFAPTSPFGGGRPG  170



>emb|CDS04034.1| Putative 40S ribosomal protein S9 [Absidia idahoensis var. thermophila]
 emb|CDS05828.1| Putative 40S ribosomal protein S9 [Absidia idahoensis var. thermophila]
 emb|CDS09313.1| Putative 40S ribosomal protein S9 [Absidia idahoensis var. thermophila]
Length=190

 Score =   261 bits (668),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT K P+RPYE  RLD ELKLVGEYGL+ KRE+WRV   LS+IR  AR LLTLDEK
Sbjct  6    RTYSKTSKVPKRPYESARLDQELKLVGEYGLKNKREVWRVGLTLSKIRRAARDLLTLDEK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DPRR+FEG+AL+RR+ R G+LDES+ KLDYVL L +E+FLERRLQT VFK G+AKSIHHA
Sbjct  66   DPRRLFEGNALIRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLIRQ+HIRVG+QVVNVPSF+VR+DSQKHIDF+L+SP+GGGRPGRV
Sbjct  126  RVLIRQRHIRVGKQVVNVPSFIVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_003026421.1| 40S ribosomal protein S9 [Schizophyllum commune H4-8]
 gb|EFI91518.1| 40S ribosomal protein S9 [Schizophyllum commune H4-8]
Length=193

 Score =   261 bits (668),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R + KT+K PRRP+E  RLDAELKL GEYGLR KRE+WR+   LS+IR  AR LL LDEK
Sbjct  6    RKHSKTYKVPRRPFESARLDAELKLAGEYGLRNKREIWRIALTLSKIRRAARELLKLDEK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ +LDYVLAL +E+FLERRLQT VFK+G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDESRMRLDYVLALKIEDFLERRLQTQVFKSGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDFSL+SP+GGGRPGRV
Sbjct  126  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFSLTSPYGGGRPGRV  172



>ref|XP_001270715.1| 40S ribosomal protein S9 [Aspergillus clavatus NRRL 1]
 gb|EAW09289.1| 40S ribosomal protein S9 [Aspergillus clavatus NRRL 1]
Length=193

 Score =   261 bits (668),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+K PRRP+E  RLD+ELK VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  6    RVYSKTYKVPRRPFESARLDSELKTVGEYGLRNKREVWRVQLTLSKIRRAARELLTLDEK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V+K G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDESRLKLDYVLALRIEDFLERRLQTCVYKLGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SP+GGGRPGRV
Sbjct  126  RVLIKQRHIRVGKQIVNVPSFMVRLDSQKHIDFALTSPYGGGRPGRV  172



>gb|AET50489.1| hypothetical protein [Eimeria tenella]
 emb|CDJ43151.1| 40S ribosomal protein S9, putative [Eimeria tenella]
Length=188

 Score =   261 bits (667),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRN  KT + P+RP+EKERLD EL+L+GEYGL+ KRE+WRVQYAL++IR+ AR LLTL+E
Sbjct  5    YRNQSKTARNPKRPFEKERLDQELRLLGEYGLKNKREVWRVQYALAKIRSAARELLTLEE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  439
            KDPRRIF+G ALLRRM R GLL E + KLDYVL LTV+ FLERRLQT VFK G+AKSIHH
Sbjct  65   KDPRRIFQGTALLRRMVRLGLLSEGEQKLDYVLGLTVQKFLERRLQTRVFKLGLAKSIHH  124

Query  440  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AR LIRQ+HIRVG+Q+V++PSF+VRVDS+K+I+FSL+SP+GGGRPGRV
Sbjct  125  ARCLIRQRHIRVGKQIVDIPSFMVRVDSEKYIEFSLTSPYGGGRPGRV  172



>gb|ABF94049.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
Length=158

 Score =   260 bits (664),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHI  469
            AKSIHHARVLIRQ+HI
Sbjct  121  AKSIHHARVLIRQRHI  136



>ref|XP_007860645.1| ribosomal protein S4 [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ60181.1| ribosomal protein S4 [Gloeophyllum trabeum ATCC 11539]
Length=193

 Score =   261 bits (667),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            RN+ KT+K PRRP+E  RLDAELKL GEYGLR KRE+WR+   LS+IR  AR LL LDEK
Sbjct  6    RNHSKTYKVPRRPFESARLDAELKLAGEYGLRNKREIWRIALILSKIRRAARELLKLDEK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDE++ +LDYVLAL +E+FLERRLQT VFK+G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDETRMRLDYVLALKIEDFLERRLQTQVFKSGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SP+GGGRPGRV
Sbjct  126  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>gb|ABA94598.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
Length=158

 Score =   259 bits (663),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGM  120

Query  422  AKSIHHARVLIRQKHI  469
            AKSIHHARVLIRQ+HI
Sbjct  121  AKSIHHARVLIRQRHI  136



>ref|XP_002629546.1| 40S ribosomal protein S9 [Blastomyces dermatitidis SLH14081]
 gb|EEQ69974.1| 40S ribosomal protein S9 [Blastomyces dermatitidis SLH14081]
 gb|EEQ91116.1| 40S ribosomal protein S9 [Blastomyces dermatitidis ER-3]
 gb|EGE82757.1| 40S ribosomal protein S9 [Blastomyces dermatitidis ATCC 18188]
 gb|EQL29231.1| 40S ribosomal protein S9 [Blastomyces dermatitidis ATCC 26199]
Length=191

 Score =   261 bits (666),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R+Y KT+K PRRPYE  RLD+EL+++G+YGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPYESARLDSELEIIGKYGLRNKREVWRVQLTLSKIRRAARELLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTQVYQLGLAKSIHHA  123

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPFG GRPGRV
Sbjct  124  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPFGEGRPGRV  170



>dbj|BAN20249.1| ribosomal protein S9 [Riptortus pedestris]
Length=193

 Score =   261 bits (666),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  89   YGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDP  268
            + KT+  PRRPYEK RLD EL+++GEYGLR KRE+WRV+Y L++IR  AR LLTLDEKDP
Sbjct  10   HSKTYVTPRRPYEKARLDQELRIIGEYGLRNKREVWRVKYTLAKIRKAARELLTLDEKDP  69

Query  269  RRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARV  448
            +R+FEG+ALLRR+ R G+LDES+ KLDYVL L VE+FLERRLQT VFK G+AKSIHHARV
Sbjct  70   KRLFEGNALLRRLVRIGVLDESKMKLDYVLGLKVEDFLERRLQTQVFKLGLAKSIHHARV  129

Query  449  LIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            LIRQ+HIRV +QVVN+PSF+VR+DSQKHIDFSL SPFGGGRPGRV
Sbjct  130  LIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLKSPFGGGRPGRV  174



>ref|XP_001609790.1| 40S ribosomal subunit protein S9 [Babesia bovis T2Bo]
 gb|EDO06222.1| 40S ribosomal subunit protein S9, putative [Babesia bovis]
Length=182

 Score =   260 bits (665),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            RNY KTF+ P+RP+EKERLD ELKL+GEYGL+ KRE+WRVQY LS+IR+ AR LLTLD+K
Sbjct  6    RNYSKTFRNPKRPFEKERLDQELKLIGEYGLKNKREVWRVQYVLSKIRSAARYLLTLDDK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            D +R F+GDALLRRM RYGL+ E++ KLD+VL LT+   +ERRLQT VFK G+AKSIHHA
Sbjct  66   DVKRQFQGDALLRRMVRYGLMGENERKLDFVLGLTLNKMMERRLQTKVFKLGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            R +IRQ+HIRVG+Q+V++PSF+VRVDS+KHIDF+L+SPFGGGRPGRV
Sbjct  126  RCMIRQRHIRVGKQIVDIPSFMVRVDSEKHIDFALTSPFGGGRPGRV  172



>ref|XP_009540632.1| hypothetical protein HETIRDRAFT_456594 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW86629.1| hypothetical protein HETIRDRAFT_456594 [Heterobasidion irregulare 
TC 32-1]
Length=193

 Score =   260 bits (665),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            RN+ KT+K PRRP+E  RLDAELKL GEYGLR KRE+WR+   LS+IR  AR LL LD+K
Sbjct  6    RNHSKTYKVPRRPFESARLDAELKLAGEYGLRNKREIWRIALILSKIRRAARELLKLDDK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ +LDYVLAL +E+FLERRLQT VFK+G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDESRMRLDYVLALKIEDFLERRLQTQVFKSGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SP+GGGRPGRV
Sbjct  126  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>emb|CCF75909.1| unnamed protein product [Babesia microti strain RI]
Length=189

 Score =   260 bits (665),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRN  KT +KP+RPY KERLD+ELKL+GEYGL+ KRE+WRVQY L++IR+ AR LLTLDE
Sbjct  5    YRNSSKTSRKPKRPYGKERLDSELKLIGEYGLKNKREVWRVQYVLAKIRSAARHLLTLDE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  439
            KDP+R+F+GDALLRRM RYGLL E + KLDY+L LT    +ERRLQT VFK G+AKSIHH
Sbjct  65   KDPKRLFQGDALLRRMVRYGLLGEGEQKLDYILGLTTAKLMERRLQTKVFKLGLAKSIHH  124

Query  440  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AR +IRQ+HIRV +Q+V++PSF+VRV+S+KHIDF+++SPFGGG+PGRV
Sbjct  125  ARCMIRQRHIRVDKQIVDIPSFMVRVESEKHIDFAITSPFGGGKPGRV  172



>ref|XP_002110068.1| S9 ribosomal protein [Trichoplax adhaerens]
 gb|EDV28234.1| S9 ribosomal protein [Trichoplax adhaerens]
Length=194

 Score =   260 bits (665),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+  PRRP+EK RLD ELKL+GEYGLR KRE+WRV+Y L++IR  AR LLTLD+K
Sbjct  4    RVYSKTYTTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKYTLAKIRKAARTLLTLDDK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            D +R+FEG+ALLRR+ R G+LDES+ KLDYVL L +E+FLERRLQT VFK G+AKSIHHA
Sbjct  64   DSKRLFEGNALLRRLVRIGVLDESKMKLDYVLGLRIEDFLERRLQTQVFKLGLAKSIHHA  123

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLIRQ+HIRV +QVVNVPSF+VR+DSQKHIDFSLSSPFGGGR GRV
Sbjct  124  RVLIRQRHIRVRKQVVNVPSFVVRLDSQKHIDFSLSSPFGGGRAGRV  170



>ref|XP_001829481.1| 40S ribosomal protein S9 [Coprinopsis cinerea okayama7#130]
 gb|EAU92441.1| 40S ribosomal protein S9 [Coprinopsis cinerea okayama7#130]
Length=192

 Score =   260 bits (664),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            RN+ KT+K PRRPYE  RLDAELKL GEYGLR KRE+WR+   LS+IR  AR LL LD K
Sbjct  6    RNHSKTYKVPRRPYESARLDAELKLAGEYGLRNKREIWRIALTLSKIRRAARELLKLDAK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ +LDYVLAL +E+FLERRLQT VFK G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDESRMRLDYVLALKIEDFLERRLQTQVFKIGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SP+GGGRPGRV
Sbjct  126  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>emb|CDJ50108.1| 40S ribosomal protein S9, putative [Eimeria brunetti]
Length=188

 Score =   260 bits (664),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRN+ KT + P+RP+EKERLD EL+L+GEYGL+ KRE+WRVQY L++IR+ AR LLTL+E
Sbjct  5    YRNHSKTARNPKRPFEKERLDQELRLLGEYGLKNKREVWRVQYVLAKIRSAARELLTLEE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  439
            KDPRRIF+G ALLRRM R GLL E + KLDYVL LTV+ FLERRLQT VFK G+AKSIHH
Sbjct  65   KDPRRIFQGTALLRRMVRLGLLSEGEQKLDYVLGLTVQKFLERRLQTRVFKLGLAKSIHH  124

Query  440  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AR LIRQ+HIRVG+Q+V++PSF+VRVDS+K+I+FSL+SP+GGGRPGRV
Sbjct  125  ARCLIRQRHIRVGKQIVDIPSFMVRVDSEKYIEFSLTSPYGGGRPGRV  172



>gb|KIM82299.1| hypothetical protein PILCRDRAFT_475098 [Piloderma croceum F 1598]
Length=193

 Score =   260 bits (664),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            RN+ KT+K PRRPYE  RLDAELKL GEYGLR KRE+WR+   +S+IR  AR LL LD+K
Sbjct  6    RNHSKTYKVPRRPYESARLDAELKLAGEYGLRNKREIWRIALTMSKIRRAARELLKLDDK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ +LDYVLAL VE+FLERRLQT VFK+G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDESRMRLDYVLALKVEDFLERRLQTQVFKSGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLIRQ+HIRVG+Q+V+VPSF+VR+DSQKHIDF+L+SP+GGGRPGRV
Sbjct  126  RVLIRQRHIRVGKQIVDVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_006964217.1| ribosomal protein S9, S4 family [Trichoderma reesei QM6a]
 gb|EGR49873.1| ribosomal protein S9, S4 family [Trichoderma reesei QM6a]
 gb|ETS03579.1| ribosomal protein S4, partial [Trichoderma reesei RUT C-30]
Length=191

 Score =   259 bits (663),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R + KT + PRRP+E  RLDAELKLVGEYGLR KRE+WRV   LS+IR  AR LLTLDEK
Sbjct  4    RAHSKTSRVPRRPFESARLDAELKLVGEYGLRNKREVWRVGLTLSKIRRAARQLLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHA  123

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPFG GRPGRV
Sbjct  124  RVLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPFGNGRPGRV  170



>ref|XP_011122298.1| hypothetical protein AOL_s00079g121 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX48900.1| hypothetical protein AOL_s00079g121 [Arthrobotrys oligospora 
ATCC 24927]
Length=192

 Score =   259 bits (663),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRV   LS+IR  AR LLTLDEK
Sbjct  6    RTYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVMLTLSKIRRAARQLLTLDEK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LD+S+ KLDYVLAL +E+FLERRLQT V+K G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRAGILDDSRMKLDYVLALKIEDFLERRLQTQVYKLGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPFGGGR GR 
Sbjct  126  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPFGGGRAGRT  172



>ref|XP_008623589.1| 40S ribosomal protein [Plasmodium vinckei vinckei]
 gb|KEG03665.1| 40S ribosomal protein [Plasmodium vinckei vinckei]
Length=189

 Score =   259 bits (662),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRNY KT + P+RP+EKERLD ELKL+GEYGL+ KRE+WRVQY L++IR+ AR LLTLDE
Sbjct  5    YRNYSKTARNPKRPFEKERLDQELKLIGEYGLKNKREIWRVQYLLAKIRSAARYLLTLDE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  439
            K P+RIF+G+ALLRRM R GLL E++ KLDYVL LT+   LERRLQT VFK G+AKS+HH
Sbjct  65   KSPKRIFQGEALLRRMVRQGLLGENEEKLDYVLGLTLPKLLERRLQTKVFKLGLAKSVHH  124

Query  440  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            ARVLIRQ+HIRVG+Q+V++PSFLVR+DS+KHIDF+ +SPFGG RPGRV
Sbjct  125  ARVLIRQRHIRVGKQMVDIPSFLVRIDSEKHIDFATASPFGGSRPGRV  172



>gb|ETB62408.1| 40S ribosomal protein S9 [Plasmodium yoelii 17X]
 gb|ETB62409.1| 40S ribosomal protein S9, variant 1 [Plasmodium yoelii 17X]
 gb|ETB62410.1| 40S ribosomal protein S9, variant 2 [Plasmodium yoelii 17X]
 gb|EUD72327.1| 40S ribosomal protein [Plasmodium vinckei petteri]
 emb|CDR14909.1| 40S ribosomal protein S9, putative [Plasmodium chabaudi chabaudi]
 emb|CDU19544.1| 40S ribosomal protein S9, putative [Plasmodium yoelii]
 emb|CDZ13848.1| 40S ribosomal protein S9, putative [Plasmodium yoelii]
Length=189

 Score =   259 bits (662),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRNY KT + P+RP+EKERLD ELKL+GEYGL+ KRE+WRVQY L++IR+ AR LLTLDE
Sbjct  5    YRNYSKTARNPKRPFEKERLDQELKLIGEYGLKNKREIWRVQYLLAKIRSAARYLLTLDE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  439
            K P+RIF+G+ALLRRM R GLL E++ KLDYVL LT+   LERRLQT VFK G+AKS+HH
Sbjct  65   KSPKRIFQGEALLRRMVRQGLLGENEEKLDYVLGLTLPKLLERRLQTKVFKLGLAKSVHH  124

Query  440  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            ARVLIRQ+HIRVG+Q+V++PSFLVR+DS+KHIDF+ +SPFGG RPGRV
Sbjct  125  ARVLIRQRHIRVGKQMVDIPSFLVRIDSEKHIDFATASPFGGSRPGRV  172



>emb|CAH04322.1| S9e ribosomal protein [Meladema coriacea]
Length=193

 Score =   259 bits (662),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+      + KT+  PRRPYEK RLD ELK++GEYGLR KRE+WRV+Y L++IR  AR 
Sbjct  1    MVNGRIPSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYTLAKIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL+EKDPRR+FEG+ALLRR+ R G+LDE++ KLDYVL L +E+FLERRLQT VFK G+
Sbjct  61   LLTLEEKDPRRLFEGNALLRRLVRIGVLDENRMKLDYVLGLKIEDFLERRLQTQVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQKHIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLKSPFGGGRPGRV  174



>gb|ABG01900.1| S9 ribosomal protein [Gryllus rubens]
Length=177

 Score =   258 bits (660),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  89   YGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDP  268
            Y KT+  PRRPYEK RLD ELK++GEYGLR KRE+WRV+Y L++IR  AR LLTL++KDP
Sbjct  13   YSKTYVTPRRPYEKARLDQELKVIGEYGLRNKREVWRVKYTLAKIRKAARELLTLEDKDP  72

Query  269  RRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARV  448
            +R+FEG+ALLRR+ R G+LDES+ KLDYVL L +E+FLERRLQT VFK G+AKSIHHARV
Sbjct  73   KRLFEGNALLRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGLAKSIHHARV  132

Query  449  LIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            LIRQ+HIRV +QVVN+PSF+VR+DSQKHIDFSL SPFGGGRPGRV
Sbjct  133  LIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLKSPFGGGRPGRV  177



>gb|AGH70193.1| 40S ribosomal protein S9 [Placozoa sp. H4]
Length=195

 Score =   259 bits (662),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+  PRRP+EK RLD ELKL+GEYGLR KRE+WRV+Y L++IR  AR LLTLD+K
Sbjct  4    RVYSKTYTTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKYTLAKIRKAARTLLTLDDK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
             P+R+FEG+ALLRR+ R G+LDES+ KLDYVL L V++FLERRLQT VFK G+AKSIHHA
Sbjct  64   HPKRLFEGNALLRRLVRIGVLDESKMKLDYVLGLRVDDFLERRLQTQVFKLGLAKSIHHA  123

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLIRQ+HIRV +QVVNVPSF+VR+DSQKHIDFSLSSPFGGGR GRV
Sbjct  124  RVLIRQRHIRVRKQVVNVPSFVVRLDSQKHIDFSLSSPFGGGRAGRV  170



>ref|XP_009038600.1| hypothetical protein AURANDRAFT_28757 [Aureococcus anophagefferens]
 gb|EGB06855.1| hypothetical protein AURANDRAFT_28757 [Aureococcus anophagefferens]
Length=196

 Score =   259 bits (662),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M   +F RNY KT K PRRP+EKER+D ELKLVGEYGLRCKRELWR Q AL+++R  AR 
Sbjct  1    MPKTSFLRNYRKTSKTPRRPFEKERIDGELKLVGEYGLRCKRELWRTQLALAKLRKAART  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLD KDP R+FE  ALLRR+ RYGLLDE++ +LD VL +T +  LERRLQT VFK G+
Sbjct  61   LLTLDTKDPARMFEAPALLRRLQRYGLLDETELELDAVLQMTTQRLLERRLQTKVFKQGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRP  574
            AKSIHHARVLI+Q+HIRVG+QVVNVPSFLVR+DS+KHIDF+++SP+G GRP
Sbjct  121  AKSIHHARVLIKQRHIRVGKQVVNVPSFLVRLDSEKHIDFAITSPYGQGRP  171



>ref|XP_005852611.1| small subunit ribosomal protein S9e [Nannochloropsis gaditana 
CCMP526]
 gb|EKU23223.1| small subunit ribosomal protein S9e [Nannochloropsis gaditana 
CCMP526]
Length=200

 Score =   259 bits (662),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 145/174 (83%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            M  + F RNY KT K PRRP+EKERLD ELKL GEYGLRCK E+WRVQ+AL++IR  AR 
Sbjct  1    MPSIAFRRNYRKTDKTPRRPFEKERLDQELKLCGEYGLRCKAEIWRVQFALAKIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKDPRR+FEG ALLRR  R GLL++ + +LD+VL LT +  LERRLQT VFK  +
Sbjct  61   LLTLDEKDPRRVFEGPALLRRCVRAGLLEQDKAELDFVLQLTTQKLLERRLQTKVFKQSL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSFLVRVDS+KHIDFS +SP+G GR GRV
Sbjct  121  AKSIHHARVLIRQRHIRVGKQLVNIPSFLVRVDSEKHIDFSTTSPYGQGRKGRV  174



>emb|CDS49582.1| 40S ribosomal protein S9, putative [Plasmodium berghei ANKA]
Length=189

 Score =   259 bits (661),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRNY KT + P+RP+EKERLD ELKL+GEYGL+ KRE+WRVQY L++IR+ AR LLTLDE
Sbjct  5    YRNYSKTARNPKRPFEKERLDQELKLIGEYGLKNKREIWRVQYLLAKIRSAARYLLTLDE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  439
            K P+RIF+G+ALLRRM R GLL E++ KLDYVL LT+   LERRLQT VFK G+AKS+HH
Sbjct  65   KSPKRIFQGEALLRRMVRQGLLGENEEKLDYVLGLTLPKLLERRLQTKVFKLGLAKSVHH  124

Query  440  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            ARVLIRQ+HIRVG+Q+V++PSFLVR+DS+KHIDF+ +SPFGG RPGRV
Sbjct  125  ARVLIRQRHIRVGKQMVDIPSFLVRIDSEKHIDFATASPFGGSRPGRV  172



>ref|XP_007510860.1| 40S ribosomal protein S9 [Bathycoccus prasinos]
 emb|CCO18393.1| 40S ribosomal protein S9 [Bathycoccus prasinos]
Length=248

 Score =   261 bits (666),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = +2

Query  98   TFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPRRI  277
            TF KPRRP+EK RLDAELK VGEYGLR KRELWRVQ+AL+++RN AR+LLTLDE DP+RI
Sbjct  64   TFSKPRRPFEKVRLDAELKTVGEYGLRNKRELWRVQFALNKLRNAARVLLTLDEDDPKRI  123

Query  278  FEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVLIR  457
            FEG+A+L+RM  YGLL+  +  LDYVLAL  E FLERRLQTLVFK G+AKS+HHAR+LI+
Sbjct  124  FEGNAILKRMRTYGLLEADKESLDYVLALNAEEFLERRLQTLVFKLGLAKSVHHARILIK  183

Query  458  QKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            Q+HIRVG+Q+VNVPSFLVRV++QKHIDF+L+SP GGGRPGRV
Sbjct  184  QRHIRVGKQIVNVPSFLVRVETQKHIDFALNSPLGGGRPGRV  225



>ref|XP_011180539.1| PREDICTED: 40S ribosomal protein S9 [Bactrocera cucurbitae]
 ref|XP_011208927.1| PREDICTED: 40S ribosomal protein S9 [Bactrocera dorsalis]
Length=195

 Score =   259 bits (661),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+      + KT+  PRRPYEK RLD ELK++GEYGLR KRE+WRV+YAL++IR  AR 
Sbjct  1    MVNGRIPSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYALAKIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKD +R+F+G+ALLRR+ R G+LDES+ KLDYVL L +E+FLERRLQT VFK G+
Sbjct  61   LLTLDEKDEKRLFQGNALLRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRV RQVVN+PSF+VR+DSQKHIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRRQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRV  174



>ref|XP_008544905.1| PREDICTED: 40S ribosomal protein S9 [Microplitis demolitor]
Length=193

 Score =   259 bits (661),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+      + KT+  PRRPYEK RLD ELK++GEYGLR KRE+WRV+Y L++IR  AR 
Sbjct  1    MVNGRIPSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYTLAKIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL+EKDP+R+FEG+ALLRR+ R G+LDES  KLDYVL L +E+FLERRLQT VFK G+
Sbjct  61   LLTLEEKDPKRLFEGNALLRRLVRIGVLDESHMKLDYVLGLKIEDFLERRLQTQVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQKHIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLKSPFGGGRPGRV  174



>ref|XP_001613757.1| 40S ribosomal protein S9 [Plasmodium vivax Sal-1]
 gb|EDL44030.1| 40S ribosomal protein S9, putative [Plasmodium vivax]
Length=189

 Score =   259 bits (661),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRNY KT + P+RP+EKERLD ELKL+GEYGL+ KRE+WRVQY L++IR+ AR LLTLDE
Sbjct  5    YRNYSKTARNPKRPFEKERLDQELKLIGEYGLKNKREIWRVQYLLAKIRSAARYLLTLDE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  439
            K  +RIF+G+ALLRRM R GLL E++ KLDYVL LT+   LERRLQT VFK G+AKS+HH
Sbjct  65   KSSKRIFQGEALLRRMVRQGLLGENEEKLDYVLGLTLPKLLERRLQTKVFKLGLAKSVHH  124

Query  440  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            ARVLIRQ+HIRVG+Q+V++PSFLVRVDS+KHIDFS +SPFGG RPGRV
Sbjct  125  ARVLIRQRHIRVGKQMVDIPSFLVRVDSEKHIDFSTTSPFGGSRPGRV  172



>emb|CDH55798.1| 40s ribosomal protein s9 [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDH49579.1| 40s ribosomal protein s9 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=190

 Score =   259 bits (661),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT K P+RPYE  RLD ELKLVGEYGL+ KRE+WRV   LS+IR  AR LLTLDEK
Sbjct  6    RTYSKTSKVPKRPYESARLDQELKLVGEYGLKNKREVWRVGLTLSKIRRAARDLLTLDEK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DPRR+FEG+AL+RR+ R G+LDES+ KLDYVL L +E+FLERRLQT VFK G+AKSIHHA
Sbjct  66   DPRRLFEGNALIRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLIRQ+HIRVG+QVVNVPSF+VR+DSQKHIDF+L+SP+GGGR GRV
Sbjct  126  RVLIRQRHIRVGKQVVNVPSFIVRLDSQKHIDFALTSPYGGGRAGRV  172



>ref|XP_007307288.1| 40S ribosomal protein S9, partial [Stereum hirsutum FP-91666 
SS1]
 gb|EIM83555.1| 40S ribosomal protein S9, partial [Stereum hirsutum FP-91666 
SS1]
Length=192

 Score =   259 bits (661),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            RN+ KT+K PRRP+E  RLDAELKL GEYGLR KRE+WR+   LS+IR  AR LL LD+K
Sbjct  4    RNHSKTYKVPRRPFESARLDAELKLAGEYGLRNKREIWRISLVLSKIRRAARELLKLDDK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ +LDYVLAL +E+F+ERRLQT VFK+G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRIGVLDESRMRLDYVLALKLEDFMERRLQTQVFKSGLAKSIHHA  123

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SP+GGGRPGRV
Sbjct  124  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  170



>gb|KIM31691.1| hypothetical protein M408DRAFT_236801 [Serendipita vermifera 
MAFF 305830]
Length=192

 Score =   259 bits (661),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R Y KT+K PRRP+E  RLD+ELKL GEYGLR KRE+WR+   LS+IR  AR LL L+ K
Sbjct  6    RTYSKTYKVPRRPFESARLDSELKLAGEYGLRNKREIWRITLILSKIRRAARELLKLEAK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDE++ +LDYVLAL +E+FLERRLQT VFKAG+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDETRMRLDYVLALKIEDFLERRLQTQVFKAGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLIRQ+HIRVGRQVVNVPSF+VR+DSQKHIDFS +SPFGGGRPGRV
Sbjct  126  RVLIRQRHIRVGRQVVNVPSFVVRLDSQKHIDFSSTSPFGGGRPGRV  172



>ref|XP_004518997.1| PREDICTED: 40S ribosomal protein S9-like [Ceratitis capitata]
Length=195

 Score =   259 bits (661),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+      + KT+  PRRPYEK RLD ELK++GEYGLR KRE+WRV+YAL++IR  AR 
Sbjct  1    MVNGRIPSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYALAKIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEKD +R+F+G+ALLRR+ R G+LDES+ KLDYVL L +E+FLERRLQT VFK G+
Sbjct  61   LLTLDEKDEKRLFQGNALLRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRV RQVVN+PSF+VR+DSQKHIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRRQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRV  174



>ref|XP_008032443.1| 40S ribosomal protein S9 [Trametes versicolor FP-101664 SS1]
 gb|EIW63864.1| 40S ribosomal protein S9 [Trametes versicolor FP-101664 SS1]
Length=193

 Score =   258 bits (660),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            RN+ KT+K PRRP+E  RLDAELKL GEYGLR KRE+WR+   LS+IR  AR LL LD+K
Sbjct  6    RNHSKTYKVPRRPFESARLDAELKLAGEYGLRNKREIWRIGLILSKIRRAARELLKLDDK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ +LDYVL+L +E+FLERRLQT VFK+G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDESRMRLDYVLSLKIEDFLERRLQTQVFKSGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SP+GGGRPGRV
Sbjct  126  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_001351758.1| 40S ribosomal protein S9, putative [Plasmodium falciparum 3D7]
 pdb|3J7A|E Chain E, Cryo-em Structure Of The Plasmodium Falciparum 80s Ribosome 
Bound To The Anti-protozoan Drug Emetine, Small Subunit
 emb|CAD51565.1| 40S ribosomal protein S9, putative [Plasmodium falciparum 3D7]
 gb|ETW14908.1| 40S ribosomal protein S9 [Plasmodium falciparum Vietnam Oak-Knoll 
(FVO)]
 gb|ETW38074.1| 40S ribosomal protein S9 [Plasmodium falciparum Tanzania (2000708)]
 gb|ETW44637.1| 40S ribosomal protein S9 [Plasmodium falciparum NF135/5.C10]
 gb|ETW50807.1| 40S ribosomal protein S9 [Plasmodium falciparum MaliPS096_E11]
 gb|ETW53438.1| 40S ribosomal protein S9 [Plasmodium falciparum Palo Alto/Uganda]
 gb|ETW63140.1| 40S ribosomal protein S9 [Plasmodium falciparum CAMP/Malaysia]
 gb|EWC78128.1| 40S ribosomal protein S9 [Plasmodium falciparum UGT5.1]
 gb|EWC90158.1| 40S ribosomal protein S9 [Plasmodium falciparum NF54]
 gb|EWC90159.1| 40S ribosomal protein S9 [Plasmodium falciparum NF54]
Length=189

 Score =   258 bits (660),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRNY KT + P+RP+EKERLD ELKL+GEYGL+ KRE+WRVQY L++IR+ AR LLTLDE
Sbjct  5    YRNYSKTARNPKRPFEKERLDQELKLIGEYGLKNKREIWRVQYLLAKIRSAARYLLTLDE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  439
            K  +RIF+G+ALLRRM R GLL E++ KLDYVL LT+   LERRLQT VFK G+AKS+HH
Sbjct  65   KSSKRIFQGEALLRRMVRQGLLGENEEKLDYVLGLTLPKLLERRLQTKVFKLGLAKSVHH  124

Query  440  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            ARVLIRQ+HIRVG+Q+V++PSFLVRVDS+KHIDF+ +SPFGG RPGRV
Sbjct  125  ARVLIRQRHIRVGKQMVDIPSFLVRVDSEKHIDFATTSPFGGARPGRV  172



>gb|KJA19242.1| hypothetical protein HYPSUDRAFT_204799 [Hypholoma sublateritium 
FD-334 SS-4]
Length=193

 Score =   258 bits (660),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            RN+ KT+K PRRP+E  RLDAELKL GEYGLR KRE+WR+   LS+IR  AR LL LD+K
Sbjct  6    RNHSKTYKVPRRPFESARLDAELKLAGEYGLRNKREIWRIALILSKIRRAARELLKLDDK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ +LDYVLAL +E+FLERRLQT VFK+G+A+SIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDESRMRLDYVLALKIEDFLERRLQTQVFKSGLARSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SP+GGGRPGRV
Sbjct  126  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_011497696.1| PREDICTED: 40S ribosomal protein S9 [Ceratosolen solmsi marchali]
Length=193

 Score =   258 bits (660),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+      + KT+  PRRPYEK RLD EL+++GEYGLR KRE+WRV+Y L++IR  AR 
Sbjct  1    MVNGRIPSVFSKTYVTPRRPYEKARLDQELRIIGEYGLRNKREVWRVKYTLAKIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL+EKDP+R+FEG+ALLRR+ R G+LDES+ KLDYVL L +E+FLERRLQT VFK G+
Sbjct  61   LLTLEEKDPKRLFEGNALLRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQKHIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLKSPFGGGRPGRV  174



>gb|AAX62465.1| ribosomal protein S9 [Lysiphlebus testaceipes]
 gb|AAX62466.1| ribosomal protein S9 variant 1 [Lysiphlebus testaceipes]
Length=194

 Score =   258 bits (660),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+    + + KT   PRRPYEK RLD ELK++GEYGLR KRE+WRV+Y L++IR  AR 
Sbjct  1    MVNHRIPQVFSKTSVTPRRPYEKARLDQELKVIGEYGLRNKREVWRVKYTLAKIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTLDEK+P+R+FEG+ALLRR+ R G+LDES+ KLDYVL L +E+FLERRLQT VFK G+
Sbjct  61   LLTLDEKEPKRLFEGNALLRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHARVLIRQ+HIRV +QVVN+PSF+VR+DSQKHIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRV  174



>emb|CDO63078.1| 40S ribosomal protein S9, putative [Plasmodium reichenowi]
Length=189

 Score =   258 bits (659),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRNY KT + P+RP+EKERLD ELKL+GEYGL+ KRE+WRVQY L++IR+ AR LLTLDE
Sbjct  5    YRNYSKTARNPKRPFEKERLDQELKLIGEYGLKNKREIWRVQYLLAKIRSAARYLLTLDE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  439
            K  +RIF+G+ALLRRM R GLL E++ KLDYVL LT+   LERRLQT VFK G+AKS+HH
Sbjct  65   KSSKRIFQGEALLRRMVRQGLLGENEEKLDYVLGLTLPKLLERRLQTKVFKLGLAKSVHH  124

Query  440  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            ARVLIRQ+HIRVG+Q+V++PSFLVRVDS+KHIDF+ +SPFGG RPGRV
Sbjct  125  ARVLIRQRHIRVGKQMVDIPSFLVRVDSEKHIDFATTSPFGGARPGRV  172



>gb|KII94201.1| hypothetical protein PLICRDRAFT_695235 [Plicaturopsis crispa 
FD-325 SS-3]
Length=193

 Score =   258 bits (660),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            RN+ KT+K PRRP+E  RLDAELKL GEYGLR KRE+WR+   LS+IR  AR LL LD+K
Sbjct  6    RNHSKTYKVPRRPFESARLDAELKLAGEYGLRNKREIWRIALILSKIRRAARELLKLDDK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ +LDYVLAL +E+FLERRLQT VFK+G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDESRMRLDYVLALKIEDFLERRLQTQVFKSGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            R LIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SP+GGGRPGRV
Sbjct  126  RTLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_007391198.1| hypothetical protein PHACADRAFT_248675 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM61799.1| hypothetical protein PHACADRAFT_248675 [Phanerochaete carnosa 
HHB-10118-sp]
Length=193

 Score =   258 bits (660),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            RN+ KT+K PRRP+E  RLDAELKL GEYGLR KRE+WR+   LS+IR  AR LL LD K
Sbjct  6    RNHSKTYKVPRRPFESARLDAELKLAGEYGLRNKREIWRIGLTLSKIRRAARELLKLDPK  65

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ +LDYVL+L +E+FLERRLQT VFKAG+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRVGVLDESRMRLDYVLSLKIEDFLERRLQTQVFKAGLAKSIHHA  125

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SP+GGGRPGRV
Sbjct  126  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYGGGRPGRV  172



>ref|XP_004222815.1| 40S ribosomal protein S9 [Plasmodium cynomolgi strain B]
 dbj|GAB66868.1| 40S ribosomal protein S9 [Plasmodium cynomolgi strain B]
Length=189

 Score =   258 bits (659),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRNY KT + P+RP+EKERLD ELKL+GEYGL+ KRE+WRVQY L++IR+ AR LLTLDE
Sbjct  5    YRNYSKTARNPKRPFEKERLDQELKLIGEYGLKNKREIWRVQYLLAKIRSAARYLLTLDE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  439
            K  +RIF+G+ALLRRM R GLL E++ KLDYVL LT+   LERRLQT VFK G+AKS+HH
Sbjct  65   KSSKRIFQGEALLRRMVRQGLLGENEEKLDYVLGLTLPKLLERRLQTKVFKLGLAKSVHH  124

Query  440  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            ARVLIRQ+HIRVG+Q+V++PSFLVRVDS+KHIDFS +SPFGG RPGRV
Sbjct  125  ARVLIRQRHIRVGKQMVDIPSFLVRVDSEKHIDFSTTSPFGGSRPGRV  172



>ref|XP_008815169.1| 40S ribosomal protein [Plasmodium inui San Antonio 1]
 gb|EUD68321.1| 40S ribosomal protein [Plasmodium inui San Antonio 1]
Length=189

 Score =   258 bits (659),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +2

Query  80   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  259
            YRNY KT + P+RP+EKERLD ELKL+GEYGL+ KRE+WRVQY L++IR+ AR LLTLDE
Sbjct  5    YRNYSKTARNPKRPFEKERLDQELKLIGEYGLKNKREIWRVQYLLAKIRSAARYLLTLDE  64

Query  260  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  439
            K  +RIF+G+ALLRRM R GLL E++ KLDYVL LT+   LERRLQT VFK G+AKS+HH
Sbjct  65   KSSQRIFQGEALLRRMVRQGLLGENEEKLDYVLGLTLPKLLERRLQTKVFKLGLAKSVHH  124

Query  440  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            ARVLIRQ+HIRVG+Q+V++PSFLVRVDS+KHIDFS +SPFGG RPGRV
Sbjct  125  ARVLIRQRHIRVGKQMVDIPSFLVRVDSEKHIDFSTTSPFGGSRPGRV  172



>gb|ADT80642.1| ribosomal protein S9 [Euphydryas aurinia]
 gb|AEL28821.1| ribosomal protein S9 [Heliconius melpomene cythera]
Length=194

 Score =   258 bits (659),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+      + KT+  PRRP+EK RLD ELK++GEYGLR KRE+WRV+Y L+RIR  AR 
Sbjct  1    MVNNRVPSVFSKTYVTPRRPFEKARLDQELKIIGEYGLRNKREVWRVKYTLARIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL+EKDP+R+FEG+ALLRR+ R G+LDE Q KLDYVL L +E+FLERRLQT VFKAG+
Sbjct  61   LLTLEEKDPKRLFEGNALLRRLVRIGVLDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHAR+LIRQ+HIRV +QVVN+PSF+VR+DS KHIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARILIRQRHIRVRKQVVNIPSFIVRLDSGKHIDFSLKSPFGGGRPGRV  174



>ref|NP_001037265.1| ribosomal protein S9 [Bombyx mori]
 gb|AAV34865.1| ribosomal protein S9 [Bombyx mori]
Length=194

 Score =   258 bits (659),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+      + KT+  PRRP+EK RLD ELK++GEYGLR KRE+WRV+Y L+RIR  AR 
Sbjct  1    MVNNRVPSVFSKTYVTPRRPFEKARLDQELKIIGEYGLRNKREVWRVKYTLARIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL+EKDP+R+FEG+ALLRR+ R G+LDE Q KLDYVL L +E+FLERRLQT VFKAG+
Sbjct  61   LLTLEEKDPKRLFEGNALLRRLVRIGVLDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHAR+LIRQ+HIRV +QVVN+PSF+VR+DS KHIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARILIRQRHIRVRKQVVNIPSFIVRLDSGKHIDFSLKSPFGGGRPGRV  174



>ref|XP_006671722.1| 40S ribosomal protein S9 (S7) [Cordyceps militaris CM01]
 gb|EGX90098.1| 40S ribosomal protein S9 (S7) [Cordyceps militaris CM01]
Length=190

 Score =   258 bits (659),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +2

Query  83   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  262
            R + KT + PRRP+E  RLD+ELKLVGEYGLR KRE+WRV   LS+IR  AR LLTLDEK
Sbjct  4    RAHSKTSRVPRRPFESARLDSELKLVGEYGLRNKREVWRVGLTLSKIRRAARQLLTLDEK  63

Query  263  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  442
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHA  123

Query  443  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPFG GRPGRV
Sbjct  124  RVLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALNSPFGSGRPGRV  170



>gb|ADO95157.1| ribosomal protein S9 [Antheraea yamamai]
Length=194

 Score =   258 bits (659),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = +2

Query  62   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  241
            MV+      + KT+  PRRP+EK RLD ELK++GEYGLR KRE+WRV+Y L+RIR  AR 
Sbjct  1    MVNNRVPSVFSKTYVTPRRPFEKARLDQELKIIGEYGLRNKREVWRVKYTLARIRKAARE  60

Query  242  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  421
            LLTL+EKDP+R+FEG+ALLRR+ R G+LDE Q KLDYVL L +E+FLERRLQT VFKAG+
Sbjct  61   LLTLEEKDPKRLFEGNALLRRLVRVGVLDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGL  120

Query  422  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPFGGGRPGRV  583
            AKSIHHAR+LIRQ+HIRV +QVVN+PSF+VR+DS KHIDFSL SPFGGGRPGRV
Sbjct  121  AKSIHHARILIRQRHIRVRKQVVNIPSFIVRLDSGKHIDFSLKSPFGGGRPGRV  174



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380